(data stored in ACNUC1104 zone)

EMBL: FM162591

ID   FM162591; SV 1; circular; genomic DNA; STD; PRO; 5064808 BP.
XX
AC   FM162591;
XX
PR   Project:PRJEA30577;
XX
DT   14-JUL-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Photorhabdus asymbiotica ATCC43949 complete genome
XX
KW   complete genome.
XX
OS   Photorhabdus asymbiotica
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Morganellaceae; Photorhabdus.
XX
RN   [1]
RP   1-5064808
RA   Crossman L.C.;
RT   ;
RL   Submitted (21-MAY-2008) to the INSDC.
RL   Crossman L.C., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-10-302.
RX   PUBMED; 19583835.
RA   Wilkinson P., Waterfield N.R., Crossman L., Corton C.,
RA   Sanchez-Contreras M., Vlisidou I., Barron A., Bignell A., Clark L.,
RA   Doggett J., Ormond D., Mayho M., Bason N., Smith F., Simmonds M.,
RA   Arrowsmith C., Churcher C., Harris D., Thompson N.R., Quail M.,
RA   Parkhill J., Ffrench-Constant R.H.;
RT   "Comparative genomics of the emerging human pathogen Photorhabdus
RT   asymbiotica with the insect pathogen Photorhabdus luminescens";
RL   BMC Genomics 10(1):302-302(2009).
XX
DR   MD5; 02e3ee26153af32ab5722c8647e1f79b.
DR   BioSample; SAMEA2272210.
DR   EnsemblGenomes-Gn; EBG00000038738.
DR   EnsemblGenomes-Gn; EBG00000038740.
DR   EnsemblGenomes-Gn; EBG00000038742.
DR   EnsemblGenomes-Gn; EBG00000038743.
DR   EnsemblGenomes-Gn; EBG00000038744.
DR   EnsemblGenomes-Gn; EBG00000038745.
DR   EnsemblGenomes-Gn; EBG00000038746.
DR   EnsemblGenomes-Gn; EBG00000038747.
DR   EnsemblGenomes-Gn; EBG00000038748.
DR   EnsemblGenomes-Gn; EBG00000038749.
DR   EnsemblGenomes-Gn; EBG00000038750.
DR   EnsemblGenomes-Gn; EBG00000038751.
DR   EnsemblGenomes-Gn; EBG00000038752.
DR   EnsemblGenomes-Gn; EBG00000038753.
DR   EnsemblGenomes-Gn; EBG00000038754.
DR   EnsemblGenomes-Gn; EBG00000038755.
DR   EnsemblGenomes-Gn; EBG00000038756.
DR   EnsemblGenomes-Gn; EBG00000038757.
DR   EnsemblGenomes-Gn; EBG00000038758.
DR   EnsemblGenomes-Gn; EBG00000038759.
DR   EnsemblGenomes-Gn; EBG00000038760.
DR   EnsemblGenomes-Gn; EBG00000038761.
DR   EnsemblGenomes-Gn; EBG00000038762.
DR   EnsemblGenomes-Gn; EBG00000038763.
DR   EnsemblGenomes-Gn; EBG00000038764.
DR   EnsemblGenomes-Gn; EBG00000038765.
DR   EnsemblGenomes-Gn; EBG00000038766.
DR   EnsemblGenomes-Gn; EBG00000038767.
DR   EnsemblGenomes-Gn; EBG00000038768.
DR   EnsemblGenomes-Gn; EBG00000038769.
DR   EnsemblGenomes-Gn; EBG00000038770.
DR   EnsemblGenomes-Gn; EBG00000038771.
DR   EnsemblGenomes-Gn; EBG00000038772.
DR   EnsemblGenomes-Gn; EBG00000038773.
DR   EnsemblGenomes-Gn; EBG00000038774.
DR   EnsemblGenomes-Gn; EBG00000038775.
DR   EnsemblGenomes-Gn; EBG00000038776.
DR   EnsemblGenomes-Gn; EBG00000038777.
DR   EnsemblGenomes-Gn; EBG00000038778.
DR   EnsemblGenomes-Gn; EBG00000038779.
DR   EnsemblGenomes-Gn; EBG00000038780.
DR   EnsemblGenomes-Gn; EBG00000038781.
DR   EnsemblGenomes-Gn; EBG00000038782.
DR   EnsemblGenomes-Gn; EBG00000038783.
DR   EnsemblGenomes-Gn; EBG00000038784.
DR   EnsemblGenomes-Gn; EBG00000038785.
DR   EnsemblGenomes-Gn; EBG00000038786.
DR   EnsemblGenomes-Gn; EBG00000038787.
DR   EnsemblGenomes-Gn; EBG00000038788.
DR   EnsemblGenomes-Gn; EBG00000038789.
DR   EnsemblGenomes-Gn; EBG00000038790.
DR   EnsemblGenomes-Gn; EBG00000038791.
DR   EnsemblGenomes-Gn; EBG00000038792.
DR   EnsemblGenomes-Gn; EBG00000038793.
DR   EnsemblGenomes-Gn; EBG00000038794.
DR   EnsemblGenomes-Gn; EBG00000038795.
DR   EnsemblGenomes-Gn; EBG00000038796.
DR   EnsemblGenomes-Gn; EBG00000038798.
DR   EnsemblGenomes-Gn; EBG00000038800.
DR   EnsemblGenomes-Gn; EBG00000038802.
DR   EnsemblGenomes-Gn; EBG00000038803.
DR   EnsemblGenomes-Gn; EBG00000038804.
DR   EnsemblGenomes-Gn; EBG00000038805.
DR   EnsemblGenomes-Gn; EBG00000038806.
DR   EnsemblGenomes-Gn; EBG00000038807.
DR   EnsemblGenomes-Gn; EBG00000038808.
DR   EnsemblGenomes-Gn; EBG00000038809.
DR   EnsemblGenomes-Gn; EBG00000038810.
DR   EnsemblGenomes-Gn; EBG00000038811.
DR   EnsemblGenomes-Gn; EBG00000038812.
DR   EnsemblGenomes-Gn; EBG00000038813.
DR   EnsemblGenomes-Gn; EBG00000038814.
DR   EnsemblGenomes-Gn; EBG00000038815.
DR   EnsemblGenomes-Gn; EBG00000038816.
DR   EnsemblGenomes-Gn; EBG00000038817.
DR   EnsemblGenomes-Gn; EBG00000038818.
DR   EnsemblGenomes-Gn; EBG00000038819.
DR   EnsemblGenomes-Gn; EBG00000038820.
DR   EnsemblGenomes-Gn; EBG00000038821.
DR   EnsemblGenomes-Gn; EBG00000038822.
DR   EnsemblGenomes-Gn; EBG00000038823.
DR   EnsemblGenomes-Gn; EBG00000038824.
DR   EnsemblGenomes-Gn; EBG00000038825.
DR   EnsemblGenomes-Gn; EBG00000038826.
DR   EnsemblGenomes-Gn; EBG00000038827.
DR   EnsemblGenomes-Gn; EBG00000038828.
DR   EnsemblGenomes-Gn; EBG00000038829.
DR   EnsemblGenomes-Gn; EBG00000038830.
DR   EnsemblGenomes-Gn; EBG00000038831.
DR   EnsemblGenomes-Gn; EBG00000038832.
DR   EnsemblGenomes-Gn; EBG00000038833.
DR   EnsemblGenomes-Gn; EBG00000038835.
DR   EnsemblGenomes-Gn; EBG00000038837.
DR   EnsemblGenomes-Gn; EBG00000038839.
DR   EnsemblGenomes-Gn; EBG00000038840.
DR   EnsemblGenomes-Gn; EBG00000038841.
DR   EnsemblGenomes-Gn; EBG00000038842.
DR   EnsemblGenomes-Gn; EBG00000038843.
DR   EnsemblGenomes-Gn; EBG00000038844.
DR   EnsemblGenomes-Gn; EBG00000038845.
DR   EnsemblGenomes-Gn; EBG00000038846.
DR   EnsemblGenomes-Gn; EBG00000038847.
DR   EnsemblGenomes-Gn; EBG00000038848.
DR   EnsemblGenomes-Gn; EBG00000038849.
DR   EnsemblGenomes-Gn; EBG00000038850.
DR   EnsemblGenomes-Gn; EBG00000038851.
DR   EnsemblGenomes-Gn; EBG00000038852.
DR   EnsemblGenomes-Gn; EBG00000038853.
DR   EnsemblGenomes-Gn; EBG00000038854.
DR   EnsemblGenomes-Gn; EBG00000038855.
DR   EnsemblGenomes-Gn; EBG00000038856.
DR   EnsemblGenomes-Gn; EBG00000038857.
DR   EnsemblGenomes-Gn; EBG00000038858.
DR   EnsemblGenomes-Gn; EBG00000038859.
DR   EnsemblGenomes-Gn; EBG00000038860.
DR   EnsemblGenomes-Gn; EBG00001215977.
DR   EnsemblGenomes-Gn; EBG00001215978.
DR   EnsemblGenomes-Gn; EBG00001215979.
DR   EnsemblGenomes-Gn; EBG00001215980.
DR   EnsemblGenomes-Gn; EBG00001215981.
DR   EnsemblGenomes-Gn; EBG00001215982.
DR   EnsemblGenomes-Gn; EBG00001215983.
DR   EnsemblGenomes-Gn; EBG00001215984.
DR   EnsemblGenomes-Gn; EBG00001215985.
DR   EnsemblGenomes-Gn; EBG00001215986.
DR   EnsemblGenomes-Gn; EBG00001215987.
DR   EnsemblGenomes-Gn; EBG00001215988.
DR   EnsemblGenomes-Gn; EBG00001215989.
DR   EnsemblGenomes-Gn; EBG00001215990.
DR   EnsemblGenomes-Gn; EBG00001215991.
DR   EnsemblGenomes-Gn; EBG00001215992.
DR   EnsemblGenomes-Gn; EBG00001215993.
DR   EnsemblGenomes-Gn; EBG00001215994.
DR   EnsemblGenomes-Gn; EBG00001215995.
DR   EnsemblGenomes-Gn; EBG00001215996.
DR   EnsemblGenomes-Gn; EBG00001215997.
DR   EnsemblGenomes-Gn; EBG00001215998.
DR   EnsemblGenomes-Gn; EBG00001215999.
DR   EnsemblGenomes-Gn; EBG00001216000.
DR   EnsemblGenomes-Gn; EBG00001216001.
DR   EnsemblGenomes-Gn; EBG00001216002.
DR   EnsemblGenomes-Gn; EBG00001216003.
DR   EnsemblGenomes-Gn; EBG00001216004.
DR   EnsemblGenomes-Gn; EBG00001216005.
DR   EnsemblGenomes-Gn; EBG00001216006.
DR   EnsemblGenomes-Gn; EBG00001216007.
DR   EnsemblGenomes-Gn; EBG00001216008.
DR   EnsemblGenomes-Gn; EBG00001216009.
DR   EnsemblGenomes-Gn; EBG00001216010.
DR   EnsemblGenomes-Gn; EBG00001216011.
DR   EnsemblGenomes-Gn; EBG00001216012.
DR   EnsemblGenomes-Gn; EBG00001216013.
DR   EnsemblGenomes-Gn; EBG00001216014.
DR   EnsemblGenomes-Gn; EBG00001216015.
DR   EnsemblGenomes-Gn; EBG00001216016.
DR   EnsemblGenomes-Gn; EBG00001216017.
DR   EnsemblGenomes-Gn; EBG00001216018.
DR   EnsemblGenomes-Gn; EBG00001216019.
DR   EnsemblGenomes-Gn; EBG00001216020.
DR   EnsemblGenomes-Gn; EBG00001216021.
DR   EnsemblGenomes-Gn; EBG00001216022.
DR   EnsemblGenomes-Gn; EBG00001216023.
DR   EnsemblGenomes-Gn; EBG00001216024.
DR   EnsemblGenomes-Gn; EBG00001216025.
DR   EnsemblGenomes-Gn; EBG00001216026.
DR   EnsemblGenomes-Gn; EBG00001216027.
DR   EnsemblGenomes-Gn; EBG00001216028.
DR   EnsemblGenomes-Gn; EBG00001216029.
DR   EnsemblGenomes-Gn; EBG00001216030.
DR   EnsemblGenomes-Gn; EBG00001216031.
DR   EnsemblGenomes-Gn; EBG00001216032.
DR   EnsemblGenomes-Gn; EBG00001216033.
DR   EnsemblGenomes-Gn; EBG00001216034.
DR   EnsemblGenomes-Gn; EBG00001216035.
DR   EnsemblGenomes-Gn; EBG00001216036.
DR   EnsemblGenomes-Gn; EBG00001216037.
DR   EnsemblGenomes-Gn; EBG00001216038.
DR   EnsemblGenomes-Gn; EBG00001216039.
DR   EnsemblGenomes-Gn; EBG00001216040.
DR   EnsemblGenomes-Gn; EBG00001216041.
DR   EnsemblGenomes-Gn; EBG00001216042.
DR   EnsemblGenomes-Gn; EBG00001216043.
DR   EnsemblGenomes-Gn; EBG00001216044.
DR   EnsemblGenomes-Gn; EBG00001216045.
DR   EnsemblGenomes-Gn; EBG00001216046.
DR   EnsemblGenomes-Gn; EBG00001216047.
DR   EnsemblGenomes-Gn; EBG00001216048.
DR   EnsemblGenomes-Gn; EBG00001216049.
DR   EnsemblGenomes-Gn; EBG00001216050.
DR   EnsemblGenomes-Gn; EBG00001216051.
DR   EnsemblGenomes-Gn; EBG00001216052.
DR   EnsemblGenomes-Gn; EBG00001216053.
DR   EnsemblGenomes-Gn; EBG00001216054.
DR   EnsemblGenomes-Gn; EBG00001216055.
DR   EnsemblGenomes-Gn; EBG00001216056.
DR   EnsemblGenomes-Gn; EBG00001216057.
DR   EnsemblGenomes-Gn; EBG00001216058.
DR   EnsemblGenomes-Gn; EBG00001216059.
DR   EnsemblGenomes-Gn; EBG00001216060.
DR   EnsemblGenomes-Gn; EBG00001216061.
DR   EnsemblGenomes-Gn; EBG00001216062.
DR   EnsemblGenomes-Gn; EBG00001216063.
DR   EnsemblGenomes-Gn; EBG00001216064.
DR   EnsemblGenomes-Gn; EBG00001216065.
DR   EnsemblGenomes-Gn; EBG00001216066.
DR   EnsemblGenomes-Gn; EBG00001216067.
DR   EnsemblGenomes-Gn; EBG00001216068.
DR   EnsemblGenomes-Gn; EBG00001216069.
DR   EnsemblGenomes-Gn; EBG00001216070.
DR   EnsemblGenomes-Gn; EBG00001216071.
DR   EnsemblGenomes-Gn; EBG00001216072.
DR   EnsemblGenomes-Gn; EBG00001216073.
DR   EnsemblGenomes-Gn; EBG00001216074.
DR   EnsemblGenomes-Gn; EBG00001216075.
DR   EnsemblGenomes-Gn; EBG00001216076.
DR   EnsemblGenomes-Gn; EBG00001216077.
DR   EnsemblGenomes-Gn; EBG00001216078.
DR   EnsemblGenomes-Gn; EBG00001216079.
DR   EnsemblGenomes-Gn; EBG00001216080.
DR   EnsemblGenomes-Gn; EBG00001216081.
DR   EnsemblGenomes-Gn; EBG00001216082.
DR   EnsemblGenomes-Gn; EBG00001216083.
DR   EnsemblGenomes-Gn; EBG00001216084.
DR   EnsemblGenomes-Gn; EBG00001216085.
DR   EnsemblGenomes-Gn; EBG00001216086.
DR   EnsemblGenomes-Gn; EBG00001216087.
DR   EnsemblGenomes-Gn; EBG00001216088.
DR   EnsemblGenomes-Gn; EBG00001216089.
DR   EnsemblGenomes-Gn; EBG00001216090.
DR   EnsemblGenomes-Gn; EBG00001216091.
DR   EnsemblGenomes-Gn; EBG00001216092.
DR   EnsemblGenomes-Gn; EBG00001216093.
DR   EnsemblGenomes-Gn; EBG00001216094.
DR   EnsemblGenomes-Gn; EBG00001216095.
DR   EnsemblGenomes-Gn; EBG00001216096.
DR   EnsemblGenomes-Gn; EBG00001216097.
DR   EnsemblGenomes-Gn; EBG00001216098.
DR   EnsemblGenomes-Gn; EBG00001216099.
DR   EnsemblGenomes-Gn; EBG00001216100.
DR   EnsemblGenomes-Gn; EBG00001216101.
DR   EnsemblGenomes-Gn; EBG00001216102.
DR   EnsemblGenomes-Gn; EBG00001216103.
DR   EnsemblGenomes-Gn; EBG00001216104.
DR   EnsemblGenomes-Gn; EBG00001216105.
DR   EnsemblGenomes-Gn; EBG00001216106.
DR   EnsemblGenomes-Gn; EBG00001216107.
DR   EnsemblGenomes-Gn; EBG00001216108.
DR   EnsemblGenomes-Gn; EBG00001216109.
DR   EnsemblGenomes-Gn; EBG00001216110.
DR   EnsemblGenomes-Gn; EBG00001216111.
DR   EnsemblGenomes-Gn; EBG00001216112.
DR   EnsemblGenomes-Gn; EBG00001216113.
DR   EnsemblGenomes-Gn; EBG00001216114.
DR   EnsemblGenomes-Gn; EBG00001216115.
DR   EnsemblGenomes-Gn; EBG00001216116.
DR   EnsemblGenomes-Gn; EBG00001216117.
DR   EnsemblGenomes-Gn; EBG00001216118.
DR   EnsemblGenomes-Gn; EBG00001216119.
DR   EnsemblGenomes-Gn; EBG00001216120.
DR   EnsemblGenomes-Gn; EBG00001216121.
DR   EnsemblGenomes-Gn; EBG00001216122.
DR   EnsemblGenomes-Gn; EBG00001216123.
DR   EnsemblGenomes-Gn; EBG00001216124.
DR   EnsemblGenomes-Gn; EBG00001216125.
DR   EnsemblGenomes-Gn; EBG00001216126.
DR   EnsemblGenomes-Gn; EBG00001216127.
DR   EnsemblGenomes-Gn; EBG00001216128.
DR   EnsemblGenomes-Gn; EBG00001216129.
DR   EnsemblGenomes-Gn; EBG00001216130.
DR   EnsemblGenomes-Gn; EBG00001216131.
DR   EnsemblGenomes-Gn; EBG00001216132.
DR   EnsemblGenomes-Gn; EBG00001216133.
DR   EnsemblGenomes-Gn; EBG00001216134.
DR   EnsemblGenomes-Gn; EBG00001216135.
DR   EnsemblGenomes-Gn; EBG00001216136.
DR   EnsemblGenomes-Gn; EBG00001216137.
DR   EnsemblGenomes-Gn; EBG00001216138.
DR   EnsemblGenomes-Gn; EBG00001216139.
DR   EnsemblGenomes-Gn; EBG00001216140.
DR   EnsemblGenomes-Gn; EBG00001216141.
DR   EnsemblGenomes-Gn; EBG00001216142.
DR   EnsemblGenomes-Gn; EBG00001216143.
DR   EnsemblGenomes-Gn; EBG00001216144.
DR   EnsemblGenomes-Gn; EBG00001216145.
DR   EnsemblGenomes-Gn; EBG00001216146.
DR   EnsemblGenomes-Gn; EBG00001216147.
DR   EnsemblGenomes-Gn; EBG00001216148.
DR   EnsemblGenomes-Gn; EBG00001216149.
DR   EnsemblGenomes-Gn; EBG00001216150.
DR   EnsemblGenomes-Gn; EBG00001216151.
DR   EnsemblGenomes-Gn; EBG00001216152.
DR   EnsemblGenomes-Gn; EBG00001216153.
DR   EnsemblGenomes-Gn; EBG00001216154.
DR   EnsemblGenomes-Gn; EBG00001216155.
DR   EnsemblGenomes-Gn; EBG00001216156.
DR   EnsemblGenomes-Gn; EBG00001216157.
DR   EnsemblGenomes-Gn; EBG00001216158.
DR   EnsemblGenomes-Gn; EBG00001216159.
DR   EnsemblGenomes-Gn; EBG00001216160.
DR   EnsemblGenomes-Gn; EBG00001216161.
DR   EnsemblGenomes-Gn; EBG00001216162.
DR   EnsemblGenomes-Gn; EBG00001216163.
DR   EnsemblGenomes-Gn; EBG00001216164.
DR   EnsemblGenomes-Gn; EBG00001216165.
DR   EnsemblGenomes-Gn; EBG00001216166.
DR   EnsemblGenomes-Gn; EBG00001216167.
DR   EnsemblGenomes-Gn; EBG00001216168.
DR   EnsemblGenomes-Gn; EBG00001216169.
DR   EnsemblGenomes-Gn; EBG00001216170.
DR   EnsemblGenomes-Gn; EBG00001216171.
DR   EnsemblGenomes-Gn; EBG00001216172.
DR   EnsemblGenomes-Gn; EBG00001216173.
DR   EnsemblGenomes-Gn; EBG00001216174.
DR   EnsemblGenomes-Gn; EBG00001216175.
DR   EnsemblGenomes-Gn; EBG00001216176.
DR   EnsemblGenomes-Gn; EBG00001216177.
DR   EnsemblGenomes-Gn; EBG00001216178.
DR   EnsemblGenomes-Gn; EBG00001216179.
DR   EnsemblGenomes-Gn; EBG00001216180.
DR   EnsemblGenomes-Gn; EBG00001216181.
DR   EnsemblGenomes-Gn; PAU_00312.
DR   EnsemblGenomes-Gn; PAU_01509.
DR   EnsemblGenomes-Gn; PAU_02458A.
DR   EnsemblGenomes-Gn; PAU_02956.
DR   EnsemblGenomes-Gn; PAU_03761.
DR   EnsemblGenomes-Tr; EBG00000038738-1.
DR   EnsemblGenomes-Tr; EBG00000038740-1.
DR   EnsemblGenomes-Tr; EBG00000038742-1.
DR   EnsemblGenomes-Tr; EBG00000038743-1.
DR   EnsemblGenomes-Tr; EBG00000038744-1.
DR   EnsemblGenomes-Tr; EBG00000038745-1.
DR   EnsemblGenomes-Tr; EBG00000038746-1.
DR   EnsemblGenomes-Tr; EBG00000038747-1.
DR   EnsemblGenomes-Tr; EBG00000038748-1.
DR   EnsemblGenomes-Tr; EBG00000038749-1.
DR   EnsemblGenomes-Tr; EBG00000038750-1.
DR   EnsemblGenomes-Tr; EBG00000038751-1.
DR   EnsemblGenomes-Tr; EBG00000038752-1.
DR   EnsemblGenomes-Tr; EBG00000038753-1.
DR   EnsemblGenomes-Tr; EBG00000038754-1.
DR   EnsemblGenomes-Tr; EBG00000038755-1.
DR   EnsemblGenomes-Tr; EBG00000038756-1.
DR   EnsemblGenomes-Tr; EBG00000038757-1.
DR   EnsemblGenomes-Tr; EBG00000038758-1.
DR   EnsemblGenomes-Tr; EBG00000038759-1.
DR   EnsemblGenomes-Tr; EBG00000038760-1.
DR   EnsemblGenomes-Tr; EBG00000038761-1.
DR   EnsemblGenomes-Tr; EBG00000038762-1.
DR   EnsemblGenomes-Tr; EBG00000038763-1.
DR   EnsemblGenomes-Tr; EBG00000038764-1.
DR   EnsemblGenomes-Tr; EBG00000038765-1.
DR   EnsemblGenomes-Tr; EBG00000038766-1.
DR   EnsemblGenomes-Tr; EBG00000038767-1.
DR   EnsemblGenomes-Tr; EBG00000038768-1.
DR   EnsemblGenomes-Tr; EBG00000038769-1.
DR   EnsemblGenomes-Tr; EBG00000038770-1.
DR   EnsemblGenomes-Tr; EBG00000038771-1.
DR   EnsemblGenomes-Tr; EBG00000038772-1.
DR   EnsemblGenomes-Tr; EBG00000038773-1.
DR   EnsemblGenomes-Tr; EBG00000038774-1.
DR   EnsemblGenomes-Tr; EBG00000038775-1.
DR   EnsemblGenomes-Tr; EBG00000038776-1.
DR   EnsemblGenomes-Tr; EBG00000038777-1.
DR   EnsemblGenomes-Tr; EBG00000038778-1.
DR   EnsemblGenomes-Tr; EBG00000038779-1.
DR   EnsemblGenomes-Tr; EBG00000038780-1.
DR   EnsemblGenomes-Tr; EBG00000038781-1.
DR   EnsemblGenomes-Tr; EBG00000038782-1.
DR   EnsemblGenomes-Tr; EBG00000038783-1.
DR   EnsemblGenomes-Tr; EBG00000038784-1.
DR   EnsemblGenomes-Tr; EBG00000038785-1.
DR   EnsemblGenomes-Tr; EBG00000038786-1.
DR   EnsemblGenomes-Tr; EBG00000038787-1.
DR   EnsemblGenomes-Tr; EBG00000038788-1.
DR   EnsemblGenomes-Tr; EBG00000038789-1.
DR   EnsemblGenomes-Tr; EBG00000038790-1.
DR   EnsemblGenomes-Tr; EBG00000038791-1.
DR   EnsemblGenomes-Tr; EBG00000038792-1.
DR   EnsemblGenomes-Tr; EBG00000038793-1.
DR   EnsemblGenomes-Tr; EBG00000038794-1.
DR   EnsemblGenomes-Tr; EBG00000038795-1.
DR   EnsemblGenomes-Tr; EBG00000038796-1.
DR   EnsemblGenomes-Tr; EBG00000038798-1.
DR   EnsemblGenomes-Tr; EBG00000038800-1.
DR   EnsemblGenomes-Tr; EBG00000038802-1.
DR   EnsemblGenomes-Tr; EBG00000038803-1.
DR   EnsemblGenomes-Tr; EBG00000038804-1.
DR   EnsemblGenomes-Tr; EBG00000038805-1.
DR   EnsemblGenomes-Tr; EBG00000038806-1.
DR   EnsemblGenomes-Tr; EBG00000038807-1.
DR   EnsemblGenomes-Tr; EBG00000038808-1.
DR   EnsemblGenomes-Tr; EBG00000038809-1.
DR   EnsemblGenomes-Tr; EBG00000038810-1.
DR   EnsemblGenomes-Tr; EBG00000038811-1.
DR   EnsemblGenomes-Tr; EBG00000038812-1.
DR   EnsemblGenomes-Tr; EBG00000038813-1.
DR   EnsemblGenomes-Tr; EBG00000038814-1.
DR   EnsemblGenomes-Tr; EBG00000038815-1.
DR   EnsemblGenomes-Tr; EBG00000038816-1.
DR   EnsemblGenomes-Tr; EBG00000038817-1.
DR   EnsemblGenomes-Tr; EBG00000038818-1.
DR   EnsemblGenomes-Tr; EBG00000038819-1.
DR   EnsemblGenomes-Tr; EBG00000038820-1.
DR   EnsemblGenomes-Tr; EBG00000038821-1.
DR   EnsemblGenomes-Tr; EBG00000038822-1.
DR   EnsemblGenomes-Tr; EBG00000038823-1.
DR   EnsemblGenomes-Tr; EBG00000038824-1.
DR   EnsemblGenomes-Tr; EBG00000038825-1.
DR   EnsemblGenomes-Tr; EBG00000038826-1.
DR   EnsemblGenomes-Tr; EBG00000038827-1.
DR   EnsemblGenomes-Tr; EBG00000038828-1.
DR   EnsemblGenomes-Tr; EBG00000038829-1.
DR   EnsemblGenomes-Tr; EBG00000038830-1.
DR   EnsemblGenomes-Tr; EBG00000038831-1.
DR   EnsemblGenomes-Tr; EBG00000038832-1.
DR   EnsemblGenomes-Tr; EBG00000038833-1.
DR   EnsemblGenomes-Tr; EBG00000038835-1.
DR   EnsemblGenomes-Tr; EBG00000038837-1.
DR   EnsemblGenomes-Tr; EBG00000038839-1.
DR   EnsemblGenomes-Tr; EBG00000038840-1.
DR   EnsemblGenomes-Tr; EBG00000038841-1.
DR   EnsemblGenomes-Tr; EBG00000038842-1.
DR   EnsemblGenomes-Tr; EBG00000038843-1.
DR   EnsemblGenomes-Tr; EBG00000038844-1.
DR   EnsemblGenomes-Tr; EBG00000038845-1.
DR   EnsemblGenomes-Tr; EBG00000038846-1.
DR   EnsemblGenomes-Tr; EBG00000038847-1.
DR   EnsemblGenomes-Tr; EBG00000038848-1.
DR   EnsemblGenomes-Tr; EBG00000038849-1.
DR   EnsemblGenomes-Tr; EBG00000038850-1.
DR   EnsemblGenomes-Tr; EBG00000038851-1.
DR   EnsemblGenomes-Tr; EBG00000038852-1.
DR   EnsemblGenomes-Tr; EBG00000038853-1.
DR   EnsemblGenomes-Tr; EBG00000038854-1.
DR   EnsemblGenomes-Tr; EBG00000038855-1.
DR   EnsemblGenomes-Tr; EBG00000038856-1.
DR   EnsemblGenomes-Tr; EBG00000038857-1.
DR   EnsemblGenomes-Tr; EBG00000038858-1.
DR   EnsemblGenomes-Tr; EBG00000038859-1.
DR   EnsemblGenomes-Tr; EBG00000038860-1.
DR   EnsemblGenomes-Tr; EBT00001785847.
DR   EnsemblGenomes-Tr; EBT00001785848.
DR   EnsemblGenomes-Tr; EBT00001785849.
DR   EnsemblGenomes-Tr; EBT00001785851.
DR   EnsemblGenomes-Tr; EBT00001785852.
DR   EnsemblGenomes-Tr; EBT00001785853.
DR   EnsemblGenomes-Tr; EBT00001785854.
DR   EnsemblGenomes-Tr; EBT00001785855.
DR   EnsemblGenomes-Tr; EBT00001785856.
DR   EnsemblGenomes-Tr; EBT00001785857.
DR   EnsemblGenomes-Tr; EBT00001785859.
DR   EnsemblGenomes-Tr; EBT00001785860.
DR   EnsemblGenomes-Tr; EBT00001785861.
DR   EnsemblGenomes-Tr; EBT00001785862.
DR   EnsemblGenomes-Tr; EBT00001785863.
DR   EnsemblGenomes-Tr; EBT00001785864.
DR   EnsemblGenomes-Tr; EBT00001785865.
DR   EnsemblGenomes-Tr; EBT00001785866.
DR   EnsemblGenomes-Tr; EBT00001785867.
DR   EnsemblGenomes-Tr; EBT00001785868.
DR   EnsemblGenomes-Tr; EBT00001785869.
DR   EnsemblGenomes-Tr; EBT00001785870.
DR   EnsemblGenomes-Tr; EBT00001785871.
DR   EnsemblGenomes-Tr; EBT00001785872.
DR   EnsemblGenomes-Tr; EBT00001785873.
DR   EnsemblGenomes-Tr; EBT00001785874.
DR   EnsemblGenomes-Tr; EBT00001785875.
DR   EnsemblGenomes-Tr; EBT00001785876.
DR   EnsemblGenomes-Tr; EBT00001785877.
DR   EnsemblGenomes-Tr; EBT00001785878.
DR   EnsemblGenomes-Tr; EBT00001785881.
DR   EnsemblGenomes-Tr; EBT00001785883.
DR   EnsemblGenomes-Tr; EBT00001785885.
DR   EnsemblGenomes-Tr; EBT00001785886.
DR   EnsemblGenomes-Tr; EBT00001785887.
DR   EnsemblGenomes-Tr; EBT00001785888.
DR   EnsemblGenomes-Tr; EBT00001785889.
DR   EnsemblGenomes-Tr; EBT00001785890.
DR   EnsemblGenomes-Tr; EBT00001785891.
DR   EnsemblGenomes-Tr; EBT00001785892.
DR   EnsemblGenomes-Tr; EBT00001785893.
DR   EnsemblGenomes-Tr; EBT00001785894.
DR   EnsemblGenomes-Tr; EBT00001785895.
DR   EnsemblGenomes-Tr; EBT00001785896.
DR   EnsemblGenomes-Tr; EBT00001785897.
DR   EnsemblGenomes-Tr; EBT00001785898.
DR   EnsemblGenomes-Tr; EBT00001785899.
DR   EnsemblGenomes-Tr; EBT00001785900.
DR   EnsemblGenomes-Tr; EBT00001785901.
DR   EnsemblGenomes-Tr; EBT00001785902.
DR   EnsemblGenomes-Tr; EBT00001785903.
DR   EnsemblGenomes-Tr; EBT00001785904.
DR   EnsemblGenomes-Tr; EBT00001785905.
DR   EnsemblGenomes-Tr; EBT00001785906.
DR   EnsemblGenomes-Tr; EBT00001785909.
DR   EnsemblGenomes-Tr; EBT00001785911.
DR   EnsemblGenomes-Tr; EBT00001785913.
DR   EnsemblGenomes-Tr; EBT00001785915.
DR   EnsemblGenomes-Tr; EBT00001785916.
DR   EnsemblGenomes-Tr; EBT00001785918.
DR   EnsemblGenomes-Tr; EBT00001785919.
DR   EnsemblGenomes-Tr; EBT00001785924.
DR   EnsemblGenomes-Tr; EBT00001785926.
DR   EnsemblGenomes-Tr; EBT00001785929.
DR   EnsemblGenomes-Tr; EBT00001785934.
DR   EnsemblGenomes-Tr; EBT00001785937.
DR   EnsemblGenomes-Tr; EBT00001785939.
DR   EnsemblGenomes-Tr; EBT00001785944.
DR   EnsemblGenomes-Tr; EBT00001785949.
DR   EnsemblGenomes-Tr; EBT00001785951.
DR   EnsemblGenomes-Tr; EBT00001785954.
DR   EnsemblGenomes-Tr; EBT00001785956.
DR   EnsemblGenomes-Tr; EBT00001785958.
DR   EnsemblGenomes-Tr; EBT00001785959.
DR   EnsemblGenomes-Tr; EBT00001785962.
DR   EnsemblGenomes-Tr; EBT00001785965.
DR   EnsemblGenomes-Tr; EBT00001785968.
DR   EnsemblGenomes-Tr; EBT00001785970.
DR   EnsemblGenomes-Tr; EBT00001785972.
DR   EnsemblGenomes-Tr; EBT00001785974.
DR   EnsemblGenomes-Tr; EBT00001785977.
DR   EnsemblGenomes-Tr; EBT00001785979.
DR   EnsemblGenomes-Tr; EBT00001785982.
DR   EnsemblGenomes-Tr; EBT00001785989.
DR   EnsemblGenomes-Tr; EBT00001785991.
DR   EnsemblGenomes-Tr; EBT00001785993.
DR   EnsemblGenomes-Tr; EBT00001786004.
DR   EnsemblGenomes-Tr; EBT00001786005.
DR   EnsemblGenomes-Tr; EBT00001786009.
DR   EnsemblGenomes-Tr; EBT00001786012.
DR   EnsemblGenomes-Tr; EBT00001786013.
DR   EnsemblGenomes-Tr; EBT00001786016.
DR   EnsemblGenomes-Tr; EBT00001786019.
DR   EnsemblGenomes-Tr; EBT00001786023.
DR   EnsemblGenomes-Tr; EBT00001786026.
DR   EnsemblGenomes-Tr; EBT00001786028.
DR   EnsemblGenomes-Tr; EBT00001786030.
DR   EnsemblGenomes-Tr; EBT00001786031.
DR   EnsemblGenomes-Tr; EBT00001786032.
DR   EnsemblGenomes-Tr; EBT00001786034.
DR   EnsemblGenomes-Tr; EBT00001786037.
DR   EnsemblGenomes-Tr; EBT00001786039.
DR   EnsemblGenomes-Tr; EBT00001786041.
DR   EnsemblGenomes-Tr; EBT00001786042.
DR   EnsemblGenomes-Tr; EBT00001786044.
DR   EnsemblGenomes-Tr; EBT00001786045.
DR   EnsemblGenomes-Tr; EBT00001786050.
DR   EnsemblGenomes-Tr; EBT00001786051.
DR   EnsemblGenomes-Tr; EBT00001786052.
DR   EnsemblGenomes-Tr; EBT00001786053.
DR   EnsemblGenomes-Tr; EBT00001786054.
DR   EnsemblGenomes-Tr; EBT00001786055.
DR   EnsemblGenomes-Tr; EBT00001786057.
DR   EnsemblGenomes-Tr; EBT00001786059.
DR   EnsemblGenomes-Tr; EBT00001786061.
DR   EnsemblGenomes-Tr; EBT00001786063.
DR   EnsemblGenomes-Tr; EBT00001786065.
DR   EnsemblGenomes-Tr; EBT00001786066.
DR   EnsemblGenomes-Tr; EBT00001786068.
DR   EnsemblGenomes-Tr; EBT00001786069.
DR   EnsemblGenomes-Tr; EBT00001786071.
DR   EnsemblGenomes-Tr; EBT00001786072.
DR   EnsemblGenomes-Tr; EBT00001786075.
DR   EnsemblGenomes-Tr; EBT00001786079.
DR   EnsemblGenomes-Tr; EBT00001786083.
DR   EnsemblGenomes-Tr; EBT00001786084.
DR   EnsemblGenomes-Tr; EBT00001786085.
DR   EnsemblGenomes-Tr; EBT00001786087.
DR   EnsemblGenomes-Tr; EBT00001786090.
DR   EnsemblGenomes-Tr; EBT00001786091.
DR   EnsemblGenomes-Tr; EBT00001786092.
DR   EnsemblGenomes-Tr; EBT00001786093.
DR   EnsemblGenomes-Tr; EBT00001786094.
DR   EnsemblGenomes-Tr; EBT00001786095.
DR   EnsemblGenomes-Tr; EBT00001786096.
DR   EnsemblGenomes-Tr; EBT00001786097.
DR   EnsemblGenomes-Tr; EBT00001786098.
DR   EnsemblGenomes-Tr; EBT00001786099.
DR   EnsemblGenomes-Tr; EBT00001786100.
DR   EnsemblGenomes-Tr; EBT00001786101.
DR   EnsemblGenomes-Tr; EBT00001786102.
DR   EnsemblGenomes-Tr; EBT00001786103.
DR   EnsemblGenomes-Tr; EBT00001786104.
DR   EnsemblGenomes-Tr; EBT00001786105.
DR   EnsemblGenomes-Tr; EBT00001786106.
DR   EnsemblGenomes-Tr; EBT00001786107.
DR   EnsemblGenomes-Tr; EBT00001786108.
DR   EnsemblGenomes-Tr; EBT00001786109.
DR   EnsemblGenomes-Tr; EBT00001786110.
DR   EnsemblGenomes-Tr; EBT00001786111.
DR   EnsemblGenomes-Tr; EBT00001786112.
DR   EnsemblGenomes-Tr; EBT00001786113.
DR   EnsemblGenomes-Tr; EBT00001786114.
DR   EnsemblGenomes-Tr; EBT00001786115.
DR   EnsemblGenomes-Tr; EBT00001786116.
DR   EnsemblGenomes-Tr; EBT00001786117.
DR   EnsemblGenomes-Tr; EBT00001786118.
DR   EnsemblGenomes-Tr; EBT00001786119.
DR   EnsemblGenomes-Tr; EBT00001786120.
DR   EnsemblGenomes-Tr; EBT00001786121.
DR   EnsemblGenomes-Tr; EBT00001786122.
DR   EnsemblGenomes-Tr; EBT00001786123.
DR   EnsemblGenomes-Tr; EBT00001786124.
DR   EnsemblGenomes-Tr; EBT00001786125.
DR   EnsemblGenomes-Tr; EBT00001786126.
DR   EnsemblGenomes-Tr; EBT00001786127.
DR   EnsemblGenomes-Tr; EBT00001786128.
DR   EnsemblGenomes-Tr; EBT00001786129.
DR   EnsemblGenomes-Tr; EBT00001786130.
DR   EnsemblGenomes-Tr; EBT00001786131.
DR   EnsemblGenomes-Tr; EBT00001786132.
DR   EnsemblGenomes-Tr; EBT00001786133.
DR   EnsemblGenomes-Tr; EBT00001786134.
DR   EnsemblGenomes-Tr; EBT00001786135.
DR   EnsemblGenomes-Tr; EBT00001786136.
DR   EnsemblGenomes-Tr; EBT00001786137.
DR   EnsemblGenomes-Tr; EBT00001786138.
DR   EnsemblGenomes-Tr; EBT00001786139.
DR   EnsemblGenomes-Tr; EBT00001786140.
DR   EnsemblGenomes-Tr; EBT00001786141.
DR   EnsemblGenomes-Tr; EBT00001786142.
DR   EnsemblGenomes-Tr; EBT00001786143.
DR   EnsemblGenomes-Tr; EBT00001786144.
DR   EnsemblGenomes-Tr; EBT00001786145.
DR   EnsemblGenomes-Tr; EBT00001786146.
DR   EnsemblGenomes-Tr; EBT00001786147.
DR   EnsemblGenomes-Tr; EBT00001786148.
DR   EnsemblGenomes-Tr; EBT00001786149.
DR   EnsemblGenomes-Tr; EBT00001786150.
DR   EnsemblGenomes-Tr; EBT00001786151.
DR   EnsemblGenomes-Tr; EBT00001786152.
DR   EnsemblGenomes-Tr; EBT00001786153.
DR   EnsemblGenomes-Tr; EBT00001786154.
DR   EnsemblGenomes-Tr; EBT00001786155.
DR   EnsemblGenomes-Tr; EBT00001786156.
DR   EnsemblGenomes-Tr; EBT00001786157.
DR   EnsemblGenomes-Tr; EBT00001786158.
DR   EnsemblGenomes-Tr; EBT00001786159.
DR   EnsemblGenomes-Tr; EBT00001786160.
DR   EnsemblGenomes-Tr; EBT00001786161.
DR   EnsemblGenomes-Tr; EBT00001786162.
DR   EnsemblGenomes-Tr; EBT00001786163.
DR   EnsemblGenomes-Tr; EBT00001786164.
DR   EnsemblGenomes-Tr; EBT00001786165.
DR   EnsemblGenomes-Tr; EBT00001786166.
DR   EnsemblGenomes-Tr; PAU_00312.
DR   EnsemblGenomes-Tr; PAU_01509.
DR   EnsemblGenomes-Tr; PAU_02458A.
DR   EnsemblGenomes-Tr; PAU_02956.
DR   EnsemblGenomes-Tr; PAU_03761.
DR   EuropePMC; PMC2717986; 19583835.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC4875751; 27206730.
DR   EuropePMC; PMC5810505; 28498729.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; FM162591.
DR   SILVA-SSU; FM162591.
