(data stored in SCRATCH3701 zone)

EMBL: EU898541

ID   EU898541; SV 1; linear; genomic DNA; STD; PRO; 2628 BP.
XX
AC   EU898541;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Escherichia coli strain 86-24 DNA gyrase subunit A (ECs3114) gene, complete
DE   cds.
XX
KW   .
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-2628
RX   PUBMED; 19439656.
RA   Leopold S.R., Magrini V., Holt N.J., Shaikh N., Mardis E.R., Cagno J.,
RA   Ogura Y., Iguchi A., Hayashi T., Mellmann A., Karch H., Besser T.E.,
RA   Sawyer S.A., Whittam T.S., Tarr P.I.;
RT   "A precise reconstruction of the emergence and constrained radiations of
RT   Escherichia coli O157 portrayed by backbone concatenomic analysis";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(21):8713-8718(2009).
XX
RN   [2]
RP   1-2628
RA   Leopold S.R., Magrini V., Holt N.J., Shaikh N., Mardis E.R., Cagno J.,
RA   Oguro Y., Iguchi A., Hayashi T., Mellmann A., Karch H., Besser T.E.,
RA   Sawyer S.A., Whittam T.S., Tarr P.I.;
RT   ;
RL   Submitted (14-JUL-2008) to the INSDC.
RL   Department of Pediatrics, Washington University School of Medicine, 660
RL   South Euclid Avenue, Saint Louis, MO 63110, USA
XX
DR   MD5; d0a6721d28d29f5396c2bfb00f339648.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2628
FT                   /organism="Escherichia coli"
FT                   /strain="86-24"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   gene            1..2628
FT                   /locus_tag="ECs3114"
FT   CDS_pept        1..2628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs3114"
FT                   /product="DNA gyrase subunit A"
FT                   /note="similar to DNA gyrase subunit A, Escherichia coli
FT                   O157 Sakai ECs3114"
FT                   /db_xref="GOA:C3T307"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C3T307"
FT                   /protein_id="ACI81092.1"
FT                   /translation="MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKI
FT                   PNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAI
FT                   INGRRGIEEAYRTGRGKVYIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELV
FT                   KEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHG
FT                   QPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRH
FT                   APTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAI
FT                   LDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELELVREQFGDKR
FT                   RTEITANSADINLEDLITQEDVVVTLSHQGYVKYQPLSEYEAQRRGGKGKSAARIKEED
FT                   FIDRLLVANTHDHILCFSSRGRVYSMKVYQLPEATRGARGRPIVNLLPLEQDERITAIL
FT                   PVTEFEEGVKVFMATANGTVKKTVLTEFNRLRTAGKVAIKLVEGDELIGVDLTSGEDEV
FT                   MLFSAEGKVVRFKESSVRAMGCNTTGVRGIRLGEGDKVVSLIVPRGDGAILTATQNGYG
FT                   KRTAVAEYPTKSRATKGVISIKVTERNGLVVGAVQVDDCDQIMMITDAGTLVRTRVSEI
FT                   SIVGRNTQGVILIRTAEDENVVGLQRVAEPVDEEDLDTIDGSAAEGDDEIAPEVDVDDE
FT                   PEEE"
XX
SQ   Sequence 2628 BP; 648 A; 666 C; 756 G; 558 T; 0 other;
     atgagcgacc ttgcgagaga aattacaccg gtcaacattg aggaagagct gaagagctcc        60
     tatctggatt atgcgatgtc ggtcattgtt ggccgtgcgc tgccagatgt ccgagatggc       120
     ctgaagccgg tacaccgtcg cgtactttac gccatgaacg tactaggcaa tgactggaac       180
