(data stored in ACNUC5340 zone)

EMBL: FJ708756

ID   FJ708756; SV 1; linear; mRNA; STD; PLN; 3039 BP.
XX
AC   FJ708756;
XX
DT   11-MAR-2009 (Rel. 100, Created)
DT   20-FEB-2010 (Rel. 103, Last updated, Version 3)
XX
DE   Arabidopsis thaliana leucine-rich repeat receptor-like protein kinase
DE   (LRR-RLK) mRNA, partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3039
RX   DOI; 10.1186/1471-2164-11-19.
RX   PUBMED; 20064227.
RA   Gou X., He K., Yang H., Yuan T., Lin H., Clouse S.D., Li J.;
RT   "Genome-wide cloning and sequence analysis of leucine-rich repeat
RT   receptor-like protein kinase genes in Arabidopsis thaliana";
RL   BMC Genomics 11:19-19(2010).
XX
RN   [2]
RP   1-3039
RA   Gou X., Clouse S.D., Li J.;
RT   ;
RL   Submitted (05-FEB-2009) to the INSDC.
RL   Department of Botany and Microbiology, The University of Oklahoma, 770 Van
RL   Vleet Oval, Norman, OK 73019, USA
XX
DR   MD5; 8b7bac2b0b2427d1ce25a04107ddd251.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3039
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="Col-0"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   gene            1..>3039
FT                   /gene="LRR-RLK"
FT                   /locus_tag="AT4G28650"
FT   CDS_pept        1..>3039
FT                   /codon_start=1
FT                   /gene="LRR-RLK"
FT                   /locus_tag="AT4G28650"
FT                   /product="leucine-rich repeat receptor-like protein kinase"
FT                   /db_xref="GOA:Q9M0G7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M0G7"
FT                   /protein_id="ACN59350.1"
FT                   /translation="MKMKIIVLFLYYCYIGSTSSVLASIDNVNELSVLLSVKSTLVDPL
FT                   NFLKDWKLSDTSDHCNWTGVRCNSNGNVEKLDLAGMNLTGKISDSISQLSSLVSFNISC
FT                   NGFESLLPKSIPPLKSIDISQNSFSGSLFLFSNESLGLVHLNASGNNLSGNLTEDLGNL
FT                   VSLEVLDLRGNFFQGSLPSSFKNLQKLRFLGLSGNNLTGELPSVLGQLPSLETAILGYN
FT                   EFKGPIPPEFGNINSLKYLDLAIGKLSGEIPSELGKLKSLETLLLYENNFTGTIPREIG
FT                   SITTLKVLDFSDNALTGEIPMEITKLKNLQLLNLMRNKLSGSIPPAISSLAQLQVLELW
FT                   NNTLSGELPSDLGKNSPLQWLDVSSNSFSGEIPSTLCNKGNLTKLILFNNTFTGQIPAT
FT                   LSTCQSLVRVRMQNNLLNGSIPIGFGKLEKLQRLELAGNRLSGGIPGDISDSVSLSFID
FT                   FSRNQIRSSLPSTILSIHNLQAFLVADNFISGEVPDQFQDCPSLSNLDLSSNTLTGTIP
FT                   SSIASCEKLVSLNLRNNNLTGEIPRQITTMSALAVLDLSNNSLTGVLPESIGTSPALEL
FT                   LNVSYNKLTGPVPINGFLKTINPDDLRGNSGLCGGVLPPCSKFQRATSSHSSLHGKRIV
FT                   AGWLIGIASVLALGILTIVTRTLYKKWYSNGFCGDETASKGEWPWRLMAFHRLGFTASD
FT                   ILACIKESNMIGMGATGIVYKAEMSRSSTVLAVKKLWRSAADIEDGTTGDFVGEVNLLG
FT                   KLRHRNIVRLLGFLYNDKNMMIVYEFMLNGNLGDAIHGKNAAGRLLVDWVSRYNIALGV
FT                   AHGLAYLHHDCHPPVIHRDIKSNNILLDANLDARIADFGLARMMARKKETVSMVAGSYG
FT                   YIAPEYGYTLKVDEKIDIYSYGVVLLELLTGRRPLEPEFGESVDIVEWVRRKIRDNISL
FT                   EEALDPNVGNCRYVQEEMLLVLQIALLCTTKLPKDRPSMRDVISMLGEAKPRRKSNSNE
FT                   ENTSRSLAEKHSSVFSTSPVNGLL"
XX
SQ   Sequence 3039 BP; 860 A; 752 C; 655 G; 772 T; 0 other;
     atgaagatga agataatagt tctcttcctt tactactgtt acattggttc tacttcctct        60
     gttttagctt ccatcgacaa tgtcaacgag ctctctgttt tgctgtcggt gaaatcaact       120
     cttgtggatc ctctcaactt tctcaaagac tggaagcttt cagacaccag cgatcactgt       180
     aattggaccg gtgttcggtg caactcaaat ggcaatgttg agaagctcga cctggcgggg       240
     atgaatctca caggcaaaat ctcagattcg atcagccagc tgagtagcct tgtctcgttt       300
     aacatatcat gcaacggatt cgagtcgctg ctcccgaaat caatccctcc gttgaaatct       360
     attgacatca gccagaattc attctcaggg agtctttttc tatttagcaa tgaatcactt       420