DR   StrainInfo; 113360; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5064808
FT                   /organism="Photorhabdus asymbiotica"
FT                   /isolate="ATCC43949"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:291112"
FT   CDS_pept        133..1452
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PAU_00001"
FT                   /old_locus_tag="PAT2033"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82094"
FT                   /db_xref="GOA:C7BTV9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTV9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82094.1"
FT                   /translation="MWIRPLQAELSGNTLALYAPNRFVLDWVREKYINNINGLLNDFCG
FT                   AEVPLLRFEVGNKPISQNDSPPQRVVAHAPVTPAPQNTSVRPSWDNTAVQPELSYRSNV
FT                   NPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNSIMA
FT                   RKANAKVVYMHSERFVQDMVKALQNNAIEDFKRYYRSVDALLIDDIQFFANKERSQEEF
FT                   FHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKK
FT                   ADENEIQLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALRDLLA
FT                   LQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGD
FT                   AFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   misc_feature    442..1098
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
FT                   score 4.1e-151"
FT                   /inference="protein motif:Pfam:PF00308"
FT   misc_feature    538..1146
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   2.4e-07"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    1171..1380
FT                   /note="HMMPfam hit to PF08299, Bacterial dnaA protein
FT                   helix-turn-helix, score 1.9e-48"
FT                   /inference="protein motif:Pfam:PF08299"
FT   CDS_pept        1457..2557
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PAU_00002"
FT                   /old_locus_tag="PAT2034"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00002"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82095"
FT                   /db_xref="GOA:C7BTW0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82095.1"
FT                   /translation="MKFIIEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVTESSLLLT
FT                   GTDLEMEMMARVTLSLPHEEGATTVPARKFFDIWRGLPDGAEISVELDGDRLLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFSLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMGIGQNLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDMLKQAFSRAAILSNEKFRGV
FT                   RLYFSKNQLKITANNPEQEEAEEIVDVSYQGTEMEIGFNVSYVLDVLNTLRCEEVRLLL
FT                   TDAISSVQIEDCASHNAAYVVMPMRL"
FT   misc_feature    1457..1816
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 1.3e-63"
FT                   /inference="protein motif:Pfam:PF00712"
FT   misc_feature    1505..2542
FT                   /note="HMMSmart hit to SM00480, no description, score
FT                   5e-161"
FT                   /inference="protein motif:Smart:SM00480"
FT   misc_feature    1841..2185
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 1.1e-65"
FT                   /inference="protein motif:Pfam:PF02767"
FT   misc_feature    2189..2551
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 2.4e-60"
FT                   /inference="protein motif:Pfam:PF02768"
FT   CDS_pept        2579..3670
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PAU_00003"
FT                   /old_locus_tag="PAT2035"
FT                   /product="dna replication and repair protein recf"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00003"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82096"
FT                   /db_xref="GOA:C7BTW1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82096.1"
FT                   /translation="MTLTRLFIRDFRNIADADLPLATGFNFLVGPNGSGKTSVLEAIYT
FT                   LGHGRSFRSIQSGRVIRHNCDEFVLHGRLEQRENARESSIGLSKNRNGDSKVRIDGSDG
FT                   GKIAELAKMLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHNDPRFFSAWVNLKRLLKQR
FT                   NAALRQVTHYSQIRPWDQELAPLANQINQWRTEYVTNIIQGIADTCKQFLPEFILRFSF
FT                   QQGWDKESDYAELLERQFERDRALTYTASGPHKADLRIRVEGTPVEDMLSRGQLKLLMC
FT                   ALRLAQGEYFTRQNGQQCLYLLDDFASELDAGRRQLLAERLKSTQAQVFVSAISPGQVT
FT                   DMLDGNSRMFRVENGKIEIQPQD"
FT   misc_feature    2582..3652
FT                   /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
FT                   domain, score 4.1e-55"
FT                   /inference="protein motif:Pfam:PF02463"
FT   CDS_pept        3687..6104
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PAU_00004"
FT                   /old_locus_tag="PAT2036"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00004"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82097"
FT                   /db_xref="GOA:C7BTW2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82097.1"
FT                   /translation="MMSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNAIDEALAGHCNEVIVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGKVHEQTYHLGVPQSPLKIVGETEQ
FT                   TGTRVRFWPSMDTFRNNTEFQHDILAKRLRELSFLNSGVSIRLIDKRTNTEDHFHYEGG
FT                   IKAFVEFLNKNKTPIHPNVFYFSTEKDGIGVEISMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLVGFRTAMTRTLNSYMDKEGYNKKSKVSATGDDAREGLVAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVETLMNEKLVEYLLENPNDAKTVVSKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDEYQLSIALDGASLYTSDHTPAL
FT                   RGEPLEKLVTEFNGVKKIIKRMERLYPASLLNNLIYHPKLTEEALTDETKVQEWIETLV
FT                   TRLNDREQNGSSYSYQLHENRERQMFEPILRVRTHGVDTDYPLDFDFVHGGEYHRITLL
FT                   GDKLSNLIEENAYIERGERRQPVSDFEQALEWLTKESRRGLSIQRYKGLGEMNPEQLWE
FT                   TTMNPETRRMMRVTVKDAIATDQLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   misc_feature    3780..4214
FT                   /note="HMMSmart hit to SM00387, no description, score
FT                   3.2e-30"
FT                   /inference="protein motif:Smart:SM00387"
FT   misc_feature    3780..4211
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and H, score 4.2e-33"
FT                   /inference="protein motif:Pfam:PF02518"
FT   misc_feature    3792..6080
FT                   /note="HMMSmart hit to SM00433, no description, score
FT                   1.4e-285"
FT                   /inference="protein motif:Smart:SM00433"
FT   misc_feature    4350..4862
FT                   /note="HMMPfam hit to PF00204, DNA gyrase B, score 1e-93"
FT                   /inference="protein motif:Pfam:PF00204"
FT   misc_feature    4941..5264
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   1.1e-05"
FT                   /inference="protein motif:Pfam:PF01751"
FT   misc_feature    5868..6068
FT                   /note="HMMPfam hit to PF00986, DNA gyrase B subunit,
FT                   carboxyl terminus, score 6.1e-46"
FT                   /inference="protein motif:Pfam:PF00986"
FT   CDS_pept        complement(7159..8268)
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="PAU_00005"
FT                   /old_locus_tag="PAT2037"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00005"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82098"
FT                   /db_xref="GOA:C7BTW3"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW3"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82098.1"
FT                   /translation="MMKNVGLIGWRGMVGSVLMQRMIEERDFDVIRPVFFTTSQHGQPA
FT                   PDFTGQQGILQNAFDIGALGALDIIISCQGGDYTNEIYPKLRATGWQGYWIDAASALRM
FT                   NDDSIIILDPVNHAHIQEGLNKGIKTFVGGNCTVSLMLMSLGGLFANDLVEWASVATYQ
FT                   AASGAGARHMRELLVQMGALHTQVAKELQDPASAILEIERKVTDFTRSGVMPTDQFGVP
FT                   LAGSLIPWIDKQLDNGQSREEWKGQVETNKILNTGNNIVTVDGLCVRIGALRCHSQAFT
FT                   LKLKKDISIPDIEQLLAEHNDWVRVIPNDRELSMRELTPAAVTGTLNTPVGRLRKLNMG
FT                   PEYLSAFTVGDQLLWGAAEPLRRMLRILA"
FT   misc_feature    complement(7204..7836)
FT                   /note="HMMPfam hit to PF02774, Semialdehyde dehydrogenase,
FT                   dimerisat, score 2.7e-77"
FT                   /inference="protein motif:Pfam:PF02774"
FT   misc_feature    complement(7900..8259)
FT                   /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
FT                   NAD bindi, score 6.2e-36"
FT                   /inference="protein motif:Pfam:PF01118"
FT   CDS_pept        complement(8471..8692)
FT                   /transl_table=11
FT                   /gene="ogrK"
FT                   /locus_tag="PAU_00006"
FT                   /old_locus_tag="PAT2038"
FT                   /product="prophage p2 ogr protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00006"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82099"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82099.1"
FT                   /translation="MIKCPLCGQAAHARSSFEHSSQTKERYNQCQNINCGATFVSHETF
FT                   VRFISKPGEVVSVKPHPKEKSKTQLNLA"
FT   misc_feature    complement(8546..8686)
FT                   /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
FT                   score 9.5e-27"
FT                   /inference="protein motif:Pfam:PF04606"
FT   CDS_pept        complement(8768..9841)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00007"
FT                   /old_locus_tag="PAT2039"
FT                   /product="putative phage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00007"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82100"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82100.1"
FT                   /translation="MMSEFGRVPEKGSAPGFLLEIDNKDISGRIQSRLISLTMTDNRGF
FT                   EADQLDIELDDADGSLMLPSRGNVISLALGWRDQPLMDKGRFTVDEIEHSGAPDKLTIR
FT                   ARSADFRESLNMRREVSYHQKTIGEIVRTIAARNNLTADLHKDIAKVFINHIDQTNESD
FT                   GSFLTRLANQEGAIASVKNGKLIFIRQGQNKTASGQVIPALVITRQSGDSHNFTLSDRE
FT                   AYTGVVANWLDTRKPEKKHTLAVRRGTGKSKSYLIGSTGNVLELSRVYADEASAKRAAK
FT                   VAWEKIQRGTATFSIQLAQGRADLYPEVPIQVTGFKPEIDETEWTLTKVTHTINGSSGG
FT                   FTTALTLELKIDDLDMK"
FT   misc_feature    complement(8786..9805)
FT                   /note="HMMPfam hit to PF05954, Phage late control gene D
FT                   protein (GPD), score 3.8e-163"
FT                   /inference="protein motif:Pfam:PF05954"
FT   CDS_pept        complement(9838..10305)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00008"
FT                   /old_locus_tag="PAT2040"
FT                   /product="putative tail fiber protein of prophage"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00008"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82101"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82101.1"
FT                   /translation="MMAALGLFVFMLKTTPYQNLQYQQSWRHAFNSRIGLRPAWQFLGP
FT                   DNDTMTLSGSLYPEITTGSRLSLIALQIMADSGKAWSFIDGRGTVYGMFVIEKIEQTKT
FT                   ELMSNGAARKIDFTLSLRRVDSSLGEMFGDLQDQFSMLTDNSASRVRGVLP"
FT   misc_feature    complement(9925..10290)
FT                   /note="HMMPfam hit to PF06995, Phage P2 GpU, score 4.1e-61"
FT                   /inference="protein motif:Pfam:PF06995"
FT   CDS_pept        complement(10308..12923)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00009"
FT                   /old_locus_tag="PAT2041"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00009"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82102"
FT                   /db_xref="GOA:C7BTW7"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82102.1"
FT                   /translation="MVQKMSNTQSQLKLVIQSVNKLTSVLKSVQRNNRRLADSIRQNRG
FT                   EFKRLNQTWDVIKPYSAPEYAQGTAHTSSKNFLMPDYDLNVQLSKIQAQTNIEKNSPKY
FT                   TTLLNQSYERSKRAGVSASQVVQETAQTSRKKEESRSENRYSKIKDFRDRISQHGASAK
FT                   SAGVNILTTSKNFLMPGYDLNAQMSKIQAQTNIEKNSPEYAMLLNQSRELSKSTGVSAN
FT                   QIAQGQSLYASKGYSSDQIKNMMPGTVSMSQANGADFAATIDIGTNVLEGFKLQSEEMS
FT                   RVSDVLTATFTGSKTTLAALGDTMKFVAPTASSLGIDIETVAAATRKLSDANIKGSEAG
FT                   EVLSSMLGRLAEPPKAAAAALAQLSIKIRDAKGNLRQLPDILVELDDKTRSMSSKQRTS
FT                   YFTAIGGENAAPALDVLVNQAGQGELQSFIDKLRNVQGESQKVASTMTNSLTGDIQKLN
FT                   AAWSDLGVQMFSGVEGPAREVTQKVTNVVNKVSEWMKANPRLAATLATITMVVGGVLTV
FT                   FGAFAQAIASILLPLAVAKYSLTLFGSTGVRALGLVGNALKMLGSTMMIVGRLMMANPI
FT                   LAIVGLIAMAAVYIWQNWETLGPKFSQLWENIKISLSEKWESIKQSALQIWDNIKNNIS
FT                   NAWELVKQNTLDIWENIKISISDKWNEIITDVMNLPSKFKEVGTAIINSLLEGINEKWE
FT                   VLKKKLTSLSDYIPDWMRPGEDTSKGTNNNMTHNVSSVLPKHDKGGIIPAGGFGIVGEY
FT                   GPEIVTGPVNVISRRQTAKLAAAAAFSLSVMAPSAAARTAPLHIQSLPVQAYPQIQEKV
FT                   EKRHQIQYRNESPVYHINIYGAPGQSAQDIAAVVRRELDDRERKQQARLRSSFSDRGEF
FT                   "
FT   misc_feature    complement(10947..10979)
FT                   /note="HMMPfam hit to PF05017, no description, score 40"
FT                   /inference="protein motif:Pfam:PF05017"
FT   misc_feature    complement(10980..11012)
FT                   /note="HMMPfam hit to PF05017, no description, score
FT                   2.1e+02"
FT                   /inference="protein motif:Pfam:PF05017"
FT   misc_feature    complement(11013..11045)
FT                   /note="HMMPfam hit to PF05017, no description, score 1.4"
FT                   /inference="protein motif:Pfam:PF05017"
FT   misc_feature    complement(11046..11078)
FT                   /note="HMMPfam hit to PF05017, no description, score 44"
FT                   /inference="protein motif:Pfam:PF05017"
FT   misc_feature    complement(11079..11111)
FT                   /note="HMMPfam hit to PF05017, no description, score 1e+02"
FT                   /inference="protein motif:Pfam:PF05017"
FT   misc_feature    complement(order(11148..11216,11253..11315,11358..11426))
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2041 by TMHMM2.0 at aa 500-522, 537-557 and 570-592"
FT   CDS_pept        complement(13038..13355)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00010"
FT                   /old_locus_tag="PAT2042"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82103"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82103.1"
FT                   /translation="MTETLITQNDEQRTIVLEEPLARGGSNITEVVIRKPNSGALRGAR
FT                   LQALLEMDVDSMMLVLPRVTTPALTKSDLLAMTPGDLINLSVEVVNFLLPKSAKSGFQT
FT                   D"
FT   misc_feature    complement(13062..13319)
FT                   /note="HMMPfam hit to PF06158, Phage tail protein E, score
FT                   2e-37"
FT                   /inference="protein motif:Pfam:PF06158"
FT   CDS_pept        complement(13382..13897)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00011"
FT                   /old_locus_tag="PAT2043"
FT                   /product="putative tail fiber component of prophage"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82104"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTW9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82104.1"
FT                   /translation="MALPRKLKYLNLFNDGNNYQGIVEELTLPKLSRKLETYRGGGMNG
FT                   SATVDLGLDEGALDVEFTLGGMEAQHYRQWGLTKTDGVMLRFSGSCQRDDTSDVIAVEI
FT                   VMRGRFHEFDHGTYKQGDNTQTKISAKNTYFKLTWDGQTLIEVDTVNMVEIVNGEDRLA
FT                   DHRRAMGL"
FT   misc_feature    complement(13385..13894)
FT                   /note="HMMPfam hit to PF04985, Phage tail tube protein FII,
FT                   score 7.2e-98"
FT                   /inference="protein motif:Pfam:PF04985"
FT   CDS_pept        complement(13908..15080)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00012"
FT                   /old_locus_tag="PAT2044"
FT                   /product="probable major tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00012"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82105"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82105.1"
FT                   /translation="MAQDYHHGVRVQEINEGTRTITTISTAIVGMVCTGPEADEKAFPL
FT                   NTPVLITDVSMAIGKAGKTGTLPQALKAIADQAKPVTVVVRVAQGETEDQTTTNIIGTT
FT                   TNEGKKTGIQALLAAQGQLGVKPRILGVPGLDTKAVAVELATIAQKLRAMAYISAYGCK
FT                   NKEEVAKYRENFGQRELMLIWPDFLSWDTVSNSEATAYATARALGLRSKIDEETGWHKT
FT                   LSNIGVNGVTGISADVFWDLQDPATDAGYLNEKGITTLIRKNGFRFWGSRTCASDPLFQ
FT                   FESYTRTAQVLADTMAEAHMWAIDKPLTPSLVRDIIEGVNAKFRELRSGGYIINGKCWY
FT                   DESANDKDTLKAGKLTLDYDYTPVPPLENMMLRQRITDKYLMDFAKSING"
FT   misc_feature    complement(13932..15074)
FT                   /note="HMMPfam hit to PF04984, Phage tail sheath protein,
FT                   score 2.7e-175"
FT                   /inference="protein motif:Pfam:PF04984"
FT   CDS_pept        15482..16042
FT                   /transl_table=11
FT                   /locus_tag="PAU_00013"
FT                   /old_locus_tag="PAT2045"
FT                   /product="similar to dna inversion product and tail fiber
FT                   protein from lambdoi prophage"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00013"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82106"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX1"
FT                   /inference="similar to DNA sequence:INSD:BX571866"
FT                   /inference="similar to DNA sequence:INSD:AF320576"
FT                   /protein_id="CAQ82106.1"
FT                   /translation="MKNLGLVETIINTLYPVGMVVWFAQNKNPNVLFPGTTWKYIDENK
FT                   TVRLASANGADILSTGGNDLITLTVAQMPAHNHVLSGMTDIFDYGTRTTNTTGEHKHDS
FT                   GWGEQDGGRYGYYDGSKNNQGSGKTDFDNYKFNTSTDGAHAHTVSIGPHSHTISGNTGS
FT                   TGASAAIPITNSYVKLMGWYRNT"
FT   CDS_pept        complement(16140..16745)
FT                   /transl_table=11
FT                   /gene="tfaE"
FT                   /locus_tag="PAU_00014"
FT                   /old_locus_tag="PAT2046"
FT                   /product="lambdoid prophage e14 tail fiber assembly
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00014"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82107"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX2"
FT                   /inference="similar to DNA sequence:INSD:BX571870"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82107.1"
FT                   /translation="MMNKAVLVLDENNIAISTGSIIVFNYDAITLEYLNSTDEHLSVGI
FT                   GLPANSCTDAPPNAQEGYVACRSSDLTGWQVVPDYRGKIAYNTQTGEQKEIIKPGELPG
FT                   ELTFKQPVTDFDKWDGEKWVTDIEAQKVSQIEQAEQQRVTLRQRADEAMTLLQYAIEAE
FT                   MASDAEKALLLTWKKYVVLLSRVDTSLDSDIEWPQIPE"
FT   misc_feature    complement(16143..16562)
FT                   /note="HMMPfam hit to PF02413, Caudovirales tail fibre
FT                   assembly protein, score 9.7e-43"
FT                   /inference="protein motif:Pfam:PF02413"
FT   CDS_pept        complement(16742..17245)
FT                   /transl_table=11
FT                   /gene="stfE"
FT                   /locus_tag="PAU_00015"
FT                   /old_locus_tag="PAT2047"
FT                   /product="side tail fiber protein homolog from lambdoid
FT                   prophage e14 (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00015"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82108"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX3"
FT                   /inference="similar to DNA sequence:INSD:BX571870"
FT                   /inference="similar to DNA sequence:INSD:X01805"
FT                   /protein_id="CAQ82108.1"
FT                   /translation="MSISVLEEIPVGIPLPWPTNIPPNGWVKCNGAIFDKSLYPKLAEV
FT                   YPSGRLPDLRGEFIRGWDDGRGVDIGRYLLSDQLADVAPHNHRLSRMWSNSSAATADGL
FT                   GTPNYILNSVTKEANYGIDSRRLGIATGMGNGGFGYMDNAIFASTGTETRPRNVAFNYI
FT                   VRIA"
FT   misc_feature    complement(17069..17212)
FT                   /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
FT                   score 2.8e-21"
FT                   /inference="protein motif:Pfam:PF07484"
FT   CDS_pept        complement(17245..18372)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00016"
FT                   /old_locus_tag="PAT2048"
FT                   /product="probable variable tail fibre protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00016"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82109"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82109.1"
FT                   /translation="MKYFAILTKLGAAKLANAAALGTKVDITHMAVGDGGGKLPDPDVN
FT                   QTQLVNEKRRAAINTLSVDPVNTNQIIAEQIIPEGEGGWWMREIGLFDSEGNLIAVANC
FT                   PETYKPQLQEGSGRTQTIRMILIVSNTDSVTLKIDPSIVLATREYVDSSILKHEKSRNH
FT                   PDATLTEKGFTKLNSATNSNDETTAATPKAVKAAYDNANSKLAKNQNGADIPDKNAFVK
FT                   NLGLLEKLIPVGVPIPWPTDTPPEGWVQCNGAAFDKSKFPELAKAYPGGNLPDLRGEFI
FT                   RGWDAGRGVDPSRTLLVWQEGSYLLQEIAGQPADNVVNFSLNERIKLQWDTPQHKEIPL
FT                   RARSVGSATTWTTSAGYIGVSRPRNVAFNYIVRAA"
FT   misc_feature    complement(17530..17673)
FT                   /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
FT                   score 4.9e-23"
FT                   /inference="protein motif:Pfam:PF07484"
FT   misc_feature    complement(17743..17874)
FT                   /note="HMMPfam hit to PF03406, Phage tail fibre repeat,
FT                   score 1.3e-15"
FT                   /inference="protein motif:Pfam:PF03406"
FT   sig_peptide     complement(18319..18372)
FT                   /locus_tag="PAU_00016"
FT                   /note="Signal peptide predicted for PAT2048 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.636) with cleavage site
FT                   probability 0.458 between residues 18 and 19"
FT   CDS_pept        complement(18369..18983)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00017"
FT                   /old_locus_tag="PAT2049"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00017"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82110"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82110.1"
FT                   /translation="MNDRLLPTGSTVLELAAAKACSQLQNIPIPLRKLWNPDTCPEELL
FT                   PYLAWAWSVDRWDEKWSVSTKRGVIKNSLFLHRHKGTIGAVRRVVEPLGYLIQIKEWWQ
FT                   NNETPGTFRLAIGVQENGITEETFLELERLIFDAKPVSRHLVGLSINLDIKGEFYCAAT
FT                   SYSGDDLTVYQYLPDVITTSDNAPLGAAIHLIDTDTLRVSP"
FT   CDS_pept        complement(18976..19980)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00018"
FT                   /old_locus_tag="PAT2050"
FT                   /product="phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82111"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82111.1"
FT                   /translation="MPNIDLSQLPPPNVVEPLDYDILLAERKARLISLYPEEQRDAITR
FT                   TLELESEPLVKLLEENVYRELILRQRVNEAARAVMLAYATNNDLDQLGANYNVTRAVME
FT                   PDSTFRKRIQNAFEGLSVAGPIRAYEYHASKVNEGIRVNKDDEKGKGEYQIVDDVSVIS
FT                   PSPANVTVTILSQKWIWEKDKDDKVDEKHNGVPSQDLLDKVVVALNDEDVRPVADRVKV
FT                   QPAQIVEYQIDAVLHLDPTPESEPIRKLAQQNMDNYIKDQHKLGRDIRLSAIYAALHVA
FT                   GVQQVELRAPTKDIILCEDQAPYCSSAKLELVKTQASDCSKPNPNLIMGGYDE"
FT   misc_feature    complement(19150..19824)
FT                   /note="HMMPfam hit to PF04865, Baseplate J-like protein,
FT                   score 9e-81"
FT                   /inference="protein motif:Pfam:PF04865"
FT   CDS_pept        complement(19985..20362)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00019"
FT                   /old_locus_tag="PAT2051"
FT                   /product="phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00019"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82112"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82112.1"
FT                   /translation="MMYLGMNRQTGRSLTDLEHVRQSVSDILLTPIGSRVERRTYGSLL
FT                   PELIDWPQNAALRLQVMAACYTAISRWEPRINLTAITIDTPKDGDTQKDGDTQKNGKMT
FT                   IDISGHYQLSPGGFSLSIPVR"
FT   misc_feature    complement(19991..20314)
FT                   /note="HMMPfam hit to PF04965, GPW / gp25 family, score
FT                   6.3e-37"
FT                   /inference="protein motif:Pfam:PF04965"
FT   CDS_pept        complement(20362..21135)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00020"
FT                   /old_locus_tag="PAT2052"
FT                   /product="putative phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82113"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82113.1"
FT                   /translation="MDTQLTELLRLLRNLIRTGVVTEVDHARGMCRIATGNLETDWRPW
FT                   LTMRAGHSRTWWAPSVNEQVLLLSVGGELTTSFVLPAIYSDQFPAPSVSSEAVHIAFPD
FT                   GAVMVYEPKFGALVVKGIRTASVQAINSISLEATNIALKAHDKISISANNKIELASHNE
FT                   ISMSADNKIGLSSHNEIAMGADNKIGLEAKKDFALKAYEVKCEATKEMSLKASKIKLDG
FT                   DVENTGGKLSSNGVTLHSHQHSGVMAGGATTGGPV"
FT   misc_feature    complement(20779..21081)
FT                   /note="HMMPfam hit to PF04717, Phage-related baseplate
FT                   assembly protein, score 2.1e-49"
FT                   /inference="protein motif:Pfam:PF04717"
FT   CDS_pept        complement(21426..21563)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00021"
FT                   /old_locus_tag="PAT2053"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82114"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTX9"
FT                   /inference="similar to DNA sequence:INSD:CAAJ01000543"
FT                   /protein_id="CAQ82114.1"
FT                   /translation="MQDILEKLKIEFVFGSKYVCLELDKQMVEVTHCNCIVLQHSNENH
FT                   "
FT   CDS_pept        complement(21717..21953)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00022"
FT                   /old_locus_tag="PAT2054"
FT                   /product="probable phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00022"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82115"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82115.1"
FT                   /translation="MKIISHQNDTVDALCWRHYGRTQGMTELVLEANPGLVELIFKKFP
FT                   ELSEYSVILPYGTEVEMPEVIPTTTKPILQLWD"
FT   misc_feature    complement(21741..21953)
FT                   /note="HMMPfam hit to PF05489, Phage Tail Protein X, score
FT                   8e-25"
FT                   /inference="protein motif:Pfam:PF05489"
FT   CDS_pept        complement(22234..22416)
FT                   /transl_table=11
FT                   /gene="rlsC"
FT                   /locus_tag="PAU_00023"
FT                   /old_locus_tag="PAT2055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00023"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82116"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AJ831831"
FT                   /protein_id="CAQ82116.1"
FT                   /translation="MSVDFLMESVIAQRINFIARMATSCECNHVEDKELALTWIAELST
FT                   PLAKQLINRHETFEE"
FT   CDS_pept        22796..23410
FT                   /transl_table=11
FT                   /locus_tag="PAU_00024"
FT                   /old_locus_tag="PAT2056"
FT                   /product="similar to phage repressor protein ci"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00024"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82117"
FT                   /db_xref="GOA:C7BTY2"
FT                   /db_xref="InterPro:IPR010744"
FT                   /db_xref="InterPro:IPR032499"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:M55249"
FT                   /protein_id="CAQ82117.1"
FT                   /translation="MKKNVTEIKMGADSGGKQAIERLVSAYGFKSRQALSDHLGVSKST
FT                   MANRYLRDSFPADWVIQCNLETNASLLWLSTGQGEMFPDGEKKRESLENIITPTIQRVK
FT                   LVGGKLNADNPVTLDNQLIAKEIKKPLIIDNNDTWYLLDTAEPDVQDGLWLIDIEGMHS
FT                   IKKITKIPVGKIRVYDNDVTFDCAIDEINFIGRVYLMISRY"
FT   misc_feature    22847..23041
FT                   /note="HMMPfam hit to PF07022, Bacteriophage CI repressor
FT                   helix-turn-h, score 1.4e-39"
FT                   /inference="protein motif:Pfam:PF07022"
FT   CDS_pept        complement(23492..24067)
FT                   /transl_table=11
FT                   /gene="hin"
FT                   /gene_synonym="pin"
FT                   /locus_tag="PAU_00025"
FT                   /old_locus_tag="PAT2057"
FT                   /product="putative dna-invertase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00025"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82118"
FT                   /db_xref="GOA:C7BTY3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY3"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82118.1"
FT                   /translation="MAKIGYIRVSTNDQNSDLQRNALISINCERIFEDKISGKTANRPG
FT                   LKQALKQLKKGDTLVVWKLDRLGRSVKNMVTLISDLSERGIHFQSLTDSIDTSTSMGRF
FT                   FFHVMSALAEMERELIVERTNAGLIAARAQGRIGGRPVSFSFTEQQQAARLLAKGHSRK
FT                   QLSLIYNTSLSTIYKYFPVNKTDYRSAN"
FT   misc_feature    complement(23519..23653)
FT                   /note="HMMPfam hit to PF02796, Helix-turn-helix domain of
FT                   resolvase, score 3.5e-09"
FT                   /inference="protein motif:Pfam:PF02796"
FT   misc_feature    complement(23657..24061)
FT                   /note="HMMPfam hit to PF00239, Resolvase, N terminal
FT                   domain, score 2e-74"
FT                   /inference="protein motif:Pfam:PF00239"
FT   CDS_pept        24165..25136
FT                   /transl_table=11
FT                   /locus_tag="PAU_00026"
FT                   /old_locus_tag="PAT2058"
FT                   /product="similar to bacteriophage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00026"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82119"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY4"
FT                   /inference="similar to DNA sequence:INSD:BX571868"
FT                   /inference="similar to DNA sequence:INSD:AB017338"
FT                   /protein_id="CAQ82119.1"
FT                   /translation="MAKNAVPNSRKVNGKVLVGDINITSQDIFDGQAIAIPEKVNLNDY
FT                   RTPGVYVQYANASAETGTNYPEPLAGSLIVLKAAGIIQRYFVYNSSRIYTRSLNDIGVW
FT                   TSWAREYNTLNKPTAGDIEVYTQTESDSRYITGSRKINGKSLSGDVDITSQDIFNGQAI
FT                   YLGDKANLDNYKTPGIYYQDYNIHAQNGANYPEQLAGSLIVLKAAGIIQRYFVYNSSRI
FT                   YTRSQYHDLAWTPWTMEYNTSNPPFVGNLGAYTKEECNSFYITNIRLGAEVQVGAGGVL
FT                   EYHGPNVLTGFYNRDRDYSAETLYWSPIQFLKNGQWITIVRG"
FT   CDS_pept        25142..25678
FT                   /transl_table=11
FT                   /locus_tag="PAU_00027"
FT                   /old_locus_tag="PAT2059"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00027"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82120"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY5"
FT                   /inference="similar to DNA sequence:INSD:AP008232"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82120.1"
FT                   /translation="MNLVNLGPFEQYIPDSENAVQFALYLQDKQGNDWYTSQNQFSTET
FT                   LKIMYDANGLIRAITTDVSKFAPLGFSVAEINKNEVPKEFNEKTNYKWIFDGQKIFPYV
FT                   ATKEELIRKAEYERVQLLVKANNIIVPLQDAIDLNIATEEEKNTLLKWKKYRIMLNRID
FT                   ISTTPEIVWPSPPLS"
FT   misc_feature    25241..25672
FT                   /note="HMMPfam hit to PF02413, Caudovirales tail fibre
FT                   assembly protein, score 3.1e-32"
FT                   /inference="protein motif:Pfam:PF02413"
FT   CDS_pept        complement(25818..25946)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00028"
FT                   /old_locus_tag="PAT2060"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00028"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82121"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82121.1"
FT                   /translation="MLNSYLPKDSDIAIYHSAKLACQEYTSNYLGRIVYSIRVLEQ"
FT   CDS_pept        complement(26022..26519)
FT                   /transl_table=11
FT                   /gene="Sc/SvP"
FT                   /locus_tag="PAU_00029"
FT                   /old_locus_tag="PAT2061"
FT                   /product="similar to dna inversion product and tail fiber
FT                   protein from lambdoi prophage"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00029"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82122"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY7"
FT                   /inference="similar to DNA sequence:INSD:BX571866"
FT                   /inference="similar to DNA sequence:INSD:X62121"
FT                   /protein_id="CAQ82122.1"
FT                   /translation="MKNLGLVEKLIPVGVPLPWPTETPPEGWVQCNGAAFDKSKFPKLA
FT                   KAYPSGNLPDLRGEFIRGWDDGRGIDQSRALLSQQNSTRLPSVYVHAASADIGILVSPP
FT                   VNTYSRTYPSEIMASDFEDSTNGSGPYYTTSSSLVPGGSVGLSAFRVRPRNIAFNYIVR
FT                   AA"
FT   misc_feature    complement(26337..26480)
FT                   /note="HMMPfam hit to PF07484, Phage Tail Collar Domain,
FT                   score 1.9e-21"
FT                   /inference="protein motif:Pfam:PF07484"
FT   CDS_pept        complement(26896..27036)
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /gene_synonym="rpmJ2"
FT                   /locus_tag="PAU_00030"
FT                   /old_locus_tag="PAT2062"
FT                   /product="50s ribosomal protein l36 2"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82123"
FT                   /db_xref="GOA:C7BTY8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82123.1"
FT                   /translation="MQVLSSLKTAKTRHPDCKIVSRRGRLYVICKSNPRFKAVQGKKKK
FT                   R"
FT   misc_feature    complement(26914..27036)
FT                   /note="HMMPfam hit to PF00444, Ribosomal protein L36, score
FT                   0.00015"
FT                   /inference="protein motif:Pfam:PF00444"
FT   CDS_pept        complement(27054..27308)
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="PAU_00031"
FT                   /old_locus_tag="PAT2063"
FT                   /product="50s ribosomal protein l31 type b"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82124"
FT                   /db_xref="GOA:C7BTY9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTY9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82124.1"
FT                   /translation="MKPNIHPNYRVVVFHDTSVNAYFSIGSTIRTERTITLNGEEYPYV
FT                   TIDVSSESHPFYTGKQKTLSQEGSTARFQKKFGRFIGNK"
FT   misc_feature    complement(27069..27308)
FT                   /note="HMMPfam hit to PF01197, Ribosomal protein L31, score
FT                   3.5e-10"
FT                   /inference="protein motif:Pfam:PF01197"
FT   CDS_pept        27328..27603
FT                   /transl_table=11
FT                   /locus_tag="PAU_00032"
FT                   /old_locus_tag="PAT2064"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00032"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82125"
FT                   /db_xref="GOA:C7BU07"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU07"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82125.1"
FT                   /translation="MLYYNIIVIRVYEQENNEKFSQTQKKASVLSMYKGLFQLLTYIPF
FT                   ILQVAALLAAFTHPSHIVIYAPGDSFTCRRAATRNLLGIKRLFHSH"
FT   misc_feature    27430..27498
FT                   /note="1 probable transmembrane helix predicted for PAT2064
FT                   by TMHMM2.0 at aa 35-57"
FT   CDS_pept        complement(27586..29415)
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="PAU_00033"
FT                   /old_locus_tag="PAT2065"
FT                   /product="L-glutamine:D-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00033"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82126"
FT                   /db_xref="GOA:C7BU08"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU08"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82126.1"
FT                   /translation="MCGIVGAVAQRDIAEILIEGLRRLEYRGYDSAGLAVVDNEKNMLR
FT                   LREVGKVQMLADEVGKQPVLGGTGIAHTRWATHGEPNERNAHPHISDYIAVVHNGIIEN
FT                   YEELRVQLIERGYSFVSDTDTEVIAHLVHWEQKQDGTLLEAVQRVIPQLRGAYGAVIMD
FT                   SRDPGTVIAARSGSPLVIGLGVGENFLASDQLALLPVTRRFIFLEEGDIAEVTRRTVRI
FT                   FNSHGEPIEREQIESNIQYDAGDKGIYRHYMQKEIYEQPMAIKSTLENRLGHGQVDLSE
FT                   LGPNAAELLSKVEHIQIVACGTSYNAGMVSRYWFEALAGIPCDVEIASEFRYRKSAHRS
FT                   GSLLITLSQSGETADTLAALRLSKDLGYLTSLTVCNVAGSSLVRESDFALMTKAGAEIG
FT                   VASTKAFTTQLTVLLMLVAYLGRLNGIDAEQEQEIVHALHALPSRIEGMLSKDKIIEAL
FT                   AEDFSDKHHALFLGRGDQYPIAVEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPV
FT                   IIVAPNNELLEKLKSNIEEVRARGGLLYVFADQDAGFTDSEGMKIIPLPHVEELIAPIF
FT                   YTVPLQLLSYHVALIKGTDVDQPRNLAKSVTVE"
FT   misc_feature    complement(27631..28041)
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 5.8e-35"
FT                   /inference="protein motif:Pfam:PF01380"
FT   misc_feature    complement(28150..28557)
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 1.6e-39"
FT                   /inference="protein motif:Pfam:PF01380"
FT   misc_feature    complement(28834..29412)
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 8.1e-51"
FT                   /inference="protein motif:Pfam:PF00310"
FT   CDS_pept        complement(29525..30895)
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="PAU_00034"
FT                   /old_locus_tag="PAT2066"
FT                   /product="bifunctional protein GlmU"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00034"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82127"
FT                   /db_xref="GOA:C7BU14"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU14"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82127.1"
FT                   /translation="MSNSAKSVVILAAGKGTRMYSDLPKVLHLLAGKPMVQHVIDTAMA
FT                   LGAKNVHLVYGHGGDLMKQTLSEQKLNWVLQEEQLGTGHAMQQAAPHFTDDEDILMLYG
FT                   DVPLIGTDTLERLLAAKPEGGIGLLTAILDNPTGYGRIIRKNGDVTGIIEQKDATEEQC
FT                   KISEINTGILVANGGDLKRWLSQLDNNNAQGEYYITDVIALAHKEGRKIEAVHPRRLSE
FT                   MEGVNNRLQLSTLERIYQSEQAEKLLLAGVMLLDPTRFDLRGTLIHGRDVVIDTNVIIE
FT                   GNVTLGNNVLIGTGCVLKNCIIGDDSILSPYTVIEDSEMGVGCTVGPFARLRPGSKLAE
FT                   KAHVGNFVEMKKSYLGKGSKAGHLTYLGDADIGSDVNIGAGTITCNYDGANKFKTIIGD
FT                   NVFVGSNTQLVAPVTIAKGATIGAGTTVTKNVAEDELVVSRTKQTHIQGWKRPVKKK"
FT   misc_feature    complement(29609..29662)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 2.4"
FT                   /inference="protein motif:Pfam:PF00132"
FT   misc_feature    complement(29663..29716)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 2.3"
FT                   /inference="protein motif:Pfam:PF00132"
FT   misc_feature    complement(29738..29791)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 1.1e+02"
FT                   /inference="protein motif:Pfam:PF00132"
FT   misc_feature    complement(29876..29929)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 21"
FT                   /inference="protein motif:Pfam:PF00132"
FT   misc_feature    complement(29945..29998)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 0.039"
FT                   /inference="protein motif:Pfam:PF00132"
FT   misc_feature    complement(30032..30085)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 0.14"
FT                   /inference="protein motif:Pfam:PF00132"
FT   misc_feature    complement(30197..30877)
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl transferase,
FT                   score 6.4e-08"
FT                   /inference="protein motif:Pfam:PF00483"
FT   CDS_pept        complement(31026..31448)
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="PAU_00035"
FT                   /old_locus_tag="PAT2067"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00035"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82128"
FT                   /db_xref="GOA:C7BU15"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU15"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82128.1"
FT                   /translation="MAAMTYHLNVVSAESRMFDGLVQKIQVTGSEGELGIYPGHAPLLT
FT                   AIKPGMVRIVKQFGEEEVIYLSGGILEVQPSGVIVLADTAIRGKDLDEAKALESKRKAE
FT                   EHIRNSHGDVDYAQASAELSKAIAKLRVIELTKKAM"
FT   misc_feature    complement(31041..31184)
FT                   /note="HMMPfam hit to PF00401, ATP synthase, Delta/Epsilon
FT                   chain, long, score 1.1e-12"
FT                   /inference="protein motif:Pfam:PF00401"
FT   misc_feature    complement(31188..31436)
FT                   /note="HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon
FT                   chain, beta, score 4.3e-32"
FT                   /inference="protein motif:Pfam:PF02823"
FT   CDS_pept        complement(31470..32852)
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="PAU_00036"
FT                   /old_locus_tag="PAT2068"
