(data stored in SCRATCH zone)

EMBL: EU871626

ID   EU871626; SV 1; linear; genomic DNA; STD; PRO; 50498 BP.
XX
AC   EU871626;
XX
DT   12-AUG-2008 (Rel. 96, Created)
DT   12-AUG-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Escherichia coli O157:H7 strain ECI-1717 enterocyte effacement gene locus,
DE   partial sequence.
XX
KW   .
XX
OS   Escherichia coli O157:H7
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-50498
RA   Zhang Y., Golds G., John S.J., Laing C., Kropinski A., Gannon V.P.J.;
RT   ;
RL   Submitted (07-JUL-2008) to the INSDC.
RL   Public Health Agency of Canada, Laboratory for Foodborne Zoonoses, ADRI,
RL   Township RD 9-1, Lethbridge, Alberta T1J 3Z4, Canada
XX
DR   MD5; edbc96ea7a017d8d372878d47fd2175d.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01852; tRNA-Sec.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..50498
FT                   /organism="Escherichia coli O157:H7"
FT                   /strain="ECI-1717; EC970520"
FT                   /serotype="O157:H7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:83334"
FT   misc_feature    <1..>50498
FT                   /note="enterocyte effacement gene locus; LEE"
FT   tRNA            200..294
FT                   /product="tRNA-Sec"
FT                   /note="similar to selC gene from Escherichia coli O157:H7
FT                   Sakai strain; selenocysteine"
FT   CDS_pept        457..1644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="phage integrase family protein"
FT                   /note="similar to ZP_01700145.1 phage integrase family
FT                   protein [Escherichia coli B]"
FT                   /db_xref="GOA:B5ARH4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH4"
FT                   /protein_id="ACG59598.1"
FT                   /translation="MALTDIQIKRAKPQDKPYTLNDGQGLSLLINPDGSKGWRFRFRFA
FT                   GKARLMSFGSYDLVSLAEAREKRDIARKQVANGIDPVEERKALRLAQKLSTENSFEAIC
FT                   REWYTNKADRWTVAYREEIIRTFEQDVFPFIGKRPISEIKPLELLEVLRRIEKRGALEK
FT                   TRKVRQRCGEVFRYAIITGRAEYNPAPDLAIALAVPKPKHHPFLSVEELPYFIRDLEAY
FT                   SGSIITKNATKIVMLTGVRTQEMRFATWEEVDLDKEVWEIPAERMKMRRPHIVPLSTQV
FT                   VDLFKQLKPITGHYPYIFIGRNNRSKPISKESVSQVIELLGYKGRATGHGFRHTMSTIL
FT                   HEQGFDSAWIEMQLAHVDKNSIRGTYNHAQYLENRRAMLQWYSNFIFNKISEDTL"
FT   CDS_pept        complement(1864..3360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="deoxycytidylate deaminase"
FT                   /note="similar to YP_606669.1 deoxycytidylate deaminase
FT                   [Pseudomonas entomophila L48]"
FT                   /db_xref="GOA:B5ARH5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH5"
FT                   /protein_id="ACG59599.1"
FT                   /translation="MNKEAPQLLKNSGEDKQSTGPLAEMVIGLVSSVGTDLEAITKKIR
FT                   DRLSLYKFECSEVRISSDVIAELLGNGDYTDNYQRIDGLMTKGNKLREDSECNYILALG
FT                   AIAKINEIRAKHARLQINKKGIAYVINSIKHPEEVYKLREVYGSGFLLFGIFSDESRRL
FT                   DNLIRNKGIPEDKAALLIARDEDEESGHGQHTRDTFHLADFFLNQDGRDDKLNNDIKRV
FT                   FDLLFGNPFITPTFDEYAMYMAFSSALRSADLSRQVGAVLAKNYAIMSTGANDVPKSGG
FT                   GLYWPYFNAENEIYEDYPEGRDYVRGFDSNAKQKREIIHDILNQIPRKSRDNFERILNN
FT                   SLIQDITEYGRVVHAEMEAILACARTNISTQDAYIYCTTFPCHNCAKHIIASGIKRVVY
FT                   IEPYPKSKAYEFHSZSITNDEKNQGKVLFEPFIGIGPRVYFNLFSIVNGSGNKIKRKDK
FT                   SGNVVKWTESNSSLRISLLPISYLEREQISVNLFAKIIGV"
FT   CDS_pept        complement(4025..4597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="similar to ZP_02810547.1| polarity suppression
FT                   protein [Escherichia coli O157:H7 str. EC869] and
FT                   ZP_00718594.1| hypothetical protein EcolE1_01003841
FT                   [Escherichia coli E110019] and NP_042044.1| amber
FT                   mutation-suppressing protein [Enterobacteria phage P4]"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH6"
FT                   /protein_id="ACG59600.1"
FT                   /translation="MESTALQQAFDTCQNNKAAWLQRKNELAAAEQEYLRLLSGEGRNV
FT                   SRLDELRNIIEVRKWQVNQAAGRYIRSHEAVQHISIRDRLNDFMQQHGTVLAAALAPEL
FT                   MGYSELTAIARNCAIQRATDALREALLSWLAKGEKINYSAQDSDILTTIGFRPDAASVD
FT                   DSREKFTPAQNMIFSRKSAQLASHQSV"
FT   CDS_pept        complement(4671..5171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="phage transcriptional activator"
FT                   /note="similar to ZP_02810548.1| transactivation protein
FT                   [Escherichia coli O157:H7 str. EC869] and ZP_03001336.1|
FT                   transactivation protein [Escherichia coli 53638] and
FT                   YP_001724054.1| transcriptional activator Ogr/delta
FT                   [Escherichia coli ATCC 8739] and NP_042043.1|
FT                   transactivation protein [Enterobacteria phage P4]"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH7"
FT                   /protein_id="ACG59601.1"
FT                   /translation="MIYCPSCGHVAHTRRAHFMDDGTKIMIAQCRNIYCSATFEASESF
FT                   FSDCKDSGMEYISGKQRYRDSLTSASGSMKRPKRMLVTGYCCRRCKGLALSRTSRRLSQ
FT                   EVTERFYVCTDPGCGLVFKTLQTITRFIVRPVTPDELAERLHEKQELPPVRLKTQSYSL
FT                   RLE"
FT   CDS_pept        complement(5168..5902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="capsid size determination protein Sid"
FT                   /note="glycoprotein 3; similar to ZP_02810549.1|
FT                   glycoprotein 3, capsid size determination protein Sid
FT                   [Escherichia coli O157:H7 str. EC869] and YP_410425.1|
FT                   hypothetical protein SBO_4170 [Shigella boydii Sb227] and
FT                   NP_042042.1| head size determination protein sid
FT                   [Enterobacteria phage P4]"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH8"
FT                   /protein_id="ACG59602.1"
FT                   /translation="MSDNTIPEYLQPALAQLEKSRAAHLENARLMDETVTAIERAEQEK
FT                   NALAQADGNDADDWSTAFRAAGGVLSDELKQRHIERVARRELVQEYDNLAVVLNFERER
FT                   LKGACDSTATAYRKAHHHLLSLYAEHELEHALNETCEALVRAMHLSILVQENPLANTTG
FT                   HQGYVAPEKAVMQQVKSSLEQKIKQMQISLTGEPVLRLTGLSAATLPHMNYEVAGTPAQ
FT                   RKVWQDKIDQQEAELKARGLLS"
FT   CDS_pept        6453..6719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="AlpA family transcriptional regulator"
FT                   /note="similar to YP_410424.1| hypothetical protein
FT                   SBO_4169 [Shigella boydii Sb227] and ZP_02809929.1|
FT                   transcriptional regulator, AlpA family [Escherichia coli
FT                   O157:H7 str. EC869] and NP_042041.1| transcriptional
FT                   regulator [Enterobacteria phage P4]"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARH9"
FT                   /protein_id="ACG59603.1"
FT                   /translation="MQAVFSSPSPAPVTPLMPLPDITQERFLRLPEVMHLCGLSRSTIY
FT                   ELIRKGEFPPQVSLGGKNVAWLHSEVTAWMAGRIAGRKRGYDA"
FT   CDS_pept        6716..7315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="putative regulator"
FT                   /note="similar to ZP_02810551.1| phage protein [Escherichia
FT                   coli O157:H7 str. EC869] and YP_410423.1| putative
FT                   bacteriophage protein [SBO_4168] [Shigella boydii Sb227]
FT                   and NP_042040.1| putative CI repressor [Enterobacteria
FT                   phage P4] and NP_285988.1| putative regulator encoded in
FT                   prophage CP-933I [Escherichia coli O157:H7 EDL933]"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARI0"
FT                   /protein_id="ACG59604.1"
FT                   /translation="MMMPALQKLPFSGLPFSGICGYSFSAAAKSAAGRGNPSNSQATYD
FT                   APCVFFCVAINATERQIMVWCVVSRADGIPCILPASAHYAAESMVAQAGQPPGWPVSCE
FT                   AGISTPVWAIAIERGNSGDSVICYSQEAAIMATTLTPSHPEFVFVFAAVRRADRHPRIC
FT                   MLRTVAGDERSARRSLVRDYVLSLAARLPVMGVSRA"
FT   CDS_pept        7588..8043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to ZP_02810553.1| conserved hypothetical
FT                   protein [Escherichia coli O157:H7 str. EC869] and
FT                   YP_410422.1| hypothetical protein SBO_4167 [Shigella boydii
FT                   Sb227] and ZP_03031917.1| conserved hypothetical protein
FT                   [Escherichia coli F11]"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARI1"
FT                   /protein_id="ACG59605.1"
FT                   /translation="MFDFPQPGEIYRSAGFPDVAVVGILEDGIPWEMPYRCPDIVWNPY
FT                   RRKFSILVRILADGRTTDIPLGRFLREFTCDRPDLFKRSPVNRHAVLKEMAGDPELQKW
FT                   REKYLDIYPQDPVPVSRAAPVAREWREIPRTEPDPEITPDNSYRNYL"
FT   CDS_pept        8514..10847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="D5 family nucleoside triphosphatase"
FT                   /note="similar to ZP_02810555.1| nucleoside triphosphatase,
FT                   D5 family [Escherichia coli O157:H7 str. EC869] and
FT                   YP_001723056.1| phage/plasmid primase, P4 family
FT                   [Escherichia coli ATCC 8739] and ZP_02999114.1|
FT                   phage/plasmid primase C-terminal domain, P4 family
FT                   [Escherichia coli 53638]"
FT                   /db_xref="GOA:B5ARI2"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARI2"
FT                   /protein_id="ACG59606.1"
FT                   /translation="MKMNVTATVSHALGHWPRILPALGIQVLKNRHQPCPVCGGSDRFR
FT                   FDDREGRGTWYCNQCGAGDGLKLVEKVFGVSPSDAAAKVAAVTGSLPPADPAVTAAAGA
FT                   ETDAARKNAAALAQTLMAKTRPGTGNAYLTRKGFPGRECRMLTGTHRAGGVSWRAGDLV
FT                   VPLYDDSGELVNLQLISADGRKRTLKGGQVRGTCHTLEGQNQAGKRLWIAEGYATALTV
FT                   HHLTGETVMVALSSVNLLSLASLARQKHPACQIVLAADRDLSGDGQKKAAAAADACEGV
FT                   VALPPVFGDWNDAFTQYGGEATRKAIYDAIRPPAESPFDTMSEAEFSAMSTSEKAMRIY
FT                   EHYGEALAVDANGQLLSRYENGVWKVLPPQDFARDVAGLFQRLRAPFSSGKVASVVDTL
FT                   KLIIPQQEAPSRRLIGFRNGVLDTQNGTFHPHSPSHWMRTLCDVDFTPPVEGETLETHA
FT                   PAFWRWLDRAAGGRAEKRDVILAALFMVLANRYDWQLFLEVTGPGGSGKSIMAEIATLL
FT                   AGEDNATSATIETLESPRERAALTGFSLIRLPDQEKWSGDGAGLKAITGGDAVSVDPKY
FT                   RDAYSTHIPAVILAVNNNPMRFTDRSGGVSRRRVIIHFPEQIAPQERDPQLKDKITREL
FT                   AVIVRHLMQKFSDPMLARSLLQSQQNSDEALNIKRDADPTFDFIGYLETLPQTSGMYMG
FT                   NASIIPRNYRKYLYHAYLAYMEANGYRNVLSLKMFGLGLPVMLKEYGLNYEKRHTKQGI
FT                   QTNLTLKEESYGDWLPKCDDPATT"
FT   CDS_pept        11470..11871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="transposase 8 superfamily conserved hypothetical
FT                   protein"
FT                   /note="similar to NP_286015.1| unknown protein encoded in
FT                   ISEc8 [Escherichia coli O157:H7 EDL933] and YP_001883083.1|
FT                   hypothetical protein SbBS512_A0019 [Shigella boydii CDC
FT                   3083-94] and NP_309336.1| hypothetical protein ECs1309
FT                   [Escherichia coli O157:H7 str. Sakai]"
FT                   /db_xref="GOA:A0A0H3JCD3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCD3"
FT                   /protein_id="ACG59607.1"
FT                   /translation="MGTKVSDMQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKL
FT                   ALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPETLSISC
FT                   EVTFRHGTLRFNGNVSEKLLTLLIQELKR"
FT   CDS_pept        11868..12215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="putative transposase 25 superfamily protein"
FT                   /note="similar to YP_444124.1| putative transposase
FT                   [Escherichia coli] and NP_287583.1| putative IS encoded
FT                   protein encoded within prophage CP-933O [Escherichia coli
FT                   O157:H7 EDL933] and ZP_02802965.1| IS66 family element,
FT                   orf2 [Escherichia coli O157:H7 str. EC4196]"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC33"
FT                   /protein_id="ACG59608.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
FT   CDS_pept        12265..13803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="transposase 25 superfamily protein"
FT                   /note="IS66 family element; similar to NP_312574.1|
FT                   hypothetical protein ECs4547 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741627.1| hypothetical protein
FT                   EschericoliO157_16892 [Escherichia coli O157:H7 str.
FT                   EC4045] and ZP_02749003.1| hypothetical protein
FT                   EschericcoliO157_02165 [Escherichia coli O157:H7 str.
FT                   EC4206] and ZP_02814202.1| IS66 family element, transposase
FT                   [Escherichia coli O157:H7 str. EC869]"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q7A9R1"
FT                   /protein_id="ACG59609.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLSRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGAPLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
FT   CDS_pept        14000..14233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_312575.1| hypothetical protein ECs4548
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741628.1|
FT                   hypothetical protein EschericoliO157_16897 [Escherichia
FT                   coli O157:H7 str. EC4045] and ZP_02749002.1| hypothetical
FT                   protein EschericcoliO157_02160 [Escherichia coli O157:H7
FT                   str. EC4206] and ZP_02767457.1| hypothetical protein
FT                   EschecoliO157_09094 [Escherichia coli O157:H7 str. EC4115]
FT                   and ZP_02816112.1| hypothetical protein
FT                   EschercoliO157_01330 [Escherichia coli O157:H7 str.
