(data stored in ACNUC8465 zone)

EMBL: EU901554

ID   EU901554; SV 1; linear; genomic DNA; STD; PRO; 660 BP.
XX
AC   EU901554;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Escherichia coli strain TW14359 putative beta-phosphoglucomutase (ECs1896)
DE   gene, complete cds.
XX
KW   .
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-660
RX   PUBMED; 19439656.
RA   Leopold S.R., Magrini V., Holt N.J., Shaikh N., Mardis E.R., Cagno J.,
RA   Ogura Y., Iguchi A., Hayashi T., Mellmann A., Karch H., Besser T.E.,
RA   Sawyer S.A., Whittam T.S., Tarr P.I.;
RT   "A precise reconstruction of the emergence and constrained radiations of
RT   Escherichia coli O157 portrayed by backbone concatenomic analysis";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(21):8713-8718(2009).
XX
RN   [2]
RP   1-660
RA   Leopold S.R., Magrini V., Holt N.J., Shaikh N., Mardis E.R., Cagno J.,
RA   Oguro Y., Iguchi A., Hayashi T., Mellmann A., Karch H., Besser T.E.,
RA   Sawyer S.A., Whittam T.S., Tarr P.I.;
RT   ;
RL   Submitted (14-JUL-2008) to the INSDC.
RL   Department of Pediatrics, Washington University School of Medicine, 660
RL   South Euclid Avenue, Saint Louis, MO 63110, USA
XX
DR   MD5; 901106809c8f033c07f0ec110874a09c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..660
FT                   /organism="Escherichia coli"
FT                   /strain="TW14359"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   gene            1..660
FT                   /locus_tag="ECs1896"
FT   CDS_pept        1..660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs1896"
FT                   /product="putative beta-phosphoglucomutase"
FT                   /note="similar to putative beta-phosphoglucomutase,
FT                   Escherichia coli O157 Sakai ECs1896"
FT                   /db_xref="GOA:C3TBL2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3TBL2"
FT                   /protein_id="ACI84100.1"
FT                   /translation="MKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLK
FT                   GISRDESLRRILQHGGKEGDFNPQERTQLAYRKNLLYVHSLRELTVNAVLPGIRNLLAE
FT                   LRAQQIPVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVP
FT                   PQACIGIEDAQAGIDAINASGMRSVGIGAGLTGAQLLLPSTDSLTWPRLSAFWQNV"
XX
SQ   Sequence 660 BP; 136 A; 182 C; 195 G; 147 T; 0 other;
     atgaaactgc aaggggtaat tttcgatctg gatggtgtaa tcaccgatac cgcgcatctg        60
     catttccagg cgtggcagca gattgccgct gaaattggca tcagcattga tgcgcagttt       120
     aacgaatccc taaaagggat cagccgcgat gagtctctgc ggcgcattct gcaacacggg       180
     ggcaaagagg gcgactttaa cccgcaggag cggacgcaac tggcgtatcg caaaaatctg       240
     ctttacgtcc actcactgcg cgagctgacg gttaatgctg tgctgcccgg tattcgcaat       300
     ttgctggcag agctccgcgc acagcagatc ccggtagggc tggcttctgt ctccctgaat       360
     gcgccgacga ttttagcggc gctggagctg cgcgagtttt tcaccttctg cgcggatgct       420
     tcccaactta aaaactcgaa accggatccg gaaatctttc tcgctgcctg tgccgggctg       480
     ggcgtgccgc cgcaggcatg tatcggcatt gaagatgcgc aggcgggcat tgacgccatt       540
     aacgccagcg gtatgcgctc ggtggggatc ggcgcaggct taaccggggc gcaattattg       600
     ttgccctcaa cggactccct gacctggccg cggttatcgg ccttctggca aaacgtatag       660
//

If you have problems or comments...

PBIL Back to PBIL home page