FT                   /product="membrane-bound ATP synthase F1 sector
FT                   beta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00036"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82129"
FT                   /db_xref="GOA:C7BU16"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU16"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82129.1"
FT                   /translation="MATGKIIQVIGAVVDVEFPQDAVPKVYDALEVQNGEAKLVLEVQQ
FT                   QLGGGVVRCIAMGTSDGLSRGLSVTDLSHPIEVPVGKATLGRIMNVLGEPIDMKGDIGE
FT                   EERWPIHRPAPSYEELSNSQELLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVLDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYNVARGVQSILQRYQELKDIIAILGMDELSEDDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGILEGDYDHLPEQAFYMVGTIEEAVEKAK
FT                   KL"
FT   misc_feature    complement(31473..31790)
FT                   /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
FT                   chain, C termin, score 4e-49"
FT                   /inference="protein motif:Pfam:PF00306"
FT   misc_feature    complement(31638..32429)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   0.0003"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(31827..32468)
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleot, score 1.9e-91"
FT                   /inference="protein motif:Pfam:PF00006"
FT   misc_feature    complement(32634..32837)
FT                   /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
FT                   family, beta-ba, score 6.1e-25"
FT                   /inference="protein motif:Pfam:PF02874"
FT   CDS_pept        complement(32887..33750)
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="PAU_00037"
FT                   /old_locus_tag="PAT2069"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00037"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82130"
FT                   /db_xref="GOA:C7BU17"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU17"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82130.1"
FT                   /translation="MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPY
FT                   AETIRSVIGHLALGNLEYKHPYLEEREIKRVGYLVVSTDRGLCGGLNTNLFKKLMLDMK
FT                   GWSDKGVQCDLALIGSKAASFFASVGGNIVAQVTGMGDNPSLSELIGPVNIMLRAYDEG
FT                   RLDKLYVVTNKFINTMSQEPTITQLLPLPAGDDETLKKKSWDYLYEPDPKALLDILLRR
FT                   YVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIV
FT                   SGASAV"
FT   misc_feature    complement(32890..33747)
FT                   /note="HMMPfam hit to PF00231, ATP synthase, score
FT                   6.7e-166"
FT                   /inference="protein motif:Pfam:PF00231"
FT   CDS_pept        complement(33809..35350)
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="PAU_00038"
FT                   /old_locus_tag="PAT2070"
FT                   /product="ATP synthase subunit alpha"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00038"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82131"
FT                   /db_xref="GOA:C7BU18"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU18"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:J01594"
FT                   /protein_id="CAQ82131.1"
FT                   /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVNDGIIRIHGLA
FT                   EVMQGEMIALPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLL
FT                   GRVVNTLGEPIDGKGPVEHDGFSAVEMIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQ
FT                   RELVIGDRQTGKTALAIDAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTI
FT                   VVVATASESAALQYLAPYSGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAARVNAEYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESSLFNAGIRPAVNPGISVSRVGGAAQTKIVKKLSGGIRTALAQ
FT                   YRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLSLFSAERGYLED
FT                   VEIAKIIDFESALLAYASREHADLLKEIDQSGGYNEEIEAKLKALLDSFKATQSW"
FT   misc_feature    complement(33878..34192)
FT                   /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
FT                   chain, C termin, score 1.4e-27"
FT                   /inference="protein motif:Pfam:PF00306"
FT   misc_feature    complement(34226..34909)
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleot, score 6e-117"
FT                   /inference="protein motif:Pfam:PF00006"
FT   misc_feature    complement(35075..35281)
FT                   /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
FT                   family, beta-ba, score 1.1e-16"
FT                   /inference="protein motif:Pfam:PF02874"
FT   CDS_pept        complement(35365..35898)
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="PAU_00039"
FT                   /old_locus_tag="PAT2071"
FT                   /product="membrane-bound ATP synthase F1 sector
FT                   delta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00039"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82132"
FT                   /db_xref="GOA:C7BU09"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU09"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82132.1"
FT                   /translation="MSEFATVARPYAKAAFDFAVEKQSLEQWQNMLAFTAEVTRNEQVG
FT                   ELLSGSLASETLANTFIAICGEQVDEHAQNFIRIMAENGRLLALPEVLQQFIQLRASLE
FT                   STVDVEVISATELSEQQLAKISTAMEKRLSRKVKLNCKIDKSVIAGVVVRAGDLVIDGS
FT                   IRGRLDRLTDVLQS"
FT   misc_feature    complement(35374..35880)
FT                   /note="HMMPfam hit to PF00213, ATP synthase delta (OSCP)
FT                   subunit, score 3.5e-70"
FT                   /inference="protein motif:Pfam:PF00213"
FT   CDS_pept        complement(35911..36381)
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="PAU_00040"
FT                   /old_locus_tag="PAT2072"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82133"
FT                   /db_xref="GOA:C7BU10"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU10"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82133.1"
FT                   /translation="MNLNATILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLS
FT                   SAERAKKDLDLAQANATDQMKRAKAEAQVIIEQANKQKAQILDDAKAEAELERNRIVAQ
FT                   AQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL"
FT   misc_feature    complement(35971..36366)
FT                   /note="HMMPfam hit to PF00430, ATP synthase B/B' CF(0),
FT                   score 4.1e-40"
FT                   /inference="protein motif:Pfam:PF00430"
FT   sig_peptide     complement(36289..36381)
FT                   /gene="atpF"
FT                   /locus_tag="PAU_00040"
FT                   /note="Signal peptide predicted for PAT2072 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.878) with cleavage site
FT                   probability 0.869 between residues 31 and 32"
FT   misc_feature    complement(36295..36363)
FT                   /note="1 probable transmembrane helix predicted for PAT2072
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(36438..36677)
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="PAU_00041"
FT                   /old_locus_tag="PAT2073"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82134"
FT                   /db_xref="GOA:C7BU11"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU11"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /inference="similar to AA sequence:UniProt:Q0TAX2"
FT                   /protein_id="CAQ82134.1"
FT                   /translation="MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDL
FT                   IPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA"
FT   misc_feature    complement(36447..36656)
FT                   /note="HMMPfam hit to PF00137, ATP synthase subunit C,
FT                   score 1.2e-24"
FT                   /inference="protein motif:Pfam:PF00137"
FT   misc_feature    complement(order(36453..36521,36582..36650))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2073 by TMHMM2.0 at aa 10-32 and 53-75"
FT   sig_peptide     complement(36609..36677)
FT                   /gene="atpE"
FT                   /locus_tag="PAU_00041"
FT                   /note="Signal peptide predicted for PAT2073 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.749) with cleavage site
FT                   probability 0.528 between residues 23 and 24"
FT   CDS_pept        complement(36726..37550)
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="PAU_00042"
FT                   /old_locus_tag="PAT2074"
FT                   /product="membrane-bound ATP synthase F0 sector subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00042"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82135"
FT                   /db_xref="GOA:C7BU12"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU12"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82135.1"
FT                   /translation="MSASGEVSTARDYIGHHLNNLQLDLRTFELVDPNSGGSATFWTLN
FT                   IDSLFFSVVLGILFLYVFRKVAVNATSGVPGKLQTAIELIMGFVDNSVRDMYHGKSKVI
FT                   APLALTVFVWVLLMNIMDLLPIDFLPYIGEHVFGLPALRVVPTADVSITLSMAIGVFVL
FT                   ILYYSIKMKGISGFTKELTLQPFNHPLFIPINLILEGVSLLSKPVSLGLRLFGNMYAGE
FT                   LIFILIAGLLPWWSQWMLSLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH"
FT   misc_feature    complement(36744..37427)
FT                   /note="HMMPfam hit to PF00119, ATP synthase A chain, score
FT                   6.6e-92"
FT                   /inference="protein motif:Pfam:PF00119"
FT   misc_feature    complement(order(36747..36815,36843..36911,37050..37118,
FT                   37176..37244,37362..37430))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2074 by TMHMM2.0 at aa 41-63, 103-125, 145-167, 214-236
FT                   and 246-268"
FT   CDS_pept        complement(37581..37958)
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="PAU_00043"
FT                   /old_locus_tag="PAT2075"
FT                   /product="atp synthase protein i"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00043"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82136"
FT                   /db_xref="GOA:C7BU13"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU13"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to AA sequence:UniProt:Q0W9Q9"
FT                   /protein_id="CAQ82136.1"
FT                   /translation="MSVSLYSGKIALKLLFLQLMTFVILSVAFCTKSIEWGASAFAGGL
FT                   ACWLPNAIFMLFAGFQKAKGEDVSVRVAWSFAIGEGVKVIITIAVLIVALGVFKAAFVP
FT                   LGLAYLVVLIVQIIASAVING"
FT   misc_feature    complement(37584..37946)
FT                   /note="HMMPfam hit to PF03899, ATP synthase I chain, score
FT                   3.5e-20"
FT                   /inference="protein motif:Pfam:PF03899"
FT   misc_feature    complement(order(37587..37655,37674..37742,37785..37853,
FT                   37872..37931))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PAT2075 by TMHMM2.0 at aa 10-29, 36-58, 73-95 and 102-124"
FT   sig_peptide     complement(37833..37958)
FT                   /gene="atpI"
FT                   /locus_tag="PAU_00043"
FT                   /note="Signal peptide predicted for PAT2075 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.844) with cleavage site
FT                   probability 0.811 between residues 42 and 43"
FT   CDS_pept        complement(38568..39209)
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="PAU_00044"
FT                   /old_locus_tag="PAT2076"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00044"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82137"
FT                   /db_xref="GOA:C7BU63"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU63"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82137.1"
FT                   /translation="MPERIFIVLNKLELLLTKARIKLSQQQKQQLIAYVDMLNKWNKTY
FT                   NLTSVRDPEQMLVRHIMDSIIVSPYLQGYRFIDVGTGPGLPGIPLAIVRPDSHFTLLDS
FT                   LGKRVRFLRQVQHELSLANIEPVQSRVEEYLSGPPFDGVISRAFASLQDMVSWCNHLSK
FT                   PIHGRFYALKGVLPEEELTMLPSGISVDSVIQLDVPELEGQRHLVILKSN"
FT   misc_feature    complement(38586..39131)
FT                   /note="HMMPfam hit to PF02527, Glucose inhibited division
FT                   protein, score 1.9e-83"
FT                   /inference="protein motif:Pfam:PF02527"
FT   CDS_pept        complement(39202..41091)
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="PAU_00045"
FT                   /old_locus_tag="PAT2077"
FT                   /product="trna uridine 5-carboxymethylaminomethyl
FT                   modification enzyme gid (glucose-inhibited division protein
FT                   a)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00045"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82138"
FT                   /db_xref="GOA:C7BU64"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU64"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82138.1"
FT                   /translation="MFYPEQFDVIIIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEIDALGGLMAKATDQAGIQFRTLNASKGPAVRATRAQADRVLY
FT                   RQAIRTALENQPNLMIFQQPVEDLIVENDMVIGAVTRMGLKFRAKAVVLTVGTFLDGKI
FT                   HIGLENYSGGRAGDPPAISLSQRLRELPLRVNRLKTGTPPRIDARTIDFSQLTQQLGDT
FT                   PTPVFSFLGNAGQHPQQMPCYITHTNEKTHDVIRNNLDRSPMYAGIIEGIGPRYCPSIE
FT                   DKVMRFADRNAHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVHSMKGMENARIVRPG
FT                   YAIEYDFFDPRDLKQTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARYATEEE
FT                   GWFPRRDQAYIGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEKGRKLGLV
FT                   DDSRWEHYCRKVEMIEQERQRLRNIWIHPHSNNLIDINDILKTPLSKEANGEDLLRRPE
FT                   MNYELLTSLPLFSPGLKEPQTADQVEIQVKYEGYIARQQEEIEKQLRNENTSLPIDLDY
FT                   CQISGLSNEVVAKLNDHKPSSIGQASRISGITPAAISILLVWLKKQGLLRRSA"
FT   misc_feature    complement(39895..41070)
FT                   /note="HMMPfam hit to PF01134, Glucose inhibited division
FT                   protein A, score 6.7e-273"
FT                   /inference="protein motif:Pfam:PF01134"
FT   misc_feature    complement(39898..41070)
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.0011"
FT                   /inference="protein motif:Pfam:PF01266"
FT   CDS_pept        complement(41470..41931)
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="PAU_00046"
FT                   /old_locus_tag="PAT2078"
FT                   /product="protein mioc, involved in modulation of
FT                   initiation at oric, initiation of chromosome replication"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00046"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82139"
FT                   /db_xref="GOA:C7BU65"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU65"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82139.1"
FT                   /translation="MKFVGITMATITLISGSTMGSAEYVAEHMAEILEDVGFSTEILHG
FT                   PSLNELPQEGIWLVVTSTHGAGELPENIQPLAEEIAEQKPDLSKVTFGAVGLGSSEYDT
FT                   FCGAIRSLDQLLIENGAKRLGDRLEIDIQQHEIPEDPAEEWVKIWATSL"
FT   misc_feature    complement(41497..41895)
FT                   /note="HMMPfam hit to PF00258, Flavodoxin, score 1.7e-35"
FT                   /inference="protein motif:Pfam:PF00258"
FT   sig_peptide     complement(41872..41931)
FT                   /gene="mioC"
FT                   /locus_tag="PAU_00046"
FT                   /note="Signal peptide predicted for PAT2078 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.775 between residues 20 and 21"
FT   CDS_pept        complement(42002..42463)
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="PAU_00047"
FT                   /old_locus_tag="PAT2079"
FT                   /product="regulatory protein asnc"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00047"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82140"
FT                   /db_xref="GOA:C7BU66"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU66"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82140.1"
FT                   /translation="MSEIYQIDNLDRDILHALMDNARTPYAELAKKFAVSPGTIHVRVE
FT                   KMKQAGIITGTRVDISPKQLGYDVCCFIGIILKSAKDYPSALKKLGNLNEVVEVYYTTG
FT                   HYSIFIKVMCRSIESLQDVLINKIQTIDEIQSTETLISLQNPIMRTIKP"
FT   misc_feature    complement(42029..42253)
FT                   /note="HMMPfam hit to PF01037, AsnC family, score 3.2e-19"
FT                   /inference="protein motif:Pfam:PF01037"
FT   misc_feature    complement(42122..42445)
FT                   /note="HMMSmart hit to SM00344, no description, score
FT                   3.3e-44"
FT                   /inference="protein motif:Smart:SM00344"
FT   CDS_pept        42552..43622
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="PAU_00048"
FT                   /old_locus_tag="PAT2080"
FT                   /product="asparagine synthetase A"
FT                   /EC_number="6.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00048"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82141"
FT                   /db_xref="GOA:C7BU67"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU67"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82141.1"
FT                   /translation="MNLFPILLLNVFNRTSGSFKEFENNIMKKSFIEKQQQISFVKSFF
FT                   SRLLESKLGLIEVQGPMLSCLGDGIQDNLSGHEKAVQVKVKTLPDSTFEVVHSLAKWKR
FT                   KTLGRFDFQPEQGLYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMGDGQRSLAYLKQTV
FT                   GKIYEAIKETEKAVSKEFGLAPFLPDQIHFVHSEALLSRYPELDAKGRERAIAKELGAV
FT                   FLIGIGAKLSDGQSHDVRAPDYDDWTTPNSDGFAGLNGDIIVWNPVLEDAFEISSMGIR
FT                   VDAATLERQLSLTGDEDRLQYDWHQALLKGDMPQSIGGGIGQSRLVMLLLQMKHIGQVQ
FT                   CSIWSPEVRETVEDML"
FT   misc_feature    42636..43367
FT                   /note="HMMPfam hit to PF03590, Aspartate-ammonia ligase,
FT                   score 7.2e-167"
FT                   /inference="protein motif:Pfam:PF03590"
FT   CDS_pept        complement(43628..45085)
FT                   /transl_table=11
FT                   /gene="viaA"
FT                   /gene_synonym="yieM"
FT                   /locus_tag="PAU_00049"
FT                   /old_locus_tag="PAT2081"
FT                   /product="protein viaa (vwa-domain protein interacting with
FT                   aaa atpase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00049"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82142"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU72"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82142.1"
FT                   /translation="MISLTTLDLLLSVNEGELIEELVLTLLASPQLAIFFEKYPRLKRA
FT                   LLKDIPGWKQDLQQRIKEALIPATLAEEFQLYQQLLPASTDNFYLKLPEILETLSRIES
FT                   PFYTEAQKLATNAIDHSNTLQTLFIQRWRLNLILQTTNFHKELLEQEKEQLLAELQQRL
FT                   TLSGNLDPILNENDRAAGRLWDMSKSQINHSRNDTQLLIHYSEFLRQQPELEKLAQLLG
FT                   RSQSARSKLQENHLLEPFTTIERTPDTIPEQVNGIGQSDDILRLLPTELAILGIEDLEY
FT                   EFYRRLIEKRLFTYQLQGDSWKQKTTLRSVTHYSQEEKPRGPFIVCVDTSGSMGGFNEK
FT                   CAKAFCLALLRIALADDRNCHIMLFATEVVHYELSSSDGLEQAIRFLSQTFTGGTDLTF
FT                   CLTSTIEKMKEQHWQDADAVVISDFIAQRLPGSLIHQIKNLQQHQQHRFHAVSMSQYGK
FT                   PGIMRIFDYIWRFDTGLKSRLLRKWRH"
FT   misc_feature    complement(43631..44125)
FT                   /note="HMMSmart hit to SM00327, no description, score
FT                   5.2e-05"
FT                   /inference="protein motif:Smart:SM00327"
FT   CDS_pept        complement(45090..46601)
FT                   /transl_table=11
FT                   /gene="ravA"
FT                   /locus_tag="PAU_00050"
FT                   /old_locus_tag="PAT2082"
FT                   /product="ATPase RavA"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82143"
FT                   /db_xref="GOA:C7BU73"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU73"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82143.1"
FT                   /translation="MVWIMQIAEKIACLSNYLESGLYERQQAIRLCLLAALCGESVFLL
FT                   GPPGIAKSLIARRLKFAFHDARAFEYLMTRFSTPEEIFGPLSIQALKDEGRYQRLTTGY
FT                   LPETEIVFLDEIWKAGPAILNTLLTAINEKKFRNGDIEEKIPMRLLVTASNELPEADSS
FT                   LEALYDRMLIRIWLDKIQEKQNFRALLTNHKNEIDNPVPANIQITSEEFHQWQNEINKI
FT                   ALPDNCFDIIYQLRQQLDVTEHSPYVSDRRWKKAIHLLQASAFFNGRKEISFLDLILLK
FT                   DCLWHDLHSFKLLPQHLNTLITEQAYQQRVLSQQIDSLYHQWIQVRQDKNNQQAFQLGK
FT                   KIHLFRHKTQYSLPDHINEEKLTLFLHTPLYVHDIQVNFIEIEKKILNIWINKGGKLPA
FT                   RLNSIGFPQNITAEINSAHQIEIFDISRRSSTLYLPDSQYQQNEKSSKWLERFDKINQD
FT                   IHHQRQLFNQHKPCLFIESHWLNTIEQSFIQLTDKLNQLKTKMGN"
FT   misc_feature    complement(46041..46490)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   3.6e-05"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(46065..46481)
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 1.4e-42"
FT                   /inference="protein motif:Pfam:PF07728"
FT   operon          46871..52786
FT                   /operon="rbs"
FT   CDS_pept        46871..47275
FT                   /transl_table=11
FT                   /operon="rbs"
FT                   /gene="rbsD"
FT                   /locus_tag="PAU_00051"
FT                   /old_locus_tag="PAT2083"
FT                   /product="high affinity ribose transport protein rbsd"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82144"
FT                   /db_xref="GOA:C7BU74"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU74"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82144.1"
FT                   /translation="MLNSEISAVISRLGHTDQITIGDAGLPIPSSAQRIDLALTQGIPC
FT                   FISVLKVVTHEMQVEAAFLAKEIISYNPLIHQLILAQIKELEKQQGNSITIEYISHNTL
FT                   KEKTEHSRAMIRTGENSPYANIILCAGVTF"
FT   misc_feature    46871..47272
FT                   /note="HMMPfam hit to PF05025, RbsD / FucU transport
FT                   protein family, score 2.8e-63"
FT                   /inference="protein motif:Pfam:PF05025"
FT   CDS_pept        47283..48788
FT                   /transl_table=11
FT                   /operon="rbs"
FT                   /gene="rbsA"
FT                   /locus_tag="PAU_00052"
FT                   /old_locus_tag="PAT2084"
FT                   /product="ribose transport atp-binding protein rbsa"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00052"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82145"
FT                   /db_xref="GOA:C7BU75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU75"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82145.1"
FT                   /translation="MQPVLELKGIGKSFPGVKALSDAALRVYPGKVMALVGENGAGKST
FT                   MMKVLTGIYTRDTGMIRYLGKEVTFSSPKSSQEAGIGIIHQELNLVSQLTIAENIFLGR
FT                   EFVNKFGTIDWKKMYQEADRLLRKLNLSYSSHRRVTELSIGEQQMVEIAKVLSFESKVI
FT                   IMDEPTDALTDTETESLFRVIRELKFQGCGIVYISHRLKDIFEICDDVTILRDGQFIDE
FT                   KQVKELKEDNLIEMMVGRKLEDQYPRLNLPRGKKRLEVEEISGPGVRNVSFSLYSGEIL
FT                   GISGLMGAGRTELMRIIYGALPKTQGQITLDGNPVITRNPQDALAYGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSNKSGSLNHKEERQAVSNFIKLFNIKTPSMEQTINLLSGG
FT                   NQQKVAIARGLMTRPKVLILDEPTRGIDVGAKKEIYQLINQFKKGGLSIILVSSEMPEV
FT                   IGMSDRILVMHEGHISAEFFAEQATQKALMAAAVGKHYDVVQE"
FT   misc_feature    47367..47960
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   9.9e-08"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    47370..47933
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.6e-48"
FT                   /inference="protein motif:Pfam:PF00005"
FT   misc_feature    48111..48698
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   1.2e-10"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    48114..48695
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-34"
FT                   /inference="protein motif:Pfam:PF00005"
FT   CDS_pept        48795..49766
FT                   /transl_table=11
FT                   /operon="rbs"
FT                   /gene="rbsC"
FT                   /locus_tag="PAU_00053"
FT                   /old_locus_tag="PAT2085"
FT                   /product="ribose transport system permease protein"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00053"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82146"
FT                   /db_xref="GOA:C7BU76"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU76"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82146.1"
FT                   /translation="MNSNASLTPKRWFTKEWLLAQKSLIALLVLIIVVSSLSPNFFTLD
FT                   NLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASLVGMDVNALVAIVS
FT                   GLALGAAIGAGTGIIIAKGKIQAFIATLVMMLLLRGITRVYTDGSPINTGFSDNADLFS
FT                   WFGIGRPLGIPTPVWLMLIVFVIAWYILHYTRLGRYIYALGGNESATRLSGISVDKIKI
FT                   IVYSLCGLLTALAGIIEVARLSSAQPMAGNGYELDAIAAVVLGGTRLSGGKGLIVGTLI
FT                   GALILGFLNNGLNLLGISSNYQMIVKAIVILLAVLIDNKSGK"
FT   sig_peptide     48795..48923
FT                   /gene="rbsC"
FT                   /locus_tag="PAU_00053"
FT                   /note="Signal peptide predicted for PAT2085 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.950) with cleavage site
FT                   probability 0.733 between residues 43 and 44"
FT   misc_feature    order(48867..48926,48960..49028,49086..49154,49173..49232,
FT                   49305..49373,49458..49526,49620..49688)
FT                   /note="7 probable transmembrane helices predicted for
FT                   PAT2085 by TMHMM2.0 at aa 25-44, 56-78, 98-120, 127-146,
FT                   171-193, 222-244 and 276-298"
FT   misc_feature    48930..49739
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport syst, score 6.1e-76"
FT                   /inference="protein motif:Pfam:PF02653"
FT   CDS_pept        49791..50681
FT                   /transl_table=11
FT                   /operon="rbs"
FT                   /gene="rbsB"
FT                   /locus_tag="PAU_00054"
FT                   /old_locus_tag="PAT2086"
FT                   /product="d-ribose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00054"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82147"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU77"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82147.1"
FT                   /translation="MKMKKLAAILSAVALSATMSANTLAKDAIALVISTLNNPFFVTMK
FT                   DSAQKEANKLGYNLIVLDSQDNPAKELANVQDLTVRGIKLMLINPTDSDAVGNAIIMAN
FT                   NAEIPVITLDRMANKGRVVSHIASDNRRGSKIAGDFIAEILGNGAQVIQLEGIIGTSAA
FT                   RERGEGFNKVAQEHKFNVLINQTADFDRTKGLNVMQNLLTAHPNVQAVFAQNDEMALGA
FT                   LRALQAAGKSDVLVVGFDGTEDGIKAVQSGKLGATIAQRPDQIGIIGVQTADKVLKGEK
FT                   VDAVIPVELELIIKK"
FT   sig_peptide     49791..49865
FT                   /gene="rbsB"
FT                   /locus_tag="PAU_00054"
FT                   /note="Signal peptide predicted for PAT2086 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.991 between residues 25 and 26"
FT   misc_feature    49866..50678
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 1.9e-09"
FT                   /inference="protein motif:Pfam:PF00532"
FT   CDS_pept        50853..51782
FT                   /transl_table=11
FT                   /operon="rbs"
FT                   /gene="rbsK"
FT                   /locus_tag="PAU_00055"
FT                   /old_locus_tag="PAT2087"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00055"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82148"
FT                   /db_xref="GOA:C7BU68"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU68"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82148.1"
FT                   /translation="MGTAKLAVVGSINADHILNLESFPRPGETVIGKQYQIAFGGKGAN
FT                   QAVAAGRSGADITFIACVGQDDIGSRICQQLAMDNVNTSSIEAIEGETTGVALILVNQQ
FT                   GENVICINAGANAALTPEYFHRYQNIIKEADALLIQLESPLETVQLAAETAKQNNTKVI
FT                   LNPAPAQKLSDQLLSLVDIITPNETEVEYLTGITIKDNSDAEKAAKVLHGKGIETVIIT
FT                   LGSCGIWLSEKGQKGKIVPGFKVKAVDTIAAGDTFNGALATALLEGKVMLSAVRFAHSA
FT                   AAIAVTRQGAQPSIPWRNEIDTFLTEQD"
FT   misc_feature    50859..51746
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase, score 8.6e-89"
FT                   /inference="protein motif:Pfam:PF00294"
FT   misc_feature    51234..51722
FT                   /note="HMMPfam hit to PF08543, Phosphomethylpyrimidine
FT                   kinase, score 9.5e-05"
FT                   /inference="protein motif:Pfam:PF08543"
FT   CDS_pept        51785..52786
FT                   /transl_table=11
FT                   /operon="rbs"
FT                   /gene="rbsR"
FT                   /locus_tag="PAU_00056"
FT                   /old_locus_tag="PAT2088"
FT                   /product="regulator for rbs operon"
FT                   /note="regulator for rbs operon"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00056"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82149"
FT                   /db_xref="GOA:C7BU69"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU69"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82149.1"
FT                   /translation="MATIKDVARFAGVSTSTVSHVINNNRYVSDGVKKKVNDAINQLNY
FT                   APSALARSLKVKQTKTIGMLVTTSNNPFYAEIVRGVERSCYERGYSLILCNTEGDIKRM
FT                   DHSMETLLQKRVDGLLIMCAENQCTSCDVLRRYPPLPMVMMDWSPFDIVGDIIQDNSLL
FT                   GGEMATNHLISCGFKKIACIAGPQDKTPARHRLEGYRKAMAKVGYAIPDGYEIYSDFEF
FT                   AGGFESMQKLLQHPEPPEAVFAGNDAMAVGAYQALYQAGLSVPNDISIIGYDDIDLAPY
FT                   MIPPLTTIHQPKDELGKLAIDTLLYRMGNPESDPKLLVLTPTLIERNSVFRS"
FT   misc_feature    51785..51997
FT                   /note="HMMSmart hit to SM00354, no description, score
FT                   2.1e-33"
FT                   /inference="protein motif:Smart:SM00354"
FT   misc_feature    51788..51865
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.2e-12"
FT                   /inference="protein motif:Pfam:PF00356"
FT   misc_feature    51959..52768
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 2.3e-17"
FT                   /inference="protein motif:Pfam:PF00532"
FT   CDS_pept        complement(52783..54174)
FT                   /transl_table=11
FT                   /gene="yieO"
FT                   /locus_tag="PAU_00057"
FT                   /old_locus_tag="PAT2089"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82150"
FT                   /db_xref="GOA:C7BU70"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU70"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82150.1"
FT                   /translation="MVKTARNMAGLPWIAAIAFFMQALDATILNTALPAIAESLEHSPL
FT                   AMQSAVVSYTLTVALLIPVSGWLADRFGTRRIFIFAVSLFSLGSLACALSGNLAFLVVS
FT                   RVIQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLVGPILGPMLGGLLVTYATW
FT                   HWIFIINIPIGLLGIIYAKKHMPNFTMPKRSFDFSGFILFGLSLIMVSISLDLLGESSL
FT                   PSYIPFTIMIVGFTMLFGYLMHARKHPQPLISLNLFRTRTFSIGIIGNIVTRLGTGCIP
FT                   FLMPLMLQIGFGYPAVIAGMMMAPTAIGSIIAKSFVTNVLTRFGYRKILVSITVIIGLI
FT                   ISQFSLQSPEIPVVLLVIPLFLLGMAVSIQFTSMNTITLADLTNNNASSGNSLLAVTQQ
FT                   LSISFGVAVSAAILRFYDSMPHGTTVDHFHNTFITVGIMTLLSSSTFLLLHKEDGDNLI
FT                   KEKNT"
FT   misc_feature    complement(order(52825..52884,52927..52995,53056..53124,
FT                   53137..53205,53239..53307,53320..53388,53449..53508,
FT                   53536..53595,53632..53691,53701..53769,53803..53871,
FT                   53881..53949,53968..54027,54070..54138))
FT                   /note="14 probable transmembrane helices predicted for
FT                   PAT2089 by TMHMM2.0 at aa 13-35, 50-69, 76-98, 102-124,
FT                   136-158, 162-181, 194-213, 223-242, 263-285, 290-312,
FT                   324-346, 351-373, 394-416 and 431-450"
FT   misc_feature    complement(52933..54132)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.8e-49"
FT                   /inference="protein motif:Pfam:PF07690"
FT   sig_peptide     complement(54064..54174)
FT                   /gene="yieO"
FT                   /locus_tag="PAU_00057"
FT                   /note="Signal peptide predicted for PAT2089 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.814 between residues 37 and 38"
FT   CDS_pept        complement(54345..54569)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00058"
FT                   /old_locus_tag="PAT2090"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00058"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82151"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU71"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82151.1"
FT                   /translation="MPAESSPYWLFSAWPDNVYQRCVGQWWRIIGRSSALASVYLQKTF
FT                   VRVFFQQILYFWWFFYTKTNVIDSNSSQI"
FT   rRNA            54772..56260
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            56391..56463
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:56425..56427,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score58.81"
FT   rRNA            57296..59677
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            59813..59928
FT                   /inference="similar to RNA sequence:Rfam:RF00001"
FT   CDS_pept        complement(60039..61622)
FT                   /transl_table=11
FT                   /gene="yhbX"
FT                   /locus_tag="PAU_00059"
FT                   /old_locus_tag="PAT2096"
FT                   /product="outer-membrane protein yhbx"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00059"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82152"
FT                   /db_xref="GOA:C7BTZ0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82152.1"
FT                   /translation="MQNKLSILIISLLTLLPIIFIGDIAHEYKLRIVLLNFFLAGTSAF
FT                   LYRFNYLKPLVFITSLLWSLNISTSFFFSNEYQINFSSTIANTFINTNSNEAVGMLSYN
FT                   KHYVLFFIFMLLTYFLSIRWLSKNTNYRLLKFSVWALFFTCLLVPIDYYISEKKLSDNI
FT                   ILTEYFLMVTPFNNSSAIVRAIYENQQIRKIASVNVKFNYIQEDKNIDTYILLIGESAR
FT                   RDHMSLYGYDKATTPTLDAMQKNMLIFNQAISPASVTILSVPISLSNITLYQLRDKAHY
FT                   ADNIISLAKDAGFNTTWISNQGRSGKSNSLITVIANMAESQKWNKYIGYDEELLPYLDD
FT                   ALKQKGKKFIIMHIYGSHEPSCNRFPENKLISFSSNKDDNCYDSSIAYTDLLIDKIIDK
FT                   LKGNKASILYFSDHGLQRLDKDGDIRYHHGVSNPRKDSYNIPLLIWYDDSINSQYRHTG
FT                   VINTPFSTTDNYYLISDWLGIHHKSPEHCRSPLSNCFKSLKELMVIDGNKNLMEYSKLP
FT                   DEKDIKTSGK"
FT   misc_feature    complement(60159..60995)
FT                   /note="HMMPfam hit to PF00884, Sulfatase, score 3.9e-49"
FT                   /inference="protein motif:Pfam:PF00884"
FT   misc_feature    complement(order(61158..61226,61245..61304,61404..61463,
FT                   61482..61535,61545..61604))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2096 by TMHMM2.0 at aa 7-26, 30-47, 54-73, 107-126 and
FT                   133-155"
FT   sig_peptide     complement(61548..61622)
FT                   /gene="yhbX"
FT                   /locus_tag="PAU_00059"
FT                   /note="Signal peptide predicted for PAT2096 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.703) with cleavage site
FT                   probability 0.543 between residues 25 and 26"
FT   CDS_pept        complement(61771..63420)
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /gene_synonym="yjcG"
FT                   /locus_tag="PAU_00060"
FT                   /old_locus_tag="PAT2097"
FT                   /product="cation/acetate symporter actp (acetate
FT                   transporter actp) (acetat permease)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82153"
FT                   /db_xref="GOA:C7BTZ1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82153.1"
FT                   /translation="MKKSLLTVILLFSNLTWADAISGSVERQPVNIQAIIMFVLFVGFT
FT                   LYITYWASKRTRSRTDYYTAGGRITGFQNGMAIAGDFMSAASFLGISALVYISGYDGLI
FT                   YSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSAIGSLVVVALYLIA
FT                   QMVGAGKLIELLFGLDYHIAVVLVGILMVLYVLFGGMLATTWVQIIKAILLLAGATFMA
FT                   FMVMKAVNFNFNTLFKEAVAVHSKGEAIMSPGGLVSDPISALSLGLALMFGTAGLPHII
FT                   MRFFTVNDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSPNPLFKEATGALIGGTN
FT                   MAAVHLASAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVIKHGKANER
FT                   DELKVSKITVVILGLVAIGLGILFENQNIAFMVGLAFSIAASCNFPIILLSMYWRKLTT
FT                   RGALVGGWLGLITAVVLMILGPTIWVSILGHEKPIYPYEYPALFSMIVAFIGSWLFSIT
FT                   DNSLQGIQERGKFRAQFIRSQTGFGIAQGKAH"
FT   misc_feature    complement(order(61873..61941,61969..62037,62071..62139,
FT                   62152..62211,62272..62340,62464..62532,62566..62634,
FT                   62722..62790,62809..62877,62920..62988,63049..63117,
FT                   63130..63198,63259..63327,63355..63408))
FT                   /note="14 probable transmembrane helices predicted for
FT                   PAT2097 by TMHMM2.0 at aa 5-22, 32-54, 75-97, 102-124,
FT                   145-167, 182-204, 211-233, 263-285, 297-319, 361-383,
FT                   404-423, 428-450, 462-484 and 494-516"
FT   misc_feature    complement(62017..63237)
FT                   /note="HMMPfam hit to PF00474, Sodium:solute symporter
FT                   family, score 3.2e-173"
FT                   /inference="protein motif:Pfam:PF00474"
FT   sig_peptide     complement(63367..63420)
FT                   /gene="actP"
FT                   /locus_tag="PAU_00060"
FT                   /note="Signal peptide predicted for PAT2097 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.990 between residues 18 and 19"
FT   CDS_pept        complement(63417..63728)
FT                   /transl_table=11
FT                   /gene="yjcH"
FT                   /locus_tag="PAU_00061"
FT                   /old_locus_tag="PAT2098"
FT                   /product="similar to putative membrane protein yjch of
FT                   escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82154"
FT                   /db_xref="GOA:C7BTZ2"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82154.1"
FT                   /translation="MNDVIYQGIENNPRFKELVKKRGRFAWLLSIITLVLYVSFIFTIA
FT                   FTPEWLGTPLYAGSHITRGIPVGIGLIVISFILTGLYVIRANSEFDSLTSQILIEVKK"
FT   misc_feature    complement(63420..63728)
FT                   /note="HMMPfam hit to PF04341, Protein of unknown function,
FT                   DUF485, score 5e-46"
FT                   /inference="protein motif:Pfam:PF04341"
FT   misc_feature    complement(order(63477..63545,63588..63656))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2098 by TMHMM2.0 at aa 25-47 and 62-84"
FT   CDS_pept        complement(63794..65749)
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="PAU_00062"
FT                   /old_locus_tag="PAT2099"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00062"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82155"
FT                   /db_xref="GOA:C7BTZ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ3"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82155.1"
FT                   /translation="MTQIMKYPIPAIIAEHTLMNKQQYQQNYQLSLQDPEKFWGDKGKI
FT                   VDWIKPYTKVKNTSFDPGHINIRWFEDGTLNLSANCLDRHLKERGDQTAIIWEGDDPTE
FT                   SKTVTYRELHHDVCQFANVLKNLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIF
FT                   AGFSPDAVSGRIIDSNTKLVITADEGLRAGRTIPLKKNVDDALSNTAVVSVSNVIVFKR
FT                   TGNINNWHSGRDLWWHELTAGVSADCPVEEMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYASLTFKYVFDYHPGEIYWCTADVGWVTGHSYLLYGPLSCGAITLMFEGVPNYPAAN
FT                   RLSQVIDKHQVNILYTAPTAIRALMAEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYY
FT                   QKIGNKQCPIVDTWWQTETGGFMITPLPGATELKAGSATLPFFGVQPALVDNLGELLEG
FT                   ACEGNLVITDSWPGQARSLFGDHDRFEQTYFSAFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNISGHRLGTAEIESALVSHPKIAEAAVVGVPHNIKGQAIYAYVTLIHGEEPSPQLY
FT                   TEVRNWVRKEIGPIATPDILHWTDSLPKTRSGKIMRRILRKIASGDISNLGDTSTLADP
FT                   GVVEKLLEEKQTMNIS"
FT   misc_feature    complement(64109..65425)
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   3.8e-135"
FT                   /inference="protein motif:Pfam:PF00501"
FT   CDS_pept        66060..66749
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="PAU_00063"
FT                   /old_locus_tag="PAT2100"
FT                   /product="superoxide dismutase [mn] (mnsod)"
FT                   /EC_number="1.15.1.1"
FT                   /note="Superoxide dismutases (SODs) () catalyse the
FT                   conversion of superoxide radicals to molecular oxygen.