FT                   EC4042]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X2R0"
FT                   /protein_id="ACG59610.1"
FT                   /translation="MVFNSIFVIQGGIEDIRKNLKIGTDRKLRGQQKRMVTPGNATPTS
FT                   RANPPLQSWFAVLHTRLPGYTGAVWSENIHAA"
FT   CDS_pept        14118..14273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="rve superfamily; similar to dbj|BAB37972.1|
FT                   hypothetical protein [Escherichia coli O157:H7 str. Sakai]"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X2Q9"
FT                   /protein_id="ACG59611.1"
FT                   /translation="MQRPPVGLIHHSNRGSQYCTHDYRAIQERFGLKTSMPRKGNRYDN
FT                   TSMKNL"
FT   CDS_pept        complement(14668..15414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EspF"
FT                   /note="similar to NP_290250.1| espF [Escherichia coli
FT                   O157:H7 EDL933] and NP_312577.1| EspF [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_03006206.1| EspF [Escherichia
FT                   coli O157:H7 str. EC4076]"
FT                   /db_xref="InterPro:IPR006891"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB85"
FT                   /protein_id="ACG59612.1"
FT                   /translation="MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKV
FT                   HSPFSPGSSNVNARTIFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHL
FT                   AAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEAL
FT                   GFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPP
FT                   TGPSGLPPLAQALKDHLAAYEQSKKG"
FT   CDS_pept        complement(15499..15777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_290251.1| hypothetical protein Z5102
FT                   [Escherichia coli O157:H7 EDL933] and NP_312578.1|
FT                   hypothetical protein ECs4551 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741632.1| hypothetical protein
FT                   EschericoliO157_16917 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="InterPro:IPR010437"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB84"
FT                   /protein_id="ACG59613.1"
FT                   /translation="MVNDISANKILVWAAVAAANHKLPKYAEAILNVFPQIIPDKKDIA
FT                   HLEFIILFGLNRKNDAVKALEDCMDDETSQLLYSLVHENGSGWVRGF"
FT   CDS_pept        complement(15783..16004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EscF"
FT                   /note="escF; similar to ZP_02754838.1| EscF [Escherichia
FT                   coli O157:H7 str. EC4206]NP_290252.1| and escF [Escherichia
FT                   coli O157:H7 EDL933] and NP_312579.1| EscF [Escherichia
FT                   coli O157:H7 str. Sakai]"
FT                   /db_xref="GOA:Q7DB83"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB83"
FT                   /protein_id="ACG59614.1"
FT                   /translation="MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQ
FT                   QYSAYVNVESGMLKTIKDLVSTISNRSF"
FT   CDS_pept        complement(16040..16447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="Lcr superfamily; similar to NP_290253.1|
FT                   hypothetical protein Z5104 [Escherichia coli O157:H7
FT                   EDL933] and NP_312580.1| hypothetical protein ECs4553
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741634.1|
FT                   hypothetical protein EschericoliO157_16927 [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="InterPro:IPR022797"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB82"
FT                   /protein_id="ACG59615.1"
FT                   /translation="MVDTFNDEVFNYYLEQKGYTIQKEFLCGSAFFIGWRIETPFFSLA
FT                   YRLDEQELILCSFEARNQTGLNGPVLSLTHLLEELYHHFSGIKKISAMKSKIGSDSERQ
FT                   KREELFNYFIRKGAVQQETEDGIWFVMNVNS"
FT   CDS_pept        complement(16454..17392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EspB"
FT                   /note="espB; similar to NP_290254.1| secreted protein EspB
FT                   [Escherichia coli O157:H7 EDL933] and NP_312581.1| EspB
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741635.1|
FT                   EspB [Escherichia coli O157:H7 str. EC4045]"
FT                   /db_xref="InterPro:IPR008611"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XC86"
FT                   /protein_id="ACG59616.1"
FT                   /translation="MNTIDNTQVTMVNSASESTTGASSAVAASALSIDSSLLTDGKVDI
FT                   CKLMLEIQKLLGKMVTLLQDYQQKQLAQSYQIQQAVFESQNKAIEEKKAAATAALVGGI
FT                   ISSALGILGSFAAMNNAAKGAGEIAEKASSASSKAAGAASEVANKALVKATESVADVAE
FT                   EASSAMQKAMATTTKAASRASGVADDVAKASDFAEDLADAAEKTSRINKLLNSVDKLTN
FT                   TTAFVAVTSLAEGTKTLPTTISESVKSTHEVNEQRAKSLENFQQGNLELYKQDVRRTQD
FT                   DITTRLRDITSAVRDLLEVQNRMGQSGRLAG"
FT   CDS_pept        complement(17413..18537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EspD"
FT                   /note="COG5613 superfamily; SSeC multidomains; espD;
FT                   similar to NP_290255.1| secreted protein EspD [Escherichia
FT                   coli O157:H7 EDL933] and NP_312582.1| EspD [Escherichia
FT                   coli O157:H7 str. Sakai] and ZP_02741636.1| EspD
FT                   [Escherichia coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB81"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="InterPro:IPR014575"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB81"
FT                   /protein_id="ACG59617.1"
FT                   /translation="MLNVNNDTLSVTSGVNTASGTSGITQSETGLSLDLQLVKSMNSSA
FT                   GWTESSPLPTPPAGHSLVTPSAAEDVLSKLFGGISGEVTSRTEEAEPQRTSYPYLSQVN
FT                   TVDPQQMMMMVTLLSLDTSAQKVSSLKNSNEIYMDGQTKALENKTQEYKKQLEEQQKAE
FT                   EKSQKSKIVGQVFGWLGVALTAVAAVFNPALWAVVAIGATAMALQTAVDVMGENAPQGL
FT                   KTAAQVFGGISMAASILTAGVGGVSSLLSKFGNVANKIGSSVVKVVEKAAEALVKNVFA
FT                   KISTVAEGVTNGIRSAGTTALNNEAAQLQMLSQLAAFAVQNLTRQSESLGESAKLELDK
FT                   AASELQNQASYLQSVSQLMSDSARVNSRIVSGRI"
FT   CDS_pept        complement(18550..19128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EspA"
FT                   /note="espA; similar to NP_290256.1| secreted protein EspA
FT                   [Escherichia coli O157:H7 EDL933] and NP_312583.1| EspA
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741637.1|
FT                   EspA [Escherichia coli O157:H7 str. EC4045]"
FT                   /db_xref="InterPro:IPR005095"
FT                   /db_xref="InterPro:IPR035074"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB80"
FT                   /protein_id="ACG59618.1"
FT                   /translation="MDTSNATSVVNVSASSSTSTIYDLGNMSKDEVVKLFEELGVFQAA
FT                   ILMFSYMYQAQSNLSIAKFADMNEASKASTTAQKMANLVDAKIADVQSSTDKNAKAKLP
FT                   QDVIDYINDPRNDISVTGIRDLSGDLSAGDLQTVKAAISAKANNLTTVVNNSQLEIQQM
FT                   SNTLNLLTSARSDVQSLQYRTISAISLGK"
FT   CDS_pept        complement(19187..20242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein SepL"
FT                   /note="sepL; similar to NP_290257.1| sepL [Escherichia coli
FT                   O157:H7 EDL933] and NP_312584.1| SepL [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741638.1| SepL [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB79"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB79"
FT                   /protein_id="ACG59619.1"
FT                   /translation="MANGIEFNQNPASVFNSNSLDFELESQQLTQKNSSNISSPLINLQ
FT                   NELAMITSSSLSETIEGLSLGYRKGSARKEEEGSTIEKLLNDMQELLTLTDSDKIKELS
FT                   LKNSGLLEQHDPTLAMFGNMPKGEIVALISSLLQSKFVKIELKKKYARLLLDLLGEDDW
FT                   ELALLSWLGVGELNQEGIQKIKKLYEKAKDEDSENGASLLDWFMEIKDLPEREKHLKVI
FT                   IRALSFDLSYMSSFEDKVKTSSIISDLCRVIIFLSLDNYADIISISIKKDKDIILNEVL
FT                   SIIEHVWLTEDWLLESPSRVSIVEDKHIYYFHLLKDFFTSLPDACFIDSEQRENALLMI
FT                   GKVIDYKEEII"
FT   CDS_pept        20385..21605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscD"
FT                   /note="escD; similar to NP_290258.1| escD [Escherichia coli
FT                   O157:H7 EDL933] and NP_312585.1| EscD [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02773687.1| type III secretion
FT                   apparatus protein, YscD/HrpQ family [Escherichia coli
FT                   O157:H7 str. EC4113]"
FT                   /db_xref="GOA:Q7DB78"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB78"
FT                   /protein_id="ACG59620.1"
FT                   /translation="MLSSYKIKLLNGAMRNRELQLPMGNLTLGTEDNDIVYFPLEQGLN
FT                   QFLLDIREEGVFLLSPVEFWIDGQPTPYEADKPLPVGKVIDIAGCCFIIGDIDHSLPLS
FT                   DVPERFSAKSRRKKRLILASVIGATFALSGAIGSYVLLSPKAEPPTFTRADVYQQLKEN
FT                   KLHAITLVWHGKNIALYGRCESTTDLTPFFNYLKEKNIFYYNNIICNNQIISAINDVLT
FT                   EYGYKDIIITKGNKPGFFLLSGYIPPSPKWSEVENLLLNTPGVAGWEIHNNSNNKINEL
FT                   ASEFKKNKLINYVNIFKKNDVIIVAGEVSQQNESKILAIINAMNKNSNAKILFQNIQPY
FT                   ISADIFPGKILRISGTMKNPTIALDNGTSLGIGSILKGGYVIDAIDPKDGINISRPDEY
FT                   IHIPLSY"
FT   CDS_pept        complement(21869..24673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="gamma-intimin"
FT                   /note="eaeA; similar to NP_290259.1| intimin adherence
FT                   protein [Escherichia coli O157:H7 EDL933] and NP_312586.1|
FT                   gamma intimin [Escherichia coli O157:H7 str. Sakai] and
FT                   ZP_02741639.1| gamma intimin [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="GOA:A1DZE6"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013117"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:A1DZE6"
FT                   /protein_id="ACG59621.1"
FT                   /translation="MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYF
FT                   KLGSDSKLLTHDSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKA
FT                   APGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKAL
FT                   NYAAQQAASLGSQLQSRSLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNN
FT                   FDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQD
FT                   FSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPS
FT                   YPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNEN
FT                   DLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNI
FT                   PHDINGTEHSTQKIQLIVKSKYGLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAY
FT                   VQGGSNIYKVTARAYDRNGNSSNNVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNAD
FT                   TITYTATVKKNGVAQANVPVSFNIVSGTATLGANSAKTDANGKATVTLKSSTPGQVVVS
FT                   AKTAEMTSALNASAVIFFDQTKASITEIKADKTTAVANGKDAIKYTVKVMKNGQPVNNQ
FT                   SVTFSTNFGMFNGKSQTQATTGNDGRATITLTSSSAGKATVSATVSDGAEVKATEVTFF
FT                   DELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKV
FT                   TLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSD
FT                   IYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYA
FT                   VCVE"
FT   CDS_pept        complement(24733..25203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="CesT"
FT                   /note="cesT; similar to NP_290260.1| hypothetical protein
FT                   Z5111 [Escherichia coli O157:H7 EDL933] and NP_312587.1|
FT                   CesT [Escherichia coli O157:H7 str. Sakai] and
FT                   ZP_02741640.1| CesT [Escherichia coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q2ABF5"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ABF5"
FT                   /protein_id="ACG59622.1"
FT                   /translation="MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDAN
FT                   DEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDA
FT                   TPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR"
FT   CDS_pept        complement(25341..27035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="translocated intimin receptor Tir"
FT                   /note="tir; similar to ZP_02810583.2| Tir [Escherichia coli
FT                   O157:H7 str. EC869] and NP_290261.1| putative translocated
FT                   intimin receptor protein [Escherichia coli O157:H7 EDL933]
FT                   and NP_312588.1| Tir [Escherichia coli O157:H7 str. Sakai]
FT                   and ZP_02797350.2| translocated intimin receptor Tir
FT                   [Escherichia coli O157:H7 str.EC4196]"
FT                   /db_xref="InterPro:IPR003536"
FT                   /db_xref="InterPro:IPR022633"
FT                   /db_xref="InterPro:IPR022638"
FT                   /db_xref="InterPro:IPR022639"
FT                   /db_xref="InterPro:IPR037003"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARJ9"
FT                   /protein_id="ACG59623.1"
FT                   /translation="MPIGNLGHNPNVNNSIPPAPPLPSQTDGAGGRGQLINSTGPLGSR
FT                   ALFTPVRNSMADSGDNRASDVPGLPVNPMRLAASEITLNEGFEVLHDHGPLDTLNRQIG
FT                   SSVFRVETQEDGKHIAVGQRNGVETSVVLSDQEYARLQSIDPEGKDKFVFTGGRGGAGH
FT                   AMVTVASDITEARQRILELLEPKGTGESKGAGESKGVGESKGVGELRESNSGAENTTET
FT                   QTSTSTSSLRSDPKLWLALGTVATGLIGLAATGIVQALALTPEPDSPTTTDPDAAASAT
FT                   ETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAI
FT                   ENNAQAQKKYDEQQAKRQEELKVSSGAGYGLSGALILGGGIGVAVTAALHRKNQPVEQT
FT                   TTTTTTTTTTSARTVENKPANNTPAQGNVDTPGSEDTMESRRSSMASTSSTFFDTSSIG
FT                   TVQNPYADVKTSLHDSQVPTSNSNTSVQNMGNTDSVVYSTIQHPPRDTTDNGARLLGNP
FT                   SAGIQSTYARLALSGGLRHDMGGLTGGSNSAVNTSNNPPAPGSHRFV"
FT   CDS_pept        complement(27459..28070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="mitochrondria associated protein"
FT                   /note="map; map; similar to NP_290262.1| hypothetical
FT                   protein Z5113 [Escherichia coli O157:H7 EDL933] and
FT                   NP_312589.1| hypothetical protein ECs4562 [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741642.1| hypothetical protein
FT                   EschericoliO157_16977 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="GOA:Q7DB76"
FT                   /db_xref="InterPro:IPR004959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB76"
FT                   /protein_id="ACG59624.1"
FT                   /translation="MFSPMTMAGRSLVQATAQTLKPAVTRAAMQAGTGATGMRFMPVQS
FT                   NFVINHGKLTNQLLQAVAKQTRNGDTQQWFQQEQTTYISRTVNRTLDDYCRSNNSVISK
FT                   ETKGHIFRAVENALQQPLDMNGAQSSIGHFLQSNKYFNQKVDEQCGKRVDPITRFNTQT
FT                   KMIEQVSQEIFERNFSGFKVSEIKAITQNAILEHVQDTRL"
FT   CDS_pept        28336..28719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="CesF"
FT                   /note="cesF; similar to NP_290263.1| hypothetical protein
FT                   Z5114 [Escherichia coli O157:H7 EDL933] and NP_312590.1|
FT                   hypothetical protein ECs4563 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741643.1| hypothetical protein
FT                   EschericoliO157_16982 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB75"
FT                   /protein_id="ACG59625.1"
FT                   /translation="MNEKFRTDLAHTFGIALEEQTDVLSFHDNDGHEWILECASQSEIL
FT                   FFYCYLLNSESIQINSILEMNSNRELLGMFFLSLKDDNILLNIAFPADKIDITEFANLM
FT                   ENGYLLKNEIIRSLSSRPTDFLP"
FT   CDS_pept        complement(28917..29423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EspH"
FT                   /note="espH; similar to NP_290264.1| hypothetical protein
FT                   Z5115 [Escherichia coli O157:H7 EDL933] and NP_312591.1|
FT                   hypothetical protein ECs4564 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741644.1| hypothetical protein
FT                   EschericoliO157_16987 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="GOA:Q7DB74"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB74"
FT                   /protein_id="ACG59626.1"
FT                   /translation="MSLSGAVFKTFLTSEHASWNRFNRRLHIPNEDIVDEIQLKARMQQ
FT                   RHHRVYPEIGDSTIVSFRGKDYAVHFIKDGPKDDYVYKVQRITPENGCFSTLFSVFSGG
FT                   VTKALERKLNERHITPLSSTWFPRTPLEGILAERGLSSLLRRVQSTERLDNRAIATRAS
FT                   SYSVL"
FT   CDS_pept        complement(29454..30371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein SepQ"
FT                   /note="sepQ; similar to NP_290265.1| sepQ [Escherichia coli
FT                   O157:H7 EDL933] and NP_312592.1| SepQ [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741645.1| SepQ [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="InterPro:IPR009532"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB73"
FT                   /protein_id="ACG59627.1"
FT                   /translation="MKPLSSQLNMKINDFYLPLLPVIGTGRLYITSKGHACHAYFREVS
FT                   GHGIRFTLTYSGYEGRFWISEEQFIQWCQELFPYSESRLIPEDTIKLMILWVMQTALPE
FT                   GDVSVDDVQFTMLNKDIYPVIENNNGENRLNVIILETTVQSLQYLINDNWQLVPHSNAL
FT                   FFDGYIVPGWTDYPVTELRVGDSLRLYHVDDSQERRCWIVINTPLATVNLSDNNLSVTD
FT                   VLAADLLSALSNETVMNRIYCAIGTVHIDIHMLRNVKKDDIINSDGYHLFGGCQLIRNN
FT                   TTIAYGSIVKINEDFYFTVSIVCD"
FT   CDS_pept        complement(30334..30750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_312593.1| hypothetical protein ECs4566
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02748985.1|
FT                   hypothetical protein EschericcoliO157_02055 [Escherichia
FT                   coli O157:H7 str. EC4206] and ZP_02767476.1| hypothetical
FT                   protein EschecoliO157_09189 [Escherichia coli O157:H7 str.
FT                   EC4115] and ZP_02816093.1| hypothetical protein
FT                   EschercoliO157_01235 [Escherichia coli O157:H7 str.
FT                   EC4042]"
FT                   /db_xref="InterPro:IPR009490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7A9P6"
FT                   /protein_id="ACG59628.1"
FT                   /translation="MTRVSLKRNLIEPVSFRPSDDWPQGEESFNDIFYHIKKRSPDTLF
FT                   IRMASLWKRLFYSSGRRRRYFEEGEHSFSILCGRLRGIVLTIKCSNGIIYLSIKVSPNN
FT                   RNHVFLYHKKDYVFDKLKEIFPDEAIEFTIEYEN"
FT   CDS_pept        complement(30743..31120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_290267.1| hypothetical protein Z5118
FT                   [Escherichia coli O157:H7 EDL933] and NP_312594.1|
FT                   hypothetical protein ECs4567 [Escherichia coli O157:H7 str.
FT                   Sakai]"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JJE2"
FT                   /protein_id="ACG59629.1"
FT                   /translation="MLDRILSIRKSRANRLRESMAKINSQIKEVDGKLDDCEQSIKESI
FT                   ASKQAYCASLVNLDKVSLYKYQIKNNAFDEQKQRLYEKKSSLSKEKRSLLDSQKRTKEN
FT                   LQHVNKSVEKLSFAIKEHYFD"
FT   CDS_pept        complement(31123..32463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscN"
FT                   /note="escN; similar to NP_290268.1| escN [Escherichia coli
FT                   O157:H7 EDL933] and NP_312595.1| EscN [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_00719128.1| COG1157: Flagellar
FT                   biosynthesis/type III secretory pathway ATPase [Escherichia
FT                   coli E110019]"
FT                   /db_xref="GOA:Q7DB71"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB71"
FT                   /protein_id="ACG59630.1"
FT                   /translation="MISEHDSVLEKYPRIQKVLNSTVPALSLNSSTRYEGKIINIGGTI
FT                   IKARLPKARIGAFYKIEPSQRLAEVIAIDEDEVFLLPFEHVSGMYCGQWLSYQGDEFKI
FT                   RVGDALLGRLVDGIGRPMESNIAAPYLPFERSLYAEPPDPLLRQVIDQPFILGVRAIDG
FT                   LLTCGIGQRIGIFAGSGVGKSTLLGMICNGASADIIVLALIGERGREVNEFLALLPQST
FT                   LSKCVLVVTTSDRPALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLA
FT                   SGEPDVRGGFPPSVFSSLPKLLERAGPAPKGSITAIYTVLLESDNVNDPIGDEVRSILD
FT                   GHIVLTRELAEENHFPAIDIGLSASRVMHNVVTSEHLRAAAECKKLIATYKNVELLIRI
FT                   GEYTMGQDPEADKAIKNRKLIQNFIQQSTKDISSYEKTIESLFKVVA"
FT   CDS_pept        complement(32447..34474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscV"
FT                   /note="escV; similar to NP_290269.1| escV [Escherichia coli
FT                   O157:H7 EDL933] and NP_312596.1| T [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741648.1| T [Escherichia coli
FT                   O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB70"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB70"
FT                   /protein_id="ACG59631.1"
FT                   /translation="MNKLLNIFKKAESYHDLILALFFFMAVMMMIIPLPTVVVDIIIAI
FT                   NISTALLLLMLSIYIKNPLELTSFPTILLITTLMRLSLSVSTTRLILLHHDAGDIIYSF
FT                   GNFVVGGNIVVGLVIFTIITIVQFMVITKGAERVAEVSARFSLDGMPGKQMSIDGDMRA
FT                   GVIDPLEAKVLRSRVQKESQFYGSMDGAMKFVKGDAIAGIIIVLVNLFGGVLIGMWQFD
FT                   MPFSAALSLFSVLSVGDALVAQIPALIISVTAGVVVTRVPGESEKEENLAGDIVQQVSV
FT                   NSRPFLISAALMLVMAIIPGFPALVFLFLAVCLLGIAWKLQKKRTFGTGNNKDAMGADL
FT                   SNSQNISPGAEPLILNLSSNIYSSDITQQIEVMRWNFFEESGIPLPKIIVNPVKNNDSA
FT                   IEFLLYQESIYKDTLIDDTVYFEAGHAEISFEFVQEKLSTNSIVYKTNKTNQQLAHLTG
FT                   MDVYATTNDKITFLLKKLVLSNAKEFIGVQETRYLMDIMERKYNELVKELQRQLGLSKI
FT                   VDILQRLVEENVSIRDLRTIFETLIFWSTKEKDVVILCEYVRIALRRHILGRYSVSGTL
FT                   LNVWLIGSDIENELRESIRQTSSGSYLNISPERTEQIIGFLKNIMNPTGNGVILTALDI
FT                   RRYVKKMIEGSFPSVPVLSFQEVGNNIELKVLGTVNDFRA"
FT   CDS_pept        complement(34471..34824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="multiple point controller protein"
FT                   /note="mpc; similar to NP_290270.1| hypothetical protein
FT                   Z5121 [Escherichia coli O157:H7 EDL933] and NP_312597.1|
FT                   hypothetical protein ECs4570 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02767480.1| hypothetical protein
FT                   EschecoliO157_09209 [Escherichia coli O157:H7 str. EC4115]"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB69"
FT                   /protein_id="ACG59632.1"
FT                   /translation="MNLLVKRNVEEFLRLLGNDFYLFDNRVEIDFNGFSFFIEIIDNNV
FT                   FVTFALEYNENAFFSFFSALAPERTQGVIEHIFVYDNKLCLSCLLTNIDVFFLMNTFQQ
FT                   HVQIIERVRRMTS"
FT   CDS_pept        35009..35308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein SepZ"
FT                   /note="sepZ; similar to NP_290271.1| sepZ [Escherichia coli
FT                   O157:H7 EDL933] and NP_312598.1| SepZ [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741650.1| SepZ [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB68"
FT                   /db_xref="InterPro:IPR009275"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB68"
FT                   /protein_id="ACG59633.1"
FT                   /translation="MEAANLSPSGAVMPLATSLSGNNSVDEKTGVIKPENGTNRTVRVI
FT                   AGLALTTTALAALGTGIAAACSETSSTEYLALGITSGVLGTLTAVGGALAMKYA"
FT   CDS_pept        35341..35769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_290272.1| hypothetical protein Z5123
FT                   [Escherichia coli O157:H7 EDL933] and NP_312599.1|
FT                   hypothetical protein ECs4572 [Escherichia coli O157:H7 str.
