(data stored in ACNUC16935 zone)

EMBL: F14530

ID   F14530; SV 1; linear; mRNA; EST; MAM; 273 BP.
XX
AC   F14530;
XX
DT   30-AUG-1995 (Rel. 45, Created)
DT   03-SEP-1996 (Rel. 49, Last updated, Version 3)
XX
DE   S.scrofa mRNA; expressed sequence tag (5'; clone c1g04)
XX
KW   EST; expressed sequence tag; ubiquitin precursor.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-273
RX   DOI; 10.1007/s003359900153.
RX   PUBMED; 8672129.
RA   Winteroe A.K., Fredholm M., Davies W.;
RT   "Evaluation and characterization of a porcine small intestine cDNA
RT   library";
RL   Mamm. Genome 7(7):509-517(1996).
XX
RN   [2]
RP   1-273
RA   Winteroe A.K.;
RT   ;
RL   Submitted (26-JUL-1995) to the INSDC.
RL   Winteroe A.K., The Royal Veterinary and Agricultural University, Department
RL   of Animal Science and Animal Health, Division of Animal Genetics, Bulowsvej
RL   13, 1870 Frederiksberg C, DENMARK
XX
DR   MD5; bf0d8fe2f64cf0152ed7865ad0c42d2e.
DR   UNILIB; 300; 324.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..273
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /clone_lib="directionally cloned cDNA in XL1-blue MRF'"
FT                   /clone="c1g04"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:9823"
FT                   /db_xref="UNILIB:300"
FT   CDS_pept        <1..>273
FT                   /codon_start=1
FT                   /product="ubiquitin precursor"
FT                   /note="expressed sequence tag"
FT                   /protein_id="CAA23109.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL"
XX
SQ   Sequence 273 BP; 69 A; 76 C; 74 G; 52 T; 2 other;
     atgcagatct tcgtgaagac cctgaccggn aagaccatca cnctggaggt ggagcccagt        60
     gacaccatcg agaatgtgaa ggccaagatc caggataagg agggcattcc ccccgaccag       120
     cagaggctca tctttgcagg caagcagctg gaggatggcc gcactctttc tgattacaac       180
     atccagaaag agtccaccct ccatctggtt ctgcgtctga ggggtggtat gcagatcttc       240
     gtgaagacct tgaccggcaa gaccatcacc ctg                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page