FT                   Their function is to destroy the radicals that are normally
FT                   produced within cells and are toxic to biological systems"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00063"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82156"
FT                   /db_xref="GOA:C7BTZ4"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82156.1"
FT                   /translation="MIMLFTEMWTWNHSYMTGVHDMSYSLPSLPYSYDALEPHFDKQTM
FT                   EIHHTKHHQTYINNTNSALEACPELAKLDIDDLIQQLDKIPADKRTFVRNNAGGHSNHS
FT                   LFWKGLKLKTTLKGPLKEAIERDFGSVDVFKEKFEQAAATRFGSGWAWLVLKDDGKLAI
FT                   VSTANQDSPLMGEAISGASGYPIIGLDVWEHAYYLQYQNRRPDYIKAFWHVVNWDEAAE
FT                   RYQAKVK"
FT   misc_feature    66126..66392
FT                   /note="HMMPfam hit to PF00081, Iron/manganese superoxide
FT                   dismutases, alpha-, score 2.7e-48"
FT                   /inference="protein motif:Pfam:PF00081"
FT   misc_feature    66408..66731
FT                   /note="HMMPfam hit to PF02777, Iron/manganese superoxide
FT                   dismutases, C-term, score 6.1e-63"
FT                   /inference="protein motif:Pfam:PF02777"
FT   CDS_pept        66867..67538
FT                   /transl_table=11
FT                   /gene="yiiM"
FT                   /locus_tag="PAU_00064"
FT                   /old_locus_tag="PAT2101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00064"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82157"
FT                   /db_xref="GOA:C7BTZ5"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82157.1"
FT                   /translation="MHYPQVYTGKIEISEKLSASAINKRMVDGRLHLTALGLEGDEQAE
FT                   TRFHGGPDRALCHYPREHYDFWIRQFPEQEDFFIAPAFGENISTTGLTEENVCIGDIFS
FT                   WGETMIQVTQPRSPCYKLNSHSGISNFSAIMQESGRCGWLYRVIASGNISPDEPLVLVS
FT                   RNSDVLVKEAIAIAFNMPFDEEQYRRLMSAAALSASWSLTMQKRVMLGKIEDFNRRLFG
FT                   K"
FT   misc_feature    66972..67349
FT                   /note="HMMPfam hit to PF03473, MOSC domain, score 1.3e-44"
FT                   /inference="protein motif:Pfam:PF03473"
FT   misc_feature    67365..67505
FT                   /note="HMMPfam hit to PF03475, 3-alpha domain, score
FT                   5.6e-09"
FT                   /inference="protein motif:Pfam:PF03475"
FT   CDS_pept        complement(68401..68709)
FT                   /transl_table=11
FT                   /gene="orf2"
FT                   /locus_tag="PAU_00065"
FT                   /old_locus_tag="PAT2102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00065"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82158"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ6"
FT                   /inference="similar to DNA sequence:INSD:AE009442"
FT                   /inference="similar to DNA sequence:INSD:AF346500"
FT                   /protein_id="CAQ82158.1"
FT                   /translation="MMTVVSGGPLTWFFVLPDGVTVRLTIDHVGLDDSAVRLSYPGLGI
FT                   HEGFLDAEQGLIIAYAHGPETFVMRYDEPSVSHSELLGTNPWIDFSSNTPKLFKKVK"
FT   CDS_pept        complement(68851..69888)
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="PAU_00066"
FT                   /old_locus_tag="PAT2103"
FT                   /product="tryptophanyl-tRNA synthetase (tryptophan--tRNA
FT                   ligase (trprs)"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00066"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82159"
FT                   /db_xref="GOA:C7BTZ7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82159.1"
FT                   /translation="MNKPTVSEKPNSQKPIVFSGAQPSGELTIGNYMGALRQWVKMQDD
FT                   YDCIYCIVDQHAITVRQDPTALKKRTLDTLALYLACGIDPKKSTIFVQSHVPQHAQLSW
FT                   VLNCYTYFGELSRMTQFKDKSARHAENINAGLFDYPVLMAADILVYQTNQVPVGIDQKQ
FT                   HLELSRDIAQRFNAIYGDIFTVPEPFIPTGGARVMALQDPEKKMSKSDDNRNNIIALLE
FT                   DPKSAAKKIKRAVTDSEEPPRVRYDLEQKPGVSNLLDILVGVTGKTIPELEAEFEGQMY
FT                   GHLKSAVADAVSGMLTELQERFHHFRNDEALLNKIMAEGAAKAKARAQITLDKVYEAVG
FT                   FIAHP"
FT   misc_feature    complement(68998..69849)
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 8.2e-119"
FT                   /inference="protein motif:Pfam:PF00579"
FT   CDS_pept        complement(69893..70597)
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="PAU_00067"
FT                   /old_locus_tag="PAT2104"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00067"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82160"
FT                   /db_xref="GOA:C7BTZ8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82160.1"
FT                   /translation="MANKVLKGIRAVAFDLDGTLVDSAGGLADALDQALLAKGFPTAGK
FT                   ERVAAWVGNGADIMVERALTWAKVDLTVQLHTETRKLFDQFYETTVTTGSQLFPEVKTT
FT                   LKELAKHNLPMGIITNKPTPFIAPLLASLGISEYFSLVLGGDDVKEKKPHPAPIYLTMG
FT                   TFGLRKEELLFVGDSRNDILAAQAAGCPCVGLTYGYNYGESIALSNPDCILTNFSDLLP
FT                   TIGLPSLKLQEA"
FT   misc_feature    complement(70004..70573)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 8.3e-37"
FT                   /inference="protein motif:Pfam:PF00702"
FT   CDS_pept        complement(70587..71279)
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="PAU_00068"
FT                   /old_locus_tag="PAT2105"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00068"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82161"
FT                   /db_xref="GOA:C7BTZ9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C7BTZ9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:U18997"
FT                   /protein_id="CAQ82161.1"
FT                   /translation="MEKIMKDFLIAPSILSADFARLGADTAEVLAAGADVVHFDVMDNH
FT                   YVPNLTFGPMVCQALRNYGITAPIDVHLMVKPVDRIIPDFAKAGATYITFHPEASEHID
FT                   RSLQLIKEYGCKAGLVFNPATPLSYLDYVLDKLDVILLMSVNPGFGGQSFIPRTLDKLR
FT                   QVRKIIDKSGYDIRLEVDGGIKTSNIAQAAEAGADMFVAGSAIFSQSDYKTVIDNMRSE
FT                   LSKVSHGK"
FT   misc_feature    complement(70650..71255)
FT                   /note="HMMPfam hit to PF00834, Ribulose-phosphate 3
FT                   epimerase family, score 8.5e-140"
FT                   /inference="protein motif:Pfam:PF00834"
FT   CDS_pept        complement(71330..72142)
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="PAU_00069"
FT                   /old_locus_tag="PAT2106"
FT                   /product="DNA adenine methylase
FT                   (deoxyadenosyl-methyltransferase (dna adenine
FT                   methyltransferase)"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00069"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82162"
FT                   /db_xref="GOA:C7BU00"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU00"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82162.1"
FT                   /translation="MKKKRAFLKWAGGKYPLVDDIKRHLPAGSCLIEPFVGAGSVFLNT
FT                   DYDSYILADINSDLINLYNTVKFRANEFIAHTRPLFTQEYNSAEHFYQLREQFNQSTDP
FT                   FHRSVLFLYLNRHCYNGLCRYNSHGKFNVPFGRYKKPYFPEEELYWFAEKAQNATFICE
FT                   HYQYTLDKAHKGSVIYCDPPYAPLSATANFTAYHTNSFNITDQENLAHIAFKLSSERAI
FT                   PVLISNHDTPMTRKWYYQASLHIVKARRTISRNILARSKVDELLALYR"
FT   misc_feature    complement(71387..72115)
FT                   /note="HMMPfam hit to PF02086, D12 class N6
FT                   adenine-specific DNA met, score 3.2e-97"
FT                   /inference="protein motif:Pfam:PF02086"
FT   CDS_pept        complement(72227..73180)
FT                   /transl_table=11
FT                   /gene="damX"
FT                   /locus_tag="PAU_00070"
FT                   /old_locus_tag="PAT2107"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82163"
FT                   /db_xref="GOA:C7BU01"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU01"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82163.1"
FT                   /translation="MAVLALFGGHMDEFKSENAQRADNEFRPDTSDRRPSRSRQQLNKP
FT                   KFAISRQQMMIGVGILVLLLLIIAISSALKAPTEHEKQQSPNVAERNIDLSSSSAKKDD
FT                   NGQSVTSENTTTDAMNRPQEIHVPPVSGTPMHPQPPQVNSGENQQIELSGNIPDVLTQQ
FT                   QSNINHAVQNLNKTQQPQTITPPPPVQQKSENIRPLKPEESTKSKPSTNHTTNSKNNVA
FT                   NTGNNLLKTPPNHYTLQLSSASRSDTLTSFAKKHNLTHYKVYETKRNGKTWFVLIHGNY
FT                   RSVSEAKRAVSSLPDEIQAKKPWVRTMQQVQQDLRK"
FT   misc_feature    complement(72260..72487)
FT                   /note="HMMPfam hit to PF05036, Sporulation related domain,
FT                   score 2.4e-09"
FT                   /inference="protein motif:Pfam:PF05036"
FT   misc_feature    complement(72959..73027)
FT                   /note="1 probable transmembrane helix predicted for PAT2107
FT                   by TMHMM2.0 at aa 52-74"
FT   CDS_pept        complement(73302..74402)
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="PAU_00071"
FT                   /old_locus_tag="PAT2108"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82164"
FT                   /db_xref="GOA:C7BU02"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU02"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82164.1"
FT                   /translation="MEKIIVTLGERSYPITIAKGLFDDPSAFAPLKAGQQVMLVTNQTL
FT                   APLYLAKVKATLQQAGVRVDEIILPDGEQYKSLSILDDVFSALLENNHGRDTTLIALGG
FT                   GVIGDLTGFAAACYQRGVRFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPVSV
FT                   MVDLNCLQTLPARELSSGLAEVIKYGIILDSEFFSWLEDNMDKLLALDNKAMAYCIRRC
FT                   CELKAEVVAADEKELSGLRALLNLGHTFGHAIETEMGYGVWLHGEAVAAGIVMATRTAQ
FT                   LAGDFSEQDTQRIIRLLKRANLPVHGPQNMSPETYLPHMMRDKKVIAGKLHLILPIAIG
FT                   KASLRADIGYDCVLEAVRQCLPSESV"
FT   misc_feature    complement(73422..74354)
FT                   /note="HMMPfam hit to PF01761, 3-dehydroquinate synthase,
FT                   score 6.9e-184"
FT                   /inference="protein motif:Pfam:PF01761"
FT   CDS_pept        complement(74449..74970)
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="PAU_00072"
FT                   /old_locus_tag="PAT2109"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00072"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82165"
FT                   /db_xref="GOA:C7BU03"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU03"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82165.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFREREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDAPAREVLENLADERNPLYEEIADVTIRTDEQSAKVVA
FT                   NQIIELLEKN"
FT   misc_feature    complement(74458..74934)
FT                   /note="HMMPfam hit to PF01202, Shikimate kinase, score
FT                   1.9e-80"
FT                   /inference="protein motif:Pfam:PF01202"
FT   CDS_pept        complement(75340..76374)
FT                   /transl_table=11
FT                   /gene="hofQ"
FT                   /locus_tag="PAU_00073"
FT                   /old_locus_tag="PAT2110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00073"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82166"
FT                   /db_xref="GOA:C7BU04"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU04"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82166.1"
FT                   /translation="MTKKFILFIIFLPVICVAEIRNPFTPPIIEPEEQPTELIDQSVYD
FT                   TEIQHIATTLQYADAERIALNLRQNTPALMTKEGKADFDPETNSLILKDTPIAIAQIKS
FT                   WLKEIDTPQQQVQITAHIVTSSREALHELGIYWGIPIGEQLNTSTGINRLNINQAANDN
FT                   MHRFALNIARIHTSLLELELSALEQENLLDIIASPRLTASHQQLASIKQGSDIPYVSQE
FT                   KEKSTVQFKEAVLGMEVTPHILRKDKIRLSLKISQNMPGISISQGGGENLTIDKQEIMT
FT                   QVTVKNGETLILGGIFQQKKGEKTQKIPYLSDIPLLGSLFDQKGHKHSRRELIIFITPQ
FT                   LMDI"
FT   misc_feature    complement(75346..76026)
FT                   /note="HMMPfam hit to PF00263, Bacterial type II and III
FT                   secretion system, score 1.6e-62"
FT                   /inference="protein motif:Pfam:PF00263"
FT   misc_feature    complement(76030..76227)
FT                   /note="HMMPfam hit to PF03958, Bacterial type II/III
FT                   secretion system sho, score 1.4e-07"
FT                   /inference="protein motif:Pfam:PF03958"
FT   sig_peptide     complement(76321..76374)
FT                   /gene="hofQ"
FT                   /locus_tag="PAU_00073"
FT                   /note="Signal peptide predicted for PAT2110 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.867) with cleavage site
FT                   probability 0.783 between residues 18 and 19"
FT   CDS_pept        complement(76367..76912)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00074"
FT                   /old_locus_tag="PAT2111"
FT                   /product="similar to putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00074"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82167"
FT                   /db_xref="GOA:C7BU05"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU05"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to AA sequence:UniProt:Q0WKF4;"
FT                   /protein_id="CAQ82167.1"
FT                   /translation="MIKSDYLWWFAKPAWLLFVWQQASIIPFLLLFYLFFWQESTEQEI
FT                   NLTQEIVAQEINTKSTNDRLNQLPLLENIQQHIHQIENELSKPSQNTVKISAVKQLQQP
FT                   LINSGGQILEWQRKKEGEKTLWQIMIYLNYEQMLDFLSALQTLHPPLLIKQFSVSPSGE
FT                   FLNVKMTLSETSYEELYD"
FT   misc_feature    complement(76802..76870)
FT                   /note="1 probable transmembrane helix predicted for PAT2111
FT                   by TMHMM2.0 at aa 15-37"
FT   CDS_pept        complement(76899..77453)
FT                   /transl_table=11
FT                   /gene="yrfC"
FT                   /locus_tag="PAU_00075"
FT                   /old_locus_tag="PAT2112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00075"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82168"
FT                   /db_xref="GOA:C7BU06"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR016778"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU06"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82168.1"
FT                   /translation="MMYQVNFLPWRQTRLKQRYRWWIILLLLQLILWLIVLIWISFKQQ
FT                   ETINRYQRQLQQLNRQQLHLQQQITQTEEAFNLYNKLTYKLKQQQTRLRQNQQHLKLFN
FT                   QLPDLLPEGSWLTAFDDHAGQLKLVANSLDYSSMTSLLDNLENNEQLSEIQLKKMTTTE
FT                   QQIRQSIIDANWQTEIPDDKK"
FT   misc_feature    complement(76956..77441)
FT                   /note="HMMPfam hit to PF05137, Fimbrial assembly protein
FT                   (PilN), score 1.3e-06"
FT                   /inference="protein motif:Pfam:PF05137"
FT   sig_peptide     complement(77325..77453)
FT                   /gene="yrfC"
FT                   /locus_tag="PAU_00075"
FT                   /note="Signal peptide predicted for PAT2112 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.617) with cleavage site
FT                   probability 0.541 between residues 43 and 44"
FT   misc_feature    complement(77334..77393)
FT                   /note="1 probable transmembrane helix predicted for PAT2112
FT                   by TMHMM2.0 at aa 21-40"
FT   CDS_pept        complement(77450..78280)
FT                   /transl_table=11
FT                   /gene="yrfD"
FT                   /locus_tag="PAU_00076"
FT                   /old_locus_tag="PAT2113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00076"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82169"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU34"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82169.1"
FT                   /translation="MYSPKWYVGLDIQNGIVRAVAAIKRRDGWQLRHCWQYLLPDVVMP
FT                   EGRLQRPEILRDILNQWRQKLPKKISFRLALPVQQTLQRNLILPSDISLKEPEQGWFIN
FT                   ASAEKQFPFNTRELTLDYRIIEQNAYISAARQKDLDLWLQCLAQAGIFPDAIDIAPCAL
FT                   RYMAQYSGVPINSWLLHRQQSGWLWVSPANAPFAYDLVSANTAVSPQQIISQLPALSII
FT                   EEKIYYSSFQHEALPEGTCSWDMLAAFRHYHPPLPIQLMEYVIAGGLALRPDDK"
FT   CDS_pept        78400..80928
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="PAU_00077"
FT                   /old_locus_tag="PAT2114"
FT                   /product="penicillin-binding protein 1a (pbp-1a) (pbp1a)
FT                   (penicillin-bindin protein a)"
FT                   /note="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00077"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82170"
FT                   /db_xref="GOA:C7BU35"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU35"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82170.1"
FT                   /translation="MKFVKYFLIFVVCCIFLGTVSIFGMYKYIEPQLPDVATLKDVRLQ
FT                   TPMQVFSADGELIAQYGEKRRMPLTLSEIPPIMVKAFIATEDSRFYEHHGVDPVGIIRA
FT                   ASVAVSSGRASQGASTITQQLARNFFLSPEKTLTRKIKEVFLAIRIEQLLNKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGKSVNELTLSEIAMIAGLPKAPSTFNPLYSYGRAINRR
FT                   NVVLSRMLDQGYITQQQYNQARNEKLVANYHAPQIAFSAPYLSEMVRQEMIERYGENAY
FT                   TDGYKVYTTITRKLQLAAVEAARNNTIDYDVRHGYRGAQEVLWKVGESGWSQEQILKKL
FT                   KTLPNYDPLMPAVVTRVSTDRATVMLADGSNVELPMAGVRWARKFRSDNAQGAVPRSVN
FT                   EVVQAGEQVWVRKVKDIWWLAQIPEVNVALVSIDPNDGAVKALVGGFDFNLSKFNRVTQ
FT                   SLRQIGSNIKPFLYAAAMDKGLTLASLLNDLPISRWDAGAGTDWRPKNSPPTYAGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAADYLQRFGFPGKNIVRTESLALGAPSFTPMQVVRG
FT                   YSVMSNGGYLVDPYFITKIENEDGDILFEARPKVACSQCDIPVIYGDTARSIELSENSI
FT                   ENVAQSHVSQQEILPLPELEKVPVMDGNENEQKYAPHVISTPLAFLIHDALNSNIFGEP
FT                   GWTGTGWRASRDLKRRDIGGKTGTTNSSKDAWFSGYGPDIVTTVWIGFDDHRRSLGRTA
FT                   AGGGEAGAKSAQPIWDDFMKVALEGVAEKEIAPPPGIVSVVIDRRTGKLAGGGGDTRSE
FT                   YFIDGTQPTESAIQEVGTTLIEDGESQELF"
FT   sig_peptide     78400..78471
FT                   /gene="mrcA"
FT                   /locus_tag="PAU_00077"
FT                   /note="Signal peptide predicted for PAT2114 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.605) with cleavage site
FT                   probability 0.531 between residues 24 and 25"
FT   misc_feature    78418..78486
FT                   /note="1 probable transmembrane helix predicted for PAT2114
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    78541..79044
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   6.9e-92"
FT                   /inference="protein motif:Pfam:PF00912"
FT   misc_feature    79678..80718
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 3.5e-22"
FT                   /inference="protein motif:Pfam:PF00905"
FT   CDS_pept        complement(80979..81578)
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="PAU_00078"
FT                   /old_locus_tag="PAT2115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00078"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82171"
FT                   /db_xref="GOA:C7BU19"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU19"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82171.1"
FT                   /translation="MMHRYSTQSILIPSGAIMNDPKNPKILNIENIAHSRLFHIQSVDL
FT                   EFSNGVKRVYERMRPANREAVLIIPILGDELLLIREYAVGIEQYELSFPKGAIDPGESI
FT                   LEAANRELKEEVGFGARKIEQLAKLTMAPSYFSNKMNIVIAENLYPESLKGDEPEPLLQ
FT                   IRWPIADMMSLLDHADFNEARNVSALFLAQKYLQHR"
FT   misc_feature    complement(81000..81395)
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 1.2e-14"
FT                   /inference="protein motif:Pfam:PF00293"
FT   CDS_pept        81952..82884
FT                   /transl_table=11
FT                   /gene="yrfF"
FT                   /locus_tag="PAU_00079"
FT                   /old_locus_tag="PAT2116"
FT                   /product="putative membrane protein igaa homolog"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00079"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82172"
FT                   /db_xref="GOA:C7BU20"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU20"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82172.1"
FT                   /translation="MHDNVRYLPSVAEPTCRKLNADEYQAIECYLNRVLPPVTDRVNKT
FT                   TWPALVGENDTIYTICNAITRFAVATDEPHSWRYYIDMAEVHLPFFFEPFIKQRNIIDV
FT                   VHTATIPLVISINGHFLKDFQRDFPSALVVSDASHQQASIQKNGDTSVKFQGIRKETPE
FT                   EYRLNHSSGIWEGGFLCLGFLIWFLALLSPALLLPWLMLIAGSLIAVSFWSLFCPLSVR
FT                   RRQDIHCFTGMPRRWGLFGEFEQGQMSNISLGGIDLIYPTHWQPYIIHNLDQQTNIDIY
FT                   TMVRSSDKGIIFLCMMKRRIIPITVMGKI"
FT   misc_feature    order(82450..82518,82546..82614)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2116 by TMHMM2.0 at aa 167-189 and 199-221"
FT   CDS_pept        82884..83981
FT                   /transl_table=11
FT                   /gene="yrfF"
FT                   /locus_tag="PAU_00080"
FT                   /old_locus_tag="PAT2117"
FT                   /product="hypothetical membrane protein yrff"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82173"
FT                   /db_xref="GOA:C7BU21"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU21"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82173.1"
FT                   /translation="MMIGSSLLIMLLLYLYQPISVPMKLSFVWLHGSNTKVVTDANAID
FT                   RMELRVGDVLKAKGIGMCYMPPDNMNGKGDVRFSPFDCSGIYWNSTNPLPMPESEIIEN
FT                   AAKLIATVNKQLRLQENNDAVNPDLTPKMSKSGMILLDNFSDIILKTKNLCGKEADCFR
FT                   LKNALVNLGSANDWEALLKDAKSGKFDDINVLLRPAGAEALGKLVDATTSSFIYREIDK
FT                   AAILLNSPSPGGVLLISDEGKQLVEYMMPLSISYDHSALEQWHDLQRLSDMLLQTPFET
FT                   TGIITELSEDANGTHRIVLHSMLDSMTLARCIGTTLLLLVLFATLIINLVLVVKKNRQN
FT                   KQRFSKIKQYYDNCFNMTFSPTCWR"
FT   misc_feature    82884..83978
FT                   /note="HMMPfam hit to PF07095, Intracellular growth
FT                   attenuator protein IgaA, score 5.5e-52"
FT                   /inference="protein motif:Pfam:PF07095"
FT   misc_feature    83817..83885
FT                   /note="1 probable transmembrane helix predicted for PAT2117
FT                   by TMHMM2.0 at aa 312-334"
FT   CDS_pept        84038..84454
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /gene_synonym="hlsR"
FT                   /locus_tag="PAU_00081"
FT                   /old_locus_tag="PAT2118"
FT                   /product="ribosome-associated heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82174"
FT                   /db_xref="GOA:C7BU22"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU22"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82174.1"
FT                   /translation="MKDNSDSNQAVRLDKWLWAARFYKTRAVAREMIDGGKVHYNGQRS
FT                   KPSKLVELRAEIKLRQGNDERTVEVLALSSHRRSAPEAQQLYRETEASIANREKMAIAR
FT                   KMNALTMPHPDRRPDKKERRTLIKFKNTKLSEPE"
FT   misc_feature    84068..84253
FT                   /note="HMMSmart hit to SM00363, no description, score
FT                   2e-09"
FT                   /inference="protein motif:Smart:SM00363"
FT   misc_feature    84068..84208
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 3.3e-11"
FT                   /inference="protein motif:Pfam:PF01479"
FT   CDS_pept        84481..85353
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PAU_00082"
FT                   /old_locus_tag="PAT2119"
FT                   /product="33 kda chaperonin (heat shock protein 33 homolog)
FT                   (hsp33)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00082"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82175"
FT                   /db_xref="GOA:C7BU23"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU23"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82175.1"
FT                   /translation="MSKQDQLHRFLFENYSVRGELVLASETYQHILENHGYPQPVQQLL
FT                   GELLVATSLLTATLKFDGDITVQIQGDGPVKLAVINGNHQQQMRGVARIDGLIAENSSL
FT                   KQMVGTGYMVITITPTHGERYQGVVALEGETLADCLDDYFRQSEQLPTRLFIRTGSQDG
FT                   NIAAAGMLLQVLPTAEQNSEEAFDHLVQLTATIKGEELFSLEVKEILRRLYHEEDVTLY
FT                   EPQGVEFRCTCSRQRCADTLVTLSDEDVNHILQKDGNINMGCEYCGAHYIFDANDIAEI
FT                   KSEKKSRLH"
FT   misc_feature    84490..85305
FT                   /note="HMMPfam hit to PF01430, Hsp33 protein, score
FT                   2.5e-123"
FT                   /inference="protein motif:Pfam:PF01430"
FT   CDS_pept        85569..87188
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="PAU_00083"
FT                   /old_locus_tag="PAT2120"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82176"
FT                   /db_xref="GOA:C7BU24"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU24"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82176.1"
FT                   /translation="MSVKGITPQELADYGIHDIREIVYNPSYELLFSEETKPSLEGYEC
FT                   GTLTNLGAVAVDTGIFTGRSPKDKYIVRDDVTCDTVWWADQGKGKNDNKPLQQETWTHL
FT                   KGLVTKQLSGKRLFIVDAFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDEELAGFK
FT                   PDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLL
FT                   PLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTINLSKEAEPDIYNAIKRDALLENVTVLADGIVDFNDGSKTENTRVSYPIYHI
FT                   ENIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTPEQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLTLHPTQYAEVLVKRMQAAGAKAYLVNTGWNGTGKRISIKDTRGII
FT                   DAILSGDIEEADTIELPIFELAVPTALPGVDTHILDPRNTYADKSQWEEKAKDLANRFV
FT                   DNFDKYTDTPAGEALVKAGPKL"
FT   misc_feature    85620..87044
FT                   /note="HMMPfam hit to PF01293, Phosphoenolpyruvate
FT                   carboxykinase, score 0"
FT                   /inference="protein motif:Pfam:PF01293"
FT   CDS_pept        complement(87237..87602)
FT                   /transl_table=11
FT                   /gene="yhhW"
FT                   /locus_tag="PAU_00084"
FT                   /old_locus_tag="PAT2121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00084"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82177"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU25"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82177.1"
FT                   /translation="MTGIYQIWIIPDKTGLTPRYEQHRFEDVQGRQLILSPDARDGSMK
FT                   IFQDMTLWRWTLKNNETSEYVTKKDRHIWIQVVRGNVIVNGVKATTSDGLAIQNATNLQ
FT                   LSANDDSEILLFDLPQR"
FT   CDS_pept        complement(87642..88046)
FT                   /transl_table=11
FT                   /gene="yhhW"
FT                   /locus_tag="PAU_00085"
FT                   /old_locus_tag="PAT2122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00085"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82178"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU26"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82178.1"
FT                   /translation="MIHLRKASDRGHANHGWLDSWHTFSFANYYDANFMRFSALRVINE
FT                   DFIKAGQGFDPHPHKDMEILTYVLSGTIEHQDSMGNKEQISAGEFQIMSAGTGIRHSEY
FT                   NPDSDSQLHLYPMDFKMHRDGKGANPREHR"
FT   misc_feature    complement(87693..87917)
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 0.0021"
FT                   /inference="protein motif:Pfam:PF07883"
FT   misc_feature    complement(87702..88040)
FT                   /note="HMMPfam hit to PF02678, Pirin, score 3.6e-54"
FT                   /inference="protein motif:Pfam:PF02678"
FT   misc_RNA        complement(88168..88262)
FT                   /inference="similar to RNA sequence:Rfam:RF00057"
FT   CDS_pept        88606..89970
FT                   /transl_table=11
FT                   /locus_tag="PAU_00086"
FT                   /old_locus_tag="PAT2123"
FT                   /product="similar to two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00086"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82179"
FT                   /db_xref="GOA:C7BU27"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU27"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000316"
FT                   /protein_id="CAQ82179.1"
FT                   /translation="MKDILSGNHMWHFFAWMVLTALTAWGMINHSLDQNYQQQTVSFNI
FT                   LYRELSEKLAQHDAIVSLMDANIGLKQLQENFPQIIGLQEIPVHVLIFPMISEAEEGRY
FT                   WLNSTRNSIRLLIDLNILMKNLSLLSQFRSVQLDWNNRPLIRWGLEEGPYFWHWEKKLT
FT                   SRFQPFVLKASNDQQWSQLPWGYITCLSFLWAVIICFIFLIQKNRRLRKVSDLRAHFFE
FT                   FTRLNTIDEVATGIVHELNQPLTAIMSYNQSALRLIKKQQYDKVISVLDSSILQTQRIA
FT                   NLLTQYHEKLTTGSTILQPVNILSILIRVETLLENEIKTGKIKVIKHVCDDLPMIFSDP
FT                   LWIEQIFHNLISNAIQAQQEKNQAEHKNWICIDITYADEMIKIVITDGGPGLSNEALKN
FT                   VFIPFFTTRQQGMGLGMTLTETLVQKLGGDISAENCETGGARFIILLPAKKGKEE"
FT   misc_feature    order(88633..88701,89149..89217)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2123 by TMHMM2.0 at aa 10-32 and 182-204"
FT   misc_feature    89287..89484
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 0.0032"
FT                   /inference="protein motif:Pfam:PF00512"
FT   misc_feature    89617..89955
FT                   /note="HMMSmart hit to SM00387, no description, score
FT                   1.1e-20"
FT                   /inference="protein motif:Smart:SM00387"
FT   misc_feature    89617..89952
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 7.6e-27"
FT                   /inference="protein motif:Pfam:PF02518"
FT   CDS_pept        89970..90599
FT                   /transl_table=11
FT                   /locus_tag="PAU_00087"
FT                   /old_locus_tag="PAT2124"
FT                   /product="two component transcriptional regulator, luxr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00087"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82180"
FT                   /db_xref="GOA:C7BU28"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU28"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000316"
FT                   /protein_id="CAQ82180.1"
FT                   /translation="MAEMIYLIDDDEAIRDSLSILLETMNWSVVSFPGAQEFLDVINKK
FT                   NISELQGCILLDIRMPGKPGLTLQDDLLKLNNTLPVIIMTGHGNIDICRRAFKNGAFEF
FT                   LTKPIDADLLIETVSNALSFHQKIFKQHQVYEQLKVKFSQLSDRESEVMKIILEGKTSK
FT                   QIAQQLALSPRTIEVHRANIFHKLDIHSLPQLVKEYELLKSLSFCD"
FT   misc_feature    89976..90326
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 4.2e-22"
FT                   /inference="protein motif:Pfam:PF00072"
FT   misc_feature    89976..90323
FT                   /note="HMMSmart hit to SM00448, no description, score
FT                   3.9e-22"
FT                   /inference="protein motif:Smart:SM00448"
FT   misc_feature    90372..90530
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.0016"
FT                   /inference="protein motif:Pfam:PF08281"
FT   misc_feature    90393..90566
FT                   /note="HMMSmart hit to SM00421, no description, score
FT                   6.8e-20"
FT                   /inference="protein motif:Smart:SM00421"
FT   CDS_pept        90700..91188
FT                   /transl_table=11
FT                   /locus_tag="PAU_00088"
FT                   /old_locus_tag="PAT2125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00088"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82181"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU29"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000316"
FT                   /protein_id="CAQ82181.1"
FT                   /translation="MKHSLFYTILAAGLFAQSAFASSLITERNITLELANKLASEAIQS
FT                   CKSSNYNVTVAVVDKSGVLKAVQRMDKAGLHTVEASKMKAYTALSTQRTSEDVMKTAQS
FT                   NLGAQYLGDIPGFLLLAGGVPVKSGDEVIGAIGIGGAPSGSLDQQCALDAIQKVSSEL"
FT   sig_peptide     90700..90762
FT                   /locus_tag="PAU_00088"
FT                   /note="Signal peptide predicted for PAT2125 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 21 and 22"
FT   misc_feature    90781..91164
FT                   /note="HMMPfam hit to PF03928, Domain of unknown function
FT                   (DUF336), score 1.7e-38"
FT                   /inference="protein motif:Pfam:PF03928"
FT   CDS_pept        91961..92314
FT                   /transl_table=11
FT                   /locus_tag="PAU_00089"
FT                   /old_locus_tag="PAT2126"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00089"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82182"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU30"
FT                   /inference="similar to DNA sequence:INSD:AL591973"
FT                   /protein_id="CAQ82182.1"
FT                   /translation="MITQTRDLDILSDTTKSHKFIFNVEGKLAIGSISKKVNPKMLSHP
FT                   VLAKEAGGSRVISAGYMYRYRDAVYLVNHSGHYRPSVGRLLPVSGFIRNNFGYHTKIVP
FT                   AETFKHGMLKFFR"
FT   CDS_pept        92399..92599
FT                   /transl_table=11
FT                   /locus_tag="PAU_00090"
FT                   /old_locus_tag="PAT2127"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82183"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU31"
FT                   /inference="similar to AA sequence:UniProt:Q2QLW4"
FT                   /protein_id="CAQ82183.1"
FT                   /translation="MFKINFAFILDKFNRECLTTFSINVRYKIILLCFMQFTSSLCNKR
FT                   LLHYYRAQYHENAPPPAFYSP"
FT   CDS_pept        92710..95982
FT                   /transl_table=11
FT                   /gene="pulA"
FT                   /locus_tag="PAU_00091"
FT                   /old_locus_tag="PAT2128"
FT                   /product="alpha-dextrin endo-1,6-alpha-glucosidase
FT                   (pullulanase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82184"
FT                   /db_xref="GOA:C7BU32"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="InterPro:IPR041111"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU32"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:BA000032"
FT                   /protein_id="CAQ82184.1"
FT                   /translation="MVAHFGKKAYRALLSGTFVLLSGCDSNGPSPNPPKEPMAHLPIKI
FT                   PGEAARAGDLQAVIHLVDIAALNKNNPTTDRDYSTNSLYLWNDESCDSLAFPSLNWNDT
FT                   SIVPTGSDSYGPYWVVPLTKNEGCINFIVRDGNNTKLIDNDLKISFSDFSNRTISVIPG
FT                   SNQIYGSRAEAFNSVFGVSQASAHWVDKQTLLWSGGADKPYVRLYHNRNDKVGADDEGN
FT                   FTDSYLTLTPTTLSQKTAERFPHLTKLTAFRLPADTDVDKLLTGDLVALATNKEGLLLS
FT                   ATQVQTAGVLDDRFANAADTLEYGALVSGSGVTFHLWAPTAQQVALVIYDTDKQVIANY
FT                   AMNRNPASGSWSWQGDKDLIGAYYRYALTVYHPRSRNVEHYEVTDPYSHSLSTNSEYSQ
FT                   VINLDDEALKPQNWDSLIMPRSQSTQADIARMTIYESHVRDLSIADSTVPEAWRGKYLA
FT                   LTANNSDMFKHLKALSQAGVTHMELLPVFDVASINEFSNQVADLNHPFSRLCQVNAMVR
FT                   NSRFADYCNGLQTVGEVLQELKNGDSANNPQVQELNAMIAETDSYNWGYDPFHYSVPEG
FT                   SYATDAEGSVRIKEFRAMVQAIKQQLGMNVIMDVAYNHTDAAGPTDRSSVLDKIVPWYY
FT                   HRLNEISGNVESNTCCHDTAPEHRMFAKLIEDSLVTWVKDYKIDAFRFDLMGFHPKAQI
FT                   LSALAKVRMINPSVYFLGEGWNSGQDDRFEIASQINLKGSGIGTFSDRLRDAVQGGGPF
FT                   DSANSIRINQGVGNGAGTLPNEMTWLNADEVRHLADLVRLGMAGNLADFVLINKDGAVK
FT                   TGREIDYKGAIAGYAADPTEVINYVSKHDNQTLWDIISYKAAREANLATRVRMQAISLA
FT                   TTFLGQGLAFAQHGSELLRSKSFTRDSYNAGDWFNRVSYTYQDNNYDVGMPGWRDDGEN
FT                   YALIEQVKNLVDKPGQTELLQMTSFYQELLRLRQFSPLMTLGDGKSVKQRVDFRNVGPN
FT                   QQLGLFVMTIDDGNTTDDDRDLRFDGLVVMINAASQTATVSDLNVRGLKLNDIQGELGN
FT                   ASLAAGIRIAEDGSVTLPAWSVAVLVLPQDGVRSIGLPVRGK"
FT   misc_feature    92884..93237
FT                   /note="HMMPfam hit to PF03714, Bacterial
FT                   pullanase-associated domain, score 2.9e-22"
FT                   /inference="protein motif:Pfam:PF03714"
FT   misc_feature    93616..93873
FT                   /note="HMMPfam hit to PF02922, Isoamylase N-terminal
FT                   domain, score 5.5e-14"
FT                   /inference="protein motif:Pfam:PF02922"
FT   misc_feature    94045..95541
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 5.9e-07"
FT                   /inference="protein motif:Pfam:PF00128"
FT   misc_feature    94246..95274
FT                   /note="HMMSmart hit to SM00642, no description, score
FT                   0.0077"
FT                   /inference="protein motif:Smart:SM00642"
FT   CDS_pept        96316..96786
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="PAU_00092"
FT                   /old_locus_tag="PAT2129"
FT                   /product="cyanate hydratase"
FT                   /EC_number="4.2.1.104"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00092"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82185"
FT                   /db_xref="GOA:C7BU33"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU33"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82185.1"
FT                   /translation="MTQSQYSQTPRQILTDAIIDAKIRKNLTFEDIAQGTGLSLAFVTA
FT                   ALLGQHPLPENAAKIVVDRLELDENALRLLQTIPVRGSIPGGVPTDPTIYRFYEMVQIY
FT                   GSTLKALVHEKFGDGIISAIDFKLDIKKVDDPNGGSRAVITLDGKYLPTKPF"
FT   misc_feature    96562..96783
FT                   /note="HMMPfam hit to PF02560, Cyanate lyase C-terminal
FT                   domain, score 2.6e-48"
FT                   /inference="protein motif:Pfam:PF02560"
FT   CDS_pept        complement(96979..98490)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00093"
FT                   /old_locus_tag="PAT2130"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00093"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82186"
FT                   /db_xref="GOA:C7BU36"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU36"
FT                   /inference="similar to DNA sequence:INSD:AB193037"
FT                   /inference="similar to DNA sequence:INSD:CP000076"
FT                   /protein_id="CAQ82186.1"
FT                   /translation="MNKSAPDHNPQIDISRATDVEIIIIGAGFAGLGMGTQLKRRSQHS
FT                   FLILERADDVGGTWRDNTYPGIACDIPSHLYSFSFRPNPDWSYVFSPGHEILAYLQATA
FT                   RDEGLLPHIRLGTNVQKAYWDNQEERWIIITTTGVFSGRFLVAGTGHLTDENIPQIEGL
FT                   NSFTGEVFHSARWKHHIPLQGKRVGIIGSGASAIQIVPEVANSVSELVIFQRSAPYILP
FT                   RPDRSYSEAEKRLFRRDPKSIPALRSDIFWHFESLYPACRSIPEYLAELKRIAFDHLKQ
FT                   QISDPELCAKLIPNYEPGCKRILAANNYYPALLRDNVQLETSALKRIDGQNAISVSGNS
FT                   YPLDLLIFCTGFQTTQPPYTHLIHGRDGLSLADHWTQGMEAFASTTVTGFPNFFIINGP
FT                   SATLTHNSIIYIIESQIEYILGAIEYSRKNSNYVLEVSAEAQESYVNELQHQLKDTVWV
FT                   SGGCTSWYLDPRNKRPTLIWPGFAHTFRKHNSNFDPAPYIHRVTT"
FT   CDS_pept        complement(98517..99392)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00094"
FT                   /old_locus_tag="PAT2131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00094"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82187"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU37"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AB193037"
FT                   /protein_id="CAQ82187.1"
FT                   /translation="MNRPEQEFSANESVIKVDGKNVKFFTSTPQGPIKNNDKKNPVVLV
FT                   HGTGGSTQIHFSSLFQLLATEHRVISLDFTQPVNADETLTLEHLGKQVEAVIKTAAPGE
FT                   SVTLIGYSLGAAVVAAVAAQHPDLVRNLVLIAGWMKSDLQLKRFAAVWHQLYEIQSPVI
FT                   TEFMMYCAFRGPCHVNMLPDQLANGFENINPGEFDALQITLDSQVDITQLVPTIKATTL
FT                   IIGCKYDHIVPTYHSKALFGAIQDARYTEIECGHAVIYERPFQLVRVIDQFCTDPSFYP
FT                   AGTIIPTDQP"
FT   misc_feature    complement(98577..99194)
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 1.9e-05"
FT                   /inference="protein motif:Pfam:PF00561"
FT   CDS_pept        100202..100687
FT                   /transl_table=11
FT                   /locus_tag="PAU_00095"
FT                   /old_locus_tag="PAT2131A"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00095"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82188"
FT                   /db_xref="GOA:C7BU38"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU38"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82188.1"
FT                   /translation="MSTQAVNEYAIAEGEKRAIRTIKLFIALGFIAEFGFLLMSFILFP
FT                   DNGPLVWRLVWALGLCGIGMGAAVGGLTYLVSSRFTPGSTGAYTMTAVSSALLFSVCQT
FT                   LCWGLDHNVGLNYWGSIEMPLLFLIKGYTAALLAGILGSFLLNSVKGARFLDCLKVF"
FT   misc_feature    order(100262..100330,100358..100426,100460..100528,
FT                   100571..100639)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PAT2132 by TMHMM2.0 at aa 21-43, 53-75, 87-109 and 124-146"
FT   CDS_pept        100669..101160
FT                   /transl_table=11
FT                   /locus_tag="PAU_00096"
FT                   /old_locus_tag="PAT2132"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00096"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82189"
FT                   /db_xref="GOA:C7BU39"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU39"
FT                   /inference="similar to DNA sequence:INSD:AALM01000022"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82189.1"
FT                   /translation="MLEGVLVSKKSSLPNSFAISVFLAVLAACLNLILWRADILEMAHN
FT                   VPLKGLMAIWYVLGWGFAPGCLTALTIHSIRGRLPQITGSVVAMFISFLLITGICGLVY
FT                   TYLTNSVFMQMAMGGMAEHHSVANNGTILGFISMLLPSLCATVISIISAFSIKMGKWFR
FT                   "
FT   misc_feature    order(100705..100773,100816..100884,100921..100989,
FT                   101062..101130)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PAT2132 by TMHMM2.0 at aa 13-35, 50-72, 85-107 and 132-154"
FT   CDS_pept        101469..101765
FT                   /transl_table=11
FT                   /locus_tag="PAU_00097"
FT                   /old_locus_tag="PAT2133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00097"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82190"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU40"
FT                   /inference="similar to DNA sequence:INSD:AE017340"
FT                   /inference="similar to DNA sequence:INSD:CR628336"
FT                   /protein_id="CAQ82190.1"
FT                   /translation="MICQSGWSEHELYFSHYRDKDQIEVDLVIEDGRRIWGEVKKTASI
FT                   PPKDGMGLARLASLVDRDWQSGILLYTGNNCLPISHIPNTICSTNECALGLIS"
FT   CDS_pept        complement(101805..103046)
FT                   /transl_table=11
FT                   /gene="yhiN"
FT                   /locus_tag="PAU_00098"
FT                   /old_locus_tag="PAT2134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00098"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82191"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU41"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82191.1"
FT                   /translation="MQHVRGNSPLNYSVIKRKTVERFDAIIIGAGAAGLFCAAQAGQLG
FT                   LRVLVLDNGKKAGRKILMSGGGRCNFTNMYTEPSAYLSTNPHFCKSALARYTQWDFIEL
FT                   VQRYGIAYHEKTLGQLFCDDSAQQIVDMLLKECEAGQVNIRLRSEVSHVEKKEQDFVIT
FT                   VNGKEVSTRSLVIASGGLSMPGLGATPFGYRIAEQFGLQVLPTRAALVPFTLHKPLLEQ
FT                   LHVLSGVSVPAIVTAANGTLFKENILFTHRGLSGPAILQISSYWQPGEFVSINLLPDTD
FT                   LDAFLEQERSSHPNQSVKNSLAKLLPKRLTECLQMLDQIPNIALKQLNSIQQKQLVLNL
FT                   QSWQVQPNGTEGYRTAEVTIGGIDTHQLSSKTMEANQVKGLYFIGEVVDVTGWLGGYNF
FT                   QWAWSSAWACAQAL"
FT   misc_feature    complement(101811..102980)
FT                   /note="HMMPfam hit to PF03486, HI0933-like protein, score
FT                   1.2e-235"
FT                   /inference="protein motif:Pfam:PF03486"
FT   misc_feature    complement(101811..102977)
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 9.3e-06"
FT                   /inference="protein motif:Pfam:PF01266"
FT   misc_feature    complement(101850..102977)
FT                   /note="HMMPfam hit to PF00890, FAD binding domain, score
FT                   0.0046"
FT                   /inference="protein motif:Pfam:PF00890"
FT   misc_feature    complement(101871..102977)
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidored, score 8.8e-05"
FT                   /inference="protein motif:Pfam:PF07992"
FT   sig_peptide     complement(102924..103046)
FT                   /gene="yhiN"
FT                   /locus_tag="PAU_00098"
FT                   /note="Signal peptide predicted for PAT2134 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.823) with cleavage site
FT                   probability 0.759 between residues 41 and 42"
FT   CDS_pept        103290..104780
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="PAU_00099"
FT                   /old_locus_tag="PAT2135"
FT                   /product="low-affinity inorganic phosphate transporter 1"
FT                   /note="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00099"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82192"
FT                   /db_xref="GOA:C7BU42"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU42"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82192.1"
FT                   /translation="MLHLFTGLDFHTSLMLVLALLFVLFYEAINGFHDTANAVATVIYT
FT                   RAMRAQFAVVMAGVFNFFGVLLGGLSVAYAIVHLLPTDLLLNVSSAHGLAMVFSMLLAA
FT                   IVWNLGTWYFGLPASSSHTLIGSIIGIGLTNAIVTSSSVVDALNVPKMIQIFLSLILSP
FT                   LIGLIIAGAVVFLLRRYWSGTKKRKRIHLTPAQREKKDGKRKPPFWTRTALILSAVGVS
FT                   FSHGANDGQKGIGLIMLVLIGVAPAGFVVNMNANGYDIARTYDAVTHLQQYYQQHGTAL
FT                   SHAIELTPSVAIVENEPEGKFHCDSTRAVVVLNQTESILKGIQSYSELNPEQRNNMRRM
FT                   LMCIADTAESVAKLPETTAEDARFLNKLRKDLLHTVEYAPVWIIIAVALALSLGTLVGW
FT                   KRVAVTIGEKIGKKGMTYAQGVSAQMTAAVSIGVASYTGMPVSTTQVLSSAVAGTMLVD
FT                   GGGVQGKTIKNIMLAWILTLPVSIALSGTLYWFALKLI"
FT   misc_feature    order(103317..103385,103443..103511,103569..103637,
FT                   103656..103724,103752..103820,103908..103961,
FT                   103989..104057,104415..104483,104697..104765)
FT                   /note="9 probable transmembrane helices predicted for
FT                   PAT2135 by TMHMM2.0 at aa 10-32, 52-74, 94-116, 123-145,
FT                   155-177, 207-224, 234-256, 376-398 and 470-492"
FT   misc_feature    103377..104744
FT                   /note="HMMPfam hit to PF01384, Phosphate transporter