FT                   Sakai]"
FT                   /db_xref="GOA:A0A0H3JJE6"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JJE6"
FT                   /protein_id="ACG59634.1"
FT                   /translation="MDVLCPCLFHKKRLTVNMNNINQSENINIQLNKAPQTNFVDEHTS
FT                   LASAPSAAGAAQFLDQLLPKTAGVSSPEQVLIEEIKKRHLATMNSDLSFDALSAGGLSP
FT                   EDVLTLQKNVLNANVNVDVVSKLASLLSTSVTKLVSMQ"
FT   CDS_pept        35772..36344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscJ"
FT                   /note="escJ; similar to NP_290273.1| escJ [Escherichia coli
FT                   O157:H7 EDL933] and NP_312600.1| EscJ [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741652.1| EscJ [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB66"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB66"
FT                   /protein_id="ACG59635.1"
FT                   /translation="MKKHIKNLFLLAAICLTVACKEQLYTGLTEKEANQMQALLLSNDV
FT                   NVSKEMDKSGNMTLSVEKEDFVRAITILNNNGFPKKKFADIEVIFPPSQLVASPSQENA
FT                   KINYLKEQDIERLLSKIPGVIDCSVSLNVNNNESQPSSAAVLVISSPEVNLAPSVIQIK
FT                   NLVKNSVDDLKLENISVVIKSSSGQDG"
FT   CDS_pept        36350..36805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein SepD"
FT                   /note="sepD; similar to NP_290274.1| hypothetical protein
FT                   Z5125 [Escherichia coli O157:H7 EDL933] and NP_312601.1|
FT                   SepD [Escherichia coli O157:H7 str. Sakai] and
FT                   ZP_02741653.1| SepD [Escherichia coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB65"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB65"
FT                   /protein_id="ACG59636.1"
FT                   /translation="MNNNNGIAKNDCDWLTALDFVKDVNGSPTHLTFYIYQKNAFLHDF
FT                   GNYWVLYIELSGDFRQVPTDTFIRLCNILAVSNEYKQMGIFLSNKKWYLCQIFHKDNNH
FT                   RANMSKAIMQHTLASLLDKQFDKLEQLSSSDTMMPPTHLFSDIGRIV"
FT   CDS_pept        36805..38343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscC"
FT                   /note="escC; similar to NP_290275.1| escC [Escherichia coli
FT                   O157:H7 EDL933] and NP_312602.1| EscC [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741654.1| EscC [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB64"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB64"
FT                   /protein_id="ACG59637.1"
FT                   /translation="MKKISFFIFTALFCCSAQAAPSSLEKRLGKSEYFIITKSSPVRAI
FT                   LNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTN
FT                   EISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLS
FT                   ESLDKEAQSKAKNKDVVKVFKLNYASATDITYKYRDQNVVVPGVVSILKTMASNGSLPS
FT                   TGKGAVERSGNLFDNSVTISADPRLNAVVVKDREITMDIYQQLISELDIEQRQIEISVS
FT                   IIDVDANDLQQLGVNWSGTLNAGQGTIAFNSSTAQANISSSVISNASNFMIRVNALQQN
FT                   SKAKILSQPSIITLNNMQAILDKNVTFYTKVSGEKVASLESITSGTLLRVTPRILDDSS
FT                   NSLTGKRRERVRLLLDIQDGNQSTNQSNAQDASSTLPEVQNSEMTTEATLSAGESLLLG
FT                   GFIQDKESSSKDGIPLLSDIPVIGSLFSSTVKQKHSVVRLFLIKATPIKSASSE"
FT   CDS_pept        38357..38812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein CesD"
FT                   /note="cesD; similar to NP_290276.1| cesD [Escherichia coli
FT                   O157:H7 EDL933] and NP_312603.1| CesD [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741655.1| CesD [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB63"
FT                   /protein_id="ACG59638.1"
FT                   /translation="MSRKFSSLEDIYDFYQDGGTLASLTNLTQQDLNDLHSYAYTAYQS
FT                   GDVITARNLFHLLTYLEHWNYDYTLSLGLCHQRLSNHEDAQLCFARCATLVMQDPRASY
FT                   YSGISYLLVGNKKMAKKAFKACLMWCNEKEKYTTYKENIKKLLGNTE"
FT   CDS_pept        complement(39196..39609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="GrlA"
FT                   /note="DUF1401 superfamily; grlA; similar to NP_290277.1|
FT                   hypothetical protein Z5128 [Escherichia coli O157:H7
FT                   EDL933] and NP_312604.1| hypothetical protein ECs4577
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741656.1|
FT                   hypothetical protein EschericoliO157_17047 [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB62"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:4KT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB62"
FT                   /protein_id="ACG59639.1"
FT                   /translation="MESKNKNGDYVIPDSVKNYDGEPLYILVSLWCKLQEKWISRNDIA
FT                   EAFGINLRRASFIITYISRRKEKISFRVRYVSYGNLHYKRLEIFIYDVNLEAVPIESPG
FT                   TTGPKRKTYRVGNGIVGQSNIWNEMIMRRKKES"
FT   CDS_pept        complement(39664..40035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="GrlR"
FT                   /note="grlR; similar to NP_290278.1| hypothetical protein
FT                   Z5129 [Escherichia coli O157:H7 EDL933] and NP_312605.1|
FT                   hypothetical protein ECs4578 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741657.1| hypothetical protein
FT                   EschericoliO157_17052 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="InterPro:IPR032417"
FT                   /db_xref="PDB:3E3C"
FT                   /db_xref="PDB:4KT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB61"
FT                   /protein_id="ACG59640.1"
FT                   /translation="MIMKDGIYSIIFISNEDSCGEGILIKNGNMITGGDIASVYQGVLS
FT                   EDEDIILHVHRYNYEIPSVLNIEQDYQLVIPKKVLSNDNNLTLHCHVRGNEKLFVDVYA
FT                   KFIEPLVIKNTGMPQVYLK"
FT   CDS_pept        40231..40689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="lysozyme-like superfamily; similar to ZP_02810601.2|
FT                   transglycosylase SLT domain [Escherichia coli O157:H7 str.
FT                   EC869] and NP_290279.1| hypothetical protein Z5131
FT                   [Escherichia coli O157:H7 EDL933] and NP_312606.1|
FT                   hypothetical protein ECs4579 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741658.1| hypothetical protein
FT                   EschericoliO157_17057 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB60"
FT                   /protein_id="ACG59641.1"
FT                   /translation="MKKIILSIILISNYCYASDCFEITGKAYNIDPLILKAIAWNESKC
FT                   KSGIKSKTNKNGTYDIGIMQINSSHLDLLSKFNISEDDLLNDACINISVAGYILASNIK
FT                   SRGNTWDAVGAYNAGYFNTPNAVELRRQYAMKIYKTYNKLKNNEQIID"
FT   CDS_pept        complement(40686..41723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscU"
FT                   /note="escU; similar to NP_290280.1| secretion system
FT                   apparatus protein SsaU [Escherichia coli O157:H7 EDL933]
FT                   and NP_312607.1| secretion system apparatus protein SsaU
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741659.1|
FT                   secretion system apparatus protein SsaU [Escherichia coli
FT                   O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB59"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB59"
FT                   /protein_id="ACG59642.1"
FT                   /translation="MSEKTEKPTPKKLRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYG
FT                   MSFFVDIVGLVNTTIDSLNRPFLYAIREILGAVLNIFLLYILPISLIVFVGTVTTGVSQ
FT                   IGFIFAVEKIKPSAQKISVKNNLKNIFSVKSIFELLKSVFKLVIIVLIFYFMGHSYANE
FT                   FANFTGLNAYQALVVVAFFVFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKR
FT                   EAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKNPTHIAICLYYKLGETPLPL
FT                   VIETGKDAKALQIIKLAELYDIPVIEDIPLARTLYKNIHKGQYITEDFFEPVAQLIRIA
FT                   IDLDY"
FT   CDS_pept        complement(41716..42492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscT"
FT                   /note="escT; similar to NP_290281.1| escT [Escherichia coli
FT                   O157:H7 EDL933] and NP_312608.1| EscT [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741660.1| EscT [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB58"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB58"
FT                   /protein_id="ACG59643.1"
FT                   /translation="MNEIMTVIVSSFYCILRPLGMFIILPIFSTGVLLSNFIRNSIMIA
FT                   FTLPIIVENYTFSEKLPSGIFQLTGIALKEISIGFFIGLSFTILFWAIDAAGQIIDTLR
FT                   GSTISSIFNPSISDSSSITGVILYQFISVIFVIHGGIQSILDKLYLSYEILPLQADIAF
FT                   NRALIDFLFSLWDSFIKLMLSFSVPMIIGIFLCDMGFGFLNKTAPQLNVFTLSLPVKSL
FT                   IAIFILLLVIHVFPDFITANIHSDIIDRSLPSMINE"
FT   CDS_pept        complement(42492..42761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscS"
FT                   /note="escS; similar to NP_290282.1| escS [Escherichia coli
FT                   O157:H7 EDL933] and NP_312609.1| EscS [Escherichia coli
FT                   O157:H7 str. Sakai] and ZP_02741661.1| EscS [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB57"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB57"
FT                   /protein_id="ACG59644.1"
FT                   /translation="MDTGYFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQ
FT                   DQTLPFLLKIIAVFATLALTYHWMGTTIINFSSIIFEMIPKVNG"
FT   CDS_pept        complement(42761..43414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="type III secretion system protein EscR"
FT                   /note="escR; similar to NP_290283.1| type III secretion
FT                   system protein [Escherichia coli O157:H7 EDL933] and
FT                   ZP_02748968.1| type III secretion system protein
FT                   [Escherichia coli O157:H7 str. EC4206] and ZP_02767493.1|
FT                   type III secretion system protein [Escherichia coli O157:H7
FT                   str. EC4115]"
FT                   /db_xref="GOA:Q7DB56"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB56"
FT                   /protein_id="ACG59645.1"
FT                   /translation="MSQLMTIGSQPIFLIIVFFLLSLLPIFVVIGTSFLKISIVLGILK
FT                   NALGIQQVPPNMALTSVSLILTMFIMSPIILQINDNISQEPINYTDSDFFQKVDEKILS
FT                   PYRGFLEKNTEKDNVEFFERAAQKKLGNETILKKDSLFILLPAFTMGQLEAAFKIGFLL
FT                   YLPFIAIDLIISNILLALGMMMVSPVTISIPFKILLFILVGGWQKLFEFLLVVN"
FT   CDS_pept        complement(43419..44114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to emb|CAG17514.1| hypothetical protein
FT                   [Escherichia coli] and NP_312611.1| hypothetical protein
FT                   ECs4584 [Escherichia coli O157:H7 str. Sakai]"
FT                   /db_xref="UniProtKB/TrEMBL:Q7A9M8"
FT                   /protein_id="ACG59646.1"
FT                   /translation="MIYFLTDLIKFYCLMKLYEFKNIKIDLVLTEDIIPEDKLQEIIQS
FT                   DDIIKLARKKTYEHLLRARRKSKELKTESRKKIARKMILMRERIRKNNKIKLDKEVNQS
FT                   IKWVKDIQAIELVLMQDIMNKIHLSLTNALHSLDTSSRINWDDLLNEVVRETLSNNNIV
FT                   GAIKITKNPDIKLDPGEANNIQLINDANTPHNKIIIENEYIRITLDPLEQISILLNSFK
FT                   DNYLSIIQE"
FT   CDS_pept        complement(44059..44658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_290285.1| hypothetical protein Z5137
FT                   [Escherichia coli O157:H7 EDL933] and NP_312612.1|
FT                   hypothetical protein ECs4585 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741663.1| hypothetical protein
FT                   EschericoliO157_17092 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="InterPro:IPR025292"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB54"
FT                   /protein_id="ACG59647.1"
FT                   /translation="MTIFNKIDYNYYKLINYPIMMVHDEWLGDLTGVNQVSFRRLRETS
FT                   STRNQLNKILRQEIHDKISGVELSDINKEGFLYQSIGKIRLLALSSALFDIQCPDYIFS
FT                   RLYRETLIREIGYQNVKQLSFYWQGGQCKPEYGEERFCAELIKYGAGNLEWLFADNPLW
FT                   TIVKYLLPKSGEIKPTHINDLFLNRLNKILLPYETL"
FT   CDS_pept        complement(44655..44978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_290286.1| hypothetical protein Z5138
FT                   [Escherichia coli O157:H7 EDL933] and NP_312613.1|
FT                   hypothetical protein ECs4586 [Escherichia coli O157:H7 str.
FT                   Sakai] and ZP_02741664.1| hypothetical protein
FT                   EschericoliO157_17097 [Escherichia coli O157:H7 str.
FT                   EC4045]"
FT                   /db_xref="InterPro:IPR021545"
FT                   /db_xref="InterPro:IPR035074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JLI4"
FT                   /protein_id="ACG59648.1"
FT                   /translation="MSIVSQTRNKELLDKKIRSEIEAIKKIIAEFDVVKESVNELSEKA
FT                   KTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRNRNNR
FT                   KIV"
FT   CDS_pept        complement(44982..45200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_290287.1| hypothetical protein Z5139
FT                   [Escherichia coli O157:H7 EDL933] and ZP_02741665.1|
FT                   hypothetical protein EschericoliO157_17102 [Escherichia
FT                   coli O157:H7 str. EC4045] and ZP_02748964.1| hypothetical
FT                   protein EschericcoliO157_01950 [Escherichia coli O157:H7
FT                   str. EC4206] and NP_312614.1| hypothetical protein ECs4587
FT                   [Escherichia coli O157:H7 str. Sakai]"
FT                   /db_xref="GOA:Q7DB52"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB52"
FT                   /protein_id="ACG59649.1"
FT                   /translation="MITITELEDEIIKNKEAANVFIEKINDKKNEIHEKMKHPLDKVTY
FT                   NEAKELLIACDAAIRTIEIMRIRINNK"
FT   CDS_pept        complement(45215..45604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Ler"
FT                   /note="HNS superfamily; ler; similar to NP_290288.1|
FT                   hypothetical protein Z5140 [Escherichia coli O157:H7
FT                   EDL933] and NP_312615.1| Ler [Escherichia coli O157:H7 str.
