(data stored in ACNUC18020 zone)

EMBL: FJ891060

ID   FJ891060; SV 1; linear; mRNA; STD; VRT; 125 BP.
XX
AC   FJ891060;
XX
DT   27-APR-2009 (Rel. 100, Created)
DT   27-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Gallus gallus beta-actin mRNA, partial cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-125
RA   Das S., Bera A.K., Bandyopadhyay S., Rana T., Pan D., Bhattacharya S.,
RA   Das S.K., Bhattacharya D.;
RT   ;
RL   Submitted (30-MAR-2009) to the INSDC.
RL   Eastern Regional Station, Indian Veterinary Research Institute, 37,
RL   Belgachia Road, Kolkata, WestBengal 700037, India
XX
DR   MD5; 15d7ec393f8c57568fe6e17d8a07a1b9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..125
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /note="breed: broiler"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        <1..>125
FT                   /codon_start=3
FT                   /product="beta-actin"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:C3VQ53"
FT                   /protein_id="ACP21237.1"
FT                   /translation="IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE"
XX
SQ   Sequence 125 BP; 28 A; 46 C; 29 G; 22 T; 0 other;
     ccatctatga aggctacgcc ctcccccacg ccatcctccg tctggatctg gctggccgtg        60
     acctgacgga ctacctcatg aagatcctga cagagagagg ctacagcttc accaccacag       120
     ccgag                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page