     aaagcctata aaaaatctgc ccgtgtcgtt ggtgacgtaa tcggtaaata ccatccccat       240
     ggtgactcgg cagtttatga cacgatcgtc cgtatggcgc agccattctc gctgcgttac       300
     atgctggtag acggtcaggg taacttcggt tccatcgacg gcgactctgc ggcggcaatg       360
     cgttatacgg aaatccgtct ggcgaaaatt gcccatgaac tgatggccga tctcgaaaaa       420
     gagacggtcg atttcgttga taactatgac ggcacggaaa aaattcccga cgtcatgcca       480
     accaaaattc ctaacctgct ggtgaacggt tcttccggta tcgccgtagg tatggcaacc       540
     aacatcccgc cgcacaacct gacggaagtc atcaacggtt gtctggcgta tatcgatgat       600
     gaagacatca gcattgaagg gctgatggaa cacatcccgg ggccggactt cccgacggcg       660
     gcaatcatta acggtcgtcg cggtattgaa gaagcttacc gtaccggtcg cggcaaggta       720
     tatatccgcg cccgtgctga agtggaagtt gacgccaaaa ccggacgtga aaccattatc       780
     gtccacgaaa tcccgtatca ggtaaacaaa gcgcgcctga tcgagaagat tgcggaactg       840
     gtaaaagaaa aacgcgtgga aggcatcagc gcgctgcgtg acgagtctga caaagacggt       900
     atgcgcatcg tgattgaagt gaaacgcgat gcggtcggtg aagttgtgct caacaacctc       960
     tactcccaga cccagttgca ggtttctttc ggtatcaaca tggtggcatt gcaccatggt      1020
     cagccaaaga tcatgaacct gaaagacatc atcgcggcgt ttgttcgtca ccgccgtgaa      1080
     gtggtgaccc gtcgtactat tttcgaactg cgtaaagctc gcgatcgtgc tcatatcctt      1140
     gaagcattag ccgtggcgct ggcgaacatc gacccgatca tcgaactgat ccgtcatgcg      1200
     ccgacgcctg cagaagcgaa aactgcgctg gtggctaatc cgtggcagct gggcaacgtt      1260
     gccgcgatgc tcgaacgtgc tggcgacgat gctgcgcgtc cggaatggct ggagccagag      1320
     ttcggcgtgc gtgatggtct gtactacctg accgaacagc aagctcaggc aattctggat      1380
     ctgcgtttgc agaaactgac cggccttgag cacgaaaaac tgctcgacga atacaaagag      1440
     ctgctggatc agatcgcgga actgctgcgt attcttggta gcgccgatcg tctgatggaa      1500
     gtgatccgtg aagagctgga gctggttcgt gaacagttcg gtgacaaacg tcgtactgaa      1560
     atcaccgcca acagcgcaga catcaacctg gaagatctga tcacccagga agatgtggtc      1620
     gtgacgctct ctcaccaggg ctacgttaaa tatcagccgc tttctgaata cgaagcgcag      1680
     cgtcgtggcg ggaaaggtaa atctgccgca cgtattaaag aagaagactt tatcgaccga      1740
     ctgctggtgg cgaacacgca cgaccatatt ctgtgcttct ccagccgtgg tcgcgtctat      1800
     tcgatgaaag tttaccagtt gccggaggcc actcgtggcg cgcgcggtcg tccgatcgtc      1860
     aacctgctgc cgctggagca ggacgaacgt atcaccgcga tcctgccggt gaccgagttt      1920
     gaagaaggcg tgaaagtctt catggcgacc gctaacggta ctgtgaagaa aaccgtcctc      1980
     accgagttca accgtctgcg taccgccggt aaagtggcga tcaaactggt tgaaggcgat      2040
     gagctgatcg gcgttgacct gaccagcggc gaagacgaag taatgctgtt ctccgccgaa      2100
     ggtaaagtgg tgcgctttaa agagtcttct gtccgtgcga tgggctgcaa caccaccggt      2160
     gttcgcggta ttcgtttagg cgaaggtgat aaagtcgtct ctctgatcgt gcctcgtggc      2220
     gatggcgcaa tcctcaccgc aacgcagaac ggttatggta aacgtaccgc agtggcggaa      2280
     tacccgacta agtcgcgtgc gacgaaaggg gttatctcca tcaaggttac cgaacgtaac      2340
     ggtttagttg ttggcgcggt acaggtagat gactgcgacc agatcatgat gatcaccgat      2400
     gccggtacgc tggtacgtac tcgcgtttca gaaatcagca tcgtgggccg taacacccag      2460
     ggcgtgatcc tcatccgtac tgcggaagat gaaaacgtag tgggtctgca acgtgttgct      2520
     gaaccggttg acgaggaaga tctggatacc atcgacggca gtgccgcgga aggggacgat      2580
     gaaatcgctc cggaagtgga cgttgacgac gagccagaag aagaataa                   2628
//

If you have problems or comments...

PBIL Back to PBIL home page