FT                   Sakai]"
FT                   /db_xref="GOA:A0A0H3JQJ3"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JQJ3"
FT                   /protein_id="ACG59650.1"
FT                   /translation="MRRLFIMNMENNSHTTSPYIQLIEQIAVLQQEAKRLREQEVQSVI
FT                   ESIQKQITYYNITLQELGYTNVPDDGLARRNSSKGVYYRNEEGQTWSGVGRQPRWLKEA
FT                   LLNGMKKEDFLVKDTEEEIIPLKNI"
FT   CDS_pept        complement(46155..46280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to dbj|BAB38012.1| hypothetical protein
FT                   ECs4589 [Escherichia coli O157:H7 str. Sakai]"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARM7"
FT                   /protein_id="ACG59651.1"
FT                   /translation="MYGRSSFAEWIWAILLNTNGTVMREETNAVTVQLFVPCSFL"
FT   CDS_pept        46848..48044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="EspG"
FT                   /note="espG; similar to NP_290289.1| hypothetical protein
FT                   Z5142 [Escherichia coli O157:H7 EDL933] and NP_312617.1|
FT                   EspG [Escherichia coli O157:H7 str. Sakai] and
FT                   ZP_02741668.1| EspG [Escherichia coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:A0A0H3JHV5"
FT                   /db_xref="InterPro:IPR009669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JHV5"
FT                   /protein_id="ACG59652.1"
FT                   /translation="MILVAKLFITNQIGESLMINGLNNDSASLVLDAAMKVNSGFKKSW
FT                   DEMSCAEKLFKVLSFGLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSS
FT                   LRISVTNSELVEAEIRTANNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEMDL
FT                   TDTTSMRNLLGFTSKLSTTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVDI
FT                   PANAQKLLRDALGLKDTHSSPTRNVIDHGISRHDAEQIARESSGSDKQKAEVVEFLCHP
FT                   EAATAICSAFYQSFNVPALTLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYV
FT                   TSHTGVLIMAPEDRPNEMGMLTNRTSYEVPQGVKCIIDEMVSALQPRYAASETYLQNT"
FT   CDS_pept        48172..48990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="sdiA-regulated superfamily; similar to NP_290290.1|
FT                   hypothetical protein Z5143 [Escherichia coli O157:H7
FT                   EDL933] and NP_312618.1| hypothetical protein ECs4591
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741669.1|
FT                   hypothetical protein EschericoliO157_17122 [Escherichia
FT                   coli O157:H7 str. EC4045]"
FT                   /db_xref="GOA:Q7DB49"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DB49"
FT                   /protein_id="ACG59653.1"
FT                   /translation="MKRKPLIAFFIAIFIALTILILFPFNCTYKKSPQEHSLSFIKQLP
FT                   NTVNLSSLTYNKEDDFLYATQNSPAQLLKITKSGDIMDRAPLPFISDAETIEHIQGNIF
FT                   AAVDEKTSELFFFTVTKDMHISFRNKIQLEKFNKKNRGFEGLAWKADDRMLFVAKERRP
FT                   SKIFIYQLSPDLLSVKQATIPEALNDIRVNDISGLAFNNESLMILSDESRKLLKFNLTE
FT                   MSFIEMLDLTKGNHSLTSDLPQPEGIVTLPDESIYVASEPDILAKFVPNK"
FT   CDS_pept        complement(49304..49537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_312619.1| hypothetical protein ECs4592
FT                   [Escherichia coli O157:H7 str. Sakai]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X2G4"
FT                   /protein_id="ACG59654.1"
FT                   /translation="MFQNEIKDKFKTGLAYVRGPEKSGSSAQNAGSEGGKKCAGRSRRL
FT                   SRDVRLRNTSLIKRVSMMILVADQRNYIRRKQ"
FT   CDS_pept        complement(49762..49956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to NP_312620.1| hypothetical protein ECs4593
FT                   [Escherichia coli O157:H7 str. Sakai] and ZP_02741671.1|
FT                   hypothetical protein EschericoliO157_17132 [Escherichia
FT                   coli O157:H7 str. EC4045] and ZP_02748958.1| hypothetical
FT                   protein EschericcoliO157_01920 [Escherichia coli O157:H7
FT                   str. EC4206] and ZP_02767503.1| hypothetical protein
FT                   EschecoliO157_09324 [Escherichia coli O157:H7 str. EC4115]"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X2G3"
FT                   /protein_id="ACG59655.1"
FT                   /translation="MARMAQFAPRRFFLAQTGELNIFNKQQANHCNTQHPYRQPEQRVV
FT                   APDFNHNFVNRAGDNLAEA"
FT   CDS_pept        50010..>50498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="putative permease transporter"
FT                   /note="similar to 5' of ECs4594 [Escherichia coli O157:H7
FT                   str. Sakai]"
FT                   /db_xref="GOA:B5ARN2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5ARN2"
FT                   /protein_id="ACG59656.1"
FT                   /translation="MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEQSQMSSQFLTMTRLI
FT                   FAGLILLTLSFVHGDKIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATV
FT                   LQFLSPTIIVAWFSLVRKSRPGILVFCAILTSLIGTFLLVTHGNPTSLSISPAALFWGI
FT                   "
XX
SQ   Sequence 50498 BP; 14735 A; 11323 C; 9889 G; 14548 T; 3 other;
     atttatgatt cttgttttat gtgatcgtgg tagcgttaat tccgctcata tatcattgta        60
     aaatatgagt tttatatgaa ttataatgct ttcgtgataa tacgctgcgt gtattaggcg       120
     gaaaaaactg atctggggga tgtagaaact caaggaagta gctataatgc gccccgcctc       180
     catgtagcaa tcgaggcgcg gaagatcgtc gtctccggtg aggcggctgg acttcaaatc       240
     cagttggggc cgccagcggt cccgggcagg ttcgactcct gtgatcttcc gccaaacctc       300
     atccagccag ttccgagata ctccataaaa tactttatat tcaatacgat gaataatcag       360
     cttgtccgta atagtccgag atcatctccc tgaatccgcg aaaaatatgt atagtaatgt       420
     gtatagattt tttatacgta gttttcagtt atacacatgg ctctaaccga tatacagatc       480
     aaacgtgcaa aaccacaaga caaaccatac acattgaacg atggacaagg tctgtcattg       540
     cttatcaatc ccgatggctc gaaaggctgg cgtttccgtt tccggtttgc agggaaagcg       600
     cggttaatgt catttggcag ctacgattta gtaagcctcg cagaagcacg tgagaagcgt       660
     gatatcgccc gtaagcaggt tgctaatggc attgacccgg tagaggaacg caaagcttta       720
     agactcgctc aaaagctatc aacagaaaat tctttcgaag caatatgtcg agaatggtat       780
     accaacaaag ctgatcgctg gactgtagcc tatcgagaag aaatcattag gacattcgag       840
     caggatgtct tcccgttcat tggtaaacgt cctatcagtg aaatcaaacc attagaactg       900
     cttgaagtat tgcgacgaat agagaaacga ggagcactag agaagaccag aaaagtgcgc       960
     caaagatgcg gtgaggtctt tcgttatgca atcataactg gccgagctga atacaaccca      1020
     gcacctgatt tagctatcgc tctggccgtt cctaagccaa aacaccaccc atttttatct      1080
     gtcgaagagt tgccttattt tattcgggat ttggaggcat actccggcag cataatcacc      1140
     aaaaatgcaa ctaagatagt tatgcttact ggtgtaagaa cgcaggagat gcgctttgct      1200
     acgtgggaag aggttgattt ggataaggag gtttgggaga taccagcgga acgtatgaaa      1260
     atgcgtaggc ctcacattgt tcctttatct actcaggtag ttgacctttt taaacagctc      1320
     aaaccaatta ccggtcatta cccttacatc tttattggca ggaacaaccg tagcaaaccg      1380
     atctcgaaag aaagtgtttc acaagtgatt gagttacttg gttacaaagg ccgtgctaca      1440
     ggtcatggat ttagacatac aatgtcaaca atattacatg aacaagggtt tgacagtgcc      1500
     tggattgaga tgcaattagc acatgttgat aaaaattcta ttcgtggaac atacaatcac      1560
     gcacaatatt tagaaaatag acgcgcaatg cttcagtggt atagtaactt catatttaat      1620
     aaaattagtg aagacacact ttgatttata aataaaaaga gcctcttccg aagctctttt      1680
     ttaattgttt atttattgtt cttcaatctt ttatcttctt gtaaaacaag attatttaac      1740
     actttaattg acttggagga taaatcatct cctcctaaca tatttttttt ccattccggc      1800
     cattcattaa ttattttttt agttgcaacc acatgtttaa taaaaccatt ttcgatagac      1860
     atgttaaact cctatgatct ttgcgaataa gttaacagaa atctgctctc tttccaagta      1920
     agaaataggc aacagtgata ttcttaatga cgaattagac tcagtccatt taacaacatt      1980
     tcccgactta tcttttctct taattttatt accacttcca ttaacaatgg aaaatagatt      2040
     aaaatagact cgtggaccta ttccaataaa aggttcgaaa agcacctttc cttggttttt      2100
     ttcatcatta gttattgatt stgaatgaaa ttcataagcc ttactttttg gatatggctc      2160
     tatgtaaacc accctcttta ttcccgaagc tataatatgc ttagcgcagt tgtggcatgg      2220
     gaaagtagtg caatatatat aagcatcttg agtactaata tttgttctag cgcatgctaa      2280
     aatagcttcc atttcagcat gcaccacacg accatattcc gtaatatctt gaatcaggct      2340
     gttattgagg attctctcaa aattatcacg agattttcta ggtatttgat tgagaatatc      2400
     atgtataatt tctctttttt gtttagcatt cgaatcaaaa cctcttacat agtcccttcc      2460
     ttccggatag tcttcataaa tttcgttctc tgcattaaaa tatggccagt ataaaccacc      2520
     accagactta ggaacatcat tagcaccagt tgacataata gcgtaatttt ttgctaatac      2580
     agctccaact tgtcttgata aatcagcaga tctcaaagct gaagaaaagg ccatatacat      2640
     tgcatattca tcaaatgttg gcgtaataaa aggattaccg aatagcaaat caaaaactct      2700
     ttttatatca ttattaagtt tatcatctcg gccatcttgg tttaaaaaga aatcagccaa      2760
     atgaaatgta tctctggtat gctgcccatg cccagactct tcatcttcat ctctagcaat      2820
     caataacgct gctttatctt ctggaattcc tttattacga attaaattat ctaacctgcg      2880
     actctcatca gaaaaaatac caaacaataa aaatcccgag ccatatactt ctcttaattt      2940
     atacacctct tctggatgct ttattgaatt tataacatat gcaattcctt ttttatttat      3000
     ttgtaaacgt gcatgctttg ccctaatctc attaatttta gctattgctc caagagccaa      3060
     tatataatta cattcactat cctccctcag tttatttccc ttagtcatta agccatcaat      3120
     tctttggtaa ttatctgtat aatctccatt acctaagagc tcagctatca catcagatga      3180
     aatccgaact tcagaacatt caaatttata taaggataat ctatctctta ttttttttgt      3240
     aattgcttct aggtctgtgc caacggaaga aactaaccct attaccattt ctgctaaagg      3300
     tcctgtggat tgcttatcct cccctgagtt ttttaaaagc tgaggtgctt ctttattcaa      3360
     ttctgttatc tttgtaattt tcatatgaag tcattcatcc agtgaagata caaaacattt      3420
     ttataaataa ttcttagcat gttttctatg ttttcattaa attttttgaa ttacctcatg      3480
     ttttacattt aagcaacaca aggtaaacaa ctgttatata agaaaattga aagcataatg      3540
     aatgatgtag ttggctgtca cgtcttccca cttcgtaggg cggattcagg ctgaatcata      3600
     gatagtttta gacctcttat aggaccgaat gtataagatg aaggtattag aggagctgag      3660
     cgccttcaaa accgccactc agtatctaaa ccgggcaata ctttctcgcc cctaacttag      3720
     ccactcatgg gctcatcacg ccatcaaaca ttactgcacg atcactaata ctcgttcgaa      3780
     acggcacagt actacggtac accaagtccc gcaaaaataa atacattacc gctggcgcgc      3840
     agtgctttcc ccgcctcgcc cgcccgcttt gcggggcggt tttaatgcag tttcactgac      3900
     acgctcaggc cgcgccggga atggcgcggt ctgcagaaaa tgaggcagga aaacgcatgc      3960
     aaagccatgc accttatcga tgcatggctt ttttcagtaa aaacgggcgg attttcgggg      4020
     agttttacac agactgatgt gatgccagtt gcgcactttt acgcgaaaaa atcatgttct      4080
     gcgcaggggt gaatttttca cggctgtcat ccaccgaagc cgcgtcaggc ctgaatccga      4140
     tggtcgttaa aatgtcgcta tcctgtgcgg aataattaat tttttccccc ttcgcaagcc      4200
     aggacaggag ggcttcacgc agggcatctg tggcacgctg tatggcacag tttcgggcaa      4260
     tggccgtcag ctcactgtaa cccatcagct ccggtgccag tgcggccgcc agtactgtgc      4320
     cgtgctgctg cataaaatca ttcagccggt cgcggatgct gatgtgctga acggcttcat      4380
     gcgaacgaat ataacgaccg gcggcctgat tcacctgcca ttttctgact tcgataatat      4440
     tgcgtaattc gtccaggcgg ctgacgtttc tgccttctcc tgacagaagc cgcagatatt      4500
     cctgttcggc cgctgccagc tcatttttgc gttgcagcca tgctgctttg ttattctgac      4560
     aggtgtcaaa ggcctgctgt aaggctgtgc tttccatcgt tatctctttc tcatcatgct      4620
     gaagaataaa aatacggtgt gcggcgacgg ccggggttaa ccggcagccc tcattccaga      4680
     cgcagcgaat atgattgtgt ttttaaccgt actggcggca gttcctgttt ttcatgcagg      4740
     cgttctgcca gttcgtccgg cgtgaccggg cggacaatga agcgggtgat ggtctgaagc      4800
     gttttaaaca ccagaccaca gcccggatcc gtgcacacat aaaaacgctc ggtgacttcc      4860
     tgagacagac gccgcgatgt tcttgacagc gcaaggcctt tacatctccg acaacaatat      4920
     ccggtaacaa gcattctttt cgggcgtttc atactgccgg aggccgacgt cagtgaatcg      4980
     cggtatctct gtttgcctga aatgtattcc attcctgaat ctttacagtc agagaaaaag      5040
     ctttcactcg cttcaaatgt cgcagagcaa taaatattcc ggcactgtgc aatcattatc      5100
     ttggtgccat cgtccatgaa atgtgcgcga cgggtgtgag caacatgtcc acacgacggg      5160
     cagtaaatca tgacagcagc cctctggcct taagctctgc ttcctgctgg tctattttgt      5220
     cctgccacac cttgcgctgt gccggtgtgc ctgccacctc ataattcatg tgcgggagtg      5280
     ttgccgctga cagtccggtc agccggagaa ccggctcgcc ggtgaggctg atttgcatct      5340
     gttttatttt ctgttccagc gatgatttca cctgctgcat gacagccttt tccggtgcga      5400
     cgtagccctg atggccggtg gtgttggcga gcggattttc ctgtaccagg atgctcagat      5460
     gcattgcccg gacaagcgcc tcacaggttt cattcagggc gtgttccagc tcatgctctg      5520
     catacagact cagcaggtga tgatgtgcct tccggtaggc ggtggccgtg ctgtcacacg      5580
     cccctttcag gcgttcacgt tcaaaattca gcaccacggc cagattgtca tattcctgta      5640
     ccagctcccg gcgtgccacg cgctcaatgt ggcgctgttt cagctcgtca ctcaggacac      5700
     caccggctgc acgaaaggcc gtgctccagt cgtcagcgtc gtttccgtcg gcctgcgcca      5760
     gcgcattttt ttcctgctct gcccgttcaa tggccgtaac ggtctcatcc atcaggcggg      5820
     cgttctcaag atgggcggct ctggactttt ccagttgtgc cagtgcgggt tgcagatatt      5880
     cagggatggt gttgtcagac attttccagc tcctcgtcac ttcaggttaa gaaaattgtg      5940
     acgtacaccg gacaacaaca cgacgcattg cagatgtgcc agccctgaca caggagactc      6000
     atcctcagac cggcaagcca ggaaaaggtc gcaggaaaaa ccggcttact gtttgttttt      6060
     tatattttac tgttcacctc tgttcaccat aagaaaaaag ataagtaata cagtaagtta      6120
     aagggtgaac aatcgcagta atgactgttc accgtctgtt caccactgtt cacccgttga      6180
     tgggcttttt gtgctgttta ttacttttta tttttattaa ttcactgaaa taaataagaa      6240
     aaaacaattt gtatttcact ataatttttt ccagctcctt ccagagcgtt ttaaagctat      6300
     ctggcgctga tgtacaaaaa atgcacagcc attgtaaggc tgccggaaca aatcccccct      6360
     gttgcgtctg ccgaaaatat tcacaaaata aagcgctacc cgaagccgga cggacttatc      6420
     cggtgctgta tggacattaa cgaggtagcc cgatgcaagc tgttttttct tccccgtctc      6480
     ccgcccctgt gacgccactg atgccgctgc cggacatcac gcaggagcgt tttttacgtc      6540
     tgccggaagt gatgcacctg tgcggcctgt cacgctcgac catctatgaa ctcatccgta      6600
     agggggaatt tccgccgcag gtgagtcttg gcggtaaaaa tgtggcctgg ctgcactctg      6660
     aagtcaccgc atggatggcc ggccgcattg ccggacgcaa acgggggtat gacgcatgat      6720
     gatgcccgct ctgcaaaaac tccctttttc tggcttgcct ttttccggca tttgcggata      6780
     tagtttttcc gctgccgcaa aatcggcagc cgggcgtgga aacccgagca attcacaggc      6840
     gacatatgac gcgccatgcg tctttttttg tgtcgcaatc aacgccacag agcgccagat      6900
     tatggtgtgg tgtgtggtca gtcgtgcaga tggcattccg tgcatcctgc ccgcgtccgc      6960
     tcattatgcc gcagagtcaa tggtagctca ggcggggcag cctccgggct ggccggtatc      7020
     ctgtgaagcc ggtatttcca cccccgtctg ggctatcgcc atcgagcgtg gaaactccgg      7080
     cgatagcgtt atttgctatt cacaggaggc tgccatcatg gctacaaccc ttaccccctc      7140