FT                   family, score 1.3e-102"
FT                   /inference="protein motif:Pfam:PF01384"
FT   CDS_pept        complement(104955..105326)
FT                   /transl_table=11
FT                   /gene="uspB"
FT                   /locus_tag="PAU_00100"
FT                   /old_locus_tag="PAT2136"
FT                   /product="conserved hypothetical protein"
FT                   /note="Universal stress protein B"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82193"
FT                   /db_xref="GOA:C7BU43"
FT                   /db_xref="InterPro:IPR019598"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU43"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82193.1"
FT                   /translation="MTALANHSKEGIMFSTIALFWALCLVCIMNMMRYFSSLRVLLSIL
FT                   RQSDPLLYQSVDGNGFFTTHGQLNKQMRLVRYINSQRYLDHHDPEVVLLCERLRKQFIL
FT                   TSALSGLVVVCLISMLIWY"
FT   misc_feature    complement(order(104964..105023,105240..105299))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2136 by TMHMM2.0 at aa 10-29 and 102-121"
FT   CDS_pept        105813..106292
FT                   /transl_table=11
FT                   /locus_tag="PAU_00101"
FT                   /old_locus_tag="PAT2137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82194"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU44"
FT                   /inference="similar to DNA sequence:INSD:CP000308"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82194.1"
FT                   /translation="MANLIYLTLKGRKQGLISAGCSSIDSIGNKGQVNHTDQILVYSLS
FT                   HSISREQNVSHHPIVIKKPIDKSSPLLGLAISDNEVLDAIFECYRTNQSGAQELYYTIK
FT                   VVDATISDLTAVHPHNITHTGSEPQETLSLRYKSITWTHHIAGTSAYSIWDDRNY"
FT   misc_feature    105822..106244
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 7.4e-62"
FT                   /inference="protein motif:Pfam:PF05638"
FT   CDS_pept        complement(106637..106819)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00102"
FT                   /old_locus_tag="PAT2138"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82195"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU45"
FT                   /inference="similar to DNA sequence:INSD:BX571861"
FT                   /protein_id="CAQ82195.1"
FT                   /translation="MLRGIRSLAVAMHLEIYWVYINTDLLYGLKNRGIKMMSIEEIIIE
FT                   IVSDISTAYGYMRSN"
FT   CDS_pept        complement(106822..107607)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00103"
FT                   /old_locus_tag="PAT2139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00103"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82196"
FT                   /db_xref="InterPro:IPR025320"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU46"
FT                   /inference="similar to DNA sequence:INSD:CP000308"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82196.1"
FT                   /translation="MMDVLDEFYGRNPWARGYFDDATQKERQLMKIQMDKQNELIIVMN
FT                   SVANKFIKWSLAKDHFINEVIAYSQDITAKINTGELSILEAIDLLEEEIKSLKEQDRMI
FT                   SQKNVRQAIVVQKEVIDSPRNSKRREFDKLIIAGVGFISGGLQIVGGLTVTRLSRSGYG
FT                   GLLLAHGYNNVIENGYYILYREDYAGPVRFVYRQVAKETFNMNERDADALYASVDIGIS
FT                   LTGMLTYQLLPDHQRLYRYTCYLSSCLFVGFTHSPRSHS"
FT   CDS_pept        107627..107767
FT                   /transl_table=11
FT                   /locus_tag="PAU_00104"
FT                   /old_locus_tag="PAT2140"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00104"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82197"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU47"
FT                   /inference="similar to DNA sequence:INSD:AF300528"
FT                   /protein_id="CAQ82197.1"
FT                   /translation="MSCIVIYINKNKQIEQVYFLIIVICNPNLTSQHYLKMNPYFIKAI
FT                   I"
FT   CDS_pept        108580..109011
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="PAU_00105"
FT                   /old_locus_tag="PAT2141"
FT                   /product="universal stress protein a"
FT                   /note="The universal stress protein UspA is a small
FT                   cytoplasmic bacterial protein whose expression is enhanced
FT                   when the cell is exposed to stress agents. UspA enhances
FT                   the rate of cell survival during prolonged exposure to such
FT                   conditions, and may provide a general stress endurance
FT                   activity."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00105"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82198"
FT                   /db_xref="GOA:C7BU48"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU48"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82198.1"
FT                   /translation="MAYKHILVAVDLSPESQVLLQKAVSVAKPYNAKVSLIHVDVNYSD
FT                   LYTGLIDVNLGDMQQRITDETRNALKDLSAESDYGIQETLSGSGDLGQVLVDAIKKYDI
FT                   DLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDDE"
FT   misc_feature    108583..108993
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 3.6e-18"
FT                   /inference="protein motif:Pfam:PF00582"
FT   CDS_pept        109269..110612
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="PAU_00106"
FT                   /old_locus_tag="PAT2142"
FT                   /product="nadp-specific glutamate dehydrogenase (nadp-gdh)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00106"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82199"
FT                   /db_xref="GOA:C7BU49"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU49"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82199.1"
FT                   /translation="MSCLLSLSSFLGSIQRRDEYQPEYLQAVREVFTSLWPFLEQNPKY
FT                   REQSLLERMVEPERVIQFRVCWVDDQGKVQVNRAWRVQFNSAIGPYKGGMRFHPSVNLS
FT                   ILKFLGFEQTLKNALTTLPMGGGKGGSDFDPKGKSQGEVMRFCQALMTELYRHLGPDTD
FT                   VPAGDIGVGGREVAFMSGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTNAM
FT                   LKRHGMGFEGMRVSVSGAGNVAQYTIEKCMALGAKVVTASDSGGTVVDEEGFTLEKLAH
FT                   LEEIKNQHYGRVEEYAKERGLAFLKGLQPWSVPVDIALPCATQNELDLDAAKVLIKNGV
FT                   KAVAEGANMPATISATEAFIEAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVD
FT                   ARLHHIMLDIHHACVKYGGEGKQTNYVQGANIAGFVKVADAMLAQGIL"
FT   misc_feature    109437..109829
FT                   /note="HMMPfam hit to PF02812, Glu/Leu/Phe/Val
FT                   dehydrogenase, dimeri, score 8.4e-86"
FT                   /inference="protein motif:Pfam:PF02812"
FT   misc_feature    109872..110603
FT                   /note="HMMPfam hit to PF00208,
FT                   Glutamate/Leucine/Phenylalanine/Valin, score 1.1e-134"
FT                   /inference="protein motif:Pfam:PF00208"
FT   CDS_pept        complement(110648..111391)
FT                   /transl_table=11
FT                   /gene="yhiQ"
FT                   /locus_tag="PAU_00107"
FT                   /old_locus_tag="PAT2143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00107"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82200"
FT                   /db_xref="GOA:C7BU50"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU50"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82200.1"
FT                   /translation="MDICLICEQGADSSALSQLAKRWHLIHDESAVMALVLTPQHLELR
FT                   KLDEPKLGGIYVDFVSGVMAHRRRFGGGRGEAVAKAVGIKKDYLPTVVDATAGLGRDAF
FT                   VLASLGCHVRMLERHPVVAALLDDGLQRGYQDAEIGGWLQERMTLLHASSITALVDITP
FT                   QPDVVYLDPMYPHKQKSALVKKEMRVFQSLVGADEDANHLLAPARALAKRRVVVKRPDY
FT                   AEPLAGVAASAAITTKNHRFDIYPC"
FT   misc_feature    complement(110651..111352)
FT                   /note="HMMPfam hit to PF04445, Protein of unknown function
FT                   (DUF548), score 5.6e-162"
FT                   /inference="protein motif:Pfam:PF04445"
FT   CDS_pept        complement(111397..113439)
FT                   /transl_table=11
FT                   /gene="opdA"
FT                   /gene_synonym="prlC"
FT                   /locus_tag="PAU_00108"
FT                   /old_locus_tag="PAT2144"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.15.5"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82201"
FT                   /db_xref="GOA:C7BU51"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU51"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82201.1"
FT                   /translation="MTNPLLVPSGLPKFSSIKPEHVVPAVKEVIANYRQTVEKILTENT
FT                   VFTWDNLCQPLAEAGDKQSRAWSPVNHLNSVKNSPELRAVYEESLPLLSEFSTWLGQHK
FT                   GLYQAYKSLRESAEFEKLSQPQRKAVENSLRDFKLSGIGLPEEKQKRYGEISARLSDLS
FT                   SLFNNNVLDATMGWTKLITNVKELSGLPESAIAAAKAQAEAKGQKGWLLTLEAPSYQPV
FT                   ITYADNRELRREIYHAYNTRASDQGPNAGKWDNSEVIAEILALRHEQAQLLGLKNYAEQ
FT                   SLATKMAKTPKEVLDFLNDLTKRARPQGQEEVDELKGFAKWHHCAHKLEAWDMTYYGEK
FT                   QKQYEFSINDEQLRPYFPEQKAVEGLFEVVRRIYGITAKERHDVETWHPDVRFFDLFDD
FT                   TNELRGSFYMDLYARENKRGGAWMDECISKMRRSNGELQKPVAYLNCNFNRPVGDKPAL
FT                   FTHNEVNTLFHEFGHCLHLMLTQIETASVSGTNGVPWDAVEMPSQFMENWCWEPEALAF
FT                   ISGHYETQEPLPKSMLDNLLAAKNYQAAMRILRQLEFGQFDFRLHVEYDPKKGAQTMKT
FT                   LKEVKKLVSVVPSPEWGRFPHSFTHIFSGGYAAGYYSYLWADVLAADAYSRFEEEGIFN
FT                   RETGQSFLDNILSRGGSEEPMELFKRFRGREPKLDAMLRKAGIKG"
FT   misc_feature    complement(111406..112776)
FT                   /note="HMMPfam hit to PF01432, Peptidase family M3, score
FT                   3e-214"
FT                   /inference="protein motif:Pfam:PF01432"
FT   tRNA            113677..113767
FT                   /product="transfer RNA-SeC(p)"
FT                   /anticodon="(pos:113711..113713,aa:SeC)"
FT                   /note="tRNA SeC(p) anticodon TCA, Cove score 69.81"
FT   CDS_pept        114306..115229
FT                   /transl_table=11
FT                   /locus_tag="PAU_00109"
FT                   /old_locus_tag="PAT2145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00109"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82202"
FT                   /db_xref="GOA:C7BU52"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU52"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AAPS01000002"
FT                   /protein_id="CAQ82202.1"
FT                   /translation="MKAYCFNLRQKVLTSILIFTCYIGFVYPSTHKQFFRHDGSEITYY
FT                   LKQRGGKNLLVLIQGSDCNSIANNKFVNETFSDIYPDTDVLTVEKYGIDALLPWSDAGE
FT                   RSDCPKAYIKSDTPEQRVKDYIQIIGYLKNQNKYKKIIILGGSEGAMVANLITSQVNYI
FT                   DRTISLNGGGRYLADDVIHSIKSEVPPEHVNQAMKGFREFQQRIHTNNNLEMSNHGVNW
FT                   WKISLGINQYRVLDQTKRPILIIQTLNDNSVSVSAAMAMEQQLKKDNITFYQYPGLSHG
FT                   FKNSEGVLQVTPIVEDIRNWLSRVSG"
FT   misc_feature    114339..114392
FT                   /note="1 probable transmembrane helix predicted for PAT2145
FT                   by TMHMM2.0 at aa 12-29"
FT   CDS_pept        116157..116477
FT                   /transl_table=11
FT                   /gene="cipB"
FT                   /locus_tag="PAU_00110"
FT                   /old_locus_tag="PAT2146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82203"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU53"
FT                   /inference="similar to DNA sequence:INSD:AP006852"
FT                   /inference="similar to DNA sequence:INSD:U89925"
FT                   /protein_id="CAQ82203.1"
FT                   /translation="MEFIIMMIKKDILLHEELIVDDELRVGKVEKVNIDILSPSSVIVS
FT                   LNILGVVDDFHLLVVDGDKDKEKIVLLYLSLLRVLHEKLDVKVKIAKSNLTKIKYIVGV
FT                   EI"
FT   CDS_pept        117119..118255
FT                   /transl_table=11
FT                   /locus_tag="PAU_00111"
FT                   /old_locus_tag="PAT2147"
FT                   /product="l-arginine:lysine amidinotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82204"
FT                   /db_xref="GOA:C7BU54"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU54"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000058"
FT                   /protein_id="CAQ82204.1"
FT                   /translation="MRRHNIQISGEDMLDPNLIDSDSKISSPVNSFNEWDPLEEVIVGA
FT                   VDGARFPGWHMAIEPVLPPNQIETFHRNAGRSFPKERIEAASRELEEFVHILESEGVKV
FT                   RRPEPQDQSQVFGAPGWSSTGLYCAMPRDSLLVIGDDIIECPLAWRSRYFETAAYKTLL
FT                   KDYFKQGARWSSGPKPQLIDEQYDFEWYKPDGKDSTRLAVTEFEPTFDAADFIRCGRDI
FT                   IAQKSHVTNEFGIEWLRRHIGDDYRIHVFEFNDDSPMHIDATFFPMAPGKLLINPEKVL
FT                   KIPELFKGWDVLCAPEPVIPDEHPLYMTSKWINMNILMLDEKRVIVEKQDEPMIAAMKR
FT                   WGFTPIPCNFRNFNSFGGSFHCATVDVRRRGILQSYFN"
FT   misc_feature    117215..118225
FT                   /note="HMMPfam hit to PF02274, Amidinotransferase, score
FT                   2.3e-05"
FT                   /inference="protein motif:Pfam:PF02274"
FT   CDS_pept        118264..119220
FT                   /transl_table=11
FT                   /locus_tag="PAU_00112"
FT                   /old_locus_tag="PAT2148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00112"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82205"
FT                   /db_xref="GOA:C7BU55"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU55"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE016853"
FT                   /protein_id="CAQ82205.1"
FT                   /translation="MAIWRYSYWDSVMFILSILHTIATVTLVVYWDNFTIMGWLGNIVL
FT                   LTLMTTYNIIVISHFFSHTPWFVSRTVNMFVSILNSMNIGQSVQAYHLSHVRNHHKYNN
FT                   DRGVGESGPQDTSSTFINGKEIGEHSTLWNYSALGGIFTLYNSFVRMFWAIFIWQKPLS
FT                   KADKGYEKLLSMDRKRKVEELLQLRLDRLFQAVWVIILFTLSWKWVLFCYLPALYFSFV
FT                   LVNIQNYYEHYGAQPENRFANSVSYYGRIYNLLTFNDGYHQEHHISGNTHWKSLPDLRQ
FT                   KYSTKLSAQERIVSPVPAILGFLHKRRPLLHRSINKK"
FT   misc_feature    order(118297..118356,118366..118434,118657..118725,
FT                   118846..118914)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PAT2148 by TMHMM2.0 at aa 12-31, 35-57, 132-154 and
FT                   195-217"
FT   misc_feature    118375..119121
FT                   /note="HMMPfam hit to PF00487, Fatty acid desaturase, score
FT                   1.8e-06"
FT                   /inference="protein motif:Pfam:PF00487"
FT   CDS_pept        119271..120146
FT                   /transl_table=11
FT                   /locus_tag="PAU_00113"
FT                   /old_locus_tag="PAT2149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00113"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82206"
FT                   /db_xref="InterPro:IPR016946"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU56"
FT                   /inference="similar to DNA sequence:INSD:AL672114"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82206.1"
FT                   /translation="MMQEKFGIRGTKLAKSEFIVYETSNNISMNAVSDLLDGHLAVCRI
FT                   NHFLLPEQRKKIIENFWRSSALTPRYGDGIDGIDGVEGYFIGASHIEKNTRQYIEEVEN
FT                   FRPAISEIFQDTINPIDRFIEQITHFSGDNPQVTRPAMYHGVAAGNVKIVYWNNFGEFL
FT                   LLPHDDLAQLSDPRQSDFEVQQINRVMAVNFYADVPQNGGQLKVWNIQPDNQSRSALGL
FT                   TYSGFPYPVELLENHANMVINIKAGDLVLLNGNLVHAVLNGNAISAPERRLLVTCFMGV
FT                   QQNGDLVWWT"
FT   CDS_pept        120455..121345
FT                   /transl_table=11
FT                   /locus_tag="PAU_00114"
FT                   /old_locus_tag="PAT2150"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00114"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82207"
FT                   /db_xref="GOA:C7BU57"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU57"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000076"
FT                   /protein_id="CAQ82207.1"
FT                   /translation="MIPMISKALWVSYGSTLLFVLLWSSGAIFSRWGLDHSTAFAILLM
FT                   RFAVALIFLIFLGLLFGRKGHFLPEQGTRKQVASTGVLLIGGYSICYFFALDNGITPGV
FT                   LATVMGIQPIITLLVIERRFSAVRLAGLLLALLGLILVVYQSLVLSRFSLAGITFALVA
FT                   LACMSIGAILQKRIHQAPSVVLPLQYGVSLLLCLLFVPFQPFEFQLVPGFIISLLWLGL
FT                   VISVVAQLLLYRLIQAGNLVNVTSLFYLVPGVTAVMDYLFLGNSLPDLSLLGMVAILSG
FT                   LILVFRTKKISLSTE"
FT   sig_peptide     120455..120544
FT                   /locus_tag="PAU_00114"
FT                   /note="Signal peptide predicted for PAT2150 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.640) with cleavage site
FT                   probability 0.269 between residues 30 and 31"
FT   misc_feature    order(120473..120541,120569..120637,120683..120742,
FT                   120752..120814,120833..120901,120914..120973,
FT                   120992..121060,121088..121156,121175..121243,
FT                   121253..121312)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PAT2150 by TMHMM2.0 at aa 7-29, 39-61, 77-96, 100-120,
FT                   127-149, 154-173, 180-202, 212-234, 241-263 and 267-286"
FT   misc_feature    120515..120886
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 4.5e-10"
FT                   /inference="protein motif:Pfam:PF00892"
FT   misc_feature    120947..121315
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 4.3e-12"
FT                   /inference="protein motif:Pfam:PF00892"
FT   CDS_pept        121561..123150
FT                   /transl_table=11
FT                   /locus_tag="PAU_00115"
FT                   /old_locus_tag="PAT2151"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00115"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82208"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU58"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AY167420"
FT                   /protein_id="CAQ82208.1"
FT                   /translation="MESAISTDNIKLFIKKIDELVNIEDKKKGGALAVAVTHGDETIYQ
FT                   RHIGQASIEHAVAIQPDTKFYLASASKQFTAFCIALLEKEGKLSVKDKVGKYLDDFPAR
FT                   FSDITIEHLIHHTSGLRDIFLLYNLAGKNSDFDYCNADLVRKLAHRQQELSFTPGEYSL
FT                   YSNTGYHFLGEIISVVSGQTLRKYAEENVFAPLKMKDTLICDDITEIIPNRAMGYTYNE
FT                   DSHQWIRSDINNSVVGSAAVHSTVNDLCRWIRAFYSPSIVQELLPQLSRTPDLTNGNRN
FT                   KYAYGLDIDQREGQRIIHHSGTYAGFRANIVILPDAKLGIAITSATNVNVAKWVDKNID
FT                   ILFNTGIKPEKPHCLTSDIDITGIFRGIESYPYIITKEDVYLLSNLLEEGKPIIFNVDG
FT                   TFQEQGGVIKFRPIVENNSVIALEKIDENGNVFYFKKMKDEENIDIKLLLGKYYSHETE
FT                   AMVDIISSGDGIAIGGIIYPSKKEVLRRIHGNSYFSPRTELIIDFAFDPNANKHSLYIS
FT                   DSRCWKVEFVAV"
FT   misc_feature    121597..122598
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   5.2e-59"
FT                   /inference="protein motif:Pfam:PF00144"
FT   CDS_pept        123371..124966
FT                   /transl_table=11
FT                   /locus_tag="PAU_00116"
FT                   /old_locus_tag="PAT2152"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to penicillin binding protein, beta
FT                   lactamase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00116"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82209"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU59"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AAIA01000048"
FT                   /protein_id="CAQ82209.1"
FT                   /translation="MMESTISTDKIKLFLNKIDELINIENKKKGGALAVAVTHGNKIIY
FT                   QRHIGKADIEHSVAVKPNTKFYLASVSKQFAAFCIALLEKEGKLCVKDKVGQYLDYFPA
FT                   HFSDITIEHLVHHTSGLRDEFLLYSLAGKNSDFDHRHIELVRKLTQRQYSLNFTPGEYY
FT                   LYSNTGYNLLAEIVSVVSGKSLRKYAEENVFIPLKMKDTFFYDDITEIIPDRAMGYAYN
FT                   EESHQWRRDDLNDVVVGGSGLYSTVNDLCSWMKAFYSPSIVQDLWPQLSRTPDLTNGNR
FT                   NNYAYGFAINQREGQKIIRHDGGYGGFRSEVCILPDAELGIAVTSAMNTNVSKLVQQCF
FT                   DVLFNPNDTKPEKQPCRTSDADITGIFKGLQPYPYIITKEDCYLLGNLFEKGNPIIFNS
FT                   DGTFQAEDGKIRFRPVIENDNVIALEQINENGNVFYLDKMIDDGGADIQLLLGHYYNHE
FT                   TEAVLTVAASGDELYIDAIISPERKEVLHRVYGNSYFSPSTKLIIDFALDPETNEPQLY
FT                   LSNGRCWNIEFVAF"
FT   misc_feature    123410..124414
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   4.4e-61"
FT                   /inference="protein motif:Pfam:PF00144"
FT   CDS_pept        125256..126848
FT                   /transl_table=11
FT                   /locus_tag="PAU_00117"
FT                   /old_locus_tag="PAT2153"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to penicillin binding protein, beta
FT                   lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00117"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82210"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU60"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AY167420"
FT                   /protein_id="CAQ82210.1"
FT                   /translation="MESTISTDKIKLFINKIDELVNIENKKKGGALAVAVTHGNKIIYQ
FT                   RHIGKADIEHSVAVKPNTKFYLASVSKQFAAFCIALLEKEGKLCIKDKVGQYLDYFPAH
FT                   FSDITIEHLIHHTSGLRDEFLFYSLAGKNSDFDHRHIELVRKLMQRQQALNFTPGEYYL
FT                   YSNTGYNLLAEIVRVVSGKSLRKYAEENVFVPLKMKDTFFYDDITEIIPDRAMGYAYNE
FT                   ESHQWRRDDLNDVVVGGSGLHSTVNDLCRWMRAFYSPSIVQDLLPQLSRTPDLTNGNRN
FT                   NYAYGLMISQREGQKIIQHGGSYTGFKSHVCILPDAKLGIAITAATGAEVTGWVEQHID
FT                   ILFHTDIEREEPYCLTNDIDITGIFRGIEPYPYIITKEDTYLLGNLFEKGNPIIFNSDG
FT                   TFQEQGGKIRFRPIIENDSVIALEQIDENGNIFYLKKRVDDGGVDIQLLSGRYYSHEAE
FT                   AMLFISSSDNGIYIDGIVYPGKKEVLRRIYGNSYFSPSTELIIDFELDSDTNKPRLYIN
FT                   DSRCWNVELVQFN"
FT   misc_feature    125292..126293
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   1.3e-65"
FT                   /inference="protein motif:Pfam:PF00144"
FT   CDS_pept        126988..128577
FT                   /transl_table=11
FT                   /locus_tag="PAU_00118"
FT                   /old_locus_tag="PAT2154"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to penicillin binding protein, beta
FT                   lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00118"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82211"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU61"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AY167420"
FT                   /protein_id="CAQ82211.1"
FT                   /translation="MMALTISRDNIKFLLKKIDNLIDIENKKNGGALAVAVTHENETIY
FT                   KRYIGQASIEHSAAITPNTKFYMASVSKQFTAFCIALLEKAGKLNVKDKVGKYVDYFPT
FT                   RFSDITIEHLIHHTSGLRDKYVPYGLAGKNSDFDHRSMGLLRKLIQRQQALNFTPGERF
FT                   RYSNTGYNLLAEIIKVVSGKSLREYAKENIFIPLKMNNTSFYDEVTEIIDDRAIGYVYN
FT                   EDAKQWKRSDHNDSTIGSAGLRSTVSDLCRWMKAFYSPSIVRDMLPHLSRTPNLTNGNR
FT                   NNYAYGLMISQREGQKIIRHDGSYGGFKAEVCVLPDIKLGIVITAATGINTVEFTNQCL
FT                   NILFNTDITEPEHCRTSNIDITGMFKGEDPYPYIITKEDCYLLGNLFEKGNPIIFNADG
FT                   TFQEKGGDIRFRAVIGNNEVIALEQIDENGNIFYLKKMIDKADIDIQRLSGRYYNHETE
FT                   SIINIESSGDKLYLDAVVLPGKKEALRWAYENSYFSQATELIIDFKLDSDTNKPHLYVN
FT                   DSRCWKIEFVPV"
FT   misc_feature    127048..128028
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   5.5e-60"
FT                   /inference="protein motif:Pfam:PF00144"
FT   CDS_pept        129096..130604
FT                   /transl_table=11
FT                   /locus_tag="PAU_00119"
FT                   /old_locus_tag="PAT2155"
FT                   /product="similar to deoxycytidylate deaminase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00119"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82212"
FT                   /db_xref="GOA:C7BU62"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C7BU62"
FT                   /inference="similar to DNA sequence:INSD:AE016853"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82212.1"
FT                   /translation="MEIIHMIDINKTYLSEDNQMPCDFDSEVVIGLVGAVGTDLEIIKD
FT                   SITQKLNAFRYDVQEVRISSEIISVLRDIPLTKDNYEKISCLMTEGNNLREVSQDNSIL
FT                   ALAAVAEINKRREKKNSLPIPSIRRAYIINSLKHPDEVNALREIYANGFFLIGVYTSES
FT                   QRLKNLTVDKGIDREKAKELISRDSNEGNEWGQHTRDTYELSDFFISYDGNKNRADNSI
FT                   WRILDLIFGNPYVTPTFDEYAMFMAFSASLRSGDLSRQVGAVLTKNKNIISTGANDVPK
FT                   FGGGLYWPEYVGDEIEDAKNGRDYKVGEDSNAKEKRLIIEDILKDVKDEKKEEFKEYLL
FT                   RSKIKDITEYGRVVHAEMEAILACARSNISTYNGILYCTTFPCHNCAKHIVASGIKRVV
FT                   YIEPYPKSKAFDFHPDSISTPGVDDNKVIFEPFVGVGPRCFFNLFSINLGVGYKIKRKN
FT                   KEGKTLNWDRRDGKLRMKMLSLSYIEKETESAANVDRLIKELKK"
FT   misc_feature    129804..130301
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminas, score 4.4e-23"
FT                   /inference="protein motif:Pfam:PF00383"
FT   CDS_pept        complement(130958..132145)
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="PAU_00120"
FT                   /old_locus_tag="PAT2156"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82213"
FT                   /db_xref="GOA:C7BGN4"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGN4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82213.1"
FT                   /translation="MEQTWRWFGPNDPVSLDDIRQAGATGIVTALHHIPNGHVWHQDEI
FT                   LARKTLIENKGLIWSVVESIPVHEEIKTQTGHYQQWINNYKTSLKNLAECGINTVCYNF
FT                   MPVLDWTRTDLEYLLPDGSKALRFDQIAFAAFEIYILKRPGAEADYTVEEQAQAKVYYD
FT                   NMSAADIEKLTANIIAGLPGAEEGYTLAEFQAQLDRYQDITHDKLREHLAYFLHQIVPV
FT                   CEEYSLRLAIHPDDPPRPILGLPRIISTIEDIEWLTTIEPSPVNGITMCTGSYGVRSDN
FT                   DLVEMIKRYGNRIYFTHLRSTQREENSKTFHEAAHLAGDVDMYNVIMEILREEYRRKAA
FT                   GDNRLIPMRPDHGHQIIDDLKKQTNPGYSCIGRLKGLAEIRGLELGLRRAFFENK"
FT   misc_feature    complement(130979..132145)
FT                   /note="HMMPfam hit to PF03786, D-mannonate dehydratase
FT                   (UxuA), score 1.5e-244"
FT                   /inference="protein motif:Pfam:PF03786"
FT   CDS_pept        complement(132235..133035)
FT                   /transl_table=11
FT                   /gene="uxuR"
FT                   /locus_tag="PAU_00121"
FT                   /old_locus_tag="PAT2157"
FT                   /product="uxu operon transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82214"
FT                   /db_xref="GOA:C7BGN5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGN5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:BA000007"
FT                   /protein_id="CAQ82214.1"
FT                   /translation="MQLIDSHRNGSNMMKHLLESKRPYQEVGISLRQMIANQQYHIGDR
FT                   LPPERELAELLGVSRTVVREALIMLELENLIEVRKGSGVYIISLPHLLPASSCSVNAAG
FT                   PFELLQARQLLESNIAEFAAMQVTPNNIANMRRALQKESEDLASGEDESGDREFHLAIA
FT                   EATHNSMLVELLKQSWAWRENNPMWQKLHTRITDKDYRKEWLHDHQIILSAMIKKDPAA
FT                   AKQAMWQHLENVKLRLLELSDIDDPYFDGYLFNSYPYEIAKKRN"
FT   misc_feature    complement(132337..132717)
FT                   /note="HMMPfam hit to PF07729, FCD domain, score 4.2e-36"
FT                   /inference="protein motif:Pfam:PF07729"
FT   misc_feature    complement(132778..132969)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 2.9e-25"
FT                   /inference="protein motif:Pfam:PF00392"
FT   misc_feature    complement(132778..132957)
FT                   /note="HMMSmart hit to SM00345, no description, score
FT                   4.7e-23"
FT                   /inference="protein motif:Smart:SM00345"
FT   CDS_pept        complement(133116..134096)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00122"
FT                   /old_locus_tag="PAT2158"
FT                   /product="putative c4-dicarboxylate transport system
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00122"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82215"
FT                   /db_xref="GOA:C7BGN6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGN6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82215.1"
FT                   /translation="MNNSKRILCTVIGTIFTLGASQVIAVTTLKLSHNHNRDHAVHKAM
FT                   TQFADEVRQKTNGDVRIRIYPDAQLGNQRESMELMQNGALDLVKSNAAEQEAFSPAYSA
FT                   FNLPYLFRDQAHYEKIKNGEIGKEILASSKNRGFVGITFYEAGARSFYAKKPIRTPADL
FT                   KGMKIRVQPSPTAISMVKNLGGNPTSLAYGELYTALQQGVVDAAENNIPSFSLSRHSEV
FT                   AGYFSLDKHTMVPDVLVISNKSLNKLSSEQQKILMSAATHSSEYMTKLWEKSEEKERQH
FT                   AEKIGVKFVDVDKKSFEEAVKPIYDDIKKSDPMLYHMVERIRAVK"
FT   misc_feature    complement(133161..134006)
FT                   /note="HMMPfam hit to PF03480, Bacterial extracellular
FT                   solute-binding prot, score 3.9e-101"
FT                   /inference="protein motif:Pfam:PF03480"
FT   misc_feature    complement(134010..134078)
FT                   /note="1 probable transmembrane helix predicted for PAT2158
FT                   by TMHMM2.0 at aa 7-29"
FT   sig_peptide     complement(134022..134096)
FT                   /locus_tag="PAU_00122"
FT                   /note="Signal peptide predicted for PAT2158 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 25 and 26"
FT   CDS_pept        134396..134902
FT                   /transl_table=11
FT                   /locus_tag="PAU_00123"
FT                   /old_locus_tag="PAT2159"
FT                   /product="trap-type c4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00123"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82216"
FT                   /db_xref="GOA:C7BGN7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGN7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE016796"
FT                   /protein_id="CAQ82216.1"
FT                   /translation="MKNLVDCINKGLAFFTICLFVFLVFCVTWQVVSRYVLGTPSTVTD
FT                   ELARYLFIWVAMIGAAYTTGQHRHLAIDLLAMKLKGIGKNIVGLVILASIALFASVVLV
FT                   YGGSVLAISTLETGQITPALGLQMGYVYLCLPISGVLMIFYTLTDSVALIQNFSGKDTV
FT                   VYESR"
FT   misc_feature    order(134432..134491,134534..134590,134651..134719,
FT                   134762..134830)
FT                   /note="4 probable transmembrane helices predicted for
FT                   PAT2159 by TMHMM2.0 at aa 13-32, 47-65, 86-108 and 123-145"
FT   misc_feature    134462..134863
FT                   /note="HMMPfam hit to PF04290, Tripartite ATP-independent
FT                   periplasmic trans, score 1.4e-34"
FT                   /inference="protein motif:Pfam:PF04290"
FT   CDS_pept        134930..136231
FT                   /transl_table=11
FT                   /gene="ygiK"
FT                   /locus_tag="PAU_00124"
FT                   /old_locus_tag="PAT2160"
FT                   /product="similar to dicarboxylate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00124"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82217"
FT                   /db_xref="GOA:C7BGN8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGN8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82217.1"
FT                   /translation="MDWQVVLVLFGSFAILLALGIPVSFAISLSSLLAIMMTLPIEAAV
FT                   TVVAQRMAVGVDNFSLLAIPFFILAGNIMNQGGIATRLINLAKVMGGRLPGSLVHVNIM
FT                   ANMFFGAISGSAVASAAAVGGTMAPMQKKEGYEPEYSAAVNIASCPAGLLIPPSNTLIV
FT                   YSLVSGGTSIAALFLAGYIPGILMGVSLMIVSAIIAKRRGYPVSPRPTWNEFFITLVRA
FT                   LPSLMLIVVVMGGIIAGIFTATEASAIAVLYSFVLAVLIYREVSIIKLPKIILDSAVTT
FT                   SIVLLLIGASMGMSWAMANADLPYLIADALMVVSENPLVILLVINIILLLVGTFMDMTP
FT                   AILIFTPIFLPVAQSMGIDPVHFGIIMTFNLAIGICTPPVGSALFVGCSIGEVSINKVL
FT                   KPLVPMYCALIIALMLVTFMPQLSLWLPQMLLNY"
FT   sig_peptide     134930..135058
FT                   /gene="ygiK"
FT                   /locus_tag="PAU_00124"
FT                   /note="Signal peptide predicted for PAT2160 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.600 between residues 43 and 44"
FT   misc_feature    order(134942..135010,135023..135091,135104..135172,
FT                   135230..135298,135359..135427,135455..135523,
FT                   135584..135652,135665..135724,135761..135829,
FT                   135857..135925,135944..136003,136031..136099,
FT                   136133..136201)
FT                   /note="13 probable transmembrane helices predicted for
FT                   PAT2160 by TMHMM2.0 at aa 5-27, 32-54, 59-81, 101-123,
FT                   144-166, 176-198, 219-241, 246-265, 278-300, 310-332,
FT                   339-358, 368-390 and 402-424"
FT   misc_feature    134957..136198
FT                   /note="HMMPfam hit to PF06808, DctM-like transporters,
FT                   score 4.8e-148"
FT                   /inference="protein motif:Pfam:PF06808"
FT   CDS_pept        136270..137727
FT                   /transl_table=11
FT                   /gene="uxuB"
FT                   /locus_tag="PAU_00125"
FT                   /old_locus_tag="PAT2161"
FT                   /product="mannonate oxidoreductase (d-mannonate
FT                   oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00125"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82218"
FT                   /db_xref="GOA:C7BGN9"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGN9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82218.1"
FT                   /translation="MSRNIANCKINPAVSLPSYDRNRLITRIVHLGCGAFHRAHQAVFT
FT                   HHMLEKTDSDWGICEVSLFSGHRLIQQLNDQDCLCTIAEKGAEKTELKVIGSMIDALHP
FT                   EFVGQQGILETIAQPQVAIVSLTITEKGYCIDAVNGKLDVNNALIQWDLANPTAPTSAI
FT                   GYIVEALRLRYERGLSPLSVMSCDNVKENGNVAREAVVGFARLRDEKLAQWIELNVTFP
FT                   CTMVDRIVPAATSESLGEIAEQLGVYDPCAITCEPFCQWVIEDNFANGRPNWDVAGAQF
FT                   VKDVMPFETMKLRMLNGSHSFLAYLGYLAGYAHIADTMANADYRQAVLDLMLKEQAPTL
FT                   TMPVGTDLSQYAHLLIERFSNPSLKHQTWQIAMDGSQKLPQRMFDSVAYHLANGSDYRY
FT                   LALGIAGWMCYVSGQDEQGKLIDVRDPMVDQFKSIYQKYGLSVDVVPALLAVFGNPLLA
FT                   NPHFVRVVTEAYQRLLDYGARRAVAAL"
FT   misc_feature    136345..136836
FT                   /note="HMMPfam hit to PF01232, Mannitol dehydrogenase
FT                   Rossmann domain, score 1.5e-77"
FT                   /inference="protein motif:Pfam:PF01232"
FT   misc_feature    136918..137655
FT                   /note="HMMPfam hit to PF08125, Mannitol dehydrogenase
FT                   C-terminal domai, score 2e-110"
FT                   /inference="protein motif:Pfam:PF08125"
FT   CDS_pept        137749..139173
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="PAU_00126"
FT                   /old_locus_tag="PAT2162"
FT                   /product="uronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00126"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82219"
FT                   /db_xref="GOA:C7BGP0"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82219.1"
FT                   /translation="MKNFMCEDFLLNNETARQLYHEYAVDMPIYDYHCHLNPREIAENR
FT                   LFDNLGQIWLEGDHYKWRAMRSVGIDESLITGKQTGDNEKYQAWAKTVPLTLGNPLYHW
FT                   THLELRRPFGITGKLFGPQTADEIWHQCNEKLATPEFSARGIMQQMNVRMVGTTDDPVD
FT                   SLEYHRQIATDEDFDIEVLPSWRPDRVFKIELEGFIEYIQQLEAVADVSISSFADVLSA
FT                   LGRRLEHFAAHGCRAADHGIENLRYAPIPDEAVLNSILQKRFAGGTLSELEIAQYTTAV
FT                   LVWLGRQYAARGWVMQLHIGAIRNNNTRMFRLLGADSGFDSIGDNNIARSLSRLLDSMD
FT                   VTDELPKTILYCLNPRDNEVIATMAGNFQGGGIAGKVQFGSGWWFNDQKDGMLRQLEQL
FT                   SQLGLLSRFVGMLTDSRSFLSYTRHEYFRRILCNLLGKWVENGEVPNDRTMLGRMVEDI
FT                   CFNNARRYFALPGENS"
FT   misc_feature    137749..139164
FT                   /note="HMMPfam hit to PF02614, Glucuronate isomerase, score
FT                   0"
FT                   /inference="protein motif:Pfam:PF02614"
FT   CDS_pept        139170..140132
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="PAU_00127"
FT                   /old_locus_tag="PAT2163"
FT                   /product="2-dehydro-3-deoxygluconokinase
FT                   (2-keto-3-deoxygluconokinase) (3-deoxy 2-oxo-d-gluconate
FT                   kinase) (kdg kinase)"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00127"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82220"
FT                   /db_xref="GOA:C7BGP1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP1"
FT                   /inference="similar to DNA sequence:INSD:AAPH01000001"
FT                   /inference="similar to DNA sequence:INSD:L42023"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82220.1"
FT                   /translation="MKQIALLGECMIELNGVPFGTLHQTFGGDVLNSAVYLARASQQKI
FT                   AVNFVTALGMDSLSEGMIKRWQDEGIHTHLVLRDPAHQPGLYLIQLDEQGERTFLYWRN
FT                   DSAARYMVRHPDFTSISQALQQMDVVYLSGISLAILPADDREKLLNLLAELAEQGKTIV
FT                   FDSNYRSALWESIAETQVCYQKLLSCTSLALVTDDDEENLWGDKSVKATMTRLKRAGVK
FT                   EAVIKAGEVGCYYQNLGRGTPLELIPTEPVAKVIDTTAAGDAFNAGFLAGYLMDCPIQQ
FT                   AAIMGHRLAGIVIQHKGAIIPSSVTKTMTDSFFSEQEKN"
FT   misc_feature    139170..140090
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase, score 5.7e-66"
FT                   /inference="protein motif:Pfam:PF00294"
FT   CDS_pept        140132..140779
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="PAU_00128"
FT                   /old_locus_tag="PAT2164"
FT                   /product="khg/kdpg aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00128"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82221"
FT                   /db_xref="GOA:C7BGP2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP2"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82221.1"
FT                   /translation="MKQIIVQLRQLKIVPVIEVDRAEDIISLGKALADNGLPVAEITFR
FT                   SAAAEEAIRLLRKAQPNMLIGAGTVLNRGQVMAAKQAGATFIVSPGFNPNTVKACQELN
FT                   IPIIPGVNNPSAIEGAMELGLKLLKFFPAEPSGGLPMIKAILSPYTELQIMPTGGIGPK
FT                   NICDYLAVPRIVACGGSWMVSKVLVDSQNWQEIGRLTREAVDLVNGINNRTD"
FT   misc_feature    140141..140728
FT                   /note="HMMPfam hit to PF01081, KDPG and KHG aldolase, score
FT                   6.3e-103"
FT                   /inference="protein motif:Pfam:PF01081"
FT   CDS_pept        140900..141382
FT                   /transl_table=11
FT                   /locus_tag="PAU_00129"
FT                   /old_locus_tag="PAT2165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00129"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82222"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP3"
FT                   /inference="similar to DNA sequence:INSD:AAOU01000013"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82222.1"
FT                   /translation="MPGVSLPNPEELFSVGAINNINNKSDLPHKESSLPHSYSGIQIHR
FT                   DELGRLAPSSFSLPFIDDLKYITSDLREKLREIAKPACENRRLELEQMQSIIMKLCESH
FT                   YIRIDVLSILLNRSAKNLRQRHIKPLLNKQNLMMAFPQTPNHPNQGYTVKALLQKD"
FT   CDS_pept        complement(141736..142623)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00130"
FT                   /old_locus_tag="PAT2166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82223"
FT                   /db_xref="GOA:C7BGP4"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP4"
FT                   /inference="similar to DNA sequence:INSD:AY502024"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82223.1"
FT                   /translation="MIIDMNINELLTAEASFMLATLTLESNIIGVMKYENGAILITQDS
FT                   PFYPKNYKWPDQLHDNGIISIDDKELAVTKVYTAGLINGNLYIDQEITKQATSPAKIMP
FT                   AHYLPDLQGISERDLIGKTVTLSINDKTRYRVSAAHSMAHFMSLALNKATNHIWSKVYD
FT                   TDDLGNYNLDKAAIYQSSITELKSVDIYRFGKSLKKKGFDKNILIENLDKINREVNSTL
FT                   NNWLTQGVEITVEYKSKEISDTRLWKSTIDSTVVTIPCGGTHIKNINEVKGVNIEIKIG
FT                   ESVDFIQITTRCEI"
FT   CDS_pept        142746..143441
FT                   /transl_table=11
FT                   /locus_tag="PAU_00131"
FT                   /old_locus_tag="PAT2167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82224"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP5"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82224.1"
FT                   /translation="MDYLSYKKQSDHVIAKNIDNVTRKSAPIVYSTMEDIYLGLVRLRN
FT                   SQAFLYKDIYGKQISNEDQRMIDAAIKTIFKKGDVIYDIVSTIINTMYDFIPERTQRII
FT                   SEKFHLIVATYGVQTATKISVATAITSLISIKINAVPSVKTKIATFLNISINSLAIYGI
FT                   FEKAARSARKLKIESPVTYLALKKKGLEMLYFLVEPYMEKLINIYRKNIMTLEDEKLLL
FT                   DEIERLIYL"
FT   CDS_pept        complement(143686..144165)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00132"
FT                   /old_locus_tag="PAT2168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00132"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82225"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP6"
FT                   /inference="similar to DNA sequence:INSD:CP000308"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82225.1"
FT                   /translation="MSFSIYLKLNGRKQGLISSGCSTSDSIGNRYQIGHEDEIQVLSFV
FT                   HSLTREQNSDHHPVDFIKIIDKSSPLLGIAISNNEVLNAFFDFYRINSFGVMEKFYTVE
FT                   LRDASIVDICANYPHSIDSSNTIPFETISLAYKSITWKHHIAGTSGYSIWDDRVY"
FT   misc_feature    complement(143734..144156)
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 7.8e-61"
FT                   /inference="protein motif:Pfam:PF05638"
FT   CDS_pept        complement(144497..145999)
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="PAU_00133"
FT                   /old_locus_tag="PAT2169"
FT                   /product="aerobic glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00133"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82226"
FT                   /db_xref="GOA:C7BGP7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82226.1"
FT                   /translation="METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLAKATSSAS
FT                   SKLIHGGLRYLEHYEFRLVSEALAEREVLLNLAPHIAFPMRFRLPHQPHLRPAWMIRIG
FT                   LFLYDNLGKRVSLPSSKGLKFGANSVLKPELVRGFEYSDCWVDDARLVVLNAQEVKKHD
FT                   GEVRTRTKVTRAWREHDGWMVEAEDLRTGKTHTWRAKGLVNATGPWVKEFFDDSLKLKS
FT                   PYGIRLIKGSHIVVPRVHDEPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYTGDPKE
FT                   VKIDDQEINYLLKVYNAHFKKQLSREDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHD
FT                   EQGKAPLLSVFGGKLTTYRKLAEHATEKLMQYYPNAGKAWTKNGQLPGGNLEGCDRDGY
FT                   ARLLRKRYNWLPEGVAVRYARTYGSHSELILQSANNLADLGKSFGHGLYEAELRYLVDN
FT                   EWVVELDDAIWRRTKLGMWLNEEQKQHVAAWLVENAKPRSEI"
FT   misc_feature    complement(144923..145987)
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 6.4e-69"
FT                   /inference="protein motif:Pfam:PF01266"
FT   CDS_pept        complement(146355..147113)
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="PAU_00134"
FT                   /old_locus_tag="PAT2170"
FT                   /product="glycerol-3-phosphate regulon repressor"
FT                   /note="glycerol-3-phosphate regulon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00134"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82227"
FT                   /db_xref="GOA:C7BGP8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82227.1"
FT                   /translation="MKQTQRHDAIVELVRLQGYVSTEELVEHFNVSPQTIRRDLNDLAD
FT                   KNKIQRHHGGAALPSSSVNTAYHDRKIMWSEEKARIAQRVASQIPDGATLFIDIGTTPE
FT                   AVAHALLNHKDLRIVTNNLNVATLLMAKEDFRLILAGGEVRTRDGGIIGEATLDFISQF
FT                   RLDYGILGISGIDMDGSLLEFDYHEVRIKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   NLIDCLFTDQTPPASIQKVIEQHNVQLELC"
FT   misc_feature    complement(146421..146891)
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   proteins, deoR family, score 4.2e-76"
FT                   /inference="protein motif:Pfam:PF00455"
FT   misc_feature    complement(146928..147098)
FT                   /note="HMMPfam hit to PF08220, DeoR-like helix-turn-helix
FT                   domain, score 1.1e-28"
FT                   /inference="protein motif:Pfam:PF08220"
FT   misc_feature    complement(146940..147098)
FT                   /note="HMMSmart hit to SM00420, no description, score
FT                   1.5e-25"
FT                   /inference="protein motif:Smart:SM00420"
FT   misc_feature    complement(146943..147098)
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.00042"
FT                   /inference="protein motif:Pfam:PF08279"
FT   CDS_pept        complement(147130..147894)
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="PAU_00135"
FT                   /old_locus_tag="PAT2171"
FT                   /product="putative membrane protein glpg"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00135"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82228"
FT                   /db_xref="GOA:C7BGP9"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGP9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82228.1"
FT                   /translation="MHPGHDERHVELWLEDDTKLALVQQELEKFTRDPLNERYQAASWQ
FT                   SGKISHSLKYQNNLNWHYLSRQAGPLTITVLILNIAVYLWMQFAGDYQVMYWLAWPDNS
FT                   QHMELWRWVTHGLLHFSLLHIIFNLMWWWYLGGQTEKRLGTGKLFVITIVSAVFSGWGQ
FT                   SLFSGSNFGGLSGVVYALIGYVWLTGERAPEHGIGVPRGLMAFSILWLIVGYFDTFGLS
FT                   IANAAHFSGLTIGLLMALWDNRHTFKNNNRHF"
FT   misc_feature    complement(147154..147588)
FT                   /note="HMMPfam hit to PF01694, Rhomboid family, score
FT                   2.8e-31"
FT                   /inference="protein motif:Pfam:PF01694"
FT   misc_feature    complement(order(147172..147240,147253..147306,
FT                   147331..147384,147394..147453,147490..147558,
FT                   147625..147693))
FT                   /note="6 probable transmembrane helices predicted for
FT                   PAT2171 by TMHMM2.0 at aa 68-90, 113-135, 148-167, 171-188,
FT                   197-214 and 219-241"
FT   CDS_pept        complement(147989..148324)
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="PAU_00136"
FT                   /old_locus_tag="PAT2172"
FT                   /product="thiosulfate sulfurtransferase GlpE"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00136"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82229"
