(data stored in ACNUC8465 zone)

EMBL: EU968473

ID   EU968473; SV 1; linear; mRNA; STD; PLN; 1521 BP.
XX
AC   EU968473;
XX
DT   31-OCT-2008 (Rel. 97, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 2)
XX
DE   Zea mays clone 321207 MKK6 - putative MAPKK mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RP   1-1521
RX   DOI; 10.1007/s11103-008-9415-4.
RX   PUBMED; 18937034.
RA   Alexandrov N.N., Brover V.V., Freidin S., Troukhan M.E., Tatarinova T.V.,
RA   Zhang H., Swaller T.J., Lu Y.P., Bouck J., Flavell R.B., Feldmann K.A.;
RT   "Insights into corn genes derived from large-scale cDNA sequencing";
RL   Plant Mol. Biol. 69(1-2):179-194(2009).
XX
RN   [2]
RP   1-1521
RA   Alexandrov N.N., Brover V.V., Freidin S., Troukhan M.E., Tatarinova T.V.,
RA   Zhang H., Swaller T.J., Lu Y.-P., Bouck J., Flavell R.B., Feldmann K.A.;
RT   ;
RL   Submitted (04-AUG-2008) to the INSDC.
RL   Ceres, Inc., 1535 Rancho Conejo Blvd., Thousand Oaks, CA 91320, USA
XX
DR   MD5; e6788fcf1a82f58b025f4cb6f1085d6b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521
FT                   /organism="Zea mays"
FT                   /mol_type="mRNA"
FT                   /clone="321207"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        148..1215
FT                   /codon_start=1
FT                   /product="MKK6-putative MAPKK"
FT                   /note="similar to NP_001043164.1"
FT                   /db_xref="GOA:O49975"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:O49975"
FT                   /protein_id="ACG40591.1"
FT                   /translation="MKGKKPVKELKLTVPAQETPVDKFLTASGTFKDGELRLNQSGLRL
FT                   ISEENGDEDESTKLKVEDVQLSMDDLEMIQVIGKGSGGVVQLVRHKWVGTLFALKGIQM
FT                   NIQESVRKQIVQELKINQATQSPHIVMCHQSFYHNGVIYLVLEYMDRGSLADIVKQVKT
FT                   ILEPYLAVLCKQVLEGLLYLHHQRHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSI
FT                   GQRDTFVGTYNYMAPERISGSTYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYE
FT                   LLEAIVDQPPPSAPADQFSPEFCSFISSCIQKDPAQRMSASELLNHPFLKKFEDKDLNL
FT                   GILVENLEPPMNIPE"
XX
SQ   Sequence 1521 BP; 404 A; 332 C; 370 G; 415 T; 0 other;
     accgtgcagc ggcaagggtg tccaggtccc gtaaaatctg gcttttctcc ctccccatac        60
     cccgcacaca cactcgcttt cttcggttct tcctcctcga gcagccactt ccgtctctaa       120
     ccctacagcg acgacgagag cgaggctatg aaggggaaga agccggtcaa ggagctcaag       180
     ctcaccgtgc cggcgcagga gaccccggta gacaagttcc tgacggcaag tggcacgttc       240
     aaggatggtg agctgaggct caatcagagc ggcttgcggc ttatctctga ggaaaacggg       300
     gatgaagatg aatctacaaa gctgaaggtg gaagatgtgc agttatcaat ggatgatctt       360
     gagatgattc aagtcattgg caaaggaagc ggtggtgttg tccagctagt gaggcacaaa       420
     tgggtgggca cattgtttgc cttaaagggt attcaaatga acattcagga gtcagttcgt       480
     aaacaaatag tacaggagct caaaataaac caagcaacac agagccctca tatagttatg       540
     tgccatcaat ctttttacca caatggtgta atatatcttg ttcttgagta catggaccgt       600
     ggatcgcttg cagacattgt taagcaagtg aagactattc tggagccata ccttgcagta       660
     ctttgtaagc aggtcttgga gggtttattg tatcttcatc atcaaaggca cgtgattcac       720
     agggacataa aaccatctaa cttgttggtc aaccgtaaag gtgaagtcaa gattaccgac       780
     ttcggagtga gtgctgtgct agcaagctca ataggtcagc gagatacatt tgttggaacc       840
     tacaactata tggcgcctga gcggattagt ggtagcactt atgactacaa aagtgacata       900
     tggagtttgg gcttagttat acttgagtgt gccattggcc ggttccctta tataccttcg       960
     gaaggtgaag gttggttaag cttttatgaa cttctggagg ccattgtcga tcagccacca      1020
     ccttctgcac ctgcagatca gttctctcca gaattctgct catttatctc ctcttgcata      1080
     cagaaagatc cggctcagag gatgtctgct tcagaactct tgaatcaccc ttttttgaag      1140
     aagttcgagg ataaggactt aaacctgggg attcttgtgg agaacctgga acctccaatg      1200
     aatatacccg aatagcctgt cgtttttagt gatgaagcct ttgttgtgcc ttcagggttt      1260
     ggcctcgaag cctcttggca tctgctcctc aactgcagcc tccctacctg aatatgctat      1320
     aacatcattg tatgattcaa gccccttgtg gctatctgag cataagagta gagggaacta      1380
     tgctgcattc cgtgtatggt caccttattg tagctattgt tgcgacgggc cttgtgattt      1440
     tgagtcttgt tttaactttt gcagtcttat cagcggtgga ttcaaaatga acgaactgaa      1500
     tattcaaaaa aaaaaaaaaa a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page