     acaccctgaa tttgtctttg tgtttgcggc tgtccgtcgc gcagaccgtc atccccgtat      7200
     ctgcatgctt cgcaccgtcg ccggtgatga acgcagcgcc cgccgttccc ttgtccgtga      7260
     ctatgtgctc tcccttgctg cccgtctgcc ggtgatgggg gtgtcccgtg cgtaataaaa      7320
     aagcccctca gaccgtctca gcgcgtcatg acgcccgtga acacntcagc attgaggctt      7380
     accataagct caaccgcgcc agcgccgtat cccagtttgt tgggggtgat ttgattcacc      7440
     gtgaactctc cggcctgcat cagctctaca ttccgcatat tttcagctac ctgaatgaag      7500
     atattgattt tgtgctgaat gagctgaaag ccaaaggcct gtgccgcgat tttctcgccc      7560
     agcagaaaga ccggggagac aggacgcatg tttgattttc cccagcccgg tgagatttac      7620
     cgttctgccg gttttcccga tgtggccgtg gtcggcattc tggaagacgg tattccgtgg      7680
     gaaatgccgt accgctgccc ggacattgtc tggaacccgt accgccgtaa attcagtatc      7740
     cttgtgcgta tcctcgctga cgggcgcacc acagacatcc cgctggggcg ttttctgcgg      7800
     gaatttacct gtgaccgtcc tgacctgttt aaacgcagcc ccgtaaaccg gcatgcggta      7860
     ctgaaagaaa tggccggaga cccggaatta cagaaatggc gggagaaata tctggatatt      7920
     tacccgcagg accctgttcc ggtcagccgg gcggcaccgg tggcgcggga atggcgggaa      7980
     atcccccgca cggagcctga cccggaaatc acaccggata acagttaccg caattatctg      8040
     taattaaaaa acgacacccg aaaaattaaa tgtgcgtatt cgcgcaggga tacgcacgtc      8100
     ttcaggagac gcagatatgc cttatcagtt aatgcaaccg gcacggaatg cagtcatctg      8160
     tcacagggag gaaagcaaat gaaaacaccc ttaccgcccg tcttacgcgc agccctttac      8220
     cgtcgtgctg tcgcctgtgc ctggctgacc gtgtgcgaac gtcagcaccg ctacccgcat      8280
     ctcacccttg aatcactgga ggcggccatc gccgctgagc tggaaggctt ttatctgcgc      8340
     cagcacggtg aggaaaaagg gcgtcagata gcctgtgccc tgctggaaga tttaatggaa      8400
     tccggccccc tgaaggccgc gccgtcgctg tcctttctcg ggctggttgt gatggatgaa      8460
     ctctgtgccc gtcacataaa agcgccggta ctgcactgaa ggagaacaac accatgaaaa      8520
     tgaacgtaac cgccaccgtc agccatgcgc tcggccactg gccgcgtatt ctcccggcgc      8580
     tggggattca ggtgctgaaa aaccgtcatc agccctgtcc ggtctgtggc gggagtgacc      8640
     gcttccgttt tgatgacagg gaggggcgcg gcacctggta ctgcaatcag tgtggtgccg      8700
     gtgacggcct gaaactggtt gaaaaggtgt ttggtgtttc cccgtccgat gcggccgcaa      8760
     aggtggctgc cgtgaccggc agcctgcccc cggctgaccc ggcagtgacg gctgccgccg      8820
     gtgctgaaac agacgctgcc cggaagaacg ccgccgcact ggcacaaacc ctgatggcga      8880
     aaacccgtcc cggaaccggt aacgcctacc tgacccgcaa gggctttccc ggccgggaat      8940
     gccggatgct gaccggcaca cacagagccg gtggcgtgag ctggcgtgcc ggtgaccttg      9000
     tggtgccact gtatgacgac agcggcgaac tggttaacct tcagttaatc agtgctgacg      9060
     gccgtaagcg caccctgaaa ggcggacagg tcaggggcac ctgtcacacc cttgaaggac      9120
     agaatcaggc cggaaaacgt ctgtggatag cggagggata cgcgaccgca cttaccgtgc      9180
     atcacctgac cggtgaaacg gtgatggtgg cgctttcttc cgtgaatctc ctttctctgg      9240
     ccagccttgc ccggcagaag catccggcct gtcagattgt ccttgctgct gaccgtgacc      9300
     tcagcggtga cggccagaaa aaggccgccg cagccgcaga tgcgtgtgaa ggtgttgttg      9360
     ccctgccgcc ggtcttcggt gactggaatg atgccttcac gcagtacggc ggggaagcca      9420
     cccgtaaggc catttatgat gccatccggc caccggctga aagcccgttc gacaccatga      9480
     gcgaagcgga gttttccgcc atgagtacca gcgaaaaggc catgcgtatc tatgagcatt      9540
     acggcgaggc gctcgcggtc gatgccaacg gccagcttct gtcccgctat gaaaatggtg      9600
     tctggaaggt gctgccgcca caggactttg cccgggatgt ggccgggctg tttcagcgtc      9660
     tgcgcgcgcc gttctcctcc gggaaggtgg cctccgtggt ggacaccctg aagctgatta      9720
     ttccgcagca ggaagccccc tcccgccgcc tgattggctt tcgtaacggc gtgctcgaca      9780
     cgcagaacgg cacgttccac ccgcacagtc cgtcacactg gatgcgcacc ctgtgcgatg      9840
     tggatttcac cccgccggtg gaaggggaaa cgctggaaac ccacgccccc gcgttctggc      9900
     gctggcttga ccgtgccgcc ggtggccgtg cggaaaaacg cgacgtgatt ctggccgcac      9960
     tgtttatggt gctggcaaac cgctacgact ggcagctctt tctggaggtg accggtcccg     10020
     gcggcagcgg caaaagtatc atggccgaaa tagccaccct gctggccggg gaggataacg     10080
     ccacatcggc caccattgag acgctggaat ccccgcgtga acgtgccgcg ttaactggct     10140
     tctcactgat acgcctgccg gaccaggaaa aatggagcgg cgacggagcc ggactcaagg     10200
     ccatcaccgg cggcgatgcg gtgtccgttg acccgaaata ccgggatgcg tactccacgc     10260
     acatcccggc ggtgattctg gccgtgaaca ataacccgat gcgcttcacc gaccgcagcg     10320
     gcggcgtgtc acgccggcgg gtgattattc acttcccgga acagatagcc ccgcaggagc     10380
     gcgacccgca gcttaaggac aaaatcaccc gcgagctggc ggtcatcgtg cgtcacctga     10440
     tgcagaagtt cagcgacccg atgctcgccc ggtcactgct tcagtcccag cagaactcag     10500
     acgaggcact gaacatcaaa cgggatgccg acccgacgtt tgattttatc ggctatctgg     10560
     aaaccctgcc gcagaccagc ggcatgtata tggggaacgc cagtatcatc ccgcgtaatt     10620
     accgtaaata cctctatcac gcctatctgg cctacatgga ggcaaacggc taccggaatg     10680
     tactcagtct gaaaatgttc gggctggggc tgccggtgat gctgaaggaa tacggactga     10740
     attacgagaa gcgccatacc aaacagggga tacagaccaa cctgacgctg aaagaggaaa     10800
     gctacggcga ctggctgcca aaatgtgacg accctgcaac aacctgaccc tcatgaccca     10860
     cctgaccggc atctgccggt ctttttttat cccgatatcc cccgcaggtg aacaatccac     10920
     tgttcaccct tcaccgtata ttcacccgtt atcacactga aattaaaaga gaaaaacgaa     10980
     aggtgaacag tgtgaacaat caaatcaaaa aaaacttttt tctccctgtg tgatttcagt     11040
     gcggaggatt aatcccctgc acaaatcaca tcggcagaat gccggaggtg aagaatcgaa     11100
     tgttcaccct tcacccatta ttcacccatt attcaccacc tatcatactg aaataaaagg     11160
     agaaaaaaga aaggtgaaca gtgtgaacag ttctttcgaa aaaaaaattt tttcctgagt     11220
     taacgtgcgt gaagatacgt gtaacaatta atcgatagat attatatgta taaggatgtg     11280
     tataaatgaa ttagaataga gaaatataaa cgatttgaat caaatggtta tatggcaatt     11340
     ttgactcctg tgatctccgc caaacttcct cttctgaact ctcccgacgt caacaaaagt     11400
     aagcgtacag cctgaaccgt ctggtcagaa tctgacgaat tagacaaagt ggtgtccacc     11460
     aaataagtag tgggaaccaa agtatcagat atgcagaaaa atgtgactcc cggcaggcga     11520
     aaaggctgcc ctaattatcc tcccgaattt aaacagcagc tcgttgctgc ctcctgtgaa     11580
     cccgggatat ccatctcaaa acttgctctt gaaaatggca ttaacgccaa tctgttgttc     11640
     aaatggcgac aacaatggcg cgagggaaag ctgctattac cttcttcaga gagcccccag     11700
     ctacttcctg tgactctcga tgcagctgcc gaacagccag aatcgctcgc agaggacccg     11760
     gaaaccctca gtatcagctg tgaggtaacg ttccggcacg ggacgctccg cttcaatggc     11820
     aatgtcagcg aaaagctcct gactctgctg atacaggaac tgaagcgatg atcccgttac     11880
     cttccgggac caaaatttgg ctggttgccg gtatcaccga tatgagaaat ggcttcaacg     11940
     gcctggctgc gaaagtacaa acggcgctga aagacgatcc catgtccggc catgttttca     12000
     ttttccgggg ccgcagcggc agtcaggtta aactgctgtg gtccaccggt gacggactgt     12060
     gcctcctgac caaacggctg gagcgtgggc gcttcgcctg gccgtcagcc cgtgatggca     12120
     aagtgttcct tacgcaggcg cagctggcga tgctgctgga aggtatcgac tggcgacagc     12180
     ctaagcggct gctgacctcc ctgaccatgc tgtaaatctc tttatcctgg ttgtcacaga     12240
     ataagcccgg taaaatacgg gcttatgaac gacatctctt ctgacgacat cttcctgctg     12300
     aaacagcgcc tggccgaaca ggaagcgctg atccacgccc tgcaggaaaa gctgagcaac     12360
     cgggagcgcg aaatagacca tctgcaggcg cagctggata aactccgccg gatgaacttc     12420
     ggcagtcgtt ccgaaaaagt ctcccgccgt atcgcacaaa tggaagccga tctgaaccgg     12480
     cttcagaaag agagcgatac gctgactggt agggtgtatg acccggcagt acagcgtccg     12540
     ttgcgtcaga cccgcacccg taagccgttc cctgaatcac taccccgtga cgaaaagcga     12600
     ctgttgcctg cggcgccgtg ctgcccgaac tgcggcggtt cactgagcta tctgggcgag     12660
     gataccgccg aacagctgga gttgatgcgt agcgccttcc gggttatccg gacggtacgg     12720
     gaaaaacatg cctgtactca gtgcgatgcc atcgtgcagg cacctgcacc ttcgcggccc     12780
     atcgagcggg gtatcgccgg accggggctg ctggcccgcg tgctgacctc gaagtatgca     12840
     gagcacaccc cgctgtatcg ccagtcagaa atatacggcc ggcaaggtgt ggagctgagg     12900
     cgttcactgc tgtcgggctg ggtggatgca tgctgccggc tgctgtctcc gctggaagag     12960
     gcgcttcatg gctatgtcat gactgacggc aaactccatg ccgatgatac cccggtccag     13020
     gtactgctgc cgggtaataa gaagacgaag accgggcggt tgtgggcgta tgttcgtgat     13080
     gaccgcaatg cagggtcagc gttggcacct gcagtgtggt tcgcttacag cccggacaga     13140
     aaaggcatcc atccgcagac tcatcttgcc tgcttcagcg gtgtgctgca agcggatgcg     13200
     tacgccgggt tcaacgagct gtatcgcaat ggtgggataa cggaagctgc ctgctgggct     13260
     catgcccgcc gaaagatcca cgatgtgcac gtccgcatcc cgtcagcact gacggaagaa     13320
     gccctggagc agatcggtca gttgtacgcc atagaggcgg atataagggg aatgccggca     13380
     gagcagcggc ttgctgaacg tcagcgaaaa acgaaaccgt tgttgaaatc cctggaaagc     13440
     tggttgcgtg aaaagatgaa gaccctgtcg cgacactcag agttggcgaa ggcgttcgcg     13500
     tacgcactta accagtggcc ggcactgacg tactatgcga acgatggctg ggtggaaatc     13560
     gacaacaaca tcgctgaaaa tgccctgcgg gcggtcagtc tgggtcgtaa aaacttcctg     13620
     ttcttcggct ctgatcatgg tggtgagcgg ggagcgccac tgtacagcct gatcgggacg     13680
     tgcaaactga atgacgtgga tccagaaagc taccttcgcc atgtgcttgg cgtcatagca     13740
     gactggccgg tcaaccgggt cagcgaactg cttccgtggc gcatagcact gccagctgaa     13800
     taacacatcc ccgtcaatac ggccctcgct gtacgcttac caacaaaacc ccttttaatc     13860
     ccttatatat caggctttct ttgtgtacag gggtcaaccg actcaacctg tatcaagttg     13920
     cttttgagga tactttaggg ggtattattt cctcttgaaa tattagcacc ccataatggg     13980
     aaaaaggtaa tacataacaa tggtttttaa cagtatcttt gttatacaag ggggcattga     14040
     ggatatcagg aaaaatctca aaatcggtac ggacaggaaa ctacgtgggc agcaaaaacg     14100
     tatggtaaca ccgggaaatg caacgcccac cagtcgggct aatccaccac tccaatcgtg     14160
     gttcgcagta ctgcacacac gattaccggg ctatacagga gcggtttggt ctgaaaacat     14220
     ccatgccgcg taaaggtaac cgttacgaca acacctcaat gaaaaactta tagtaaacgc     14280
     tgaagaatga aactatcgtt ttaataaccg ggatgaagcc atctaagtaa tacggaaata     14340
     cattgagatt ttctacaacc atcagcgccg ccactcccgt ctggggaata tctccctggt     14400
     agccttcagg aaaaatataa ccagataact gcgtaaaaaa agaacaaatg gtggtgtccg     14460
     ctattgccag tatacctgag tttactgcct ttcagattat cacaatcaat agcgaacaga     14520
     cttttaagct ctgtgcgctt ttaacaaaac gtccctttct ccactttcac cgtataataa     14580
     tacattattt attacccctc caataaaaac cgatattact aatcacattt attaccacac     14640
     aatttgatat cggtttttat tagttggtta ccctttcttc gattgctcat aggcagctaa     14700
     atgatctttt aatgcctgtg caaggggcgg tagtccacta ggccctgtcg gtggcggtgg     14760
     tgcctgacgg gcgggcttaa aacctaaagc ctcaggacct ttcgattttt cataggcagc     14820
     caagtgctct tttaatgcct gtgcaatggg cggtaaaggt cgggatgccc cggatgcctg     14880
     tccacttgtc ggtggcggcg gtgcctgacg ggcgggctta aaacctaaag cctcaggacc     14940
     tttcgatttt tcataggcag ccaagtgctc ttttaatgcc tgtgcaatgg gcggtaaagg     15000
     tcgggatgcc ccggatgcct gtccacttgt cggtggcggc ggtgcctgac gggcgggctt     15060
     aaaacctaaa gcctcaggac ctttcgattt ttcataggca gccaagtgct cttttaatgc     15120
     ctgtgcaatg ggcggtaaag gtcgggatgc cccggatgcc tgtccacttg tcggtggcgg     15180
     cggtgccgga cgagagggag taaatgaagt cacctggctg ctcacattaa aaatcgttct     15240
     cgcattaaca ttcgacgagc ctggagaaaa aggggaatga actttcaccg gagtaagacg     15300
     cacggcctga ggggctacag aaaatccagt tccccccgca gagctcactc gacttgcgat     15360
     acctacaagc tgccgcccta gtgtagaagc agcgttacta attccattaa gcataattta     15420
     tgcctcttta tatctaagct tggctaactc tcatatatat caaaacgaat aataaaatga     15480
     tttttaaatc aatataaatt aaaatcctcg tacccagcca ctaccattct catggaccaa     15540
     actgtacaat aactgactcg tctcatcatc catacagtcc tccaaagcct ttaccgcatc     15600
     attttttcta tttaatccaa ataagataat aaattctaaa tgtgcgatat cttttttatc     15660
     aggtataatt tgtgggaata cattcaggat agcttccgca tatttgggaa gcttatggtt     15720
     tgccgcagct acagccgccc acaccagtat cttattagca gaaatatcat taaccattaa     15780
     aattaaaaac tacggttaga aatggttgag accagatctt ttatcgtttt caacattcca     15840
     ctttctacgt taacataagc agaatattgc tgaaccgcaa actgcaactc taacattttt     15900
     tcagggtcat taaccaaatc ggtgctatta agtaactctg gcacagaatc gctcagcgtt     15960
     ttacctactt cacccatttg ttgagtaatt tcagataaat tcattaaatt tccctcagaa     16020
     gttaataaaa taaaaacttt taactattta cgttcattac gaaccaaatt ccgtcttctg     16080
     tttcttgctg cacggcaccc tttctgatga agtaattaaa caactcttcg cgcttttgac     16140
     gttctgaatc tgaaccaatc ttagatttca tcgcgctgat tttcttaata cccgaaaaat     16200
     ggtgatacaa ctcttcgagc aaatgagtca gcgataaaac agggccgtta agccctgttt     16260
     ggttacgtgc ttcaaaagag cacaaaatca gttcttgttc atccagtctg tacgctaatg     16320
     aaaaaaaagg tgtctcaatc cgccatccga taaaaaaggc actgccacaa agaaactcct     16380
     tctgtattgt gtaccctttt tgttcaagat agtaattaaa cacttcatca ttaaacgtat     16440
     cgaccatgat caattaccca gctaagcgac ccgattgccc catacgattc tggacctcaa     16500
     ggagatcgcg gacagcggac gttatatcac gcagacgagt cgtgatatca tcctgcgttc     16560
     tgcgaacgtc ttgtttatac agctccagat tcccctgctg gaagttttcc agcgacttcg     16620
     cacgttgttc attaacctca tgagtcgatt tgacggactc agatattgtt gttggcaacg     16680
     ttttcgtacc ttcagcaaga ctggtcacgg caacaaatgc tgtggtattg gtcagtttat     16740
     ctacggaatt caacaactta ttgattctgc ttgtcttctc ggcggcgtct gcaagatctt     16800
     cagcaaagtc agaggctttc gcaacatcat ctgcaacgcc agatgcacgg ctggctgctt     16860
     tcgttgttgt ggccatcgct ttctgcatcg cactggatgc ctcctctgcg acatcagcaa     16920
     cactttccgt agccttgacc agagctttat ttgcaacctc agaagccgca ccagcagcct     16980
     ttgaagatgc agagcttgct ttttcagcaa tctcaccagc ccctttagcc gcgttgttca     17040
     ttgctgcaaa agaacctaag atccccaatg ctgatgaaat aatcccgcca accaaagcag     17100
     cggttgccgc ggcttttttt tcctcaatag ctttattctg gctctcaaaa acggcctgct     17160
     gaatctgata gctttgcgcc aattgttttt gttggtaatc ctgcaataga gtcaccatct     17220
     tgccgaggag tttttgaatt tccagcatca gcttacaaat atcaacctta ccatcagtaa     17280
     gcagagatga atcaattgat aaagcagatg cggcaactgc actggaagcg ccggtcgtac     17340
     tctccgaagc ggaattaacc atcgttactt gagtattatc aatagtattc ataataaaat     17400
     tctctttaat aattaaattc ggccactaac aatacgacta tttacccgtg ctgaatcgga     17460
     catcagttga gaaacacttt gtaaatagct cgcctgattt tgtaactcgc ttgccgcttt     17520
     atccagctcg agcttcgcac tctcacctaa gctttcactc tgtcgagtta agttttgcac     17580
     cgcgaaagca gctaactgag acaacatttg gagttgcgca gcctcattat tcaacgcagt     17640
     tgtcccggca gaacgaatac cgttcgtaac gccctcagcc actgtcgaaa tttttgcaaa     17700
     aacgttttta accagcgctt ctgccgcctt ctcaacgact tttacaacgc ttgagccaat     17760
     tttgttagca acattaccaa atttagataa cagtgaagac accccgccaa cgccggctgt     17820
     cagaatgctt gcggccatag atattccgcc aaagacctgt gctgcagtct ttaatccctg     17880
     aggggcattt tcccccatta catcgactgc cgtttgcagt gccattgctg ttgcaccaat     17940
     ggcaacaaca gcccagagtg ctgggttaaa aacagcggca acggctgtta atgcgacgcc     18000