FT                   /db_xref="GOA:C7BGQ0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82229.1"
FT                   /translation="MEHFQTISPEQAYQHWQDKSAIMVDIRDPQSFQAGHVCGAFHLTN
FT                   ETLNEFMLQANFEQPVMVMCYHGHSSQSAAQYLLNLGFEAVYSINGGFEAWLKNYPHAV
FT                   DSLRNPA"
FT   misc_feature    complement(148019..148306)
FT                   /note="HMMSmart hit to SM00450, no description, score
FT                   1.4e-19"
FT                   /inference="protein motif:Smart:SM00450"
FT   misc_feature    complement(148028..148303)
FT                   /note="HMMPfam hit to PF00581, Rhodanese-like domain, score
FT                   5e-16"
FT                   /inference="protein motif:Pfam:PF00581"
FT   CDS_pept        complement(148420..148995)
FT                   /transl_table=11
FT                   /gene="gntY"
FT                   /locus_tag="PAU_00137"
FT                   /old_locus_tag="PAT2173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00137"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82230"
FT                   /db_xref="GOA:C7BGQ1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82230.1"
FT                   /translation="MINITEAAQAHFAKLLANQEPGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFEKLSAYVDELSAPFLEEAEIDFVTDQLGSQLTLKAPNAKMRKVSDD
FT                   APLVERVEYVLQSQINPQLAGHGGRVSLMEITDEGFAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLNMFPELKGVKDLTEHQRGEHSYY"
FT   misc_feature    complement(148456..148665)
FT                   /note="HMMPfam hit to PF01106, NifU-like domain, score
FT                   1.8e-07"
FT                   /inference="protein motif:Pfam:PF01106"
FT   misc_feature    complement(148714..148992)
FT                   /note="HMMPfam hit to PF01521, Iron-sulphur cluster
FT                   biosynthesis, score 9.8e-32"
FT                   /inference="protein motif:Pfam:PF01521"
FT   CDS_pept        complement(149055..149519)
FT                   /transl_table=11
FT                   /gene="gntX"
FT                   /locus_tag="PAU_00138"
FT                   /old_locus_tag="PAT2174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00138"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82231"
FT                   /db_xref="GOA:C7BGQ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82231.1"
FT                   /translation="MSRLIRRYKYHSTPQLASVLARLFLLHWQQGYRDGRWFKPNILLS
FT                   VPLHRHRRWKRGFDQGELMAKQLSEWLQCDYQQSILQRTRATLPQRNLSAAQRRTNLRK
FT                   AFQLCGPVAGQHVAILDDVITTGATITEISRLLIRAGARSVQVWAICRTL"
FT   CDS_pept        complement(149494..149949)
FT                   /transl_table=11
FT                   /gene="OSJNAa0079B05.15"
FT                   /locus_tag="PAU_00139"
FT                   /old_locus_tag="PAT2175"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00139"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82232"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ3"
FT                   /inference="similar to DNA sequence:INSD:CR382137"
FT                   /protein_id="CAQ82232.1"
FT                   /translation="MDQNISRVSITVFGDATENAERIAFQWNARLPHSAPIRAAAQDHA
FT                   NLHQKSAKTDQPLLFSTLFAIKEEAYANNGWVLLAMPSTPLVSTSWNMQFLQQAAETFD
FT                   KHVPMLRPALRINFITLWALHQETASMGKYDSDHRLSPSIEPPYSPL"
FT   CDS_pept        150369..151568
FT                   /transl_table=11
FT                   /gene="tyrS2"
FT                   /locus_tag="PAU_00140"
FT                   /old_locus_tag="PAT2176"
FT                   /product="tyrosyl-trna synthetase 2"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82233"
FT                   /db_xref="GOA:C7BGQ4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AAPM01000001"
FT                   /protein_id="CAQ82233.1"
FT                   /translation="MKENIDKLLSNIAIMEPPSGLQDKLALARQENRKLTIKLGFDPTA
FT                   PDLHLGHSVVLQKLKDFQDEGHRIVVIIGDFTAGIGDPTGRNKLRPPLTLEQINKNSQT
FT                   YINQLAKVINIENIEIRKNSEWFSNMPFSNVIKLISKITLAQIMHRDDFKTRFESKSPV
FT                   HLHEIIYPILQGYDSVMIDADIELGGTDQLFNNLVGRTLQEAYEKKGQIVITMPLLEGL
FT                   DGIEKMSKSKNNYIGLTDNANDMYGKVMSIPDSVIINYLTLATDMEAEKQSAIVSQLEL
FT                   GLNPMKVKKDIAYNIVKRYHDDISAKEAAEHFERVVQKRTPEEADHDVLILPKGSYITL
FT                   LDLCSVALPTISRSELRRLIRSGAVRVDKSKEDNEIKNIEVIPGMLIWIGKRYKFRIDG
FT                   "
FT   misc_feature    150456..151322
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 2.6e-89"
FT                   /inference="protein motif:Pfam:PF00579"
FT   misc_feature    151380..151529
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 0.017"
FT                   /inference="protein motif:Pfam:PF01479"
FT   CDS_pept        complement(151579..152376)
FT                   /transl_table=11
FT                   /gene="spnH"
FT                   /locus_tag="PAU_00141"
FT                   /old_locus_tag="PAT2177"
FT                   /product="conserved hypothetical protein"
FT                   /product="similarities with putative methyltransferase"
FT                   /product="probable o-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82234"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AY007564"
FT                   /protein_id="CAQ82234.1"
FT                   /translation="MKPEKEIIPFSPEMIQKLISEGKDPHYYVIQDFMEDKSLNLSELD
FT                   KQSLVDSHYLISKKIISPHSTEDIFTFIKEILSIPSSREGCIVEAGSYKGSSTAKFSLA
FT                   AKLTGRELVVCDSFMGLPFHNEVHGISIEGREAVFREGDFAGSLQEVKNNIIKYGNISS
FT                   CTFIKGWFETSLANWSRPIAAIYLDVDLQKSTRDCLKYLYPWLTPGGSLYSQDGHLPLV
FT                   LDVFEDVNFWRKEIGTQPPTVVGIRKKKLIKITKPDTPSLPLL"
FT   CDS_pept        complement(152379..154031)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00142"
FT                   /old_locus_tag="PAT2178"
FT                   /product="predicted fe-s oxidoreductase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00142"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82235"
FT                   /db_xref="GOA:C7BGQ6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ6"
FT                   /inference="similar to DNA sequence:INSD:BA000001"
FT                   /inference="similar to DNA sequence:INSD:AE010388"
FT                   /protein_id="CAQ82235.1"
FT                   /translation="MLDLSLLRDSGTFSIDGGSPRLALVHHGFRTTQLGATDKRQDKYA
FT                   ARYASLGLLNLARSAQVDFERGRIPFQPEIQYFDEDNFTDDVELAKAISDWLRPSKARF
FT                   VLVSLYSLAFERTKNMLSNLNPEEVCIMVGGAHPTVAPEIDFVHLVARGEGGNALRHVL
FT                   RLFLHPEFGMGNEARGLCFMLDGKVQMGEVVFDKSLEDIPSPAFSYELIQNDTSFAGQS
FT                   RERWWKAVGESQQIYICTQSCRARCTFCSTYLIHGKLVSRPVELIAGDIEHLLTFGHDS
FT                   IQFHDDDLLQHENLHELLDLLLEFNIAWTCNARSEVITPALARRMYDAGCKKVFLGVES
FT                   LDQRSLNYYNKATTVEMNINAVNALNSSGIGVICGYIIGAPHDTVESILADLDRVLALP
FT                   IYFLATAILTPDIGTVEYRRALRRIPLLQELGNDGTKMNIRPRPEIFGTSAPYGLPTVA
FT                   EAISKEELNELYALINCEFFLRKEYINRVIKYTSNDRLNEALSWCSLQKLKAEELAESA
FT                   TLASVQERTVQLLQKIDADYPYYGVLSEFAEAR"
FT   misc_feature    complement(152745..153335)
FT                   /note="HMMSmart hit to SM00729, no description, score
FT                   2e-21"
FT                   /inference="protein motif:Smart:SM00729"
FT   misc_feature    complement(152847..153323)
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 3.1e-18"
FT                   /inference="protein motif:Pfam:PF04055"
FT   CDS_pept        complement(154042..155025)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00143"
FT                   /old_locus_tag="PAT2179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00143"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82236"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ7"
FT                   /inference="similar to DNA sequence:INSD:CP000362"
FT                   /inference="similar to DNA sequence:INSD:BC097873"
FT                   /protein_id="CAQ82236.1"
FT                   /translation="MLSNQCVNIIDQYRNDGYVVIRNVLNPVTDLLPVIKEYGELANKL
FT                   ANQWLGQGIITSYDKNAPEENRLLQLMKQTDGNCFQELDITLPVEAEIKEDSPVHLGEA
FT                   IFNLLRNQTILDVVENIIGSEIYSVPVQHMRIKPPEAQITDETQSHTLTLTGKTFWHQD
FT                   LAVVTQDADNTDMLSVWLPLNEATEKNGCLVVIPGSHTKGLVHHCDTPVLQGIPDSLIG
FT                   ENIRPIPAKPGDMVLLHPLMIHASLSNISTHGRWSLDLRYCPTGQPTGRRWFPGFIARS
FT                   KSHPEKELSDYEVWVESWHFARQTLAGQPHPKFDRWDKNDPSPLCA"
FT   misc_feature    complement(154255..154995)
FT                   /note="HMMPfam hit to PF05721, Phytanoyl-CoA dioxygenase
FT                   (PhyH), score 5e-17"
FT                   /inference="protein motif:Pfam:PF05721"
FT   CDS_pept        complement(155076..155990)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00144"
FT                   /old_locus_tag="PAT2180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00144"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82237"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ8"
FT                   /inference="similar to DNA sequence:INSD:AAEH02000007"
FT                   /inference="similar to DNA sequence:INSD:CP000362"
FT                   /protein_id="CAQ82237.1"
FT                   /translation="MKTILYMERKMCSDINRLEPGLIKKYKEEGFLLIPSLISEEDLII
FT                   LEATIQNIIRDVENHETATQVIEYENTQVDGLWLPRRLFNPFELHEQFRRIATSEQILG
FT                   HVISLIGQDIALQHSKLNMKPRKVGAAVEWHQDFTYFPHTNDDLVGVLIYLDDATSENG
FT                   CLEVLPRQHTRSFDHSLPDGSFAGMITEEIDEENYGQPVTLAAKAGGTIFLHPFTPHRS
FT                   APNVSEQPRKTLIFEYRAADAFPIYTGSQLVSMESYVHHLHGNPATYARFGGPSPAIYT
FT                   PKNIPKSLYELQEVSSKILKPKE"
FT   misc_feature    complement(155292..155921)
FT                   /note="HMMPfam hit to PF05721, Phytanoyl-CoA dioxygenase
FT                   (PhyH), score 4e-26"
FT                   /inference="protein motif:Pfam:PF05721"
FT   CDS_pept        complement(156089..156676)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00145"
FT                   /old_locus_tag="PAT2181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00145"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82238"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGQ9"
FT                   /inference="similar to AA sequence:UniProt:Q23TZ6"
FT                   /protein_id="CAQ82238.1"
FT                   /translation="MVSQNELCRISNNADAIRAKAMELTDSWEGVMFALSAEELENIAL
FT                   ALEFSPDIADKIHNELKTLQYAKIQSQVGPSFIATYHVLDVSLLALRGVTDFDNALSHV
FT                   NDFNLQSFLNENQYTFQKIRAALPGHAARMNFKPETAAAVLKALGANISPDLLYELCPK
FT                   YGTSSVIDLEGRRGVTTEFIRSVTLTLGMTLV"
FT   CDS_pept        157600..158817
FT                   /transl_table=11
FT                   /gene="ydeF"
FT                   /locus_tag="PAU_00146"
FT                   /old_locus_tag="PAT2182"
FT                   /product="putative membrane transport protein"
FT                   /note="MFS transporters are single-polypeptide secondary
FT                   carriers capable only of transporting small solutes in
FT                   response to chemiosmotic ion gradients"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00146"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82239"
FT                   /db_xref="GOA:C7BGR0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR0"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82239.1"
FT                   /translation="MNYNISLLHVFKNERIVSFFLFSSLLLTIGRGASLPYLAIYLSVE
FT                   LNFSPVIVGYIISSSMVFGIITSLIGGMLADNKKFKLPILSSLLTFLFCFLIFPYFKNS
FT                   ILISFLLALVNLAYSLFEVLLKSYFSDYLPQSIKIRLFSLNYTLINVGWSVGPLIGALL
FT                   SGYNHSFPFILSGLTALLPMIFIIIYYSSCFHSLPILSQRNNRLLADTISNIKPLKNHL
FT                   LFLITISSVLGSFVYGSTISYLSQYLIVYTNKEFSYTAIAAMMVTNAMVVIGFQYHVGK
FT                   YIKDDYIGRWLTGGAIFFILGIFGFIYSEQNLIYWIIAMFSFSLGEIIFIPVLYALTDS
FT                   IAPEGFRGHYFAIQNLGSLGAAVSPVLMGYLISYYKSPYIFLILIVTISFSYFILLVVK
FT                   HAYIKQ"
FT   misc_feature    order(157654..157722,157750..157818,157843..157902,
FT                   157915..157983,158020..158088,158131..158199,
FT                   158260..158328,158371..158439,158458..158526,
FT                   158536..158604,158665..158724,158734..158793)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PAT2182 by TMHMM2.0 at aa 19-41, 51-73, 82-101, 106-128,
FT                   141-163, 178-200, 221-243, 258-280, 287-309, 313-335,
FT                   356-375 and 379-398"
FT   misc_feature    157657..158718
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 4e-35"
FT                   /inference="protein motif:Pfam:PF07690"
FT   CDS_pept        complement(158880..159164)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00147"
FT                   /old_locus_tag="PAT2183"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00147"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82240"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR1"
FT                   /inference="similar to DNA sequence:INSD:CR382137"
FT                   /inference="similar to DNA sequence:INSD:CT573326"
FT                   /protein_id="CAQ82240.1"
FT                   /translation="MLFSTLFAIKEEAYANNGWVLLAMPSTSLVSTSWNMQFLQQAAET
FT                   FDKHVPMLRPALRINFTALWALYQDTASMGKYDSDHRLSPSIERPYSPL"
FT   CDS_pept        159164..159940
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="PAU_00148"
FT                   /old_locus_tag="PAT2184"
FT                   /product="carboxylesterase BioH"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00148"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82241"
FT                   /db_xref="GOA:C7BGR2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82241.1"
FT                   /translation="MADLFWQTSDGDSRDLVLLHGWGLNAEVWRSIEMRCAPHFRLHLV
FT                   DLPGYGRSQKYGPMSLADMADEVWRHAPENALWLGWSLGGLVASRIALDHQDKVAGLIT
FT                   VASSPHFSAEGDWPGIKPEVLSDFEHQLSEDFQRTVERFLALQTMGTDSARQDARLLKS
FT                   VVLVQPMPAVEVLHVGLEILCTEDLRESLAALTIPFLRIYGYLDGLVPRKILNILDEKW
FT                   PRSVSTIMRHAAHAPFISHPDEFVGLLTEFVGREAL"
FT   misc_feature    159281..159916
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 1.1e-23"
FT                   /inference="protein motif:Pfam:PF00561"
FT   CDS_pept        160538..160837
FT                   /transl_table=11
FT                   /locus_tag="PAU_00149"
FT                   /old_locus_tag="PAT2185"
FT                   /product="similar to protein gp48 from prophage n15"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00149"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82242"
FT                   /db_xref="GOA:C7BGR3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR3"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82242.1"
FT                   /translation="MSDNDYDIIPFSEAKTLLLEDAATLEAYNDIQIRKALMKQLKDAR
FT                   KALHLTQQDVAQKIGTQKQNISRMENGKSVPNLDTLSRYAAALGGRFVFQMPVS"
FT   misc_feature    160655..160822
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   3.7e-13"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    160658..160822
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   7.9e-15"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        complement(160962..161201)
FT                   /transl_table=11
FT                   /gene="yhgG"
FT                   /locus_tag="PAU_00150"
FT                   /old_locus_tag="PAT2186"
FT                   /product="similar to putative DNA-binding transcriptional
FT                   regulator protein yhgg of escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82243"
FT                   /db_xref="GOA:C7BGR4"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82243.1"
FT                   /translation="MISLLQVRDAVALNGRADAKLLSHQLSASLSMVEAMLEQLTVMGK
FT                   LEKINATACLSGGCKQCPEAQKCDTAVYRIAGGH"
FT   CDS_pept        complement(161211..163523)
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="PAU_00151"
FT                   /old_locus_tag="PAT2187"
FT                   /product="ferrous iron transport protein b"
FT                   /note="iron(II) transport system (feo) which may make an
FT                   important contribution to the iron supply of the cell under
FT                   anaerobic conditions. FeoB has been identified as part of
FT                   this transport system and may play a role in the transport
FT                   of ferrous iron."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82244"
FT                   /db_xref="GOA:C7BGR5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82244.1"
FT                   /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVEQKTGRF
FT                   ITADHKIELVDLPGTYSLTTISEQTSLDEQIACHYILSGDADMLINVVDASNLERNLYL
FT                   TLQLLELGIPCIIALNMLDIAKNQHIQIDIAELEQRLGCPVIPMVSTRATGLNELKQAI
FT                   DHHKQNSGQPLIRYPDSLLQEVDKLSGAISDNFNPQQRRWLALQMLEGDIYSLGRSGLA
FT                   TSMLAESKECLQQQQHEEPELVIADARYQGINALCMAVIDTQKAMPNKLTQAIDKIILN
FT                   RWLGVPIFLIVMYLMFVLAINIGGALQPIFDSGSIAIFIHGVQWLGHTLSFPEWLTVFL
FT                   AQGIGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQVLGLPGKSFVPLI
FT                   VGFGCNVPSIMGARTLDAPRERLITIMMAPFMSCGARLAIFAVFAAAFFGKNGATIVFS
FT                   LYILGIVVAILTGLMLKYTIMRGEASPFVMELPVYHIPHLKTLLLQAWQRLKGFVIRAG
FT                   KVIVIASMFIGALNSFSFSGQAVDSINESALASVSKAITPVLQPIGVHSDNWQATVGLI
FT                   TGAMAKEVVVGTLNTLYTAESITNEPFDADGFNLLGELKDAVNETWDSLKDTFTLSVLS
FT                   NPIEASKGDGEMDSGSMGTMSTKFGSAISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   TFSILWGLNVAYSISTLFYQMVTFSQHSQSSLIIILTVITFNALVFYFLRRARSRVTMK
FT                   LISNPGNNCHCSSGNCH"
FT   misc_feature    complement(order(161295..161354,161382..161450,
FT                   161469..161537,161925..161993,162096..162164,
FT                   162192..162260,162297..162365,162423..162491,
FT                   162510..162578,162621..162689))
FT                   /note="10 probable transmembrane helices predicted for
FT                   PAT2187 by TMHMM2.0 at aa 279-301, 316-338, 345-367,
FT                   387-409, 422-444, 454-476, 511-533, 663-685, 692-714 and
FT                   724-743"
FT   misc_feature    complement(161445..161987)
FT                   /note="HMMPfam hit to PF07670, Nucleoside recognition,
FT                   score 2e-16"
FT                   /inference="protein motif:Pfam:PF07670"
FT   misc_feature    complement(162000..162161)
FT                   /note="HMMPfam hit to PF07664, Ferrous iron transport
FT                   protein B C terminus, score 3.3e-24"
FT                   /inference="protein motif:Pfam:PF07664"
FT   misc_feature    complement(162168..162473)
FT                   /note="HMMPfam hit to PF07670, Nucleoside recognition,
FT                   score 6.3e-16"
FT                   /inference="protein motif:Pfam:PF07670"
FT   misc_feature    complement(162483..163058)
FT                   /note="HMMPfam hit to PF02421, Ferrous iron transport
FT                   protein B, score 2.6e-46"
FT                   /inference="protein motif:Pfam:PF02421"
FT   misc_feature    complement(163155..163514)
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 1.5e-39"
FT                   /inference="protein motif:Pfam:PF01926"
FT   CDS_pept        complement(163586..163810)
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="PAU_00152"
FT                   /old_locus_tag="PAT2188"
FT                   /product="ferrous iron transport protein a"
FT                   /note="iron(II) transport system (feo) which may make an
FT                   important contribution to the iron supply of the cell under
FT                   anaerobic conditions."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00152"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82245"
FT                   /db_xref="GOA:C7BGR6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82245.1"
FT                   /translation="MQLLPDHSYKIIGFSPKISPAYRQKLLSLGMLPGSSFHVVRLAPL
FT                   GDPIQIETRRVSLILRKKDLEFLTLDNAQ"
FT   misc_feature    complement(163595..163810)
FT                   /note="HMMPfam hit to PF04023, FeoA domain, score 4.2e-09"
FT                   /inference="protein motif:Pfam:PF04023"
FT   CDS_pept        complement(164054..166408)
FT                   /transl_table=11
FT                   /gene="yhgF"
FT                   /locus_tag="PAU_00153"
FT                   /old_locus_tag="PAT2189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00153"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82246"
FT                   /db_xref="GOA:C7BGR7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82246.1"
FT                   /translation="MKPIHQKKTHMNESLSQIIASELQAQPHQVLSAINLLDEGNTVPF
FT                   IARYRKEVTGGLDDTQLRQLDSRLGYLRELSDRRQTILKSIDEQGKLTPELAEAINGTL
FT                   SKTELEDLYLPYKPKRRTRGQIAIEAGLEPLADSLWQDPQQEPDLAAAAFVDTDKGVAD
FT                   TKTALDGARYILMERFAEDAALLAKVRDYLWKNAHLVAKVVTGKEEEGAKFRDYFEHHE
FT                   PVAQVPSHRALAMFRGRNEGILQLSLNADPQFDEPPKESYCEQIITQHLNLRLNNAPAD
FT                   SWRKAVVNWTWRVKVLLHLETELMSTLREKAEDEAIKVFARNLQDLLMAAPAGMRATMG
FT                   LDPGLRTGVKVAVVDATGKLIATDTIYPHTGQANKAAASVAALCIKHQVELVAIGNGTA
FT                   SRETERFFADIQKQFPEIKAQKVIVSEAGASVYSASELAAQEFPDLDVSLRGAVSIARR
FT                   LQDPLAELVKIDPKSIGVGQYQHDVSQTQLAKKLDAVVEDCVNAVGVDLNTASVPLLTK
FT                   VAGLTRMIAQNIVNWRDENGRFNNRAQLMKVNRLGPKAFEQCAGFLRINHGDNPLDAST
FT                   VHPEAYPVVEKILAATEQKLQELMGNPSSLRGLKPEDFTTEQFGVPTVSDILKELEKPG
FT                   RDPRPEFKTATFAEGVETMNDLRPGMVLEGSVTNVTNFGAFVDIGVHQDGLVHISSLSD
FT                   RFVADPHTVVKAGDIVKVKVLEVDLNRKRIALTMRLDEQPGETNSRRSSNPQADRRTER
FT                   NDRSRNTPRSPASAGNSAMSDALAAAFGKKR"
FT   misc_feature    complement(164222..164443)
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   3.2e-28"
FT                   /inference="protein motif:Pfam:PF00575"
FT   misc_feature    complement(164222..164437)
FT                   /note="HMMSmart hit to SM00316, no description, score
FT                   4.6e-26"
FT                   /inference="protein motif:Smart:SM00316"
FT   misc_feature    complement(165110..165403)
FT                   /note="HMMSmart hit to SM00732, no description, score
FT                   3.9e-37"
FT                   /inference="protein motif:Smart:SM00732"
FT   CDS_pept        complement(166684..166794)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00154"
FT                   /old_locus_tag="PAT2190"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00154"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82247"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR8"
FT                   /inference="similar to DNA sequence:INSD:BA000040"
FT                   /protein_id="CAQ82247.1"
FT                   /translation="MVCIWMRTILLAWNHKISRSAVNRVSSNDIGFQITY"
FT   CDS_pept        complement(166879..167352)
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="PAU_00155"
FT                   /old_locus_tag="PAT2191"
FT                   /product="transcription elongation factor greb (transcript
FT                   cleavage facto greb)"
FT                   /note="GreB promotes transcription elongation by
FT                   stimulating an endogenous, endonucleolytic transcript
FT                   cleavage activity of the RNA polymerase, allowing RNA
FT                   transcription to continue past template-encoded arresting
FT                   sites."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00155"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82248"
FT                   /db_xref="GOA:C7BGR9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGR9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82248.1"
FT                   /translation="MKTKLITREGYNKLKKELDYLWREERPEVTKKVTWAASLGDRSEN
FT                   ADYQYNKKRLREIDRRVRYLTKSLEELRCVDYSPQQDGKVFFGAWVEIENAQGEIKRFR
FT                   IVGYDEIFGRKDYISIDSPMARALLKKEVGDSVIVHTPTGEVMWYVNEIEYVK"
FT   misc_feature    complement(166888..167115)
FT                   /note="HMMPfam hit to PF01272, Prokaryotic transcription
FT                   elongation fact, score 1.1e-38"
FT                   /inference="protein motif:Pfam:PF01272"
FT   misc_feature    complement(167131..167352)
FT                   /note="HMMPfam hit to PF03449, Prokaryotic transcription
FT                   elongation fact, score 4e-40"
FT                   /inference="protein motif:Pfam:PF03449"
FT   CDS_pept        complement(167377..167598)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00156"
FT                   /old_locus_tag="PAT2192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00156"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82249"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS0"
FT                   /inference="similar to DNA sequence:INSD:BX571872"
FT                   /inference="similar to DNA sequence:INSD:BX571867"
FT                   /protein_id="CAQ82249.1"
FT                   /translation="MGDYRIQSWEQKVVLSPVLDLYNGEIIHTLWISRCIATARERIPG
FT                   SIANYVTGMSECSQQRGSLKDNGYIKAN"
FT   CDS_pept        167939..168655
FT                   /transl_table=11
FT                   /locus_tag="PAU_00157"
FT                   /old_locus_tag="PAT2193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00157"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82250"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS1"
FT                   /inference="similar to DNA sequence:INSD:CP000308"
FT                   /protein_id="CAQ82250.1"
FT                   /translation="MNQQDTNVSILAGNSRVYLDKDNEIVVEAQLKAFEAALLFSRQSQ
FT                   DKCGQLPRISMAFDHHGIFRLQFLTENLTNSQKRNPRLSHLHASIRNVFLPVAEKYQIP
FT                   LSEIRVIHEDSARQHLVHILASGEIPETVTRRMVSKNLADSKPPTSDASYEAPTQKLTC
FT                   AAITKEYFEKAAGDHKGQDAILEVFFEDCAWSRALAYVRGLQLSHMLGVSTAIRLNLVN
FT                   EEGDVSKGDIITAQQI"
FT   CDS_pept        168701..169882
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="PAU_00158"
FT                   /old_locus_tag="PAT2194"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="4.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00158"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82251"
FT                   /db_xref="GOA:C7BGS2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS2"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82251.1"
FT                   /translation="MYNLARPIYLDNNATTPLDPDVLQSMMPYFTNAYGNASSNNHVFG
FT                   WKAMEAVDDARQVISTSINATSHADIIFTSGATESNNLAIMGLQHRGKGGHVITSTIEH
FT                   KAVLDCCGRLESMGTEVTYLPPQSDGIVSPDSISRAIRDDTYLVSIMAANNEIGSIQKI
FT                   EEIGAICKARDIPLHTDATQALGKIEFDVQRMNVSLASFSAHKIYGPKGIGALYINSRD
FT                   KNISLTPLIVGGGHERGLRSGTLNVPGIVGFGRAVELSVKNLTAESMRLRYLRDLLRLY
FT                   IIENVADVRINGHLTECLPGLLNVSFNGIDADSLLLELSEVALSSGSACTSANRAPSHV
FT                   LKAIGVSDALAQASVRFGLGRFNNEDEIRYVCLRLEKAVNKLRSMAPKSFVTQ"
FT   misc_feature    168719..169630
FT                   /note="HMMPfam hit to PF00282, Pyridoxal-dependent
FT                   decarboxylase con, score 0.00035"
FT                   /inference="protein motif:Pfam:PF00282"
FT   misc_feature    168722..169813
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 1.9e-100"
FT                   /inference="protein motif:Pfam:PF00266"
FT   misc_feature    168836..169597
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
FT                   score 0.00018"
FT                   /inference="protein motif:Pfam:PF01212"
FT   CDS_pept        169905..171098
FT                   /transl_table=11
FT                   /locus_tag="PAU_00159"
FT                   /old_locus_tag="PAT2195"
FT                   /product="similarities with MFS transporter protein"
FT                   /note="MFS transporters are single-polypeptide secondary
FT                   carriers capable only of transporting small solutes in
FT                   response to chemiosmotic ion gradients"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00159"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82252"
FT                   /db_xref="GOA:C7BGS3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS3"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82252.1"
FT                   /translation="MRTMSALFLLFGTLFTAGGYGATFLISAYFRSQGGSDIDAGTTLG
FT                   VALVGTLIGVPLVGWFAGRLEASRLAALAALAMSCGYLLLGGFNGELSYIPRIAAFLIG
FT                   LGWGMFYISGPMALSERVTDADRGQWFTRFSAFQMAGICGSPILLATAVEQVGMPIRTT
FT                   FLFVGVVGILASLLLATFGIREPNGQQELSLRPWVKKITKIATSSAIRPIIMVGLGGGV
FT                   FSGMMSFQSSLVEGTRANASAFFAVHAATVVVSRLLLARRLSTMPRIPLVTVLMSCLIM
FT                   GILALLGMPVHPVFQIVAAMLTGIGYGLVYPVIQTWAVNDSALEDRHAALTWFVVAYFV
FT                   GIFGFPVIGGWILVSSGKLLFILVLAVIASLELVVALLGGRWFRRIKDGLTTQKEIR"
FT   sig_peptide     169905..169967
FT                   /locus_tag="PAU_00159"
FT                   /note="Signal peptide predicted for PAT2195 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.890 between residues 21 and 22"
FT   misc_feature    order(169923..169991,170034..170093,170112..170168,
FT                   170196..170255,170292..170360,170388..170456,
FT                   170514..170582,170625..170681,170715..170783,
FT                   170793..170861,170898..170966,170979..171047)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PAT2195 by TMHMM2.0 at aa 7-29, 44-63, 70-88, 98-117,
FT                   130-152, 162-184, 204-226, 241-259, 271-293, 297-319,
FT                   332-354 and 359-381"
FT   misc_feature    169929..170966
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 7.6e-23"
FT                   /inference="protein motif:Pfam:PF07690"
FT   CDS_pept        172454..173173
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="PAU_00160"
FT                   /old_locus_tag="PAT2196"
FT                   /product="transcriptional regulatory protein ompr"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82253"
FT                   /db_xref="GOA:C7BGS4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS4"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82253.1"
FT                   /translation="MQEGNKILVVDDDMRLRTLLERYLTEQGFQVRSAANAEQMDRLLT
FT                   RESISLIVLDLMLPGEDGLSVCQRLRNQNNSVPIIMVTARGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANKLLGVPTEDDAIINFGKFSLNLSTREMFQGDEHIPLTS
FT                   GEFSVLKVLVSYPSVPLSRNKLMNLALGREYSTMKRSIDVLISRLRRVIEEDPAHPRYI
FT                   QTIWGLGYVFVPDGSCV"
FT   misc_feature    172466..172804
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.1e-39"
FT                   /inference="protein motif:Pfam:PF00072"
FT   misc_feature    172466..172801
FT                   /note="HMMSmart hit to SM00448, no description, score
FT                   2.5e-45"
FT                   /inference="protein motif:Smart:SM00448"
FT   misc_feature    172919..173149
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 4.6e-15"
FT                   /inference="protein motif:Pfam:PF00486"
FT   CDS_pept        173170..174501
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="PAU_00161"
FT                   /old_locus_tag="PAT2197"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82254"
FT                   /db_xref="GOA:C7BGS5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS5"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82254.1"
FT                   /translation="MKLLRFSPRSTFTRTLFLIMAILFISLVSSYLVVVNFVIMPSLQQ
FT                   FNKVLAYEVRTLMAEKLKLEDGSFLVISPIVRREIYQELGITLYSESDAEMQGLRWARH
FT                   YDFLSEKMSQYLGGEADLRLEISKDTPILWLNSYLAPDIWVRVPLTEIEQNQFSPIFRY
FT                   ILAILLLTVGCIWLYIRFQNRPLLEMEYAARQTGKGIMMPAVREAGSQEVRASIRAFNQ
FT                   MSAGIKLLESDRTILMAGVSHDLRTPLTRIRLATEMMSKEDAYLSESINKDIEECNAII
FT                   EQFIDYLRTGQEMPMEFCELNSILKEVISAENGYEQDIENNLSLNPITVNANPISIKRA
FT                   LANMLVNANRYGNGWIKVSSGQTNKFAWFQVEDNGAGIKQEDLPRLFQPFVRGERARSN
FT                   SGTGLGLAIVQRIIDAHEGKIEVGTSPRGGLSIRACIPVVEDNF"
FT   sig_peptide     173170..173271
FT                   /gene="envZ"
FT                   /locus_tag="PAU_00161"
FT                   /note="Signal peptide predicted for PAT2197 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.590 between residues 34 and 35"
FT   misc_feature    order(173212..173280,173647..173706)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2197 by TMHMM2.0 at aa 15-37 and 160-179"
FT   misc_feature    173647..173856
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 0.0038"
FT                   /inference="protein motif:Pfam:PF00672"
FT   misc_feature    173866..174048
FT                   /note="HMMSmart hit to SM00388, no description, score
FT                   3.4e-11"
FT                   /inference="protein motif:Smart:SM00388"
FT   misc_feature    174163..174489
FT                   /note="HMMSmart hit to SM00387, no description, score
FT                   3.8e-27"
FT                   /inference="protein motif:Smart:SM00387"
FT   misc_feature    174163..174486
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 8.2e-32"
FT                   /inference="protein motif:Pfam:PF02518"
FT   CDS_pept        174514..175722
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="PAU_00162"
FT                   /old_locus_tag="PAT2198"
FT                   /product="phosphate-binding periplasmic protein psts"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00162"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82255"
FT                   /db_xref="GOA:C7BGS6"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82255.1"
FT                   /translation="MTVLCQSQTESHFAVIKMSYLRHFAVTKLTYFLLGTLFNLTKYIP
FT                   LLILNIPLGGIMKLMRTTVVSVMVATFSLTTLSVFATTSLTGAGATFPAPVYAKWADSY
FT                   QKETGNKVNYQGIGSSGGVKQILANTVDFGASDAPLSDEKLAADGLFQFPTVIGGVVLA
FT                   VNIPGIKSGELTLDGKTLGDIYLGKVKKWNDPAITKLNPGVKLPEQDIAVVRRADGSGT
FT                   SFVFTNYLSKVNEEWKEKVGVGSTVSWPVGLGGKGNDGIAAFVQRLTGSIGYVEYAYAK
FT                   QNHLAYTKLVSADGNVVSPTEVSFSAAARKAAWHKTFAQDLTNQSGEHAWPITSTTFIL
FT                   VHKQQKDSVKGAEVLKFFDWTYENGSKQANDLDYATLPKEVVEQVRAAWKTHVKDSSGK
FT                   ALY"
FT   misc_feature    order(174598..174666,174703..174771)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2198 by TMHMM2.0 at aa 29-51 and 64-86"
FT   misc_feature    174706..175617
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 8.3e-31"
FT                   /inference="protein motif:Pfam:PF01547"
FT   CDS_pept        175931..176902
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="PAU_00163"
FT                   /old_locus_tag="PAT2199"
FT                   /product="phosphate transport system permease protein pstc"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00163"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82256"
FT                   /db_xref="GOA:C7BGS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82256.1"
FT                   /translation="MRISSMAEQKTAIKAPSKNGDLIFSALVRLAALITLFLLGGIIIS
FT                   LIIASWPSIQQFGIAFLWHKEWDVPTEQFGALVPIYGTLVTSLIALIIAVPVSFGIALF
FT                   LTELAPNWLKRPLGVAIELLAAIPSIVYGMWGLFVFAPLFATYFQQPVGHILSSIPVVG
FT                   ELFSGPAFGIGILAAGVILAIMIIPYIASVMRDVFEQTPVMMKESAYGIGCTTWEVIWH
FT                   IVLPYTRNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSFSLFMPGNSITSALANEFA
FT                   EAESGLHTAALMELGLILFVITFIVLALSKLMIMRLAKDEGR"
FT   misc_feature    order(176009..176077,176177..176245,176279..176347,
FT                   176441..176509,176624..176692,176789..176857)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PAT2199 by TMHMM2.0 at aa 27-49, 83-105, 117-139, 171-193,
FT                   232-254 and 287-309"
FT   misc_feature    176168..176887
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 6.7e-14"
FT                   /inference="protein motif:Pfam:PF00528"
FT   CDS_pept        176904..177788
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="PAU_00164"
FT                   /old_locus_tag="PAT2200"
FT                   /product="phosphate transport system permease protein psta"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00164"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82257"
FT                   /db_xref="GOA:C7BGS8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:BA000007"
FT                   /protein_id="CAQ82257.1"
FT                   /translation="MAIMDGQQPVNVDARSRKQAWRRHKNRLALLLSMATMLFGLFWLV
FT                   WILFSTVTKGFDGMSLALFTEMTPPPNTAGGGLANAIVGSGLLILWATIIGTPLGIMAG
FT                   IYLAEYGRRSWLAEVIRFINDILLSAPSIVVGLFVYTVIVMKMQHFSGWAGVIALALLQ
FT                   VPIVIRTTENMLKLVPDSLREAAYALGTPKWKMISAITLKASVSGIITGVLLAIARIAG
FT                   ETAPLLFTSLSNQFWSTDLSQPIANLPVTIFKFAMSPFSEWQQLAWAGVLLITLCVLLI
FT                   NIVARVLFAKKKH"
FT   misc_feature    order(176985..177053,177162..177230,177267..177335,
FT                   177348..177407,177501..177569,177702..177770)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PAT2200 by TMHMM2.0 at aa 28-50, 87-109, 122-144, 149-168,
FT                   200-222 and 267-289"
FT   misc_feature    177147..177785
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.8e-38"
FT                   /inference="protein motif:Pfam:PF00528"
FT   CDS_pept        177815..178591
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="PAU_00165"
FT                   /old_locus_tag="PAT2201"
FT                   /product="phosphate import ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00165"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82258"
FT                   /db_xref="GOA:C7BGS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGS9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82258.1"
FT                   /translation="MSRVNDIAGSKIQVHNLNFYYGKFHALKNITLNIAKNKVTAFIGP
FT                   SGCGKSTLLRTFNKMYELYGEQRAEGEILLDGNNILMDKQDVALLRAKVGMVFQKPTPF
FT                   PMSIYDNIAFGVRLFEKLSRAEMDERVQWALTKAALWNETKDKLYQSGYSLSGGQQQRL
FT                   CIARGIAIRPEVLLLDEPCSALDPISTGRIEELISELKSEYTVVIVTHNMQQAARCSDH
FT                   TAFMYLGELIEFSDTDTLFTTPKKKQTEDYITGRYG"
FT   misc_feature    177920..178528
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   2.9e-10"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    177923..178501
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2e-68"
FT                   /inference="protein motif:Pfam:PF00005"
FT   CDS_pept        178588..179325
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="PAU_00166"
FT                   /old_locus_tag="PAT2202"
FT                   /product="phosphate transport system protein phou"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00166"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82259"
FT                   /db_xref="GOA:C7BGT0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82259.1"
FT                   /translation="MITGRNMDNLNLNKHISGQFNAELEHIRTELMAMGGLVEEQLCKA
FT                   INAMHNQDAALAREVIEGDHRVNMMEVAIDEACVRIIAKRQPTASDLRLIMSISKTIAE
FT                   LERIGDVAKKICQTALEKFSHQHQPLLVSLESLGRHTIQMLHDVLDAFARMDLEEAIRI
FT                   YHEDKKVDKEYEGIVRQLMTYMMEDSRTIPSVLIALLCARSIERIGDRCQNICEFIFYY
FT                   VKGQDFRHVGGDELERLLTKENK"
FT   misc_feature    178678..178944
FT                   /note="HMMPfam hit to PF01895, PhoU family, score 1.9e-31"
FT                   /inference="protein motif:Pfam:PF01895"
FT   misc_feature    178987..179244
FT                   /note="HMMPfam hit to PF01895, PhoU family, score 8.4e-29"
FT                   /inference="protein motif:Pfam:PF01895"
FT   CDS_pept        179578..180441
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="PAU_00167"
FT                   /old_locus_tag="PAT2203"
FT                   /product="putative periplasmic binding transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00167"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82260"
FT                   /db_xref="GOA:C7BGT1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82260.1"
FT                   /translation="MINYHQECSMKSRVLVTALLAGLALVTGVAKADKLDDIKKAGTVR
FT                   IAVFDSNPPFGFIDPQTKKLAGYDVDIANAIANDLGVKLELRPTNPANRLPLLASKKID
FT                   LIAANFTVTDERAKQVDFSIPYFATGQKFIARKGVLKSPEDIKNLRIGADKGTVQEITL
FT                   REHYPTAKVISYDDTPLAFAALRNGNVQAITQDDAKLVGLLANVPAAQKAEFEISPFSI
FT                   TREYQAVAAAKGEGRLVEVVNQTLLKLEKEGEAEKIYNHWFGPDTKSAQPRGDFKFAPL
FT                   EQQAKF"
FT   sig_peptide     179578..179673
FT                   /gene="fliY"
FT                   /locus_tag="PAU_00167"
FT                   /note="Signal peptide predicted for PAT2203 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.910 between residues 32 and 33"
FT   misc_feature    179614..179667
FT                   /note="1 probable transmembrane helix predicted for PAT2203
FT                   by TMHMM2.0 at aa 13-30"
FT   misc_feature    179704..180375
FT                   /note="HMMSmart hit to SM00062, no description, score
FT                   1.9e-68"
FT                   /inference="protein motif:Smart:SM00062"
FT   misc_feature    179707..180372
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 3.1e-71"
FT                   /inference="protein motif:Pfam:PF00497"
FT   misc_feature    179710..180372
FT                   /note="HMMSmart hit to SM00079, no description, score
FT                   0.0045"
FT                   /inference="protein motif:Smart:SM00079"
FT   CDS_pept        180510..181247
FT                   /transl_table=11
FT                   /locus_tag="PAU_00168"
FT                   /old_locus_tag="PAT2204"
FT                   /product="similar to amino acid permease component of abc
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00168"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82261"
FT                   /db_xref="GOA:C7BGT2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82261.1"
FT                   /translation="MFELFVTEHLLAPQYLEWLWQGFLITLWISFCTVVASTLLGFLLA
FT                   AARDSQLKILRWPVTAYTTLFRNTPLLVQLFFWYFASGQILPQDVMLWLNTPHEINLLG
FT                   LPLSWPSFEFLAGFIGLTLYSAPFVAEELRAGIQGIGRGQKYAAHALGLTGWQAMRYVV
FT                   LPQALKIAMPPLLGQYMNIVKNSSLTMAIGVAELSYASRQVETETLKTFEAFGVATVLY
FT                   IATIAVMEGWGQWRQQQAIARGH"
FT   misc_feature    180564..181235
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.7e-16"
FT                   /inference="protein motif:Pfam:PF00528"
FT   misc_feature    order(180573..180641,180702..180770,180828..180896)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2204 by TMHMM2.0 at aa 22-44, 65-87 and 107-129"
FT   CDS_pept        181249..181992
FT                   /transl_table=11
FT                   /locus_tag="PAU_00169"
FT                   /old_locus_tag="PAT2205"
FT                   /product="similar to amino acid permease component of abc
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00169"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82262"
FT                   /db_xref="GOA:C7BGT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT3"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to AA sequence:UniProt:Q0W9S8"
FT                   /protein_id="CAQ82262.1"
FT                   /translation="MDFSVIAENWRYLLFGTFPDGPLEGAALTLVISLIAGVISIVLGT
FT                   VAGVALAMQKGFWVNLLAAVLGFFRAIPVIMLIFWTYFLLPVMLGMEIPEITTVVCALA
FT                   LITSAYLAHGVKAGIIAIGAGQWQAGLSLGFNRWQVLWYIVLPQALRMMVPSFINQWIA
FT                   LIKDTSLAYIVGVAELSFLATQVNNRSMVYPTEVFLFVAFIYFVMCLTLELAANYIARR
FT                   FSLQRRKIPFFRFWRKEKLVLAPQL"
FT   misc_feature    181312..181923
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.5e-20"
FT                   /inference="protein motif:Pfam:PF00528"
FT   misc_feature    order(181327..181395,181414..181482,181525..181593,
FT                   181729..181797,181840..181908)
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2205 by TMHMM2.0 at aa 27-49, 56-78, 93-115, 161-183 and
FT                   198-220"
FT   CDS_pept        182111..182263
FT                   /transl_table=11
FT                   /gene="yieG"
FT                   /locus_tag="PAU_00170"
FT                   /old_locus_tag="PAT2206"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82263"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT4"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /inference="similar to DNA sequence:INSD:CP000026"
FT                   /protein_id="CAQ82263.1"
FT                   /translation="MILFNLLIIHLVFQLQRHCAWFYRVLCHESSPCVVVTLLFVLKMV
FT                   FVDAH"
FT   CDS_pept        182341..182847
FT                   /transl_table=11
FT                   /locus_tag="PAU_00171"
FT                   /old_locus_tag="PAT2207"
FT                   /product="transposase, orfa, is3/is911 family"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82264"
FT                   /db_xref="GOA:C7BGT5"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT5"
FT                   /inference="similar to DNA sequence:INSD:CP000082"
FT                   /inference="similar to DNA sequence:INSD:AAAK03000003"
FT                   /protein_id="CAQ82264.1"
FT                   /translation="MSKYSRELKIIIAKRCLAGNTSDKLSAEYSISSRQIRYWAQVVAI
FT                   HGDNAFLPTSHSLCAVTKFQALKLMWTHDWSLTHTSAVLNLTTPGTLSVWLDKYNETGI
FT                   KGLESHQRGRPPMKSRPKTPPKSDDKMTVEELKEELAYLRAENAVLKKLEELEQKKRPL
FT                   AKKKR"
FT   CDS_pept        182916..183689
FT                   /transl_table=11
FT                   /gene="insK"
FT                   /locus_tag="PAU_00172"
FT                   /old_locus_tag="PAT2208"
FT                   /product="putative transposase InsK for insertion sequence
FT                   element IS150"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00172"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82265"
