(data stored in ACNUC7421 zone)

EMBL: EU895934

ID   EU895934; SV 1; linear; genomic DNA; STD; PRO; 828 BP.
XX
AC   EU895934;
XX
DT   30-APR-2009 (Rel. 100, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Escherichia coli strain TW14359 putative enzyme (ECs3789) gene, complete
DE   cds.
XX
KW   .
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-828
RX   PUBMED; 19439656.
RA   Leopold S.R., Magrini V., Holt N.J., Shaikh N., Mardis E.R., Cagno J.,
RA   Ogura Y., Iguchi A., Hayashi T., Mellmann A., Karch H., Besser T.E.,
RA   Sawyer S.A., Whittam T.S., Tarr P.I.;
RT   "A precise reconstruction of the emergence and constrained radiations of
RT   Escherichia coli O157 portrayed by backbone concatenomic analysis";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(21):8713-8718(2009).
XX
RN   [2]
RP   1-828
RA   Leopold S.R., Magrini V., Holt N.J., Shaikh N., Mardis E.R., Cagno J.,
RA   Oguro Y., Iguchi A., Hayashi T., Mellmann A., Karch H., Besser T.E.,
RA   Sawyer S.A., Whittam T.S., Tarr P.I.;
RT   ;
RL   Submitted (14-JUL-2008) to the INSDC.
RL   Department of Pediatrics, Washington University School of Medicine, 660
RL   South Euclid Avenue, Saint Louis, MO 63110, USA
XX
DR   MD5; 9115a29ee66962482f212a7b3dce60c3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..828
FT                   /organism="Escherichia coli"
FT                   /strain="TW14359"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   gene            1..828
FT                   /locus_tag="ECs3789"
FT   CDS_pept        1..828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs3789"
FT                   /product="putative enzyme"
FT                   /note="similar to putative enzyme, Escherichia coli O157
FT                   Sakai ECs3789"
FT                   /db_xref="GOA:C3SVK2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3SVK2"
FT                   /protein_id="ACI78495.1"
FT                   /translation="MNLSRRNILIKGIFMSYQYVNVVTINKVAVIEFNYGRKLNALSKV
FT                   FIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITR
FT                   MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLT
FT                   RDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
FT                   IKEELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFVGH"
XX
SQ   Sequence 828 BP; 212 A; 205 C; 193 G; 218 T; 0 other;
     gtgaatttat ccagacgcaa tattttgatt aaaggaattt ttatgtctta tcagtatgtt        60
     aacgttgtca ctatcaacaa agtggcggtc attgagttta actatggccg aaaacttaat       120
     gccttaagta aagtctttat tgatgatctt atgcaggcgt taagcgatct caaccggccg       180
     gaaattcgct gtatcatttt gcgcgcgccg agtggatcca aagtcttctc cgcaggtcac       240
     gatattcacg aactgccgtc tggcggtcgc gatccgctct cctatgatga tccattgcgt       300
     caaatcaccc gcatgatcca aaaattcccg aaaccgatta tttcgatggt ggaaggtagt       360
     gtttggggtg gcgcatttga aatgatcatg agttccgatc tgattatcgc cgccagtacc       420
     tcaaccttct caatgacgcc tgtaaacctc ggcgtcccgt ataacctggt cggcattcac       480
     aacctgaccc gcgacgcggg cttccacatt gtcaaagagc tgatttttac cgcttcgccc       540
     atcaccgccc agcgcgcgct ggctgtcggc atcctcaacc atgttgtgga agtggaagaa       600
     ctggaagatt tcaccttaca aatggcgcac cacatctctg agaaagcgcc gttagccatt       660
     gccgttatca aagaagagct gcgtgtactg ggcgaagcac acaccatgaa ctccgatgaa       720
     tttgaacgta ttcaggggat gcgccgcgcg gtttatgaca gcgaagatta ccaggaaggg       780
     atgaacgctt tcctcgaaaa acgtaaacct aatttcgttg gtcattaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page