     caaccaacca aagacctggc caacaatttt acttttttgt gatttctctt cggctttctg     18060
     ttgttcttcg agctgttttt tatactcctg cgttttattc tccagcgctt tagtttgccc     18120
     atccatataa atctcgttag agtttttcag actcgagact ttctgcgcgg aagtatccag     18180
     ggataacaga gtgaccatca tcatcatttg ctgagggtca acggtattca cctgagagag     18240
     atagggatag cttgtgcgct gtggctctgc ctcctcagtg cgacttgtaa cctcaccact     18300
     aataccacca aacaatttac taaggacatc ctcagcagca gagggcgtca ctaatgagtg     18360
     acctgccggc ggcgtcggta aagggctact ttctgtccag cctgctgacg agttcatgga     18420
     tttaaccagt tgtaaatcca gcgataaacc cgtttcagat tgagtaatac cagaagtacc     18480
     cgaggcggta ttaaccccag acgttacaga cagggtatcg ttatttacgt taagcatagt     18540
     tatctccggt tatttaccaa gggatattgc tgaaatagtt ctatattgta gagattgcac     18600
     atcagaacgt gcactcgtta agagatttaa tgtattcgac atttgctgaa tttcgagctg     18660
     gctattattc actaccgttg tcaggttatt cgctttagct gaaatagccg ccttcactgt     18720
     ttgcagatca ccagcgctta aatcaccact aagatcacga ataccagtta cacttatgtc     18780
     attacgtgga tcgtttatat agtcaatcac gtcttgagga agtttggctt tcgcattctt     18840
     atcagtgcta ctctgaacat cagcaatttt ggcatccaca agattagcca tcttttgtgc     18900
     cgtggttgac gctttagatg cctcattcat atcagcaaac tttgcaatcg acagattact     18960
     ttgtgcctga tacatataag aaaacatgag aatcgcagcc tgaaaaacac cgagttcctc     19020
     aaatagctta accacctcat ccttcgacat attacctaag tcatagatcg tcgatgtcga     19080
     agaactcgca ctcacattaa caacggatgt tgcatttgat gtatccatct atatacctct     19140
     tgataatttt tctcaggaaa acaaaaaaat tattgagtaa ttaatatcaa ataatttcct     19200
     ccttatagtc gataacttta ccaatcatta ataatgcatt ctctctctgc tcactatcaa     19260
     taaagcaagc atctggtaat gatgtaaaaa agtctttcaa taaatgaaaa taataaatat     19320
     gtttatcttc gacaatcgat acccgagaag gactctccag caaccagtct tctgttagcc     19380
     agacatgttc aataatcgat aacacttcat ttaaaatgat atctttatct ttcttaatag     19440
     agatcgaaat aatatctgca tagttatcaa gtgataaaaa aatgattacc ctgcataaat     19500
     cactaataat tgaagatgtc tttactttgt cttcaaaaga agacatataa gagagatcga     19560
     acgacagcgc cctaataatg acttttaagt gcttctcacg ctcgggaaga tccttaatct     19620
     ccataaacca gtcaagtaaa gaggcgccat tttcagaatc ctcatcctta gccttttcat     19680
     aaagcttctt gatcttctgg ataccttcct gatttaactc acccacccct aaccaggaaa     19740
     gcagagccag ctcccaatca tcttcgccta ataaatctaa taataacctg gcatatttct     19800
     tttttaattc aatcttaaca aacttagatt gcaataaaga agatattagc gcaacaattt     19860
     ccccctttgg catgttgcca aacatcgcca aagtaggatc gtgttgttcc agcagcccgc     19920
     tgttttttaa tgatagttct tttattttat cactatcggt aagagtaagc agctcttgca     19980
     tatcattgag cagcttctcg attgtcgagc cttcctcttc tttccttgcg ctacctttgc     20040
     gatatcccag gcttagccct tcaatcgttt cagaaagcga tgaactagta atcattgcta     20100
     attcattttg caaatttatt aatggcgaag aaatattaga agaatttttt tgcgttaatt     20160
     gctgagattc taattcaaaa tctaatgaat tagaattaaa aacagatgcg gggttttgat     20220
     taaattcaat accattagcc attggaaact cacgtaatca ttaattatga atattccatt     20280
     aaatagtact gtacaacagc ttcctttcta ctctattctt agacgatgta agttcaccat     20340
     attttttctc attgttcaac caccaggatg aataaaattt aaaaatgtta tcctcatata     20400
     aaataaaact tctcaatggt gcgatgcgta atcgggaatt acaacttccg atgggaaacc     20460
     taacgctagg tacggaagat aacgatattg tttactttcc ccttgaacaa ggcctcaatc     20520
     agtttttact tgatatacgt gaggaaggtg ttttcctttt atctccggtt gaattttgga     20580
     ttgatgggca acccacgccc tatgaagcag ataaaccatt acctgtcgga aaggttattg     20640
     atatagcggg atgttgcttc atcattggtg atattgacca ttccttgcca ttgtctgatg     20700
     tgccagaaag gttctctgcc aaaagtcgac gcaaaaaacg ccttatcctg gcgagcgtga     20760
     ttggtgctac ttttgcgttg tctggtgcca tcggcagtta cgttttgctt tccccaaaag     20820
     ctgaaccccc aacgtttacc agagctgatg tatatcagca gctaaaagaa aacaaacttc     20880
     atgcaatcac tctggtatgg catgggaaaa atatcgcgct ttatgggcgt tgcgaatcaa     20940
     ccacggattt aactccattt tttaattacc taaaagaaaa aaatattttt tattacaata     21000
     atatcatttg caataaccaa atcatatccg caattaatga tgtcttaacg gaatacggtt     21060
     acaaagatat cattattaca aaaggtaata agcctggatt ctttctgtta tcgggataca     21120
     ttcccccttc acccaaatgg agcgaggttg aaaatctgtt actgaatacg ccaggagttg     21180
     caggatggga aatacacaac aacagtaaca ataaaatcaa tgaactggca tcagagttta     21240
     aaaagaataa actaataaac tatgtcaata ttttcaaaaa gaatgatgtc atcattgttg     21300
     cgggggaagt ttctcaacag aatgagagta agatccttgc cattataaat gcaatgaaca     21360
     aaaatagtaa cgccaagata ctctttcaga acattcagcc gtacatttca gcagatattt     21420
     tccccggaaa aatactcaga atcagcggta cgatgaagaa tccaacaatt gctcttgata     21480
     atggcaccag cctggggatt ggtagcattc tgaaaggagg ctatgtcata gacgcgattg     21540
     atcctaaaga tggtatcaac atctcccgcc cagacgaata tatacatatt ccactgtcgt     21600
     attaatttct tatcctcttc cccctcttcg gagggttttt tattgtgtgg atgttgtgag     21660
     catagttgtt gcttgatgtg attcagcttt ggtatcagcg tgnttggatc aacctacatg     21720
     agaaaacgtg aatgtgtctc tttgaaagag acctattaag cagataaaaa gaccagtagt     21780
     agatttgatt ataagaggtt atttcttaag aagaaataat tatgccccga ctaaaacaat     21840
     acatatttta gccggggtgg ttatggaatt attctacaca aaccgcatag acatttggag     21900
     tattaacatt aaccccagga agagggtttt gtgttattag gttataagtg cttgatactc     21960
     cagaacgctg ctcactagat gtctgtttaa tccaagcagt tattgagttc atagaactat     22020
     aatggctata tttatttgca gccccccatg agtcataaat atctgacaat accgtctgtg     22080
     tggatggtaa taaatttttg caaatggaca tagcatcagc ataataggct tgcttatcca     22140
     cttttatcat atacgacggt gcttttatag tgtaacttac tgtttgctta tcaccagatg     22200
     tggctttaat tacgacactg cctttaccat tcaaagtgac tttccctgat gcatcgacag     22260
     tcgcgatact ggtattttct gaataccatg aatatgtacc atcaccaccg cttgctttca     22320
     gtttaaactg accatattgc agccaaatat taggcaactc gcctctgaca ttgttaccaa     22380
     taatatcaac cttgttgtca attttcagtt catcaaaaaa agtgacctca gtcgctttaa     22440
     cctcagcccc atcactgact gtcgcactaa cagtcgcttt accggcggaa ctggaagtta     22500
     gtgttatcgt cgcacgacca tcatttcccg tggttgcttg cgtttgagac ttaccgttga     22560
     acatcccaaa gtttgttgag aatgtaacgg attgattatt aactggctga ccgtttttca     22620
     taacttttac agtatattta atagcatcct taccatttgc tactgcagtt gtcttatcag     22680
     ccttaatctc agtaatgctg gccttggttt gatcaaaaaa tataaccgca ctggcattaa     22740
     gtgctgaagt catctccgcg gttttagcag acacgacgac ctgtcctggc gtactcgact     22800
     tcaacgttac ggttgcctta ccgttagcat ccgttttggc actatttgcc ccaagagttg     22860
     cagttcctga aacaatatta aatgaaacag ggacattagc ctgagctacc ccattctttt     22920
     tcaccgtcgc ggtataagta atggtatcgg cgttatccgc tttagccgaa gtcttatccg     22980
     ccgtaaagtc cgttacccca acctggtcga caacttgacc attcgacaga acggtaatag     23040
     taagctgtac attgttagag ctattgccat tacggtcata ggcgcgagcc gtcactttat     23100
     aaatattgct gccaccttgc acataagcag gcaaaatagc ctggtagtct tgtgcgcttt     23160
     ggcttccgct atgctgaatc tgaccgccct gactgcgtaa tgcactatca tcccagacga     23220
     tacgatccag accgtatttg ctcttaacga tcaactgaat cttctgcgta ctgtgttcag     23280
     taccattaat atcatgcgga atattcagag aaagaatatc ctgcttcttg tactccagaa     23340
     taatattgtt attacgctga accagatcgt aacggctgcc tgataatgtt cttaactcgt     23400
     taacatactg tggttcaatt tgctgagacc acgatttatc aaactgataa cggaactgca     23460
     ttgagtaaag gagatcattt tcattacccg taccatgacg gtaatcgatc cccatcgtca     23520
     ccagaggaat cggagtatag tttacaccaa cggtcgccgc accaggattc gactgcagct     23580
     tatcagaatt aaacaaagca acattatcac cataatactg ctcatatatc agcttggcgc     23640
     ctaatgccgg atatgacggt agatagccat taaaacggat atcgaagcca tttgctgggc     23700
     gctcatcata gtctttctta ttgtatgact catgccagcc gctcatgcgg aaatagccgt     23760
     taacgctact tttgaaatag tctcgccagt attcgccacc aatacctaaa cgggtattat     23820
     caccagaaaa atcctgatca atgaagacgt tatagcccaa catgtttgca ggaaggaaaa     23880
     aacgctgacc cgcacctaaa tttgccgtaa agcgggagtc aatgtaacgc gctccgacct     23940
     gaccaaatgc cagcattttt tcggaatcat agaacggtaa taagaagtcc agtgaactac     24000
     cgtcaaagtt attaccactc tgcagattaa cctctgccgt tccataatgt tgtaaccagg     24060
     cctgcaactg tgacgaagcc tggttaccag cgataccaag agcggtatct ttcgcgtaat     24120
     cgccgttcag agatcgcgac tgaagctggc taccgagact cgccgcctgt tgtgccgcat     24180
     aatttaatgc cttgtcatcg gtcatgttgc ttttggtcac gtccggggac attttagtca     24240
     gtttattcgt gtgaccagca acaccacctg cagcaacaag aggtgccgaa cctaaaagtg     24300
     gtagtgcact gtattcaaag ggaagttttt tgagtggcaa aatgatctgc tgaccaggcg     24360
     cggccttcat catttcgctt tcagaactgt ataaatgctt attcaacgac caaatcgtcg     24420
     ataaattaat atcttgcgat ttagaaagat cggcaacagt ttcaccagtt ttcaacgtat     24480
     aaaaaaggcg attctgatag ctatcatgag ttaacagttt tgaatccgaa cccaatttaa     24540
     aataattttc accatttgca aatgaattct gattaacata aaaaaacaat cctaaaccag     24600
     cactaagcat aatcaatgtt ttttttagct tatgcttgtg ccgggtccgg gtataacaac     24660
     catgagtaat catgttatgg ctccaccaca atgagttaga atgagaaata aattatatta     24720
     atagatcgga ttttatcttc cggcgtaata atgtttattg tcgcttgaac tgatttcctc     24780
     tattttcata tgttcgtttt ctaatgttat tccctgatta tgtaatacca aatacaggtt     24840
     ttccattgac ttaacaacga cttctatttc attctcgagt ttttcagggg tagcatcatc     24900
     gagagggaaa cgtaacgcta acaacagcga ttgtgctcca gcctcatagc acagatatgg     24960
     cccaccattc tctgcaaacc ataagtttgc attcaaaatc tcaagagcga agttagagtt     25020
     atctgtcggg aatttcccac agacaccata aatcatcata tattcgtcat tggcatcaga     25080
     taacgaaata taataaattt catcaatagc aaaagaacac aatctgtttt cattaaatga     25140
     aatagatcca ataccaattt tttctgcaaa tttttctaat aaaagttcag atcttgatga     25200
     cattgtattt tctcttaatt aaatttatat ttacagaagc tcaagagttg cccatcctgc     25260
     agcaatgtta ttccctgaaa aattgacgtt agttagactt cccccctccc tccctctaaa     25320
     taaaatgatt atggatatat ttagacgaaa cgatgggatc ccggcgctgg tgggttattc     25380
     gaagtattca cagcgctatt actccccccc gttaatcctc ccatgtcatg gcgtaatcca     25440
     ccacttagcg ccagacgcgc ataagtgctt tgaatccccg cacttggatt tcctaataac     25500
     cgtgcgccgt tatcagtagt atcccgggga ggatgttgaa tggtgctata tacaacagaa     25560
     tctgtattcc ccatattctg aacagacgta ttagaattag aagtcggcac ctgcgaatca     25620
     tgcagcgatg ttttaacatc agcatacgga ttctgcacgg tccctatgct ggaagtgtca     25680
     aagaaagtcg acgaggtgct agccatcgag ctacgtctgc tctccatggt atcttctgac     25740
     ccaggggtat ctacattgcc ctgtgcaggt gtattatttg caggcttatt ctctaccgta     25800
     cgtgcgcttg tagttgtagt tgtagtagtt gttgttgttg tttgttctac cggctgattt     25860
     tttcgatgaa gcgcagcggt gacggcaaca ccaattcccc caccaagaat caatgcgcca     25920
     ctaagaccgt agccagcccc cgatgaaact ttcagctcct cctggcgttt agcttgttgt     25980
     tcatcatatt ttttttgcgc ctgagcatta ttttcaatgg cttgctgttt ggcctcttcg     26040
     cctgctgctt tagcctgctc ttctatattc gcaacaacat catctttcaa tacccctgac     26100
     ggaatcgcat ttccgagctc atcgatatta actttttgat tatctgggtt ctggaacgct     26160
     tctttcgtta actgatctct tgtcgcagtt tcagttgcac ttgcagctgc atcagggtcg     26220
     gtcgtggttg ggctatccgg ctccggcgtc aatgcaagcg cctgtacaat acccgtcgcc     26280
     gccaacccta tcagacctgt agcaacagtc cccaacgcca accaaagttt aggatctgaa     26340
     cgaaggctgg aagttgaggt tgaggtctga gtttctgtgg tgttttccgc accgctattt     26400
     gactccctca actccccaac gccttttgac tccccaacgc cttttgactc cccagcacct     26460
     ttggactccc cggtcccttt gggctctaac agctccagta tcctttggcg ggcttccgtg     26520
     atatctgaag caacggtgac catagcatgc ccagcaccac cacggcctcc agtaaataca     26580
     aatttgtctt taccttcagg atcaatggac tgcaagcgag cgtactcttg atcacttaaa     26640
     acaacagagg tctcaacacc attcctctga ccgacagcaa tatgtttacc atcttcctga     26700
     gtttcaactc gaaataccga agagccaatc tgcctgttaa gagtatcgag cggaccatga     26760
     tcatgaagaa cttcaaatcc ttcattcagt gttatctcag acgccgccag gcgcatcgga     26820
     tttacaggaa gtccaggaac atcactggca cgattgtcgc cagaatcagc catagaattc     26880
     cttacaggcg taaatagcgc acgagatccc aacggccccg tagagttaat gagctgacca     26940
     cgcccccctg caccgtcggt ttgtgaaggt aatggaggtg caggaggaat tgaattattc     27000
     acattgggat tatgaccaag attaccaata ggcataaata tctccttttt attttatgta     27060
     aatagataac aatcctttat tttgctatta cataataatg tatggtatac agcacgtatc     27120
     gataaacggc tgaacatgac atcgaccaaa taaatcacaa tctgattttt gatgcaagaa     27180
     aataatgtgc taaaaacaca catcgggtaa caaaataaaa ataattatat tatataaaag     27240
     taaacaccac ggtgaaatct taataaaaca tttcataaat aaaattgcag caaacattca     27300
     tttatattaa aaaacacagc caaagaaaac caattaagca aactataaat cttaattaat     27360
     aataaagttt attaagtttc tttatcgcgt tttttcttac atcaacaaag gccatgctat     27420
     acaccaggaa gcttaattta tacctgacaa ggttatccct acaatcgggt atcctgtaca     27480
     tgctctaaaa tcgcattctg agtaatcgct tttatctcac tgactttgaa gccgctaaag     27540
     ttgcgttcaa atatttcttg tgagacttgt tctatcatct tcgtctgggt gttaaaacgt     27600
     gttattggat ccactctttt gccgcactgc tcatcaactt tctgattaaa gtatttattg     27660
     gactgcaaga agtgaccaat tgatgattgt gccccgttca tatcaagagg ttgctgtaac     27720
     gcattttcaa cagctctaaa aatgtgacct ttagtctcct tactaatgac cgaattatta     27780
     ctcctgcaat agtcatccag agttctattt actgttctgg atatataagt cgtctgctcc     27840
     tgctggaacc attgttgggt atcgccatta cgagtttgtt tggctacagc ctgcaggagt     27900
     tggttagtca gtttgccatg attaatcaca aagttcgact gcacgggcat gaacctcata     27960
     cccgtggctc ccgtacccgc ttgcattgca gctctggtaa ccgcaggttt aagcgtctgt     28020
     gcagtcgcct gaactaacga tctgcctgcc attgtcattg gactaaacat accataaacc     28080
     tttataaatt atatttcgac agtaaaaaaa ttgcttccca ttaaaaaata actttaaaga     28140
     ataattatct tgtatttata tttgaattat cctccggcct tatctacagg tagttgcact     28200
     acatttatca tatgctatca tgaatatgca acactattcc cgtaatctta tatctacgcc     28260
     ttattatttg tatcagaact ctcggattaa ttacgtttga gtatatcaac atgaaaagaa     28320
     tggcaggact acaatatgaa tgagaaattt cgcacagacc ttgcacatac gtttgggata     28380
     gctcttgaag agcaaactga cgtgctctct ttccacgata acgatggcca tgaatggata     28440
     ctggagtgtg catctcaatc tgaaattctg tttttttatt gttatttatt gaatagcgaa     28500
     tcaatacaga ttaattcaat acttgaaatg aatagcaatc gagaactgct cggtatgttt     28560
     ttcctgtcat taaaagatga caacattctt ttaaatattg catttcctgc agataaaatt     28620
     gatattacag agtttgctaa tttaatggaa aatggttatc tattaaagaa tgagataatt     28680
     agatccttgt cttccagacc tacagatttt ttaccttgat aatttctgcg ctggatggga     28740
     tcatccattc cgtttaacat actcttcatc acagggacct ctgatttctg gccgctaacg     28800
     tctctgaaga ttcagcctat attatctaaa agcaatgtaa tatcagttaa aaagcggaaa     28860
