(data stored in ACNUC13479 zone)

EMBL: EU965884

ID   EU965884; SV 1; linear; mRNA; STD; PLN; 1094 BP.
XX
AC   EU965884;
XX
DT   31-OCT-2008 (Rel. 97, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 2)
XX
DE   Zea mays clone 289715 signal recognition particle receptor beta subunit
DE   mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RP   1-1094
RX   DOI; 10.1007/s11103-008-9415-4.
RX   PUBMED; 18937034.
RA   Alexandrov N.N., Brover V.V., Freidin S., Troukhan M.E., Tatarinova T.V.,
RA   Zhang H., Swaller T.J., Lu Y.P., Bouck J., Flavell R.B., Feldmann K.A.;
RT   "Insights into corn genes derived from large-scale cDNA sequencing";
RL   Plant Mol. Biol. 69(1-2):179-194(2009).
XX
RN   [2]
RP   1-1094
RA   Alexandrov N.N., Brover V.V., Freidin S., Troukhan M.E., Tatarinova T.V.,
RA   Zhang H., Swaller T.J., Lu Y.-P., Bouck J., Flavell R.B., Feldmann K.A.;
RT   ;
RL   Submitted (04-AUG-2008) to the INSDC.
RL   Ceres, Inc., 1535 Rancho Conejo Blvd., Thousand Oaks, CA 91320, USA
XX
DR   MD5; 4a45c7f4a0ffe8ee2f359f5f7b0b0f15.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1094
FT                   /organism="Zea mays"
FT                   /mol_type="mRNA"
FT                   /clone="289715"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        150..920
FT                   /codon_start=1
FT                   /product="signal recognition particle receptor beta
FT                   subunit"
FT                   /note="similar to NP_001062284.1"
FT                   /db_xref="GOA:B6TLL9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6TLL9"
FT                   /protein_id="ACG38002.1"
FT                   /translation="MDEWIRQTEVWVHQTDSWIRQQPPEQIYVAAAVVAVTILLLIVAS
FT                   CLKSSRPNTIVLSGLSGSGKTTIYYQLRDGSSHQGTVTSMEENSDTFVLHSEQERKDKV
FT                   KPVHIIDVPGHARLKPKLDEVLPKAAAVVFVVDAQDFLSSMQAAAEYLYDILTKATVVK
FT                   KKVPVLIFCNKTDKVTAHSKEFIKKQLEKELNKLRESRNAVSSADISDEVQLGVPGEAF
FT                   NFSQCQNKVAVAEGAGLTGDVSAVEQFIREHVKA"
XX
SQ   Sequence 1094 BP; 289 A; 240 C; 284 G; 281 T; 0 other;
     agttcgccac tctcgccatc ggggacgagg gactgggagc caggatactt ctgccgcgcg        60
     gcgaccggtc gagcgaaatc gatctacccc aggtgcggcg ggcgcggctt tattctcaag       120
     attttttctg tgttctttag agagcagcca tggacgagtg gattcgccaa accgaggtgt       180
     gggtgcacca aaccgacagc tggatccggc agcagccccc ggagcagatc tatgtagcgg       240
     ccgcggtggt tgccgtcaca atcctgttgc ttatcgtagc atcttgtctg aaatcgtcta       300
     gaccaaacac catagttcta tctgggctta gtggcagtgg caaaaccact atttactacc       360
     agcttcggga tggatcatca catcaaggaa ctgttacttc aatggaagaa aacagtgata       420
     cttttgtgct gcattcggag caagaaagga aagacaaagt aaaacctgtg catattattg       480
     atgttcctgg tcatgctagg ctcaaaccca aacttgatga agtcctgcct aaagctgctg       540
     cggttgtctt tgttgttgat gctcaagatt tcttgtctag catgcaagct gctgcagagt       600
     acctttatga cattctgaca aaggcaactg tagtgaagaa aaaggtccct gtgcttatat       660
     tctgcaacaa gacagataaa gttaccgccc actcgaagga attcatcaag aagcagttgg       720
     agaaagaatt gaacaagctt agggaatcta ggaacgccgt atcgtcagcc gacatctctg       780
     atgaagtcca gcttggggtc cctggagagg cattcaactt cagccagtgc cagaacaagg       840
     tggctgttgc ggagggtgct ggtttgacag gtgatgtttc ggccgtggaa caattcatcc       900
     gtgaacatgt gaaggcatag gttgttctta ttgtttttgg ggctccaaat ggctatcctg       960
     atgagataag atgtacattg cgtcaatgtg gttgttacct ttcatgcatg tacaccttca      1020
     tccggtgctc tgaagttgct tagagacagt gaagcacagt catattttga actggttcaa      1080
     aaaaaaaaaa aaaa                                                        1094
//

If you have problems or comments...

PBIL Back to PBIL home page