(data stored in ACNUC32233 zone)

EMBL: FJ811850

ID   FJ811850; SV 1; linear; genomic DNA; STD; HUM; 468 BP.
XX
AC   FJ811850;
XX
DT   05-APR-2009 (Rel. 100, Created)
DT   05-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens isolate YQZ SPTBN2 protein (SPTBN2) gene, exons 1, 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-468
RA   Yuan Y., Zhou X., Deng G.;
RT   "Mutation screening for SPTBN2 gene in cerebellar atrophy family";
RL   Unpublished.
XX
RN   [2]
RP   1-468
RA   Yuan Y., Zhou X., Deng G.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   Wuhan University School of Medicine, Center for Gene Diagnosis, No. 169,
RL   Donghu Road, Wuhan, Hubei 430071, P.R. China
XX
DR   MD5; 85b6417213ef6408f5f5591c6b6d79ff.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..468
FT                   /organism="Homo sapiens"
FT                   /isolate="YQZ"
FT                   /mol_type="genomic DNA"
FT                   /note="cerebellar atrophy patient"
FT                   /db_xref="taxon:9606"
FT   gene            complement(<1..378)
FT                   /gene="SPTBN2"
FT   mRNA            complement(join(<63..241,329..378))
FT                   /gene="SPTBN2"
FT                   /product="SPTBN2 protein"
FT   exon            complement(63..241)
FT                   /gene="SPTBN2"
FT                   /number=2
FT   CDS_pept        complement(<63..219)
FT                   /codon_start=1
FT                   /gene="SPTBN2"
FT                   /product="SPTBN2 protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1KC08"
FT                   /protein_id="ACO36918.1"
FT                   /translation="MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFER
FT                   SRIKALA"
FT   variation       complement(283)
FT                   /gene="SPTBN2"
FT                   /replace="c"
FT   exon            complement(329..378)
FT                   /gene="SPTBN2"
FT                   /number=1
XX
SQ   Sequence 468 BP; 95 A; 141 C; 139 G; 93 T; 0 other;
     tcatgacgag ctgacaaagc ctcctccagc atccccccac ctcgaccctc ctctgacctc        60
     acctgccaga gccttaatgc gagacctctc aaagaggcgg gccgagctgc tgtcattgtc       120
     ccagtccgag tcaggaaggt cccagcggtt gttgatgtca ctgtactggc cctggatttc       180
     caagctgtca aagtctgtgg gtgacagcgt gctgctcatg gtggtaggcg gcttcctgct       240
     cctgcaagga gaatgtggcc agtgaggggt gtccagggac catcaagccc tccactcacc       300
     accggggcct tctgtcttct tgccctacct gtgctccgct ctccttgtgg ccagaggctg       360
     cggttggctg ctcagtggaa atcagccccc aggggaagag gggaagccac ctgggaagcc       420
     tggggacggg aatacatcag aagcacagaa agtgaagcag gaaggcag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page