     aactccagaa ttataactat tctggagtta agtcaggaag aaaactcaaa tgctaatcat     28920
     aatacgctat aagaggaagc tcttgttgct atagccctat tatcaagacg ttcggtagac     28980
     tgtacacgac gtaacaaaga agataatcct ctttcagcta agatcccctc caggggagta     29040
     cgaggaaacc aggttgaaga aagtggagtt atatgtctct catttaattt tctttccaaa     29100
     gccttagtca caccgccaga aaacacgcta aatagcgttg agaaacatcc attttccggt     29160
     gttattcttt gtactttgta cacataatca tcttttgggc catctttaat aaagtgaaca     29220
     gcatagtctt tgcctctaaa agagacaatg gtggaatccc ctatttctgg atatacccga     29280
     tgatggcgtt gttgcattcg ggctttaagc tgaatttcat ctacgatatc ttcattgggt     29340
     atatgaagcc ttctgttgaa cctgttccat gacgcatgtt cacttgtcag aaatgtcttg     29400
     aataccgctc ctgataacga catgatacat ctccctatat aacgtattcc tgattaatca     29460
     catactatgc taacagtaaa ataaaaatct tcgttgattt ttacaatact cccgtatgct     29520
     atcgtcgtat tattgcgtat taactgacaa ccaccaaaaa gatggtatcc atctgaatta     29580
     ataatgtcat cttttttaac attacgcaac atgtgtatat caatatggac tgtaccgatc     29640
     gcacaataaa tgcgattcat gacagtctca ttgctaagag cagataacag atccgcagcc     29700
     agaacatccg tgacagataa attattatca ctcagattta ctgttgctaa aggggtatta     29760
     ataacaatcc agcaccttct ctcttgacta tcatcaacat gatagagtct cagactatca     29820
     ccaactctca actctgtaac tggataatca gtccacccag gtacgatata gccatcaaaa     29880
     aaaagagcat tagaatgtgg aactaattgc caattatcat taatcagata ttgtaaactt     29940
     tgtaccgttg tttcgagtat aattacatta agtctgtttt ctccattatt attttctatt     30000
     accggataaa tatctttatt tagcatcgta aattgaacat catcaactga cacatcacct     30060
     tccggtaagg cagtctgcat tacccataag atcatgagtt ttatcgtatc ttccggtatc     30120
     agccggcttt cgctatacgg gaataactct tggcaccact gaatgaactg ttcttctgat     30180
     atccagaaac gcccctcata gcccgagtat gtcaacgtga aacgaatacc atgaccgctg     30240
     acctcacgaa aatatgcatg gcaagcatga cctttggacg taatatagag gcgaccggtt     30300
     ccgataactg gcaacaacgg caaataaaaa tcgttaattt tcatattcaa ttgtgaactc     30360
     aatggcttca tcaggaaaga tttcttttaa cttatcgaaa acatagtctt ttttatgata     30420
     taaaaaaaca tgatttctat tatttgggct tactttaata gacagataaa tgattccgtt     30480
     actacattta attgttaaaa caattcctcg taatcttcca caaagaatac taaacgagtg     30540
     ctccccttct tcaaagtagc gtcgtcttcg gcccgaggag taaaacaatc tcttccataa     30600
     agaagccatt cgtatgaaca acgtatcagg cgatcttttt tttatatgat aaaaaatatc     30660
     attaaaactt tcttctcctt gcggccaatc atctgatggc cgaaaagaaa caggctctat     30720
     caaatttctt tttagagaaa ctctagtcaa agtaatgttc ctttatggca aaagataatt     30780
     tttctactga tttattaaca tgttgcagat tctcttttgt tcgtttttgt gaatctagca     30840
     atgaacgctt ttccttcgaa agtgaagatt ttttctcata caatcgctgc ttttgctcat     30900
     caaatgcatt gtttttaatc tgatatttat acaacgacac tttatccaaa ttcaccagcg     30960
     atgcacaata tgcctgctta gaggcaatcg actctttaat ggattgctcg cagtcatcga     31020
     gtttaccatc cacctctttt atctgagagt taatcttagc cattgattct ctcaatcggt     31080
     tcgctctgct tttacgaata gataaaattc tgtccaacat actcaggcaa ccactttgaa     31140
     taggctttca atcgtttttt cgtaactact gatatctttg gtgctttgtt gtataaagtt     31200
     ctgaattaat ttcctatttt ttattgcctt atctgcttca ggatcttgcc ccatcgtgta     31260
     ctcaccaata cgaataagca gctcaacatt tttataagtt gcaataagct ttttgcattc     31320
     tgccgccgca cgcaaatgct ccgatgtaac aacgttatgc ataacacgac tggcacttaa     31380
     accaatatca attgcaggga aatggttttc ctctgcaagt tctcgggtaa gtacgatgtg     31440
     cccatcaaga atagagcgga cttcatcgcc aataggatca ttaacattat cgctttctaa     31500
     caacaccgta taaatcgcgg ttattgaacc ttttggcgca ggccccgctc gctctaataa     31560
     tttgggtaac gaagaaaaaa cactcggagg gaatcccccc cttacatcag gttctcccga     31620
     tgcaagccca acatcacgtg cggctcgggc ataacgagtt acagaatcca tcattaataa     31680
     tacattttta ccttgatcgc ggaagtactc tgcaatagtc gtcgccgtaa atgcggcttt     31740
     catcctttcc agcgcggggc ggtctgacgt tgtgacgacc agtacacatt tagaaagcgt     31800
     ggattgaggt aagagcgcga ggaattcatt tacttcgcga ccacgttcgc cgataagagc     31860
     aaggacaata atatctgcgg atgcgccatt acaaatcatc cccaaaagcg tacttttacc     31920
     aacgcctgaa ccagcaaaaa taccgatacg ctgcccaata ccgcaagtta gtagcccatc     31980
     aattgccctg acgccaagta taaatggctg atcaataacc tgccttaata aaggatctgg     32040
     tggttcagca tacaagctgc gttcaaacgg aagatagggg gcagcaatat tactctccat     32100
     tggtctgcct atgccatcaa caagccgccc aagtagtgcg tctccaacac gaatcttgaa     32160
     ctcatctccc tgataactta accactgacc acagtacatg ccggaaacat gctcaaaagg     32220
     caacaagaaa acctcatctt catcaatagc gatcacctcg gctaaacgtt gactgggttc     32280
     tatcttataa aaggcgccaa tacgcgcttt tggtaaacgc gccttaataa tcgtcccgcc     32340
     gatattgata atcttgcctt catatctggt agacgaattt aatgataatg ccggcacagt     32400
     gctattgagc actttctgaa tacgtgggta tttttccaat acagaatcat gctctgaaat     32460
     catttaccgt tcctaatact ttaagttcga tattattccc aacctcctga aaagagagca     32520
     cggggactga cgggaacgaa ccttcaatca ttttcttcac atagcgcctg atatctaaag     32580
     cggtcagaat gacgccgttc cccgttggat tcatgatatt ttttaagaag ccaattatct     32640
     gctcagttcg ctccggtgag atattcagat acgaacctga tgacgtttgt ctgatcgact     32700
     ctcgtagctc attttcaata tcagagccaa taagccaaac gttcagaagt gtaccgctaa     32760
     cgctatagcg acctaaaata tgccgacgca gggcaatacg aacgtattcg cacaagataa     32820
     ccacatcctt ttcttttgtt gaccaaaaaa taagcgtctc aaagatagtt ctcaggtctc     32880
     taattgagac attttcctct acgagacgtt gtaggatgtc aacaattttg ctcaaaccaa     32940
     gctggcgctg cagctctttc acaagctcgt tatattttct ctccatgatg tccatcaaat     33000
     aacgcgtttc ttgtacgccg atgaactctt tggcattaga caatacaagt ttctttagca     33060
     aaaacgttat cttatcattt gttgttgcat aaacatccat acctgtaagg tgagcgagct     33120
     gttgattagt cttattcgtc ttatatacga tagagttagt cgaaagcttt tcctggacaa     33180
     attcgaatga tatctctgca tgcccagcct caaaatagac agtatcatct ataagagtat     33240
     ctttgtatat tgactcttga tagagcaaaa attctattgc gctatcatta tttttaaccg     33300
     gattaacaat aatcttaggc aatggaattc cactttcctc aaagaaattc caacgcatga     33360
     cctcaatttg ctgtgtaatg tctgaactat aaatattact acttaagttt aaaatcaatg     33420
     gctcagcgcc cggtgagatg ttttggctat tagacaaatc agctcccata gcatccttat     33480
     tattgccagt tccaaatgtt cttttcttct gtaatttcca ggctatcccc aacaggcaaa     33540
     ccgccagaaa taagaagacc aatgcaggaa agcccggaat aatcgccatt acgagcatta     33600
     gtgcggcact gattaaaaaa gggcgactat taacagaaac ctgttgaaca atatcacctg     33660
     caaggttttc ttctttttcg ctttcaccgg gcacacgagt aacaaccacg cctgcggtga     33720
     cagaaataat aagcgcaggg atctgggcaa ccaaagcatc accgacagac aatacagaaa     33780
     acaggctaag tgccgcacta aatggcatgt caaattgcca cataccaatg agcacgccac     33840
     caaaaaggtt aactaaaaca ataatgatac cagcaatagc gtcccctttt acaaacttca     33900
     tcgccccgtc cattgaacca taaaactggc tttccttttg cactcgggag cgaagaactt     33960
     ttgcctcaag cgggtcaata acgcctgcgc gcatatcacc atcaatactc atttgctttc     34020
     ctggcatacc atcaagggaa aaacgagcac tcacttcagc aacacgctcg gccccttttg     34080
     taataaccat aaattgaaca atggtgataa tagtaaaaat aaccaggcca acaacaatat     34140
     taccgccaac aacaaagtta ccgaaggagt aaataatgtc acccgcatcg tgatgcagca     34200
     gaataagtct ggttgtacta acactgagcg acaggcgcat caacgtcgta atcaacagga     34260
     ttgtggggaa agaagttagt tcaagaggat tttttatata gattgagagc attaataaaa     34320
     gtaaagctgt cgaaatatta atcgcgataa tgatatccac cacaactgtt ggtagtggaa     34380
     taatcatcat cattacagcc ataaagaaga agagagccag aataagatcg tgatatgact     34440
     ctgctttttt aaatatattt aagagtttat tcatgatgtc atcctgcgaa cgcgctcaat     34500
     aatctgcaca tgctgttgaa aagtattcat tagaaaaaaa acatcgatat tggttaacaa     34560
     acaacttaag cacaatttat tatcgtagac aaaaatatgt tcaatcactc cctgcgtacg     34620
     ctcaggagca agggcactaa agaaagagaa aaatgcgttt tcgttatact ctaaagcaaa     34680
     cgtaacaaaa acattattat caattatttc aataaaaaaa gaaaacccat taaaatcaat     34740
     ttcaacacgg ttatcaaata aataaaaatc atttcccaat aatcttaaaa actcttcaac     34800
     gtttctttta actaaaagat tcatctgcag gctctgaagt aagtatacgt gtgaatatta     34860
     ttgcttgaaa aagcgtattg gataatatat acagtatatg tactttatgt acattgcaac     34920
     tatttaaata atataatagt tgcctatggg ataatttggt tatttataac caggtaaatg     34980
     tctaaattag acaaaaggag aaagatcaat ggaagcagca aatttaagtc cttctggtgc     35040
     agtaatgccg ctggcgacct cactcagtgg aaataactca gtggatgaga agacaggagt     35100
     gattaaacca gaaaatggaa caaatcgcac cgttagagtt atagccggat tagcacttac     35160
     cactacggct ctggcagctc taggtacagg tattgcagcg gcatgctcgg agacgagcag     35220
     cacagaatac ttagccctgg gtattacttc tggcgtacta ggtactctta ctgcggttgg     35280
     cggtgcatta gcgatgaaat atgcctaacc ggcccatcgc ataaataaaa gatagaggta     35340
     atggatgtat tatgcccttg cctctttcat aaaaagaggc taacagtaaa tatgaacaac     35400
     attaatcaat cggaaaacat taatattcaa ttaaataaag cgccccaaac aaatttcgtt     35460
     gatgagcata cctcgttagc ctcagccccc tctgcggcag gtgcggctca gtttcttgat     35520
     caattactcc ctaaaacagc gggagtgtct tctccagaac aagtgttgat tgaagaaatt     35580
     aaaaagagac atcttgcaac aatgaacagc gatctcagtt tcgatgctct atctgcaggt     35640
     gggctctcgc cagaagacgt gctcacctta caaaagaatg tgctcaacgc aaacgtcaac     35700
     gttgatgtcg tatctaagtt agcaagcctc ctttcaacat cggttacaaa attagtttcg     35760
     atgcaataaa aatgaaaaaa cacattaaaa accttttttt attggctgct atttgtttga     35820
     cagtggcatg taaagagcaa ttgtatacag gattaacaga aaaagaagct aatcagatgc     35880
     aagcactgtt gctatccaat gatgtcaatg tttccaaaga aatggacaaa agtggaaata     35940
     tgacactcag tgtggaaaaa gaggattttg ttcgcgcaat aacgatttta aataataacg     36000
     gcttcccgaa aaagaaattt gcagatatcg aggttatttt cccacctagc cagttagtgg     36060
     catcgccatc acaagaaaat gcaaaaatca actatctcaa agaacaagac atcgaaaggt     36120
     tgctaagtaa aatacctggt gttatcgatt gcagcgtttc attaaatgtt aacaataacg     36180
     aaagtcaacc ctcctcagca gccgttttag tcatcagctc gccagaggtt aacttagcac     36240
     catcggtcat tcagataaaa aacctagtta agaatagtgt tgacgatctc aaattagaaa     36300
     atattagtgt tgttatcaag tcatcctcag gacaggacgg gtaatatgta tgaacaataa     36360
     taatggcata gcaaagaatg attgtgactg gctaacggcc cttgattttg taaaggatgt     36420
     caacggttca ccaacgcatc tcacttttta tatctaccaa aaaaatgctt tcttgcacga     36480
     ttttggaaac tactgggttc tatatattga gcttagtggt gattttcgtc aggttccaac     36540
     agatacattt atcagactct gcaatatcct ggccgttagt aacgaatata aacaaatggg     36600
     tattttcctg tctaataaga agtggtatct ttgccaaatt tttcataaag ataataatca     36660
     tcgcgcaaac atgtcaaaag caataatgca acatactctc gcctctttgc tcgataagca     36720
     atttgataaa ctagagcaat tatcttcatc ggatacaatg atgccgccaa cacacttgtt     36780
     ttctgatata ggacgaattg tgtaatgaaa aaaataagtt tttttatttt tacagcacta     36840
     ttttgctgca gtgcacaagc tgccccgtcc tctctggaaa aaagattagg caagagcgaa     36900
     tattttatta ttactaaaag ttctccagta cgtgcaatcc ttaatgactt tgctgctaac     36960
     tacagcattc ctgttttcat cagtagttcc gtgaatgatg atttctctgg cgaaataaaa     37020
     aatgaaaaac ctgtaaaagt actggaaaaa ctgtccaaac tatatcatct cacatggtat     37080
     tatgatgaga acatcttgta tatttataaa acaaatgaaa tatcaagaag tataattaca     37140
     ccaacatatc tggatattga ctcactgcta aaatatctga gtgatacaat ctcagtaaac     37200
     aaaaactctt gcaatgtgag aaaaattacg acatttaact cgattgaagt tcggggtgtt     37260
     cctgaatgta taaaatatat tacatcttta tcagaaagtc ttgataaaga ggcacagtct     37320
     aaagccaaaa ataaagatgt tgttaaggtc tttaaactga actatgcgtc agcgacagat     37380
     ataacataca aataccgtga ccaaaatgtt gtcgtcccag gtgttgtctc cattctgaag     37440
     acaatggcaa gtaatggttc acttcccagt accggtaaag gtgccgtcga gcgaagcggt     37500
     aacctgtttg ataacagtgt aacgatttcc gctgatccac gtcttaatgc agttgttgta     37560
     aaagaccgcg aaataacgat ggatatctat cagcaattaa tttctgagct tgatattgaa     37620
     caaaggcaaa ttgaaatttc tgtctcaatt attgatgttg atgcaaacga tcttcagcag     37680
     ctcggcgtaa actggtccgg tacgttaaat gcaggacaag gtacgattgc ctttaatagc     37740
     tctaccgcac aggctaatat cagctcttct gtgataagta atgccagtaa ttttatgatt     37800
     agggtgaatg cgttacaaca gaactcgaaa gctaaaatac tctctcagcc ttcaattata     37860
     accttaaata atatgcaggc gattcttgat aaaaacgtaa cgttttatac aaaagtctcc     37920
     ggagaaaagg tggcgtctct ggaaagtatt acaagcggaa cattgctgag agtgacacca     37980
     cgtatacttg atgacagctc gaatagcctt accggaaaac gtcgggaacg agttcgtttg     38040
     ttacttgata ttcaggatgg caatcaatcg actaaccaaa gcaatgctca ggatgccagc     38100
     agcaccttac ctgaagtaca aaattcagaa atgacaacag aagcgacatt aagtgcagga     38160
     gaaagtttat tacttggcgg atttatccaa gataaagaaa gttcaagtaa agatggtata     38220
     ccgctgttaa gcgacattcc tgttattggt agtttattct ccagtacggt aaaacaaaaa     38280
     catagtgttg ttcgactctt tttaattaaa gcaaccccga taaaatctgc atctagcgaa     38340
     taataaatga ggctttatga gcaggaaatt tagctctcta gaggatattt atgatttcta     38400
     ccaggatggt ggcacattag cgtcattaac aaatctgaca caacaagatc tcaatgacct     38460
     tcattcttat gcctatacag catatcaatc tggtgatgtt ataaccgcaa gaaatctatt     38520
     ccatttgctc acatatctgg aacactggaa ttatgactac accttatctc tgggcttatg     38580
     tcatcagcgt ttatcaaatc atgaagatgc acaactgtgt ttcgcacgct gtgcaacttt     38640
     agttatgcaa gatcccaggg catcttatta ttctggaatt agctacttac tcgtcggaaa     38700
     taagaaaatg gccaagaaag cctttaaggc ttgtttaatg tggtgtaatg aaaaagaaaa     38760
     atacactaca tataaagaaa atattaaaaa attgttaggt aatacagagt aaaaactacc     38820
     atcagctata ccaatcccca ggctgactgg ggattttcta tcggaaataa taaagctgct     38880
     atagtgaagt gctcccaaag ttgagcaccg accactggta gatttatcta caggtgtggg     38940
     gttattccat taaccaggag tttatgccct gaactatctt ctgctgtatt taatatcatt     39000
     tccgtttatg aaacaatcag tatatcttaa cttagcatta gaaatctgat ctttccaatc     39060
     atctatagct cagagtatat ttgtcaggaa atgaccttca aactttagcc gagaaaaagg     39120
     cttaccctgg aaaacaaaac ccttaaatat agctttattt ttattcttct ataaaatata     39180
     ctcaaaaaat tacgtctaac tctccttttt ccgcctcatg atcatttcgt tccagatatt     39240
     agactgtccc acaataccat taccaactcg gtaggttttt ctttttggtc cggttgttcc     39300
     aggactttct atcggaaccg cctcaaggtt aacatcataa atgaaaatct caaggcgctt     39360
     ataatgcaaa ttaccataac taacatatct gacacgaaat gaaatttttt cttttcttct     39420
     cgatatataa gttataataa atgatgctct cctcaggttt ataccgaatg cttcggcaat     39480
     atcattgcga gaaatccatt tctcctgcaa tttacaccaa agagaaacca agatatacag     39540
     aggttcacca tcgtaattct ttactgagtc aggaattaca tagtcgccat ttttattttt     39600
     agattccatt ttccatattc tttttatttg ataaataaat cgacataaaa aacatacata     39660
     aaattatttt aaataaactt gtggcattcc tgtgttttta ataactaatg gttctataaa     39720