     gggcttgttc acctcaatgc ttcagggaac aatctctccg gaaatctcac ggaggatctc       480
     gggaacttag tctctttaga agttcttgat ctccgaggga atttctttca agggtcactt       540
     ccaagttcat tcaagaatct acagaagctg agatttctcg gattatccgg aaacaatctc       600
     accggcgagt taccaagcgt tctcggccag ctcccttcac ttgaaaccgc cattcttggt       660
     tacaacgaat tcaaaggtcc gattccaccg gaatttggaa acataaacag cctcaagtac       720
     cttgatttgg ccatcggaaa gctcagtggt gagattccgt cagagcttgg gaagctcaag       780
     tcactcgaga cgcttctcct gtacgagaat aacttcaccg gaacaattcc aagagagata       840
     ggaagcatta ccacgctaaa ggttcttgat ttctccgata atgcgttaac cggcgagatt       900
     ccaatggaga taacaaagct caagaacctc cagctactga acctgatgcg caacaaactc       960
     tcaggctcca ttcctcccgc catcagcagt ctagcacagt tacaagtcct cgagctctgg      1020
     aacaacacgc tctccggcga gttaccaagc gatctcggga agaattctcc attacaatgg      1080
     cttgacgttt cttcaaactc cttctcaggc gagattcctt caactctatg caacaaggga      1140
     aatctaacca agctcattct cttcaacaac accttcaccg gtcagattcc agcgactctt      1200
     tccacttgcc aatcactagt tcgtgttaga atgcagaaca atctactaaa cggatcaatt      1260
     cctatcggct ttggcaagct tgagaagcta cagagactcg aactagccgg aaatcgtctc      1320
     agcggaggga tccctggaga catctccgat tcagtttcac tttctttcat tgatttctca      1380
     agaaaccaga tccgatcatc tctcccttcc acaatcctct caattcacaa cctacaggcg      1440
     tttttagtcg ccgataactt tatctccggc gaagttccag accaattcca ggattgtcct      1500
     tcactctcta atctcgatct ctcatcaaac actctcactg gcactatccc ttcaagcatt      1560
     gcttcatgcg agaagctcgt aagcctcaac ctaagaaata ataacctcac cggcgaaatc      1620
     cctagacaga tcacgacaat gtctgcatta gcagtgctag atctctccaa caattcctta      1680
     accggagtac taccagagag catcggaaca tctccagctc tggaactcct aaacgtctca      1740
     tacaacaagc tcacaggtcc agtccctatc aacggctttc tcaaaaccat aaatccagat      1800
     gatctaagag gaaactccgg tctctgcggc ggcgttctac caccgtgtag taaattccaa      1860
     agagcaacat cgagtcacag tagcctccac gggaaacgaa ttgtcgccgg atggttgatt      1920
     gggatagcat cggttctagc tctagggatt ctcaccattg ttacgagaac tctgtacaag      1980
     aaatggtatt ctaacggatt ctgcggcgac gagacggcga gcaaaggtga atggccttgg      2040
     agattaatgg cgtttcatag attagggttt acagcttccg atatcttggc atgtatcaaa      2100
     gaatcaaaca tgatcggaat gggagcaacc ggaatcgtgt acaaagcaga aatgtcacga      2160
     tcaagcacag ttctcgccgt gaagaagctc tggagatctg ccgcggatat tgaagatgga      2220
     accaccggag atttcgtagg cgaagttaac ctcctcggga aattgagaca cagaaacata      2280
     gtgaggctcc tagggttctt atacaacgac aaaaacatga tgatcgtata tgaattcatg      2340
     ctcaacggaa accttggtga tgcgattcac ggcaaaaacg ccgccgggag acttctcgtt      2400
     gattgggttt cgcgttacaa catcgcgtta ggtgtagctc acggcctcgc ttacctccac      2460
     catgattgtc atcctccggt gattcacaga gacatcaaat ccaacaatat cttgctcgac      2520
     gcgaatctcg acgccagaat cgccgatttt ggcctcgcca ggatgatggc gaggaagaaa      2580
     gaaaccgttt caatggtcgc cggttcttac ggttacattg ctcccgagta tggatacact      2640
     ttgaaggtgg atgagaagat agacatatac agctacggcg tcgtactatt ggagctgtta      2700
     accggaagaa gaccattgga accggagttt ggagaatcag tagacattgt ggagtgggtg      2760
     agaaggaaga taagagacaa catatcacta gaagaagcat tagatcctaa cgtaggaaac      2820
     tgcagatatg tgcaagaaga gatgctttta gttctacaga ttgctcttct ctgcactaca      2880
     aagctcccga aagacagacc ttcgatgaga gatgtgatat cgatgctcgg agaggctaaa      2940
     ccgaggagga aaagtaatag taatgaagag aacactagtc gtagcttggc cgagaaacat      3000
     tcatcggttt ttagtacttc acctgtaaat ggccttctt                             3039
//

If you have problems or comments...

PBIL Back to PBIL home page