(data stored in ACNUC16935 zone)

EMBL: F14869

ID   F14869; SV 1; linear; mRNA; EST; MAM; 363 BP.
XX
AC   F14869;
XX
DT   30-AUG-1995 (Rel. 45, Created)
DT   03-SEP-1996 (Rel. 49, Last updated, Version 3)
XX
DE   S.scrofa mRNA; expressed sequence tag (5'; clone c25g11)
XX
KW   EST; expressed sequence tag; polyubiquitin.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-363
RX   DOI; 10.1007/s003359900153.
RX   PUBMED; 8672129.
RA   Winteroe A.K., Fredholm M., Davies W.;
RT   "Evaluation and characterization of a porcine small intestine cDNA
RT   library";
RL   Mamm. Genome 7(7):509-517(1996).
XX
RN   [2]
RP   1-363
RA   Winteroe A.K.;
RT   ;
RL   Submitted (26-JUL-1995) to the INSDC.
RL   Winteroe A.K., The Royal Veterinary and Agricultural University, Department
RL   of Animal Science and Animal Health, Division of Animal Genetics, Bulowsvej
RL   13, 1870 Frederiksberg C, DENMARK
XX
DR   MD5; 3b74b4bf66f9b75b374f0909d6ad18cc.
DR   UNILIB; 300; 324.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..363
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /clone_lib="directionally cloned cDNA in XL1-blue MRF'"
FT                   /clone="c25g11"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:9823"
FT                   /db_xref="UNILIB:300"
FT   CDS_pept        <1..>363
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /note="expressed sequence tag"
FT                   /note="Cricetulus griseus homolog"
FT                   /protein_id="CAA23305.1"
FT                   /translation="LIFPGKQLEDGRTLSDYNIQKESTLHLVLRLKGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLV
FT                   LRXXGGXQIFVKTLTGK"
XX
SQ   Sequence 363 BP; 90 A; 101 C; 100 G; 66 T; 6 other;
     ctgatctttc ccggnaagca gctggaagat gggcgcactc tgtctgacta caacatccag        60
     aaggagtcca ccctgcacct ggtcctccgc ctcaaaggtg ggatgcagat cttcgtgaag       120
     accttgactg gtaagaccat caccctggaa gtggagccca gcgacaccat cgagaatgtc       180
     aaggcgaaga tccaggacaa ggaaggcatc cccccagacc agcagaggct gatctttgcc       240
     gggaagcagc tggaagatgg gcgcaccctg tntgactaca acatccagaa ggagtccacc       300
     ctgcacctgg tcctccgnnt canaggtggg ntgcagatct ttgtgaagac cttgactggt       360
     aag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page