     tttggcataa acatcaacaa acaatttttc atttcctctt acatggcaat gtaatgtgag     39780
     attattatca ttactcagta cttttttagg gataactaat tgataatctt gttcaatgtt     39840
     tagcaccgag ggaatttcgt aattatatcg atggacatga agtatgatgt cctcatcttc     39900
     agagaggacc ccctgataca cagaagcaat atcgccgcca gtgatcatat ttccattttt     39960
     aatcagtata ccttccccac aggagtcttc attgctaata aatataatgc tatagatgcc     40020
     atccttcata atcataactc actcagtttc atactaacct cactcctttc aatttgttct     40080
     atccataagc aatatcaaga ataatggaga cctttctttt tctccagatt gcaatgtaat     40140
     atatcattaa atatactcat gtttcaacct gctgtttccc tggttaacat atgtaatttc     40200
     tgattaataa tattgagtaa caacgtaaaa atgaaaaaaa taatactgag catcattctc     40260
     atttcaaatt actgttatgc ttccgattgt tttgaaatta caggaaaagc atataacata     40320
     gatccattaa tattaaaagc aattgcatgg aatgaatcaa aatgcaaaag cggaataaaa     40380
     agcaaaacaa acaaaaacgg aacgtatgat ataggtataa tgcaaattaa ttcatctcat     40440
     ttagatttat taagcaaatt taatatatct gaagatgatt tattgaatga tgcctgtata     40500
     aacatatctg ttgctggtta tatcttagcc tctaacataa aatccagagg gaatacatgg     40560
     gatgccgttg gtgcgtataa tgcaggttac tttaatacac caaatgcagt agaactcaga     40620
     aggcaatacg caatgaaaat atataaaaca tataataaat taaagaataa tgagcaaatt     40680
     atcgattaat aatcaaggtc tatcgcaata cgaatcaatt gtgccacagg ttcaaaaaag     40740
     tcttctgtta tatattgtcc tttgtgtata ttcttataga gagttcttgc taaaggaata     40800
     tcttcaatca ctggaatatc atagagttca gccagtttaa tgatctgtag agctttggca     40860
     tcttttcctg tttcaataac taaaggtaat ggagtctccc caagtttata gtataggcaa     40920
     atcgcaatgt gagtcgggtt tttaacaata acggttgatt ttttgatgtt attagccaaa     40980
     cttccacttt gtatctcgga atgaaggcga cggcgctccc ctttaatttc agggttacca     41040
     tcagtatcct tggcttctcg tttcacctca tctttactca ttttcatttt cttcagtccc     41100
     tcatgcttct ggaaccagaa atcaaatact gaaaagagta gatatccgaa tagcacgcct     41160
     ttccataaaa gaaaaacaaa aaaggcaaca acgacaagag cttgatatgc gttcagtcct     41220
     gtgaaattag caaactcatt tgcatatgaa tgccccataa aataaaaaat gagaacaatt     41280
     atcactaact taaatactga tttaagtagc tcaaaaatgc tctttacaga aaaaatattt     41340
     ttcaggttat tttttacact aatcttctga gccgatggtt ttattttttc aaccgcaaag     41400
     atgaatccta tttgtgatac accagtcgta acagttccaa caaagacaat caaagaaatt     41460
     ggcaaaatat ataataaaaa tatatttaat accgcaccta atatttctcg aatggcatac     41520
     aaaaacggtc tatttagcga gtctattgtc gtattaacta atccaactat atcaacaaaa     41580
     aaactcatgc catataaaga aaaaaatgaa aataagatta atgactgcac tgcagccatt     41640
     acctcttcac tttttgttac atcgcccttc ttttttagat cccttagttt tttgggtgtg     41700
     ggcttttctg ttttttcact cattaatcat gctcggtaac gatctatcaa ttatgtcaga     41760
     atgaatattt gccgtaataa aatcaggaaa aacatgaata actaatagca atataaagat     41820
     tgctatcaaa ctttttactg gcagtgataa tgtgaatacg tttagctgag gtgctgtttt     41880
     gttaagaaac ccaaacccca tatcacataa gaatataccg ataatcatgg gaactgaaaa     41940
     tgataacatc agtttaataa atgaatccca tagagaaaac aaaaaatcta ttaaagcacg     42000
     attgaatgca atatcggctt gtaatggtaa tatctcgtag gataaatata gcttatctag     42060
     gatgctttgt atcccaccat gaataacaaa gatcacagag ataaattggt acaagataac     42120
     gccagtgata gaagatgaat cacttatgga cgggttaaaa attgaagata ttgttgagcc     42180
     tcttagagta tcaataatct gtccagccgc atctattgcc caaaaaagaa tagtaaatga     42240
     taacccaatg aaaaaaccaa tacttatttc ttttagcgct attcctgtca actgaaagat     42300
     tccagatggc aatttttccg aaaatgtata gttctctact atgatcggaa gcgtaaacgc     42360
     aatcataatt gagttgcgaa taaagttact gagtaaaaca cctgttgaaa atattggtag     42420
     gataataaac atccccagcg gcctgagtat acaataaaat gatgatacta tgaccgtcat     42480
     tatctcattc attagccgtt caccttcgga atcatttcaa atattatcga cgagaagttg     42540
     atgattgttg ttcccatcca gtgataagtc agggcaagcg tagcaaacac tgctattatt     42600
     tttagcaaaa aaggcaatgt ttgatcctgt aactgcgtta tagcctggac cagactaata     42660
     ataataccga taacagaggc cgctatgact gtaggcaatg agaggataaa tattatccag     42720
     aacgtttgca cacataattg aacaaaatat ccagtatcca tcaattcacc accaacagaa     42780
     attcgaataa tttttgccag cctccaacaa gaatgaataa taagatctta aaaggaatcg     42840
     aaattgttac tggcgatacc atcatcatac ccaaggccaa taagatattg gaaatgatca     42900
     aatctatcgc aataaagggt aaatagagca aaaaacctat cttgaatgca gcttcaagct     42960
     gccccatcgt gaaagccggt aacagtataa atagagagtc tttttttaag atagtttcat     43020
     tacccaattt tttttgagct gcacgttcaa aaaactctac attgtctttc tctgtatttt     43080
     tttctaaaaa accgcgatat ggtgataata ttttctcatc aactttttga aaaaaatcag     43140
     agtcggtata attgattggt tcctgagaaa tattatcatt tatctgtaat attatcggag     43200
     acataataaa cattgtcagt atcaaagaca ctgatgttag cgccatgttt ggtggtacct     43260
     gttgaatgcc taatgcgttc ttcaatatcc ccagtacaat agaaattttc aggaatgaag     43320
     taccaataac aacaaatatt ggcagtaatg ataacagaaa aaatacaata attaaaaata     43380
     ttggctgtga gccaatggtc attaattgag acatatcatc attcctgaat aatgctaaga     43440
     taattatctt taaatgaatt caataaaata cttatttgct ctaatgggtc taaagttatt     43500
     ctaatatatt cattttctat tataatttta ttatgcggtg tgtttgcatc attaataagc     43560
     tgtatattgt tggcctcgcc aggatcaagt ttaatgtctg ggtttttagt gatcttaata     43620
     gctccgacaa tattgttatt agatagagtt tcccttacaa cttcattaag taaatcatcc     43680
     caattaattc ttgatgatgt atctaaagaa tgtaatgcat tagtcagtga caaatgaatc     43740
     ttattcatta tgtcctgcat taagaccaac tcgatagcct ggatatcttt aacccatttt     43800
     atcgattggt taacctcttt atctaatttt attttattat tttttcgaat cctttctctc     43860
     attagaatca tttttctggc aatttttttt ctggattctg tctttaattc tttcgatttc     43920
     ctcctcgccc tcagtaaatg ttcatatgtt ttttttcgag ccagtttgat aatatcatca     43980
     gattgaataa tttcctgtaa cttatcctct ggtatgatat cttctgtaag cactaaatca     44040
     atttttatat ttttaaattc ataaagtttc ataaggcaat aaaattttat taagtctgtt     44100
     aagaaataaa tcattaatat gagttggttt tatttctcca cttttcggca aaagatattt     44160
     gactatggtc cataaaggat tatcagcaaa tagccactcc aaatttcctg caccgtattt     44220
     tattaactca gcacaaaacc gttcttcacc atattctggt ttacattgcc ctccctgcca     44280
     atagaatgat aactgcttca cattttgata tcctatctct ctaatcagag tttctcgata     44340
     taatcgtgag aaaatataat cagggcattg aatgtcaaat aatgcactac ttagagcaag     44400
     caatcttatt ttcccaattg actgatataa aaaaccttcc ttatttatgt cagataattc     44460
     cacaccagaa attttatcat gtatttcctg acgcaatatc ttattgagtt gattacgagt     44520
     agaactagtt tctcttaaac gccgaaaact gacctgattg acaccggtta aatcacctag     44580
     ccattcatca tgaaccatca tgattggata attaattaat ttataatagt tatagtctat     44640
     tttattaaaa attgtcatac tatttttcta ttatttctat tccgttgatt cattgttgat     44700
     tggcttttag atcttgctgg actcagtgtc tctattagtt tttcaatctt acttagggca     44760
     gaatcatata attttcgctc ttcaccatat gtgtacccct caattaattt gtttaatttt     44820
     tctgccgcct gaggatctgt ttttgctttt tcacttaact cattaacgct ttcttttacg     44880
     acatcaaatt cggcgattat tttttttatc gcctcaattt ctgatcttat ttttttatct     44940
     aatagttctt tatttcttgt ttggctcaca atactcatcc tctatttatt attaatcctg     45000
     attcgcatta tctctatagt cctaattgcc gcatcacacg caatgagcag ttcctttgct     45060
     tcattgtagg taactttatc caaagggtgt ttcatttttt catggatttc gttctttttg     45120
     tcgtttattt tttcaataaa aacatttgcg gcttctttat tttttattat ttcatcttcc     45180
     agctcagtta tcgttatcat ttaattattt catgttaaat atttttcagc ggtattattt     45240
     cttcttcagt gtccttcaca agaaaatctt ctttcttcat tccattcaac agtgcttctt     45300
     taagccagcg tggctgtcgg cctacgcccg accaggtctg cccttcttca ttgcggtagt     45360
     aaacaccttt cgatgagttc cggcgagcga gtccatcatc aggcacatta gtatatccca     45420
     gctcttgtaa ggttatattg taataagtaa tctgcttctg aatcgactca attacacttt     45480
     gaacttcctg ctctcgcagt cgctttgctt cctgctgtag aactgcaatt tgctctataa     45540
     gctgaatgta tggacttgtt gtatgtgaat tattttccat attcataata aataatctcc     45600
     gcatgcttta atattttaag ctattagcga ccttatcagg aaggaccaac aattaatcaa     45660
     atgatataaa ttatgtgaga taacgtttat ctatcaaatt aggacacatc tatttcatca     45720
     aacaaccacc ttaaaatgtt attattctct tttttctaat gtgtaaaata cattatcatt     45780
     aaatgtcaac aaaaaaatca tatattttta aaatccattt aaaatcaatg atatagaaga     45840
     aaatcatctc gttaacaaac gactttaata attgcatttc catttagtta agcgtttctc     45900
     tttataagat agatctcatt gcataaacaa ataaaacaga ataaaaacca agctgaaccg     45960
     tttcactata ctctacttaa ttcgagttac aggaaggcgg caagcgagtg aatccccagg     46020
     agcttacata agtaagtgat tggggtaagc gaacgcagtc gcagcacatg caacttgaag     46080
     tatgacgagt atatatatct attagctgtt tcccggacat aagctacagc cagcactaac     46140
     ctggaacggg tgcattataa aaaggaacaa gggacaaata gctgaacagt aaccgcgtta     46200
     gtctcttccc gcataaccgt accattcgta ttaagaagta ttgcccatat ccattcggcg     46260
     aaagaggatc tgccatacat caagtccgtt ttacttggca tcagatcatc gccgtcatta     46320
     actctgttaa agtcggacaa acgattagca agatctgtga ttcaaaagtg cttagcgcta     46380
     aggtgggact ggttacagat tcattaaccc tgttctttgt cgcacctatc gatcggtgta     46440
     atgccacaac aggtttatgt taatcagaac aatgcgcccc tctataaaga gaattctttg     46500
     ataaggcaac tgaaaaggga aagctaactg atatcaatgt accactttag taatcatcac     46560
     attatataca ggccaaaata agtttcctga aagccagtat ctctaaatca atcattaatg     46620
     atatatttta tcgtcacaat aaaaaattat ctaaattcta ttacttatgt aaataagtac     46680
     aaccttttca tagacacaaa aactatggct gacgcatcac ttgcaatcaa ttatccatca     46740
     ttagattaat attttcactt atttttcaga aggtaaaaat aactttctat gcgtttaaaa     46800
     cacccgctat aaatatcttg tatattattg acactatatg atgctatatg atacttgttg     46860
     ccaaattgtt cattacaaac cagataggag aatctctcat gataaatgga cttaataatg     46920
     actccgcatc tttagtttta gatgctgcaa tgaaagttaa ttctgggttt aaaaaaagct     46980
     gggatgagat gtcatgcgct gaaaagttat ttaaagtact tagttttggt ttatggaatc     47040
     caacgtacag tcgtagtgaa agacaatcat ttcaagagtt gttaaccgtt ttagagcctg     47100
     tatatccact tcccaatgaa ttaggcagag tatctgctcg tttttcagat ggttcatcct     47160
     taagaatttc cgtcactaac agcgaacttg ttgaagccga gattcgcaca gcaaataatg     47220
     aaaagattac tgtgctcctg gagtcaaacg aacaaaatag gttattacaa tctttaccca     47280
     tcgatcgcca catgccatac attcaggttc atcgtgcctt atctgagatg gacctgactg     47340
     atactacctc aatgcgcaat ctacttggtt ttacgtcaaa actatcaaca accttgattc     47400
     ctcataatgc tcaaacagat ccgctttccg ggcctacacc attcagctct atctttatgg     47460
     atacatgtcg aggactcggc aatgcaaagc tttcactcaa tggtgttgat atacctgcaa     47520
     atgcacaaaa attgcttcgc gatgcactag gacttaaaga cacacattca tcaccaaccc     47580
     ggaatgttat agatcatggt atttctcgcc atgatgcaga gcaaatagca agagaaagca     47640
     gcggcagtga taaacagaaa gctgaagttg tggaattttt atgccatcca gaagcagcaa     47700
     cggccatatg ctcggctttc tatcaatctt tcaatgtgcc agccttaacg ttgacacatg     47760
     aaaggatctc taaagccagt gaatacaatg cggaaagatc attagataca cctaacgctt     47820
     gcattaacat cagtatctct caatcatcag atggaaacat ttatgttacc agccatactg     47880
     gggttctgat aatggcgcca gaagaccgcc ccaacgagat gggcatgttg acgaacagga     47940
     cttcttatga agtgccgcaa ggtgtgaaat gtataatcga tgaaatggta agtgcgctac     48000
     aaccaaggta tgccgcatct gaaacgtact tacaaaacac ttaaaataaa actttattaa     48060
     tcaaaactaa taatagaaac cacacccata attattaaca atttattccg aagttaatca     48120
     caattaaaca aagatattta ttctgcaaac aatttacagc aaatagagaa aatgaaaaga     48180
     aaaccattga ttgcattttt catcgcgata tttattgcac taaccatatt aatattattt     48240
     ccatttaatt gtacttacaa aaaatcacct caagaacact cactttcatt tataaaacaa     48300
     ttaccaaata cggtgaactt atcatctctt acttataata aagaggatga tttcctgtat     48360
     gccacccaga atagccctgc acagctactt aaaataacca aaagtggcga catcatggac     48420
     agagccccac tgccttttat ctctgatgcc gaaacaattg aacacataca agggaacatt     48480
     tttgctgcag tagacgaaaa gacttctgaa ctattctttt ttacagttac aaaagatatg     48540
     catatctcct ttcgaaataa aattcagtta gaaaaattca ataaaaagaa tagagggttt     48600
     gaagggctgg catggaaagc agatgatcgg atgctgtttg tcgcaaaaga aagacgccca     48660
     agtaaaatat ttatatatca actttctcca gacctgctga gtgtaaagca agcaactatt     48720
     ccagaggcac taaatgatat acgtgttaac gatatatccg gcctggcctt taataatgaa     48780
     agtctgatga ttctgtccga tgaatcgcgt aaattactca agtttaacct gacagagatg     48840
     tctttcattg agatgcttga cctgacaaaa ggaaatcatt ctctgaccag tgatttgccc     48900
     caacctgaag gaattgtaac tctgcctgat gaaagcattt atgttgccag tgaacctgat     48960
     atcctcgcga aatttgtccc taataagtaa gtctgtcact ggccttatta tttatcgacc     49020
     aaacctggca atctcataaa gttataaaaa tacgagtata atttcacgct aaataaacac     49080
     attaatagtt gaaaaggata tcagttatta tcaaccagaa tcttactcag tctattagta     49140
     ttatcagact tatattagat cctacaatat atttaatttg tatgcagaat agagtgttca     49200
     caccacatct ggtatagaaa agcacaggct agcaaaaacc tgaataaccc cgtacttacg     49260
     gagttattca ggttaaaaat atccataaca tcacttctga tttttattgc ttacgacgga     49320
     tataatttct ctggtcagct actaatatca tcatgctcac gcgtttaatc aaactcgtgt     49380
     ttctcaaacg gacatcgcgg gacaatcttc tgcttctccc ggcgcatttt ttaccacctt     49440
     cgctacctgc attttgagcg gaagatccgc ttttttctgg cccccgcaca tatgcaagtc     49500
     cagttttaaa tttatccttt atttcattct gaaacaaact gctcataatt ttctccagtg     49560
     gaacctgcat ctcagggaga catcactaca gaatacttcc ccttatgcac tgatttaatt     49620
     ttggtcattt agaataacgg cctgtaaagt ctcaatgcaa cagatgggta acgctattat     49680
     gaggatcctc gtcagtaaat tactggcaag gcactccgat aaataagaat aggttccgca     49740
     acaacgttat atgcaaatac ctcacgcttc ggctagatta tcgccggctc tgttgacgaa     49800
     attatggttg aaatctggag ctaccacacg ttgttctggc tggcgatagg gatgttgggt     49860
     attgcaatga tttgcttgct gtttattaaa gatatttagc tcaccagtct gggctaagaa     49920
     aaatcggcgt ggcgcaaact gagccatcct cgccattttt gctatcatgc ctgcatacat     49980
     aaacgacaaa acagtatgca gagggaaaaa tgggttccac cagaaagggg atgctgaacg     50040
     ttctgattgc cgccgtgttg tggggaagtt caggggtctg cgcgcaatac atcatggagc     50100
     aaagccagat gtcgtcgcag tttttgacta tgacgcgttt gatattcgcc ggtttgattc     50160
     tgctgacgct atcatttgtt catggtgata aaatcttttc tattattaac aatcacaaag     50220
     atgccattag cctactgatt ttttccgtgg ttggcgcgct aaccgtacag ctcacttttt     50280
     tgctaaccat cgaaaaatcg aacgcagcca cggcaacggt gctgcaattc ctctcaccga     50340
     ctattatcgt cgcctggttc tcactggtgc gtaaatcccg cccgggcatt ctggttttct     50400
     gcgctatttt gacatcgctg atcgggactt ttttattggt gacacacggt aatccgacgt     50460
     cattatcgat ctctcctgcc gcgttattct ggggcatt                             50498
//

If you have problems or comments...

PBIL Back to PBIL home page