FT                   /db_xref="GOA:C7BGT6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT6"
FT                   /inference="similar to DNA sequence:INSD:BX664015"
FT                   /inference="similar to DNA sequence:INSD:U00039"
FT                   /protein_id="CAQ82265.1"
FT                   /translation="MFYYQCQALKKTRAYEQEIEMIKTIYHEHKGRYGYRRIHLALRKN
FT                   GFKINHKTVQRLMGQLNLKSTVRPKKYRSYRGEVGKTAPNWLARDFRATKPNEKWVTDV
FT                   TEFKVNEQKVYLSPIIDLFNQEVIAYNVAKKASLPLVTEMLKGALDGLDAHSKPLIHSD
FT                   QGWQYRHRAYQKQLADKDIKQSMSRKGNCLDNAMAENFFALLKTEMYHQQHFKSADELI
FT                   EKIEEYIEYYNTKRIKVKLKGLTPIEYRNQALHAV"
FT   misc_feature    183189..183668
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   2.2e-42"
FT                   /inference="protein motif:Pfam:PF00665"
FT   CDS_pept        complement(183750..185213)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00173"
FT                   /old_locus_tag="PAT2209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00173"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82266"
FT                   /db_xref="GOA:C7BGT7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AP008232"
FT                   /protein_id="CAQ82266.1"
FT                   /translation="MPIFDTSSHKSVYWWVAGYAFLWIIVSYSFDPTVPYDAVEALNWG
FT                   KNGEWGSPKNPWLVGAMMLPAIYISGISLSFYWYFIHFIAIAIGLLGVWHLAFRLTGKK
FT                   ELAWLAMLTLNLSGIINFDIIPYNDNYLLIMLWPWTMLFFLRAVYDNPRWWLVFALCSG
FT                   LATMGKYSTLALVGSIFLLTLFVPKVRQCYRQPALYIALIIWFMLVLPNVWWLWNNDFA
FT                   AFKWVDSQIDSGFNLHTTRSLLSVFYPLIIVSTVIYALGGRISWPKEQPNRLVNIAILL
FT                   PLLIIYCWFSFNEGGRMTEWLQPFMSVASALLVGSITRFPQKSLRSTLQGLTVVAILVW
FT                   MGYVLIMVANVRGAGHKFEGIKDFSWQLEQRWHQLYPTPLHYVGGEYLHQWLTFYAPSQ
FT                   PETIQPWTLEGQAPNIYNRHVKESDIVRDGTILVGAKGKTCEQEDFHGVLQDWPILRIN
FT                   STDEFLFQPEPETQPTPVCVGFVSPEKYQ"
FT   misc_feature    complement(order(184161..184229,184335..184394,
FT                   184428..184487,184563..184622,184656..184724,
FT                   184767..184820,184839..184892,184920..184988,
FT                   184992..185045,185112..185180))
FT                   /note="10 probable transmembrane helices predicted for
FT                   PAT2209 by TMHMM2.0 at aa 12-34, 57-74, 76-98, 108-125,
FT                   132-149, 164-186, 198-217, 243-262, 274-293 and 329-351"
FT   CDS_pept        185406..185918
FT                   /transl_table=11
FT                   /gene="yihI"
FT                   /locus_tag="PAU_00174"
FT                   /old_locus_tag="PAT2210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00174"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82267"
FT                   /db_xref="GOA:C7BGT8"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82267.1"
FT                   /translation="MNQLKKKAPARASAGKQKRKSREELNAEGRARKRQKKHRGNPAGS
FT                   RHQERSSDKHQSSRKQSDPRLGSKVPVPLIIGEQPTKPVATKPKTEIKPRISPQEELAM
FT                   LESDDRLDALLERLENGEKLSQEENTYVDTTLDRIDALMEELGIKLDEEESEEEKQDDI
FT                   MQLLKGN"
FT   misc_feature    185418..185915
FT                   /note="HMMPfam hit to PF04220, Protein of unknown function,
FT                   DUF414, score 6.3e-46"
FT                   /inference="protein motif:Pfam:PF04220"
FT   CDS_pept        186112..187485
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="PAU_00175"
FT                   /old_locus_tag="PAT2211"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82268"
FT                   /db_xref="GOA:C7BGT9"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGT9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82268.1"
FT                   /translation="MSEQAIVWDLPLIQKYNYSGPRYTSYPTALEFNQQYDNAAFMQAA
FT                   VLYPERPLSLYIHIPFCHKLCYFCGCNKLITRQKHKVDQYLQLLEREIRERSKLFSGRK
FT                   VSQMHWGGGTPTYLDKDQISKLMGVLRDHFDFLPDAEISIEIDPREIELDMIDHLHHQG
FT                   FNRLSMGVQDFNKEVQRLVNREQDEDFIFALVARARETGFNSTSIDLIYGLPKQTSESF
FT                   AFTLERVLALAPDRMSIFNYAHLPNLFAAQRKIKEHDLPSAEQKLDILQQTIATLTGSG
FT                   YQFIGMDHFARPDDELAVAQREGKLHRNFQGYTTQGDCDLLGIGVSAISLLGDSYSQNQ
FT                   KELKTYYVELEKQGHALWRGLTLSQDDCIRRDVIKALICNFRLNFANIEQQYGLNFTHY
FT                   FAEDLQLLVPLAEDGLVEVNEKRIQVMPRGRLLIRNICMCFDIYLRHQVRLRQFSSVI"
FT   misc_feature    186265..186927
FT                   /note="HMMSmart hit to SM00729, no description, score
FT                   7.6e-53"
FT                   /inference="protein motif:Smart:SM00729"
FT   misc_feature    186277..186798
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 1.2e-23"
FT                   /inference="protein motif:Pfam:PF04055"
FT   misc_feature    187042..187404
FT                   /note="HMMPfam hit to PF06969, HemN C-terminal region,
FT                   score 1.4e-51"
FT                   /inference="protein motif:Pfam:PF06969"
FT   CDS_pept        complement(188416..188760)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00176"
FT                   /old_locus_tag="PAT2211A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00176"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82269"
FT                   /db_xref="GOA:C7BGU0"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGU0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82269.1"
FT                   /translation="MIKLCSIIFGVIIFYSLFVGMMQVLLINFYIFRDYFGWWEIPAKV
FT                   SATIASVYVFYLLFNFLPLIIVIFICSLAIVVNVWHWSLWTSIFIFIWPVIVVFLYCIL
FT                   TKRLKYNTSD"
FT   CDS_pept        complement(189489..190949)
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /locus_tag="PAU_00177"
FT                   /old_locus_tag="PAT2212"
FT                   /product="nitrogen regulation protein nr(i)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00177"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82270"
FT                   /db_xref="GOA:C7BGU1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGU1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82270.1"
FT                   /translation="MTMQPGKIWIVDDDNSIRWVLERALSSTGMECSCFTDADSVLTAL
FT                   AQNTPDVLISDIRMPGMNGLNLLNNIKQSNPLLPVIIMTAHSDLDAAVSAYQQGAFDYL
FT                   PKPFDIDEAVALMERALSHSREQNQPTRNPQAVTPVSDMIGEAPAMQDVYRIIGRLSRS
FT                   SISVLINGESGTGKELVAHALHRHSPRANQPFIALNMAAIPKDLIESELFGHEKGAFTG
FT                   ANQVRHGRFEQANHGSLFLDEIGDMPLDIQTRLLRVLAEGQFYRIGGYAPVKVDVRIIA
FT                   ATHQDLERLVQKGKFREDLYHRLNVIRMQLPPLRDRVEDIPRLTRHFLQQTAKELGVET
FT                   KILHPDAEMALMRLPWPGNVRQLENICRWLTVMAASQEILVQDLPSELFELHRTETGTT
FT                   IPVNTILTSPTPINTMQETWPQLLTHWATNALENGQQDLLSEALPLLERTLLNCALKHT
FT                   KGHKQEAARLLGWGRNTITRKLKELGLE"
FT   misc_feature    complement(189501..189623)
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis fam, score 2.3e-13"
FT                   /inference="protein motif:Pfam:PF02954"
FT   misc_feature    complement(189858..190523)
FT                   /note="HMMPfam hit to PF00158, Sigma-54 interaction domain,
FT                   score 3.1e-145"
FT                   /inference="protein motif:Pfam:PF00158"
FT   misc_feature    complement(190014..190454)
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various, score 0.00055"
FT                   /inference="protein motif:Pfam:PF07728"
FT   misc_feature    complement(190032..190463)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   3.8e-12"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(190596..190934)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.2e-36"
FT                   /inference="protein motif:Pfam:PF00072"
FT   misc_feature    complement(190599..190934)
FT                   /note="HMMSmart hit to SM00448, no description, score
FT                   6.9e-35"
FT                   /inference="protein motif:Smart:SM00448"
FT   CDS_pept        complement(190953..192002)
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="PAU_00178"
FT                   /old_locus_tag="PAT2213"
FT                   /product="nitrogen regulation protein nr(II)"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00178"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82271"
FT                   /db_xref="GOA:C7BGU2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7BGU2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82271.1"
FT                   /translation="MKTENLPDTGQILNSLINSVLVLDTDLVIRYANHSALQLLAQSAR
FT                   KLFGTPLPVLFSYFSLDTELMRSSLVSGQSFTDNEVTLVVDNRSHIMSLSAQPISEQFI
FT                   LLELAPMDSQRRLSQEQVQQAQQIAARELVRGLAHEIKNPLGGLRGAAQLLSRALPDPA
FT                   LQEYTQVIIEQADRLRHLVDRLLGPQHPGEQIKQSIHYVAERVYQLVSLEMPDNVTLIK
FT                   DYDPSLPELAHYPDQIEQVLLNITRNALQALGKQGGSITLRTRTAFQITLHGKRYRLAA
FT                   RIDVADNGPGIPPQIQDTLFYPMVSAHEGGTGLGLSIARNLIDQHSGKIEFTSWPGHTE
FT                   FSIYLPIKK"
FT   misc_feature    complement(190956..191306)
FT                   /note="HMMSmart hit to SM00387, no description, score
FT                   3.7e-30"
FT                   /inference="protein motif:Smart:SM00387"
FT   misc_feature    complement(190959..191306)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 3.3e-28"
FT                   /inference="protein motif:Pfam:PF02518"
FT   misc_feature    complement(191421..191618)
FT                   /note="HMMSmart hit to SM00388, no description, score
FT                   1.6e-15"
FT                   /inference="protein motif:Smart:SM00388"
FT   misc_feature    complement(191670..191984)
FT                   /note="HMMPfam hit to PF00989, PAS fold, score 0.0038"
FT                   /inference="protein motif:Pfam:PF00989"
FT   misc_feature    complement(191778..191984)
FT                   /note="HMMSmart hit to SM00091, no description, score
FT                   0.00059"
FT                   /inference="protein motif:Smart:SM00091"
FT   misc_feature    192091..229242
FT                   /note="mGOT9n"
FT   CDS_pept        complement(192160..193569)
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="PAU_00179"
FT                   /old_locus_tag="PAT2214"
FT                   /product="glutamine synthetase (glutamate--ammonia ligase)"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00179"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82272"
FT                   /db_xref="GOA:B6VM09"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM09"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82272.1"
FT                   /translation="MSAEHVLTMIEEHQVKFIDLRFTDTKGKEQHMTIPAHQVNADFFE
FT                   DGKMFDGSSIGGWKGINESDMVLMPDPSTAMLDPFFDDATLILRCDILEPGTMQGYDRD
FT                   PRSISKRAEDFLRSSGIADTVLCGPEPEFFLFDDVRFGSSMSGSYYHIDDIEAAWNSGT
FT                   RYEGGNKGHRPAVKGGYAPMPPVDSSQDLRSAMCLTMEEMGLVVEAHHHEVGTAGQNEI
FT                   ATRFNTMTKKADETQIYKYVVHNVAHNFGKTATFMPKPLVGDNGSGMHCHMSLSKNGTN
FT                   LFAGDKYGGLSELALFYIGGIIKHARALNAFTNPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASTKARRIEIRFPDPAANPYLAFAAQLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEAKEIPTVASSLDEALAALDTDREFLTRGGVFTDDAIDAYIELKNSEMERVRLTP
FT                   HPLEFELYYSV"
FT   misc_feature    complement(192421..193266)
FT                   /note="HMMPfam hit to PF00120, Glutamine synthetase,
FT                   catalytic domain, score 6.9e-171"
FT                   /inference="protein motif:Pfam:PF00120"
FT   misc_feature    complement(193285..193530)
FT                   /note="HMMPfam hit to PF03951, Glutamine synthetase,
FT                   beta-Grasp domain, score 2.6e-47"
FT                   /inference="protein motif:Pfam:PF03951"
FT   CDS_pept        193977..195818
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="PAU_00180"
FT                   /old_locus_tag="PAT2215"
FT                   /product="gtp-binding protein typa/bipa (tyrosine
FT                   phosphorylated protein a)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82273"
FT                   /db_xref="GOA:B6VM10"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM10"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82273.1"
FT                   /translation="MPEAKFVIEKLRNIAIIAHVDHGKTTLVDKLLQQSGTFGDRATAT
FT                   ERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLL
FT                   VDAMDGPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQ
FT                   LDFPIIYASALMGIAGTDHEDMAEDMTPLYQAIVDHVEPPKVDLNGAFQMQISQLDYNN
FT                   YVGVIGIGRIKRGTVKPNQNVTIIDSEGKTRNGKVGKVLGHLGLERIESEQAEAGDIIA
FT                   ITGLGELNISDTLCDTNAVEALPPLAVDEPTVSMYFCVNTSPFCGREGKYVTSRQILER
FT                   LKKELVHNVALRVEETEDPDAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREID
FT                   GRKQEPFEQVTLDIEEQHQGDVMQALGERKADLRDMLPDGKGRVRLDYVIPSRGLIGFR
FT                   TEFMTMTSGTGLLYATFSHYDDIRPGEIGRRQNGVMISNGQGKAVAYALYSLQDRGKLF
FT                   LGHGAEVYEGQVIGIHSRSNDLTVNCLTGKKLTNVRASGTDEATTLSPHIKKTLEQALE
FT                   FIDDDELVEVTPVSIRLRKRYLTENERRRAYRSKEAS"
FT   misc_feature    194001..194588
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 7.3e-72"
FT                   /inference="protein motif:Pfam:PF00009"
FT   misc_feature    194649..194861
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 1e-14"
FT                   /inference="protein motif:Pfam:PF03144"
FT   misc_feature    195177..195443
FT                   /note="HMMPfam hit to PF00679, Elongation factor G
FT                   C-terminus, score 1.4e-17"
FT                   /inference="protein motif:Pfam:PF00679"
FT   CDS_pept        complement(195887..196456)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00181"
FT                   /old_locus_tag="PAT2216"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82274"
FT                   /db_xref="GOA:B6VM11"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM11"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014613"
FT                   /protein_id="CAQ82274.1"
FT                   /translation="MNQVLATKQNTSYGMIFNIIGLFGISAALTVAFYYQLVLSELPCP
FT                   LCLLQRTGMIMIGFGFLFNLRFGIKSAHYGIALIGCIVTGIIAIRQVFLHILPGDIGYG
FT                   SALFGIHFYTWALLSSVIAIIAISVMLILKSLEKTTEEKGNTPVFGQILIGFFVLLITA
FT                   NLISTVLECGGGQCDDNPTFYQLLGK"
FT   misc_feature    complement(order(195947..196015,196049..196117,
FT                   196175..196243,196262..196315,196352..196420))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2216 by TMHMM2.0 at aa 13-35, 48-65, 72-94, 114-136 and
FT                   148-170"
FT   CDS_pept        complement(197345..198799)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00182"
FT                   /old_locus_tag="PAT2217"
FT                   /product="carbon starvation protein csta"
FT                   /note="carbon starvation protein CstA is a predicted
FT                   membrane protein. It has been suggested that CstA is
FT                   involved in peptide utilization ."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00182"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82275"
FT                   /db_xref="GOA:B6VM12"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM12"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AALS01000038"
FT                   /protein_id="CAQ82275.1"
FT                   /translation="MLWFILCIALLLAGYFIYGKLIEKIFAIRPERKTPAISMADGVDY
FT                   VAMSTPKVWLIQLLNIAGVGPIFGPILGALYGPLAMLWIVFGCIFAGAVHDYFSGMLSV
FT                   RARGASVPVIVGNELGKTMKHFMNIFAVILLMLVGVVFVLSPAGLLNNLFKDSIGWDNI
FT                   GIWVGVIFAYYILATLVPIDKIIGRLYPLFGALLLFMSVALIVGLVMSDKPFYSQGLDF
FT                   TTNFNPKDLPVWPLLFVTIACGAISGFHATQSPLMARCMQNEKNGRFVFYGAMIGEGII
FT                   ALIWCTLGLSFYEDTNALQAVIDKGTASLVVHEVSTSLLGTVGGILAILGVVILPITSG
FT                   DTAFRSARLIIAEFLDIPQQKMIKRLLLSVPMFIVGYLITKTDFNIIWRYFGWANQTTA
FT                   MVMLWAASAWLLRRDKFHWITTLPAMFMTAVCFTYLAFAPEGFALNWNTSVIIGLSAMA
FT                   VVTIVFFAKVRSKSVSNNIETEAFNE"
FT   misc_feature    complement(order(197405..197473,197486..197554,
FT                   197567..197626,197636..197704,197789..197857,
FT                   197927..197995,198053..198109,198167..198235,
FT                   198254..198313,198356..198424,198497..198565,
FT                   198575..198643,198734..198790))
FT                   /note="13 probable transmembrane helices predicted for
FT                   PAT2217 by TMHMM2.0 at aa 4-22, 53-75, 79-101, 126-148,
FT                   163-182, 189-211, 231-249, 269-291, 315-337, 366-388,
FT                   392-411, 416-438 and 443-465"
FT   misc_feature    complement(197828..198799)
FT                   /note="HMMPfam hit to PF02554, Carbon starvation protein
FT                   CstA, score 1.5e-79"
FT                   /inference="protein motif:Pfam:PF02554"
FT   CDS_pept        198951..199562
FT                   /transl_table=11
FT                   /gene="yihX"
FT                   /locus_tag="PAU_00183"
FT                   /old_locus_tag="PAT2218"
FT                   /product="conserved hypothetical protein"
FT                   /note="deleted EC_number 3.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00183"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82276"
FT                   /db_xref="GOA:B6VM13"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM13"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82276.1"
FT                   /translation="MVMLYILDMGNVIIDIDFKRVLAVWSNLSGTPLATLTKSFSMGEM
FT                   FEKHERGQITDLEFADTLCQEMSISLSFEQFTAGWQAIFIDIRPEVIQIMEKLREAGHR
FT                   VVVLSNTNRLHQDYWPHNYPEIAASADYLYLSQDLAMRKPEPDIFKYVLEKEGFSPDQA
FT                   VFFDDVLENVEAASALGIKGIHVVDRQTVPDYFKEIGFSE"
FT   misc_feature    198954..199517
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 3.6e-17"
FT                   /inference="protein motif:Pfam:PF00702"
FT   CDS_pept        199627..200064
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="PAU_00184"
FT                   /old_locus_tag="PAT2219"
FT                   /product="d-tyrosyl-tRNA(tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00184"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82277"
FT                   /db_xref="GOA:B6VM14"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM14"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82277.1"
FT                   /translation="MIALIQRVTQANVVIENEIVGEIGHGLLVLLGVEKEDDQQKAKRL
FT                   CEKVIGYRIFNDEQDKMNLNVQQVGGSLLVVSQFTLAADTQKGMRPSFSGGASPDKADE
FT                   LYRYFVERCRQSGVKTESGRFAADMKVSLINNGPVTFWLQV"
FT   misc_feature    199708..200061
FT                   /note="HMMPfam hit to PF02580, D-Tyr-tRNA(Tyr) deacylase,
FT                   score 8.4e-78"
FT                   /inference="protein motif:Pfam:PF02580"
FT   CDS_pept        200136..201053
FT                   /transl_table=11
FT                   /gene="yiiD"
FT                   /locus_tag="PAU_00185"
FT                   /old_locus_tag="PAT2220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00185"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82278"
FT                   /db_xref="GOA:B6VM15"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM15"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82278.1"
FT                   /translation="MYHLRVPETEQELEAYYRFRWEMLRKPLNQPVGSEKDGYDTMAHH
FT                   QMVVDEKGNPVAVGRLYINADSEGAIRFLAVHPHVQGKGLGKLIAMALESVARQEGVKR
FT                   VVCSAREYAVDFFSKLGFENRGPITSPQTTPVRHFLMIKPVATLDDILHRPDWCNELQK
FT                   AWYKYIPLSEKMGVRISQYTGQSFITTMPESGNQNPHQTLFAGSLFSLATLTGWGLIWL
FT                   LLQERQLGGDIILVDANIRYKKPVVGRPRAVADLKNMSGDLARLAQGSKARVKLEVAVS
FT                   GDHGVGAVFTGTYMVLPNAYTAIA"
FT   misc_feature    200274..200504
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.9e-16"
FT                   /inference="protein motif:Pfam:PF00583"
FT   CDS_pept        201313..201549
FT                   /transl_table=11
FT                   /gene="dinJ2"
FT                   /locus_tag="PAU_00186"
FT                   /old_locus_tag="PAT2221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00186"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82279"
FT                   /db_xref="GOA:B6VM16"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM16"
FT                   /inference="similar to DNA sequence:INSD:BX897699"
FT                   /inference="similar to AA sequence:UniProt:Q0XJY5"
FT                   /protein_id="CAQ82279.1"
FT                   /translation="MNTAILKVRVPEELKNAVARAAQDNSLDMSSFVRLVLTRATKERH
FT                   IPNATTQAAIRELESGGGTSVDTVDEFWDEIFK"
FT   misc_feature    201319..201540
FT                   /note="HMMPfam hit to PF04221, RelB antitoxin, score
FT                   0.00062"
FT                   /inference="protein motif:Pfam:PF04221"
FT   CDS_pept        201553..201825
FT                   /transl_table=11
FT                   /gene="ef0033"
FT                   /locus_tag="PAU_00187"
FT                   /old_locus_tag="PAT2222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00187"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82280"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM17"
FT                   /inference="similar to DNA sequence:INSD:AE016830"
FT                   /inference="similar to DNA sequence:INSD:BX908798"
FT                   /protein_id="CAQ82280.1"
FT                   /translation="MLKIRYSSAFKKDLKPFQHDKSAISVINTVLKLLATGKPLPREYK
FT                   EHSLKGDYIGYLECHGKPDLLLIYKRTEQEVFLYRVGSHAKLFKL"
FT   misc_feature    201562..201816
FT                   /note="HMMPfam hit to PF05016, Plasmid stabilisation system
FT                   protein, score 1.6e-07"
FT                   /inference="protein motif:Pfam:PF05016"
FT   CDS_pept        complement(201883..203619)
FT                   /transl_table=11
FT                   /gene="yicH"
FT                   /locus_tag="PAU_00188"
FT                   /old_locus_tag="PAT2223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00188"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82281"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM18"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82281.1"
FT                   /translation="MFSHLSWGLMMKWLGKSLVTLLLLLILAVVTIYVAIQTNWGAYQL
FT                   SQWLSHHSRYQVQIGDIEHRWLQPGTLAFSNIVIRNKQHTFTLEAQVAAFDFNWQQLTS
FT                   PRHFHRLLLQQGQLTIKGPQQSLPFSANILQLNQMAIQSENADWQIQGQNITGGITPWN
FT                   PQSNKLAGNGKFQFSADKLNFNDISLAKVIMQGDSQQNTLIIRSLGATLAQGSISGNGQ
FT                   RLPDGSWQWDNLLISNVRWQTPMTFEELWLKVSQLPAISIKDLSLTNAKLEGKNWSANY
FT                   LDASVKNIGLANGSWQAKEGILDFNVMDTTLNDLHFTDAIGHLLLAGNELRITNLTTRW
FT                   EKGLFHVKAQWNHQTKQFNIANATVAGLTYTLPQNWYQSLKKSLPQWISGFSINQLTIN
FT                   NSLLIDINPDFPFQLTALTGYINDMELLKEGEWGIWNGSSNLSATSATFNKVELHRPYL
FT                   KLHTEGNKLIIDQLDASVDDGLLKVKGTVDQQAQKPFTLDFRGIDADLAILPQWQWVPL
FT                   KLPGKGNFTLSIQGDLAADDIKSTIDGTLTATDKQSGKETQVIDKGQISIQNCETCSVI
FT                   RL"
FT   misc_feature    complement(201910..203589)
FT                   /note="HMMPfam hit to PF05170, AsmA family, score 7.9e-62"
FT                   /inference="protein motif:Pfam:PF05170"
FT   misc_feature    complement(203515..203583)
FT                   /note="1 probable transmembrane helix predicted for PAT2223
FT                   by TMHMM2.0 at aa 13-35"
FT   sig_peptide     complement(203518..203619)
FT                   /gene="yicH"
FT                   /locus_tag="PAU_00188"
FT                   /note="Signal peptide predicted for PAT2223 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.976) with cleavage site
FT                   probability 0.447 between residues 34 and 35"
FT   CDS_pept        204278..205831
FT                   /transl_table=11
FT                   /gene="hpaB"
FT                   /locus_tag="PAU_00189"
FT                   /old_locus_tag="PAT2224"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase oxygenase
FT                   component"
FT                   /EC_number="1.14.14.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00189"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82282"
FT                   /db_xref="GOA:B6VM19"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024677"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM19"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:Z29081"
FT                   /protein_id="CAQ82282.1"
FT                   /translation="MSDEMKQESPDENNTRITRPLNGKEFLEGLNDGREIWAYGERIHD
FT                   IANHPAFQNPARAVAKLYDALHDPAYRDVLTTATDTGSCGVTHPFFRIPRSQEDLIADR
FT                   DAIAAWARISYGWLGRSPDYKASFLTTLGVNPEFYGDFADNAKTWYTRSQEQVLYWNHA
FT                   LINPPIDRHLPADEIGDVCIHVEKECDDGLIVSGAKVVATGSAITHYNFIGHYGLPIKK
FT                   REFALVCTLPMNSPGLKLICRPSYALAADKMGSPFDYPLSSRFDENDTIIVLDKVKVPW
FT                   ENIFIYGDVEKTSSFFAEAGFFHRALLHGVTRLAVKLDFLCGLIIKGVEATGTQAFRGV
FT                   QTRVGEVLAWRNMFWAISDAMVKSPQPWHGDALLPRSEYGMAYRWFMTLGYPRIKEIIE
FT                   QDLGSALIYVNSHARDFTNPELAPYLNKYVRGSNGYSAVERVKLMKLIWDSIGTEFAGR
FT                   HELYERNYSGNHENIRIELLLTAQESGLMDQFKGFAEQCMSEYDLHGWIGNDFIWPSSR
FT                   "
FT   misc_feature    204650..205765
FT                   /note="HMMPfam hit to PF03241, 4-hydroxyphenylacetate
FT                   3-hydroxylase family, score 5.4e-162"
FT                   /inference="protein motif:Pfam:PF03241"
FT   CDS_pept        complement(205922..207307)
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="PAU_00190"
FT                   /old_locus_tag="PAT2225"
FT                   /product="similar to xanthine/uracil permease family
FT                   protein yice of escherichi coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82283"
FT                   /db_xref="GOA:B6VM20"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM20"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82283.1"
FT                   /translation="MFTSSPEQAATIPVKKPDSELIYRLEDRPPLLQTLFAACQHLLAM
FT                   FVAVITPAILICQALGLPAHDTQRIISMSLFASGIASLIQIRAWGPVGSGLLSIQGTSF
FT                   NFVSPLIMGGLALKNGGADIPTMMAALFGTLMLASVTEILLSRVLHLARRIITPLVSGV
FT                   VVMIIGLSLIQVGLTSIGGGFSAIENHTFGSPENLFLAGVVLAVIVLLNRQRNPYLRVA
FT                   SLVIAMSVGYVVAWLMGMLPQATVPENSSLITIPTPLYYGLSFDWHLLLPLMLIFMVTS
FT                   LETIGDITATSDVSEQPVSGPLYMKRIKGGVLANGLNSMLSAVFNTFPNSCFGQNNGVI
FT                   QLTGVASRHVGYAVALMLILLGLFPAVAGFVQQIPEPVLGGATIVMFGTIAASGVRIVS
FT                   REALNRRAIMIIALSLAVGMGVAQQPLILQFAPDWLKTLLSSGIAAGGLTAIVLNLIFP
FT                   QEK"
FT   misc_feature    complement(order(205937..205996,206024..206092,
FT                   206111..206179,206192..206260,206462..206530,
FT                   206588..206656,206675..206734,206777..206845,
FT                   206870..206938,207041..207100,207119..207187))
FT                   /note="11 probable transmembrane helices predicted for
FT                   PAT2225 by TMHMM2.0 at aa 41-63, 70-89, 124-146, 155-177,
FT                   192-211, 218-240, 260-282, 350-372, 377-399, 406-428 and
FT                   438-457"
FT   misc_feature    complement(206027..207214)
FT                   /note="HMMPfam hit to PF00860, Permease family, score
FT                   9.2e-150"
FT                   /inference="protein motif:Pfam:PF00860"
FT   CDS_pept        207545..208753
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="PAU_00191"
FT                   /old_locus_tag="PAT2226"
FT                   /product="sodium/glutamate symport carrier protein
FT                   (glutamate permease)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82284"
FT                   /db_xref="GOA:B6VM21"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM21"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82284.1"
FT                   /translation="MYHLDVYGTLVASALVLLLGRKLVQSVPFLEKYTIPEPVAGGLLV
FT                   ALILLILQQTTGWEISFDLSLKDPLMLTFFATIGLNANLASLKAGGKVLLTFVFVVVGL
FT                   LLVQNTVGIALAELLGLDPLMGLLAGSVTLSGGHGTGAAWGKLFSERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARFLVKNTKTPGLRADDTEVPTAFEKPYTGRMITALVMLETIA
FT                   LIAICLMAGNFVSEFLQGTWFELPTFVCVLFIGVILSNSLSVLGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWQMASLALPMLIILTIQAIVMALYAIFVTYRVMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHVAFLVVPMVGAFFIDIVNAIVIKLYLLLPVF
FT                   PAV"
FT   misc_feature    207548..208642
FT                   /note="HMMPfam hit to PF03616, Sodium/glutamate symporter,
FT                   score 4.8e-235"
FT                   /inference="protein motif:Pfam:PF03616"
FT   misc_feature    order(207554..207607,207641..207709,207752..207805,
FT                   207824..207892,208028..208096,208181..208249,
FT                   208277..208345,208364..208420,208448..208516,
FT                   208553..208621,208664..208732)
FT                   /note="11 probable transmembrane helices predicted for
FT                   PAT2226 by TMHMM2.0 at aa 4-21, 33-55, 70-87, 94-116,
FT                   162-184, 213-235, 245-267, 274-292, 302-324, 337-359 and
FT                   374-396"
FT   CDS_pept        209055..209822
FT                   /transl_table=11
FT                   /locus_tag="PAU_00192"
FT                   /old_locus_tag="PAT2227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00192"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82285"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM22"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82285.1"
FT                   /translation="MKLFNALGFHWDRSAVPLIVPIHSIERVCFRFHRMLPEFVWDASV
FT                   LEGNPFTFPEVKTLLDGVTVGGRKVSDQEQVLNLAESSRCLLSLVKKGQFELTKATFTE
FT                   LHSIVARNEALEWGAFRGEGREINYTPDVGLGEYGRHTPLPTEPDAPELNRVFHEGIAV
FT                   LSECQPFEQATAFFLFGALQQFFFDGNKRTSRFMMNGILMSNGIDAISVPAAKLHEFNE
FT                   KMVRFYLSKDATEMMMFLMDCHPDKVANPDFFK"
FT   CDS_pept        209993..210247
FT                   /transl_table=11
FT                   /gene="relB"
FT                   /locus_tag="PAU_00193"
FT                   /old_locus_tag="PAT2228"
FT                   /product="negative regulator of translation relb protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00193"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82286"
FT                   /db_xref="GOA:B6VM23"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM23"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:X02405"
FT                   /protein_id="CAQ82286.1"
FT                   /translation="MSTIQIRVDEELKKSAYQTFEKLNLSPSDALRLFLRYVVENEKLP
FT                   FAEVSVMVADHDEDAEILAVVRNRLKNPARRIRVNLDDI"
FT   misc_feature    209993..210244
FT                   /note="HMMPfam hit to PF04221, RelB antitoxin, score
FT                   2.2e-11"
FT                   /inference="protein motif:Pfam:PF04221"
FT   CDS_pept        210237..210527
FT                   /transl_table=11
FT                   /gene="relE"
FT                   /locus_tag="PAU_00194"
FT                   /old_locus_tag="PAT2229"
FT                   /product="similar to rele-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00194"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82287"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM24"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:X02405"
FT                   /protein_id="CAQ82287.1"
FT                   /translation="MIFNIDFDERALKEWCKLDQTIRDQFKKKLRKLQNNPYIESARLH
FT                   GDLAGCFKIKLRSSGFRLVYQVIEEEIVIWVIAVGKREDEKTYEIACKRII"
FT   misc_feature    210249..210494
FT                   /note="HMMPfam hit to PF05016, Plasmid stabilisation system
FT                   protein, score 1.4e-12"
FT                   /inference="protein motif:Pfam:PF05016"
FT   CDS_pept        complement(211032..211301)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00195"
FT                   /old_locus_tag="PAT2230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00195"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82288"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM25"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CR377818"
FT                   /protein_id="CAQ82288.1"
FT                   /translation="MEIIPAQLAKNQFGDLLMKVQREPVEISKHGKRVAVVISPEEYDQ
FT                   FAQLKLQNLKAVLAESIAQADRGELHSIDDVFAPLTVDELEGKA"
FT   misc_feature    complement(211098..211301)
FT                   /note="HMMPfam hit to PF02604, Phd_YefM, score 6.1e-18"
FT                   /inference="protein motif:Pfam:PF02604"
FT   CDS_pept        complement(212263..214383)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="PAU_00196"
FT                   /old_locus_tag="PAT2231"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00196"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82289"
FT                   /db_xref="GOA:B6VM26"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM26"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82289.1"
FT                   /translation="MTNCHAINGEKNRMKGQLLDAIPLTSLHGVGASQAAKLAKMGLIN
FT                   LQDLLLHFPLRYEDQTRLYTINDLLPGISATVTGEILHTNIIFGRRRMMICQISDGTGV
FT                   LTLRFFNFSAAMKNNLAKGKQVVAYGEIRRGSQGAEIIHPEYKIQTYAGNVRLQETLTP
FT                   IYPTTEGIRQATLRKLIEQALQLLDTCAINELLPEELSRSMISLPQALHTLHRPTPDIV
FT                   LADLETGKHPAHRRLILEELLAHHLSMLEVKVGAQRYHAQSLPTENKLKQQFLNRLPFT
FT                   PTNAQQRVVAEIEQDLAKDIPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTE
FT                   LLAEQHANTFRQWLEPLDIQIGWLAGKQKGKARQKQQEAIASGQVAMIVGTHAMFQEQV
FT                   KFSGLALVIIDEQHRFGVHQRLALWEKGREQGFHPHQLIMTATPIPRTLAMTAYADLDT
FT                   SIIDELPPGRTPVTTVAIPDTRREEVIKRIKNACLDENRQAYWVCTLIEDSDVLEAQAA
FT                   QVTSEELTLALPELKVGLVHGRMKAAEKLAVMEAFKCGELQLLVATTVIEVGVDVPNAS
FT                   LMIIDNPERLGLAQLHQLRGRVGRGAIASHCVLLYKTPLSSTARIRLQVLRDSNDGFVI
FT                   AQKDLEIRGPGELLGTRQTGNAEFKVADLLRDQGMLPEVQRIARHIHQRYPEHARALIE
FT                   RWLPERTHYSNA"
FT   misc_feature    complement(212578..212832)
FT                   /note="HMMSmart hit to SM00490, no description, score
FT                   3.6e-21"
FT                   /inference="protein motif:Smart:SM00490"
FT   misc_feature    complement(212578..212811)
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 6.4e-22"
FT                   /inference="protein motif:Pfam:PF00271"
FT   misc_feature    complement(212968..213552)
FT                   /note="HMMSmart hit to SM00487, no description, score
FT                   1.8e-31"
FT                   /inference="protein motif:Smart:SM00487"
FT   misc_feature    complement(213031..213537)
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 1e-32"
FT                   /inference="protein motif:Pfam:PF00270"
FT   misc_feature    complement(213049..213549)
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 3.1e-05"
FT                   /inference="protein motif:Pfam:PF04851"
FT   misc_feature    complement(213937..214161)
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain, score 8.9e-10"
FT                   /inference="protein motif:Pfam:PF01336"
FT   CDS_pept        214807..215373
FT                   /transl_table=11
FT                   /gene="fimB"
FT                   /locus_tag="PAU_00197"
FT                   /old_locus_tag="PAT2232"
FT                   /product="type 1 fimbriae regulatory protein fimb"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00197"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82290"
FT                   /db_xref="GOA:B6VM27"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM27"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82290.1"
FT                   /translation="MGQRKYLTQSEVESMLEMAKVGANPERNYCLVYMSFIHGFRVSEA
FT                   RHLRLSDMELNERCLYIRRLKGGFCTNHPLLRREIRAIKAWLKVRKTFLGADSDWLFLS
FT                   RSGKPLTRQRIYQIISRLGQLANIAVVPHPHMLRHACGFALADRGVDTRLIQDYLGHKN
FT                   IRHTVRYTASNAERFQGVWGMKGKR"
FT   misc_feature    214849..215346
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 4.1e-41"
FT                   /inference="protein motif:Pfam:PF00589"
FT   CDS_pept        215803..216420
FT                   /transl_table=11
FT                   /locus_tag="PAU_00198"
FT                   /old_locus_tag="PAT2233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00198"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82291"
FT                   /db_xref="GOA:B6VM28"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM28"
FT                   /inference="similar to DNA sequence:INSD:BX571866"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82291.1"
FT                   /translation="MKKILKISAVAALVMGAASAALAAGEATEEGHVGKNTMVTITGNV
FT                   VAATCDVTSPNANGKVNLGNASENAFLASAFTDQKGIVSYAKESSRPITIALSNCDDKN
FT                   TVADKVQLHVTGPVLGGSNNLIFNNSEDGKNVGAILTYKDKDAKETVVSNNSNVLLGAK
FT                   GSTGAEFNGQSITFTAYMASIVPKPGSNQHVNAPITFSYAYN"
FT   sig_peptide     215803..215871
FT                   /locus_tag="PAU_00198"
FT                   /note="Signal peptide predicted for PAT2233 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.885 between residues 23 and 24"
FT   misc_feature    215911..216417
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   5.9e-05"
FT                   /inference="protein motif:Pfam:PF00419"
FT   CDS_pept        216547..217293
FT                   /transl_table=11
FT                   /gene="aufB"
FT                   /locus_tag="PAU_00199"
FT                   /old_locus_tag="PAT2234"
FT                   /product="similarities with putative fimbrial chaperone"
FT                   /note="Periplasmic chaperones assist pili assembly by
FT                   binding to the subunits, thereby preventing premature
FT                   aggregation"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00199"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82292"
FT                   /db_xref="GOA:B6VM29"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM29"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82292.1"
FT                   /translation="MINKLRLPNIIVKSLILGAFLFASQSQAEGGFGIDVTRIIFLQDK
FT                   AEATTVSVRNTTTNIPYLVTTKITRTVDGKGKAPFYVSPPLFRLEPKGTNVLRILGDTS
FT                   KLPTDRESVFYFNASAIPGSNNPPGQRFESAKIGGGIAYAIGNTIKLFYRPTGLVGTPE
FT                   QAYKALRFTHAPDGIQVSNNSPYHISFTQIKVDGVPVKFSESHPQMLAPFSSHVYPAQN
FT                   NQNKKKVEWAVISDLGGGENFNGEIQ"
FT   sig_peptide     216547..216630
FT                   /gene="aufB"
FT                   /locus_tag="PAU_00199"
FT                   /note="Signal peptide predicted for PAT2234 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.991 between residues 28 and 29"
FT   misc_feature    216637..217023
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 8.6e-26"
FT                   /inference="protein motif:Pfam:PF00345"
FT   misc_feature    217033..217281
FT                   /note="HMMPfam hit to PF02753, Gram-negative pili assembly
FT                   chaperone, score 9.1e-10"
FT                   /inference="protein motif:Pfam:PF02753"
FT   CDS_pept        217331..217897
FT                   /transl_table=11
FT                   /locus_tag="PAU_00200"
FT                   /old_locus_tag="PAT2235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82293"
FT                   /db_xref="GOA:B6VM30"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM30"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82293.1"
FT                   /translation="MNYIGIGGILWLSSGPLWAANSAIATFKADIAYGTCDVTVDNNNI
FT                   DLGKVQFASLVSGNAYGETNLTLRNCSDVIDANRVAPAITITGEHFGTNDNTLFRSQKS
FT                   EDSVSKAVGVTVRLKKLNGTEWSSNIADGEPFYLADKGTVINDQTPSVPVRFSLVCAPA
FT                   AGETVMVCKKPGKIYANVNFTFDYR"
FT   sig_peptide     217331..217387
FT                   /locus_tag="PAU_00200"
FT                   /note="Signal peptide predicted for PAT2235 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.996 between residues 19 and 20"
FT   CDS_pept        217959..218657
FT                   /transl_table=11
FT                   /gene="papA"
FT                   /locus_tag="PAU_00201"
FT                   /old_locus_tag="PAT2236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82294"
FT                   /db_xref="GOA:B6VM31"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM31"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82294.1"
FT                   /translation="MTRQEKNRVGDQPAFLSNGGCSTLRIVVLRFCWGVMLAALFLAGS
FT                   VMAESEDPKPPFPSTKSSGINVDLFITVVPEPCDVGISGDDINGSELNFGSLPAAEFSQ
FT                   AGHISNPRRFNLELTNCGDPDVSPSRPVITVSGNTIDAEQGSIFRGPVSGSYDNASEGL
FT                   GFIVHLGGEGKIDWGNLVINNHENRLDSLFFDDGRAQLPVTVAVARGKDSKVIRPGSLI
FT                   ARVAFTYSYP"
FT   sig_peptide     217959..218102
FT                   /gene="papA"
FT                   /locus_tag="PAU_00201"
FT                   /note="Signal peptide predicted for PAT2236 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.776) with cleavage site
FT                   probability 0.767 between residues 48 and 49"
FT   misc_feature    218034..218102
FT                   /note="1 probable transmembrane helix predicted for PAT2236
FT                   by TMHMM2.0 at aa 26-48"
FT   CDS_pept        218793..219392
FT                   /transl_table=11
FT                   /locus_tag="PAU_00202"
FT                   /old_locus_tag="PAT2237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00202"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82295"
FT                   /db_xref="GOA:B6VM32"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM32"
FT                   /inference="similar to DNA sequence:INSD:AY626368"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82295.1"
FT                   /translation="MILIGWIIGCVSLSVQADGKNIEITIKGNLLRPTCALSVNGKYGG
FT                   SSGGSYDDTMPQVYANQLRNSKYVESSALDLEVQLSHCSPGQSPALYIWSLYAGNSDDS
FT                   ELFMPADGTASAEGVGIRLLDVSTNQFVKVKPINDPFKVPLPSAGDGTTRTFRAYVGGL
FT                   GDKNNPATCKSDGTNVLCGGTANVQIHFEFSYEHLK"
FT   sig_peptide     218793..218843
FT                   /locus_tag="PAU_00202"
FT                   /note="Signal peptide predicted for PAT2237 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.822) with cleavage site
FT                   probability 0.795 between residues 17 and 18"
FT   misc_feature    218859..219380
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein, score
FT                   0.00063"
FT                   /inference="protein motif:Pfam:PF00419"
FT   CDS_pept        219469..220188
FT                   /transl_table=11
FT                   /gene="afaB"
FT                   /locus_tag="PAU_00203"
FT                   /old_locus_tag="PAT2238"
FT                   /product="similar to pilli chaperone"
FT                   /product="afab"
FT                   /note="Periplasmic chaperones assist pili assembly by
FT                   binding to the subunits, thereby preventing premature
FT                   aggregation"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00203"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82296"
FT                   /db_xref="GOA:B6VM33"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM33"
FT                   /inference="similar to DNA sequence:INSD:AF072900"
FT                   /protein_id="CAQ82296.1"
FT                   /translation="MGMLGIWAVVASSSAHAGLMLRKTRIIYQQGDKVQSISLQNSGEE
FT                   VYLVQAAVTPWDNPNTRSSEFTVLPPLFRMEGNSLNVMRVMRTGGDFPDDRESLFRFRI
FT                   NAIPAKKTVDNGQENSSGKQDEIGASLSISLGMNIKLIYRPDKLPMTPEQARGRLTFTQ
FT                   SGNSVVVTNPTPYYQTFAQLKFDGKAVDFDKAPSILVPFGQTTFPLAGKAGSKVEWSMI
FT                   TDIGGVSKLQSGTLQAG"
FT   sig_peptide     219469..219519
FT                   /gene="afaB"
FT                   /locus_tag="PAU_00203"
FT                   /note="Signal peptide predicted for PAT2238 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972) with cleavage site
FT                   probability 0.971 between residues 17 and 18"
FT   misc_feature    219520..219915
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 9e-27"
FT                   /inference="protein motif:Pfam:PF00345"
FT   misc_feature    219925..220167
FT                   /note="HMMPfam hit to PF02753, Gram-negative pili assembly
FT                   chaperone, score 5.1e-19"
FT                   /inference="protein motif:Pfam:PF02753"
FT   CDS_pept        220217..221011
FT                   /transl_table=11
FT                   /gene="agg3D"
FT                   /locus_tag="PAU_00204"
FT                   /old_locus_tag="PAT2239"
FT                   /product="similar to putative fimbrial chaperone"
FT                   /note="Periplasmic chaperones assist pili assembly by
FT                   binding to the subunits, thereby preventing premature
FT                   aggregation"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00204"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82297"
FT                   /db_xref="GOA:B6VM34"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM34"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AF411067"
FT                   /protein_id="CAQ82297.1"
FT                   /translation="MAERKVSIKQRVTSVLCALAMILPVLPLRAEEALMGALYINDARV
FT                   LYLESFNNGVPSTFINNSDSNYLIQSTVRELDPATGLPLDIKAPFIVIPPIAKVDAHER
FT                   QVLKILRTGGDFPKDRESLFFLNVRMLPSEKPSSVSKGFSGKVKMTTALAVKVFYRPEG
FT                   LPKEGVAGAVKQLSASVKESVVTLTNPSPFWITLQALHVSSFAVPEQDLFRMVPPFGQQ
FT                   SWSLPVGKVLPGNNVTISWRAIDEFGLGTDEESRSITVSGSG"
FT   sig_peptide     220217..220306
FT                   /gene="agg3D"
FT                   /locus_tag="PAU_00204"
FT                   /note="Signal peptide predicted for PAT2239 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.985 between residues 30 and 31"
FT   misc_feature    220250..220306
FT                   /note="1 probable transmembrane helix predicted for PAT2239
FT                   by TMHMM2.0 at aa 12-30"
FT   misc_feature    220325..220711
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, score 7.2e-22"
FT                   /inference="protein motif:Pfam:PF00345"
FT   CDS_pept        221128..223878
FT                   /transl_table=11
FT                   /gene="lpfC"
FT                   /locus_tag="PAU_00205"
FT                   /old_locus_tag="PAT2240"
FT                   /product="similar to outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00205"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82298"
FT                   /db_xref="GOA:B6VM35"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM35"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AY057066"
FT                   /protein_id="CAQ82298.1"
FT                   /translation="MATLIMKMLIPMINCCLERPPIYHRVNQNISISLVLLKCSVKLRL
FT                   SLIFCRMVLVFLTGWGVQATARDYFDPALLDFGSNSGQPVDLSQFETAGGQAPGTYRVD
FT                   IYVNGTFFDSRDITFQRNGDSELVPVLTPDLLETAGVNISDTPALKTLPADKPIESPLD
FT                   KFIPQATARLNFSQMRLNLSIPQIAMKPSANGQVDPKLWQEGIPAFILNYSINGSQNRR
FT                   SQFGNKQANQSLFGSFNSGLNLGAWRLRNTATYSYSTQTYNRYDSLNDAMKKTTQSQQR
FT                   WNFLQTYLQRDVVALRSDLTIGDTSTGSVAGQVFDGFPYRGIGLATSDSMIPGRQSGFA
FT                   PIISGIAKSNAQVTVTQNGSVIYQTNVAPGPFRITDLVGSSTGGDLQVTITEADGTHHG
FT                   FSQAYSSLPMMLRQGQFKYEAAAGRYHSSGYSSGGHKPVFGMVSMIYGLPGNVTVYGGG
FT                   LVAQSYQSAALGTGLSLGMMGALSADITTSRARLKNMADIQRGESYRAKYSKSMLTSGT
FT                   TVDLTAYRYSTRNYLSFSDVNTQGYTVWGELPSWMSQRRRSSWQMRLSQSLPGNYSLWL
FT                   SGQRDNYWGSSKTNTTLSMGLNGSFYRVGWGLNYSIDRIRGNGDWPENRQVSLNVNIPL
FT                   SLFGSYAALNNAYANYSLFHDSTGRSSNQLGLGGSLLDDNSLSWSVSQSQANKGQGNSG
FT                   SVSMGYRGSLGQASLGYNYDSSGGRGVNYGVSGGLIAHQHGVTLTSRVGDAAVLVRTSG
FT                   VGGIRVMNSDSISTNRWGYAVVPYAQTYSRNSISLDPSSLPEGADMAQGSKNVFPTKGA
FT                   VVMVDYPVRIGQQLLMNLLYHGKPVPFGAMARLKGDTTTNLAAIVGEGGQVYLSGMPPN
FT                   GVLKVKWGSAPDSQCEVVFNLGPPPVKAKKDKSWSPMRQLNETCR"
FT   misc_feature    221329..223806
FT                   /note="HMMPfam hit to PF00577, Fimbrial Usher protein,
FT                   score 5.3e-303"
FT                   /inference="protein motif:Pfam:PF00577"
FT   CDS_pept        224026..225366
FT                   /transl_table=11
FT                   /locus_tag="PAU_00206"
FT                   /old_locus_tag="PAT2241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00206"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82299"
FT                   /db_xref="GOA:B6VM36"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM36"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82299.1"
FT                   /translation="MKISNIATGKLLPVGQPMNTKKTFINKLKQDIGWMAVCCRKWPIW
FT                   VAMICLSVVAIFSSPSVFAESLNWNADTTLKVLGPERMVKRSDGVITYPAAGKATLDVF
FT                   PFYRKRIASKTTSYDQKFLEDVRFQLRAGRGEIFKVPRVVSGSYECTIIAKSHYYHTKN
FT                   PIEGTAIQHFTVSLDKPYPNENLSQPLYFQPENPNNQDDKNIAEGRISDLDFDVSCRGV
FT                   NFSWQRNPDEKVEFDSDDNAPILSILADGEEFMSWSKPRFPPIKDPVTVLDPPVCGLDF
FT                   GTPGAFVGVVPMGEVLRSLGPYPALLPTNSLSDEYTPFFPMNIICTVSDKNSTGGVATL
FT                   QFSASQLADNNESIVVPNFDNALRIKVVPNVIGGNTQLAAPNVKDRPVKFGPPTNPADV
FT                   LYFTVGNTPNTYVSQNRFNVQLWQVKALDPGTSGEFQTTMNVTLVVR"
FT   sig_peptide     224026..224217
FT                   /locus_tag="PAU_00206"
FT                   /note="Signal peptide predicted for PAT2241 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.983) with cleavage site
FT                   probability 0.982 between residues 64 and 65"
FT   misc_feature    224149..224217
FT                   /note="1 probable transmembrane helix predicted for PAT2241
FT                   by TMHMM2.0 at aa 42-64"
FT   CDS_pept        225496..225987
FT                   /transl_table=11
FT                   /gene="yheC"
FT                   /locus_tag="PAU_00207"
FT                   /old_locus_tag="PAT2242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00207"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82300"
FT                   /db_xref="GOA:B6VM37"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM37"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AP002527"
FT                   /protein_id="CAQ82300.1"
FT                   /translation="MTINVNDSVLLQMSGNQTDLPGSQTITGKQSNHGDFRLPVCLSHL
FT                   NDTPLYLAVAYWGLLKGRGFTKNEISQVFRVSERRARDVMNYIYNERRDVISCEKVFFR
FT                   EKRRSRRLMLIVTAVAKPMPQRNQILVTKTVKSASSLTSARIHHMRTWFLQRACGPFIS
FT                   "
FT   CDS_pept        <225984..226448
FT                   /transl_table=11
FT                   /locus_tag="PAU_00208"
FT                   /old_locus_tag="PAT2243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00208"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82301"
FT                   /db_xref="GOA:B6VM38"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM38"
FT                   /inference="similar to DNA sequence:INSD:AALN01000061"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82301.1"
FT                   /translation="LKYMTHVVVWRDIMEDEFLSILCGMPYGMLISRVVLVIIVVLLTV
FT                   GGLLLGNKIRHSLYPRMLLAYWCRTWIVPLLFIVIGLVLMFGVGEEGWLGHLLDEIDSV
FT                   LVGLLFENQGDVSSSLMLSCGFAVNSTVGCSPAELHGLPGAENNNQKQVL"
FT   misc_feature    order(226068..226136,226170..226238)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2243 by TMHMM2.0 at aa 29-51 and 63-85"
FT   CDS_pept        complement(226471..228588)
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="PAU_00209"
FT                   /old_locus_tag="PAT2244"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00209"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82302"
FT                   /db_xref="GOA:B6VM39"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM39"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82302.1"
FT                   /translation="MYLFESLNLLIQKYLPESQIELLKQAYSVARDAHEGQTRTSGEPY
FT                   ITHPVAVACILAEMRLDHETLMAALLHDVIEDTPATFQDIAQPFGPVVAGLVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGALRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALHPNRYRVIKEVVKAARGNRKEMIQKILSEIAG
FT                   RLAEANIECKVSGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVNNVDICYRVLGQMH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMEQMAEMGVAAHWT
FT                   YKEQGESGTAAQVRAQRWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPKGRIVE
FT                   LPAGSTPVDFAYAVHTDIGHACVGSRVDRQPYPLSQSLTNGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKREDSIGLGRRLLNHALGNGKKLVDIPPENINKELTRMKL
FT                   VTIDDLLAEIGLGNTMSIVVARNLLGAQENTASTSSHNSGARKLPIKGADGVLITFAKC
FT                   CRPIPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDKEINSDFIAEIKVD
FT                   MFNHQGALANLTAAINAVNSNIQSMNTEEKDGRVYCAFIRLTTKDRIQLANIMRKIRIM
FT                   PDVMRVSRNRN"
FT   misc_feature    complement(227248..227427)
FT                   /note="HMMPfam hit to PF02824, TGS domain, score 3.3e-27"
FT                   /inference="protein motif:Pfam:PF02824"
FT   misc_feature    complement(227554..227886)
FT                   /note="HMMPfam hit to PF04607, Region found in RelA / SpoT
FT                   proteins, score 1e-47"
FT                   /inference="protein motif:Pfam:PF04607"
FT   misc_feature    complement(228130..228468)
FT                   /note="HMMSmart hit to SM00471, no description, score
FT                   8.3e-12"
FT                   /inference="protein motif:Smart:SM00471"
FT   misc_feature    complement(228157..228456)
FT                   /note="HMMPfam hit to PF01966, HD domain, score 5.9e-16"
FT                   /inference="protein motif:Pfam:PF01966"
FT   CDS_pept        complement(228606..228881)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="PAU_00210"
FT                   /old_locus_tag="PAT2245"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82303"
FT                   /db_xref="GOA:B6VM40"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM40"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82303.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQLQTGGKDPLVAEENDK
FT                   VTVIALREVEEGLINGKILDVRERQEQQEQEAAEMQAVSAIAESRR"
FT   misc_feature    complement(228687..228848)
FT                   /note="HMMPfam hit to PF01192, RNA polymerase Rpb6, score
FT                   7e-22"
FT                   /inference="protein motif:Pfam:PF01192"
FT   CDS_pept        complement(228936..229559)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="PAU_00211"
FT                   /old_locus_tag="PAT2246"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82304"
FT                   /db_xref="GOA:C7BHD6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHD6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82304.1"
FT                   /translation="MIQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAMR
FT                   PGENHGEHYFFITEQAFRQMIDNNEFLEHARVFGNYYGTSRKVIEETLASGVDVFLDID
FT                   WQGAQQIRKQMPSARSIFILPPSKEELCRRLRGRGQDSEDIIEKRMEQAVAEMVHYNEY
FT                   DYLIVNDDFNTALADLHTIIRSERLHRERQAQRHDALISKLLAD"
FT   misc_feature    complement(228999..229553)
FT                   /note="HMMSmart hit to SM00072, no description, score
FT                   1.6e-76"
FT                   /inference="protein motif:Smart:SM00072"
FT   misc_feature    complement(229125..229439)
FT                   /note="HMMPfam hit to PF00625, Guanylate kinase, score
FT                   1.2e-53"
FT                   /inference="protein motif:Pfam:PF00625"
FT   CDS_pept        230048..230485
FT                   /transl_table=11
FT                   /locus_tag="PAU_00212"
FT                   /old_locus_tag="PAT2247"
FT                   /product="putative hth-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00212"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82305"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHD7"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /inference="similar to AA sequence:UniProt:Q0WCU1"
FT                   /protein_id="CAQ82305.1"
FT                   /translation="MFNYPIKLEYDEETGSYVASCRDLPLFNSVGDSVDEALLESIDGL
FT                   VTAISIEIDKRRPIPEASMLEAGEYIVTLPILVVMKVALHNAMVETGTRKADLARRLGQ
FT                   KGPQIDRLLDVEHSSKVEVVELALHQLNRKLDIVVNTTLHH"
FT   misc_feature    230054..230200
FT                   /note="HMMPfam hit to PF03681, Uncharacterised protein
FT                   family (UPF0150), score 1.2e-11"
FT                   /inference="protein motif:Pfam:PF03681"
FT   CDS_pept        complement(230778..231638)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00213"
FT                   /old_locus_tag="PAT2248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82306"
FT                   /db_xref="GOA:C7BHD8"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHD8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82306.1"
FT                   /translation="MNTEKTFINRVKQNVGRNRRWSAWVMCASIGALFSTSVLAATECP
FT                   KVPVQDLGYPATPPWNPKVLFRALGQPIINGKDNQGKPVHYPARGSTNLVGVFPPVVDY
FT                   DFPTPTGDLMLKDAKFWVRAQNRIFKVPHVVTGMYHCKMVAKRKDGAPGRATANLYTDA
FT                   IVVNHDTHKFQGDQNVMESSVTDLVYTATCKGAGFSWERKPEEKFEWESKWENGVPSIE
FT                   MLDNCHWIHNVAFWTPPDDNPNDKFKDPAVLRPTSAENANPKKSVPHDNPDNFPWKRKA
FT                   DSNNQ"
FT   misc_feature    complement(231510..231578)
FT                   /note="1 probable transmembrane helix predicted for PAT2248
FT                   by TMHMM2.0 at aa 21-43"
FT   sig_peptide     complement(231519..231638)
FT                   /locus_tag="PAU_00213"
FT                   /note="Signal peptide predicted for PAT2248 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 40 and 41"
FT   CDS_pept        complement(232545..233405)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00214"
FT                   /old_locus_tag="PAT2249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00214"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82307"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHD9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82307.1"
FT                   /translation="MNTEKAFINRVKQNVGRNRRWSAWVMCASIGALFSTSVLAATECP
FT                   KVPVKDLGYPATPPWNPEVLFRALGQPIINGKDNQGKPVHYPARGSTNLVGVFPPVVDY
FT                   DFPTPTGDLKLKDGLFWVSAPNRIFKVPHVVTGKYHCKMIAKRKDGAPGRATATLETDA
FT                   VVANHIIHRFQGDKNVLESSVTDLVYTVTCRGTGFSWERKPEEKFEWESVWDNSVPLIR
FT                   MQDLCNWVHNVAFWTPPSDNPNDRFKDPAVLRPMSAESADLKKSDANATPDNLSGTKRA
FT                   DSGNK"
FT   misc_feature    complement(233277..233345)
FT                   /note="1 probable transmembrane helix predicted for PAT2249
FT                   by TMHMM2.0 at aa 21-43"
FT   sig_peptide     complement(233286..233405)
FT                   /locus_tag="PAU_00214"
FT                   /note="Signal peptide predicted for PAT2249 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 40 and 41"
FT   CDS_pept        complement(234276..235901)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00215"
FT                   /old_locus_tag="PAT2250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00215"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82308"
FT                   /db_xref="GOA:C7BHE0"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000094"
FT                   /protein_id="CAQ82308.1"
FT                   /translation="MKIFNMPTGEQSPSEYPMNTEKTFINRVKQGVGRIAVRYRRWSAW
FT                   VMCVSIGALFFTSVLAATEYPSKPTPDLGYPATPPWDAEYIFKSLGQPIINGKDNKASI
FT                   TSTYTATAMLLTNGRIVAWGDEGGGGSIPPEIAKLQDIVSLSSTGYAFAALRADRSVVA
FT                   WGDERYGGTLPEEIAKLQDIVSLSSTNYAFSALRADGSVVAWGDQKYGGKLPAEIAELK
FT                   DIISINSIHNLSDHVCAAWWPDRNQFYCGDDNRGKHKFNAVYNFTNDTFTALRANGSVV
FT                   SWGKVRVPPDIAKLQDIISLSVINNTFIARRADLTVVTWPGYSIPPEIAKWQDIVNLSI
FT                   TTYALAALRANRSVVAWGHQDYGGQVPPEIASLRDIISLSATNGAFAALRTDRSVVAWG
FT                   EPSSGGQIPPEIAALKDIVSLYSSRTTFIALRADRSVVSWGTISVPPEVAKLKDIVSLS
FT                   TTDLDDSSRGHYAFAALRANRSVVAWGFKELNIQIPPGITQLQDIISLSASSSAFTVLR
FT                   ANGQRLAWDLLDMGDNIVHSEYDD"
FT   misc_feature    complement(235710..235778)
FT                   /note="1 probable transmembrane helix predicted for PAT2250
FT                   by TMHMM2.0 at aa 42-64"
FT   sig_peptide     complement(235719..235901)
FT                   /locus_tag="PAU_00215"
FT                   /note="Signal peptide predicted for PAT2250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.661) with cleavage site
FT                   probability 0.648 between residues 61 and 62"
FT   CDS_pept        complement(236281..236610)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00216"
FT                   /old_locus_tag="PAT2251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00216"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82309"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82309.1"
FT                   /translation="MNQNNDPSPNIDTGSNPTKQYWQPNRSNHADNNTPIASTRGATAM
FT                   LLPNGRVIAWGNDSSSQIPPDIAQLQDIVSLSASRHSFTVLRADGQRVGWGSTGDNKLH
FT                   YEYDY"
FT   CDS_pept        complement(237254..237532)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00217"
FT                   /old_locus_tag="PAT2252"
FT                   /product="similar to gp48 proteins of bacteriophage n15"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00217"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82310"
FT                   /db_xref="GOA:C7BHE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CR628336"
FT                   /protein_id="CAQ82310.1"
FT                   /translation="MSSLKSLKSKALANPDVKAEYDALEPEFELINTLLRMRHAAGLTQ
FT                   NQVAQRMGTKEANISRLEKGNGNPTLKTLLNYAKACNCKLHFGFKTT"
FT   misc_feature    complement(237269..237436)
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   3.2e-10"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    complement(237269..237433)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   8.2e-11"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        complement(237723..237980)
FT                   /transl_table=11
FT                   /gene="s045"
FT                   /gene_synonym="CBU1692"
FT                   /locus_tag="PAU_00218"
FT                   /old_locus_tag="PAT2253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00218"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82311"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE3"
FT                   /inference="similar to DNA sequence:INSD:AY055428"
FT                   /inference="similar to DNA sequence:INSD:CR378675"
FT                   /protein_id="CAQ82311.1"
FT                   /translation="MNMNWNIEFYDGVEGVILDMPPGIQARILKLLELIEEYGANLGEP
FT                   HTKPIGKGLFEIRAKAQEGIGRGLFCYTLWISRCIATARE"
FT   CDS_pept        complement(238434..238757)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00219"
FT                   /old_locus_tag="PAT2254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00219"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82312"
FT                   /db_xref="GOA:C7BHE4"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE4"
FT                   /inference="similar to DNA sequence:INSD:BX571866"
FT                   /inference="similar to DNA sequence:INSD:AAQF01000115"
FT                   /protein_id="CAQ82312.1"
FT                   /translation="MPQQFDVYRNPSAKTNRLWPFYLIIQNDYFDDLTTRIIVPLVSKN
FT                   DISLNQKRITPQVVINNNSYYIFTPAITFLDAKKINKSDFVCNVASSRNEIISALDAII
FT                   TNT"
FT   CDS_pept        complement(238757..239080)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00220"
FT                   /old_locus_tag="PAT2255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82313"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE5"
FT                   /inference="similar to DNA sequence:INSD:BX571866"
FT                   /inference="similar to DNA sequence:INSD:CP000267"
FT                   /protein_id="CAQ82313.1"
FT                   /translation="MIVFPLPIILMRIPLRIGVNTMNTVTSPRNSIKRSTKRSTNVYLT
FT                   ASLVDKAHSMDMNLSATLDILLAQAIKAKQDEREKEKEDMQAMNIFMAKAGMLTDDEFF
FT                   GSL"
FT   CDS_pept        239330..241066
FT                   /transl_table=11
FT                   /gene="yicF"
FT                   /locus_tag="PAU_00221"
FT                   /old_locus_tag="PAT2256"
FT                   /product="similar to putative dna ligase-like protein yicf
FT                   of escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82314"
FT                   /db_xref="GOA:C7BHE6"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82314.1"
FT                   /translation="MLNLLILILFIVFSTPVVATETLNTEKDCPAWSQDKLQRETKSLM
FT                   QQMARWDQLYRQKGISEIDDEVYDQLMADLIHWQLCLKQEPHSDFPATVFPDNKLVHPV
FT                   AHTGLSKLKDEREINRWLHGRLPVWLQPKIDGVAVTLVYQQGKLVSLISRGNGSEGVDW
FT                   TAKSPYISEIPQEIENAPPYMVLQGELFLHKNGHIQQSSGSDGARNRVAGLMMRKEHSP
FT                   ELKQVGVFIWSWPDGPVDMDGKLQKLANMGFPLALRYSHKIERPEQVQKLRMHYFEQPM
FT                   PFATDGIVLKQEIEPKGNQWRSGSNSWAVAWKHPLRHQVTQVREVSFTIGRTGKISVVL
FT                   GLDKVKLDDRQVSRVNIGSVRRWQQLDVLPGDRVTLTLAGHGIPKLAQVVWRIKERQDI
FT                   QPPDKQRYHALSCLTLTAGCEQQFNARLKWLGEHLHMTGVSSGSWAMLTEQKLVTDLTS
FT                   WLTLSVQDIAALPGIGDKRAQAIYSQFSKAKNQPFSYWMKGIGVPYMDKLSNDVDHWQQ
FT                   LEQKLAEAQLKQQLTSGQLKKLSEFVNDTRIKAIAEKLSVSGIKGFGRENGAGPNPVSM
FT                   NQ"
FT   sig_peptide     239330..239386
FT                   /gene="yicF"
FT                   /locus_tag="PAU_00221"
FT                   /note="Signal peptide predicted for PAT2256 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 19 and 20"
FT   misc_feature    239432..240280
FT                   /note="HMMPfam hit to PF01653, NAD-dependent DNA ligase
FT                   adenylation, score 3.4e-19"
FT                   /inference="protein motif:Pfam:PF01653"
FT   misc_feature    239435..240634
FT                   /note="HMMSmart hit to SM00532, no description, score
FT                   2.6e-41"
FT                   /inference="protein motif:Smart:SM00532"
FT   misc_feature    240284..240535
FT                   /note="HMMPfam hit to PF03120, NAD-dependent DNA ligase
FT                   OB-fold doma, score 1.5e-17"
FT                   /inference="protein motif:Pfam:PF03120"
FT   CDS_pept        complement(241060..241677)
FT                   /transl_table=11
FT                   /gene="yicG"
FT                   /locus_tag="PAU_00222"
FT                   /old_locus_tag="PAT2257"
FT                   /product="similar to putative inner membrane protein yicg
FT                   of escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00222"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82315"
FT                   /db_xref="GOA:C7BHE7"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82315.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRKMDMFGVIIIASVTAIGGGS
FT                   VRDILLGHYPLGWVKHPEYIVTVACAAVITTWVAPMMKHLRRLFLILDAIGLIVFSIIG
FT                   AQIALDMNYSPIIASIAAVITGVFGGVLRDMLCNTIPLVFQKEIYAGVSFAAAWLYIGL
FT                   QHTPLPQNSIVLITLIAGLTARLVAIRYRLGLPVFNYEHSDH"
FT   misc_feature    complement(order(241111..241164,241192..241260,
FT                   241279..241347,241357..241416,241435..241488,
FT                   241525..241593,241612..241665))
FT                   /note="7 probable transmembrane helices predicted for
FT                   PAT2257 by TMHMM2.0 at aa 5-22, 29-51, 64-81, 88-107,
FT                   111-133, 140-162 and 172-189"
FT   misc_feature    complement(241123..241413)
FT                   /note="HMMPfam hit to PF03458, UPF0126 domain, score
FT                   3.8e-34"
FT                   /inference="protein motif:Pfam:PF03458"
FT   misc_feature    complement(241414..241671)
FT                   /note="HMMPfam hit to PF03458, UPF0126 domain, score
FT                   2.2e-37"
FT                   /inference="protein motif:Pfam:PF03458"
FT   CDS_pept        241812..243101
FT                   /transl_table=11
FT                   /gene="yidR"
FT                   /locus_tag="PAU_00223"
FT                   /old_locus_tag="PAT2258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00223"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82316"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82316.1"
FT                   /translation="MDFQERQITFDNRSHQLTNINVWTPDSQWLAYDVRPHGASFTGLT
FT                   IEKIHVHSGKSDIIYQAEEGAHVGVVTVSPTEPVRYAFIHGPEFPDEQWHYDFHHRRGV
FT                   IVSEDAPGKAVTLDAMDITAPYTPGALRGGSHVHVFSPDGSRLSFTYNDHVMHELDPAL
FT                   DLRNIAVAVPLKSVEPPKQHPREYDGNYFSVVVSSTESQPEPGSDEINRAYEECWVGQA
FT                   GYCKEDGNWQRWALAFIGDTISATGEKVPEIYIVDLPEQDTDYAIAGEKPLEGTETTLP
FT                   APPANVMQRRLTFTNHKRWPGVVNNPRHWLRASPDGEQIGFLMKDDNSIVQLWTISPNG
FT                   GKPRQITKGSYGIQSAFSWDRSGQYVVFICDNSVMLCDVQNSQMQRLTKRTEKAPAAEA
FT                   VVISPDSRHVAFMREVDGYTQIFLVETGLK"
FT   CDS_pept        complement(243365..243685)
FT                   /transl_table=11
FT                   /gene="yidQ"
FT                   /locus_tag="PAU_00224"
FT                   /old_locus_tag="PAT2259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00224"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82317"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHE9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82317.1"
FT                   /translation="MKSNKLILLCVTLGWLLISGCTSIMTHSGPSRGYYPGTKANIEML
FT                   KDDNTGWVVRPLLAIDLPFSALLDTFLLPYDYIKSDEDQSANSPKERIEKIEKAQNQPK
FT                   TN"
FT   misc_feature    complement(243452..243673)
FT                   /note="HMMPfam hit to PF07119, Protein of unknown function
FT                   (DUF1375), score 3.7e-34"
FT                   /inference="protein motif:Pfam:PF07119"
FT   misc_feature    complement(243599..243667)
FT                   /note="1 probable transmembrane helix predicted for PAT2259
FT                   by TMHMM2.0 at aa 7-29"
FT   sig_peptide     complement(243608..243685)
FT                   /gene="yidQ"
FT                   /locus_tag="PAU_00224"
FT                   /note="Signal peptide predicted for PAT2259 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.408 between residues 26 and 27"
FT   CDS_pept        complement(244381..245634)
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="PAU_00225"
FT                   /old_locus_tag="PAT2260"
FT                   /product="alanine-alpha-ketoisovalerate (or
FT                   valine-pyruvate) transaminase transaminase c
FT                   (valine-pyruvate transaminase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00225"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82318"
FT                   /db_xref="GOA:C7BHF0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82318.1"
FT                   /translation="MIFSQFGNKFTQDAGITRLMNDLNQGLRTPGAIMLGGGNPAHIPE
FT                   MDDYFQQLLTEMAANGQLADTLCNYDGPQGKDTLIQALAKMLREKFGWEIGTQNIALTN
FT                   GSQSAFFYLFNLLAGRSEDGSIRKVLFPLAPEYIGYSDSGLNDDLFVANKPNIELLPEG
FT                   QFKYHVDFDHLKITEDIGLICVSRPTNPTGNVITDEELQRLDRLAQQHQIPLLIDNAYG
FT                   VPFPSIIFSEATPLWNPNIILCMSLSKLGLPGSRCGIIIANDKIINAVSNMNGIISLAP
FT                   GGVGPAIALEMIRRNDLLRLSQEVIRPFYQQRVQDVIHIIRRYLPTELCLIHKPEGAIF
FT                   LWLWFKNLPITTEMLYQRLKKRGVLMVPGHYFFPGLEQNWPHAHECMRMNYVPDPTSIE
FT                   KGIAILAEEIELAHQQAA"
FT   misc_feature    complement(244420..245547)
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 1.5e-07"
FT                   /inference="protein motif:Pfam:PF00155"
FT   CDS_pept        complement(246444..247001)
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PAU_00226"
FT                   /old_locus_tag="PAT2261"
FT                   /product="dna-3-methyladenine glycosylase i
FT                   (3-methyladenine-dna glycosylase i constitutive) (tag i)
FT                   (dna-3-methyladenine glycosidase i)"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00226"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82319"
FT                   /db_xref="GOA:C7BHF1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82319.1"
FT                   /translation="MELTRCHWVTSDPEYLAYHDNEWGKPQKNSQKLFEMICLEGQQSG
FT                   LSWLTILKKREGYRKCFHQFDPVKIAVMNENDVERLMQDRTIVRNRAKINAIINNALAY
FT                   LKMQQQGEEFSAFIWHFVDNKPIINQWKTITAVPVKTEISDALSQALKKRGFKFTGSTT
FT                   CYAFMQATGLVNDHITSCLCRK"
FT   misc_feature    complement(246447..246980)
FT                   /note="HMMPfam hit to PF03352, Methyladenine glycosylase,
FT                   score 3.3e-109"
FT                   /inference="protein motif:Pfam:PF03352"
FT   CDS_pept        247197..248111
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PAU_00227"
FT                   /old_locus_tag="PAT2262"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00227"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82320"
FT                   /db_xref="GOA:C7BHF2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82320.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPITC
FT                   LRALGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWCDGLLGKTTYGDIYHQNEVEQSTYNFEHADVDFLFTC
FT                   FEQYEKEAQDLLALETPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCKKNQN"
FT   misc_feature    247221..248090
FT                   /note="HMMPfam hit to PF02091, Glycyl-tRNA synthetase alpha
FT                   subunit, score 4.3e-244"
FT                   /inference="protein motif:Pfam:PF02091"
FT   CDS_pept        248121..250190
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PAU_00228"
FT                   /old_locus_tag="PAT2263"
FT                   /product="glycyl-trna synthetase beta chain (glycine--trna
FT                   ligase beta chain (glyrs)"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00228"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82321"
FT                   /db_xref="GOA:C7BHF3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF3"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82321.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAEAFAANFAAELDNANLAHGEV
FT                   SWFATPRRLALKVANLDEAQADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITAAQ
FT                   AERLVTDKGEWLLYRALVKGLSVKELLAGMVNNALSKLPIPKLMRWSDKETQFVRPVHT
FT                   VTMLFGNELIEGDILGIKSTRVIRGHRFMGESEFTIDNTEQYPEILQQRGKVMADYVTR
FT                   KALIKQDVEQAAVKLGGIADISDSLLEEVTSLVEWPVVLTAKFEEKFLEVPAEALVYTM
FT                   KGDQKYFPVYDHAGKLMANFIFVANIESSDPQQIISGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLETVLFQKQLGTLRDKTDRIQALAGWIAEKIGADVNHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYQPRFAGDELPSTGISCALAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKKLPLDLQTLTEEAVRLYGDKLTN
FT                   AKVIDDVVEFMLGRFRAWYQEQGYSIDTIQAVLARRPTQPADFDARVKAVTHFRTLDEA
FT                   TALAAANKRVSNILAKSEETLNEKVSASVLKAPEEVKLATHLVVLQDKLAPLFAEGCYQ
FT                   EALVELASLREVVDAFFDNVMVMDEDQQVRVNRLTLLSELRELFLKVADISLLQ"
FT   misc_feature    248136..249788
FT                   /note="HMMPfam hit to PF02092, Glycyl-tRNA synthetase beta
FT                   subunit, score 0"
FT                   /inference="protein motif:Pfam:PF02092"
FT   misc_feature    249855..250145
FT                   /note="HMMPfam hit to PF05746, DALR anticodon binding
FT                   domain, score 1.4e-05"
FT                   /inference="protein motif:Pfam:PF05746"
FT   tRNA            250377..250450
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:250411..250413,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score63.52"
FT   CDS_pept        complement(250836..251237)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00229"
FT                   /old_locus_tag="PAT2264"
FT                   /product="similar to protein gp48 from phage n15"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00229"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82322"
FT                   /db_xref="GOA:C7BHF4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF4"
FT                   /inference="similar to DNA sequence:INSD:BX571861"
FT                   /inference="similar to DNA sequence:INSD:CR942285"
FT                   /protein_id="CAQ82322.1"
FT                   /translation="MFELIFHPEAQQEILDLDSAMQGKAFAALDKLESQGNQLRYPHTD
FT                   IIQDGLFELRAGKKDITRTFFAFAKEELQKLLADMRRRAGINSTQVAERMGITQPAVSK
FT                   LEKNASKASISTLERYAAACGASIKIVIG"
FT   misc_feature    complement(250845..251012)
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   3.1e-09"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    complement(250845..251009)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3.7e-10"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        251920..252057
FT                   /transl_table=11
FT                   /gene="FNV1263"
FT                   /locus_tag="PAU_00230"
FT                   /old_locus_tag="PAT2265"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82323"
FT                   /db_xref="GOA:C7BHF5"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF5"
FT                   /inference="similar to DNA sequence:INSD:AABF01000037"
FT                   /protein_id="CAQ82323.1"
FT                   /translation="MVYLATKRALRHVFVLIMLIIGFLCVFLLLMTSVEILLTQETTVV
FT                   "
FT   sig_peptide     251920..252036
FT                   /gene="FNV1263"
FT                   /locus_tag="PAU_00230"
FT                   /note="Signal peptide predicted for PAT2265 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.813) with cleavage site
FT                   probability 0.497 between residues 39 and 40"
FT   misc_feature    251953..252021
FT                   /note="1 probable transmembrane helix predicted for PAT2265
FT                   by TMHMM2.0 at aa 12-34"
FT   CDS_pept        252159..253766
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="PAU_00231"
FT                   /old_locus_tag="PAT2266"
FT                   /product="periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82324"
FT                   /db_xref="GOA:C7BHF6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82324.1"
FT                   /translation="MTTSSKKTGLLKLGISLIALAVTASVQAKTLVYCSEGSPEGFNPQ
FT                   LFTAGTTYDASSRPLYNRLVDFETGKTEIIPSLAEKWDISDDGKVYIFHLRKGVKWHGN
FT                   KEFKPSREFNADDVIYTFMRQKDANHPYHKVSGGSYEYFIGMGMGEMINKVEKVDDYTV
FT                   RIELSRPEAPFLADLGMDFASILSAEYADKMMKAGTPEKVDLNPIGTGPFQLVQYQKDS
FT                   RILYKAFKEYWGDKAKVDRLVFSITPDASVRYAKLQKNECQIMPYPNPADIARMKQDKD
FT                   IVLMEQPGLNVGYVSFNVTKKPLDNVKVRQALAMAVNKDAIIDAVYQGAGQKAKNLIPP
FT                   TMWSYDNALKDYQYDPEKAKQLLKEAGMSDGFAIDLWAMPVQRPYNPNARRMAEMVQAD
FT                   WAKIGVKAKIVSYEWGEYLKRAKDGEHQIVMMGWTGDNGDPDNFFATLFSCAAKERGSN
FT                   YSKWCYKPFEDAIQPARIASEHAKRVELYKQAQAVMHEQVPALIIAHSTVYEPVRKEVK
FT                   GYVVDPLGRHIFSNVSLE"
FT   sig_peptide     252159..252242
FT                   /gene="dppA"
FT                   /locus_tag="PAU_00231"
FT                   /note="Signal peptide predicted for PAT2266 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.991 between residues 28 and 29"
FT   misc_feature    252375..253523
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding prot, score 8.1e-95"
FT                   /inference="protein motif:Pfam:PF00496"
FT   CDS_pept        253983..255002
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="PAU_00232"
FT                   /old_locus_tag="PAT2267"
FT                   /product="dipeptide transport system permease protein dppb"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00232"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82325"
FT                   /db_xref="GOA:C7BHF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82325.1"
FT                   /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVTIMAGERGIS
FT                   AERHAQLMAEMGLDKPLWQQYFHYVNGVLHGDLGISLKSRISVWEEFVPRFKATLELGV
FT                   CAMLFAIAVGIPVGVLAAVKRGSVFDHTAIGLSLTGYSMPIFWWGIMLIMLVSVQLDLT
FT                   PVSGRISDSVFLDDSNPLTGFMLIDTLIWGEEGDFKDAIMHMILPAIVLGTIPLAVIVR
FT                   MTRSSMLEVLGEDYIRTARAKGLSRIRVIVVHALRNALLPVVTVIGLQVGIMLAGAILT
FT                   ETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVAIMIILVNLVVDVLYGIVNPRIRHKK"
FT   misc_feature    order(254007..254075,254277..254345,254382..254450,
FT                   254586..254645,254757..254825,254907..254975)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PAT2267 by TMHMM2.0 at aa 9-31, 99-121, 134-156, 202-221,
FT                   259-281 and 309-331"
FT   misc_feature    254268..254993
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 9.5e-58"
FT                   /inference="protein motif:Pfam:PF00528"
FT   CDS_pept        255014..255916
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="PAU_00233"
FT                   /old_locus_tag="PAT2268"
FT                   /product="dipeptide transport system permease protein dppc"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00233"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82326"
FT                   /db_xref="GOA:C7BHF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF8"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82326.1"
FT                   /translation="MSQVTEPVANNAPKIMTPVQEFWYYFKRNKGAVVGLVYIVLMLLI
FT                   ALLAGVLAPHSAAEQFRDSLLTPPVWQEGGSWQFILGTDDVGRDLLSRLMYGARLSLLV
FT                   GCLVVVLSLLMGVMLGVLAGYFGGVVDIIIMRIVDIMLALPSLLLALVLVAIFGPSIVN
FT                   ASLALTFVALPHYIRLTRAAVLVEVNRDYVTASQVAGAGSMRQMFVNILPNCLAPLIVQ
FT                   ASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVL
FT                   AFNLMGDGLRDALDPKLKQ"
FT   misc_feature    order(255104..255172,255320..255388,255431..255499,
FT                   255641..255709,255806..255874)
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2268 by TMHMM2.0 at aa 31-53, 103-125, 140-162, 210-232
FT                   and 265-287"
FT   misc_feature    255305..255913
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.7e-46"
FT                   /inference="protein motif:Pfam:PF00528"
FT   CDS_pept        255929..256909
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="PAU_00234"
FT                   /old_locus_tag="PAT2269"
FT                   /product="dipeptide transport atp-binding protein dppd"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00234"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82327"
FT                   /db_xref="GOA:C7BHF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHF9"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82327.1"
FT                   /translation="MALLNVEKLSVHFGEEEAPFRAVDRISYRVEQGQVVGIVGESGSG
FT                   KSVSSLAVMGLIDYPGRVMADKLEFNQRDLTKISEKERRQLVGAEVAMIFQDPMTSLNP
FT                   CYTVGYQIMEALKVHQGGNRRTRRQRAIDLLTLVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQVIELLLELQQRENMALVLITHDLALVAEAAH
FT                   HIIVMYAGQVVESGKASEIFRAPRHPYTQALLRALPEFAADKSRLASLPGVVPGKYDRP
FT                   IGCLLNPRCPYADDYCHQVEPELRTVGERQVKCHMPLDDAGRPTI"
FT   misc_feature    256022..256621
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   5.9e-13"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    256025..256618
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.2e-60"
FT                   /inference="protein motif:Pfam:PF00005"
FT   misc_feature    256625..256819
FT                   /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
FT                   transporter, C-termi, score 6.5e-25"
FT                   /inference="protein motif:Pfam:PF08352"
FT   CDS_pept        256906..257925
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="PAU_00235"
FT                   /old_locus_tag="PAT2270"
FT                   /product="putative atp-binding component of dipeptide
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00235"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82328"
FT                   /db_xref="GOA:C7BHG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG0"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82328.1"
FT                   /translation="MSEQTYQERETSTVPLLKAAELKKYYPIKGGLFSPARIVKALDGV
FT                   SFELEKGKTLAVVGESGCGKSTLGRLLTMIEKPTEGELYYQGQDLLVPNKEAEKLRRQK
FT                   IQIVFQNPYGSLNPRKKVGQILEEPLLINTKLSAHERKEKVLQMMEKVGLKTEHYGRYP
FT                   HMFSGGQRQRIAIARGLMLNPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFI
FT                   SHDLSVVEHIADEVMVMYLGRCVEKGSKEMIFSNPRHPYTQALLSATPRLNPELRRERI
FT                   KLTGELPSPMNPPPGCAFAARCRRALSMCTQLQPKLNQHGDQLIACFAVDQDENVAME"
FT   misc_feature    257056..257634
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   3.3e-12"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    257059..257631
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.4e-62"
FT                   /inference="protein motif:Pfam:PF00005"
FT   misc_feature    257638..257835
FT                   /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
FT                   transporter, C-termi, score 8.7e-31"
FT                   /inference="protein motif:Pfam:PF08352"
FT   CDS_pept        258154..258894
FT                   /transl_table=11
FT                   /gene="yhjK"
FT                   /locus_tag="PAU_00236"
FT                   /old_locus_tag="PAT2271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00236"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82329"
FT                   /db_xref="GOA:C7BHG1"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG1"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82329.1"
FT                   /translation="MKMKLRVKRSLTIKQMAAVTGVTLVTIAIFIAIQLCHLIQQRKDD
FT                   YISQLNNAAVQVQVPLTEALLRSDLSKAKELLIGLRTAGILGRADVVLPENIRVIRLNF
FT                   ATHRPIPELAKRVFGIPVEVSIPLYAYGSVPANAKPLGHLILQVDSNRVYRFAMNTLAL
FT                   MLTAYLLLALILTVSISWCINRIIVHPLRDIARDLNNDQPPEPMTCPKHHQDDELGLLI
FT                   RGYNRQFDKHKLPSSRNHPGRFEV"
FT   sig_peptide     258154..258249
FT                   /gene="yhjK"
FT                   /locus_tag="PAU_00236"
FT                   /note="Signal peptide predicted for PAT2271 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.791) with cleavage site
FT                   probability 0.392 between residues 32 and 33"
FT   misc_feature    order(258196..258264,258634..258702)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2271 by TMHMM2.0 at aa 15-37 and 161-183"
FT   CDS_pept        259037..260521
FT                   /transl_table=11
FT                   /gene="yhjJ"
FT                   /locus_tag="PAU_00237"
FT                   /old_locus_tag="PAT2272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00237"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82330"
FT                   /db_xref="GOA:C7BHG2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG2"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82330.1"
FT                   /translation="MQGTKIRYFIGGIMLVVAGQTQAEVLQPDPAWKQGKLENGFNWQI
FT                   LQTPQRPNDRIQLRLVVKTGSLAEKTQQAGYTWLIPKVALFSSKSLSSVKLEQLWNSAI
FT                   DPKYPLPPAIVSYDFTLYSLSLPHNHPELLKNALSWLADAAGKTAFTPETLQHAMKMAN
FT                   TSVATYPPDIQDPVWRRRLKGSTLLGHDPAQSAAHPVDLDKLKQFYRQWYTPDMMTLYV
FT                   AGHVDSRALPENISQSFSSLKGKRHTPATVATLSPMKPETIGIISDKKKEDTLSLIWDL
FT                   NWQPINDSQVLSHYWISDITREALYRYLQLGLEKKNDKALKLGLDCKVQYQRASCALNL
FT                   NTTAGNLKPAMEYLAAELVTLRDKGLPKGQFDELYAQKQTQLKQLFAMYGHTSTDILIN
FT                   QRLLSQQSNVVDIAPEQYQRLRQAFLASLTPEMLNHELKHILSQEVAFVLIQPKGEAEM
FT                   DVNQLRNSFNQIMLLAPDKVDPPAQPPVSKPEEKAS"
FT   sig_peptide     259037..259105
FT                   /gene="yhjJ"
FT                   /locus_tag="PAU_00237"
FT                   /note="Signal peptide predicted for PAT2272 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.984 between residues 23 and 24"
FT   misc_feature    259166..259609
FT                   /note="HMMPfam hit to PF00675, Insulinase (Peptidase family
FT                   M16), score 0.049"
FT                   /inference="protein motif:Pfam:PF00675"
FT   misc_feature    259631..260170
FT                   /note="HMMPfam hit to PF05193, Peptidase M16 inactive
FT                   domain, score 2.4e-06"
FT                   /inference="protein motif:Pfam:PF05193"
FT   CDS_pept        260672..260851
FT                   /transl_table=11
FT                   /locus_tag="PAU_00238"
FT                   /old_locus_tag="PAT2273"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00238"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82331"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG3"
FT                   /inference="similar to DNA sequence:INSD:CP000250"
FT                   /protein_id="CAQ82331.1"
FT                   /translation="MVFSVFISKGILDYAEYHHARQADTTQYCVRGGLYRINMVIARSP
FT                   AYFKQENGELKKSN"
FT   CDS_pept        complement(260843..261733)
FT                   /transl_table=11
FT                   /gene="ybjE"
FT                   /locus_tag="PAU_00239"
FT                   /old_locus_tag="PAT2274"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00239"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82332"
FT                   /db_xref="GOA:C7BHG4"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG4"
FT                   /inference="similar to DNA sequence:INSD:AE014613"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82332.1"
FT                   /translation="MKESITSILIICFLLALGFFLGKLIKENIKAKLVGSITMIVMLLL
FT                   FMMGIELGEVFINSNLGTSIIIESIVLSSLISISTFLILFKRKFCQIEKKEKQSFLDPF
FT                   IGCFKAIMFFCLGVLVYKFTHLSLAEHNISSNYALYTLILLVGLDLVNFSFKDIKINHI
FT                   KIPIFTIAGTVIGALIFSMLTDYSISESMLISSGYGWFSLSGPMVTSMTNPHYGSLSFM
FT                   TDLFREIFSIFFLYFLGRSYPQGAIGISGAAALDSALPFIKENCTNEDIKYAIASGFVL
FT                   TLLAPLFISVFVGLV"
FT   misc_feature    complement(order(260849..260917,261020..261088,
FT                   261182..261250,261269..261328,261371..261424,
FT                   261482..261541,261584..261637,261671..261724))
FT                   /note="8 probable transmembrane helices predicted for
FT                   PAT2274 by TMHMM2.0 at aa 4-21, 33-50, 65-84, 104-121,
FT                   136-155, 162-184, 216-238 and 273-295"
FT   misc_feature    complement(260852..261412)
FT                   /note="HMMPfam hit to PF03956, Membrane protein of unknown
FT                   function (DUF340, score 1.5e-34"
FT                   /inference="protein motif:Pfam:PF03956"
FT   CDS_pept        complement(261733..262491)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00240"
FT                   /old_locus_tag="PAT2275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82333"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG5"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:BX571966"
FT                   /protein_id="CAQ82333.1"
FT                   /translation="MQNNNLKSEGFSHYQLNLEYSEKDKSNLLNEFSKLEPDAYAPDKV
FT                   SRFRRYGNAIIIPWLKEPKLYWLPTVKDDNGNNLSGYDQGSNNPEHKNMRYFSALSDEV
FT                   KNNALLESIILDDFKSTFGLNDHYLPIYVGIHFVKVKCTDNKLPGFSSPDCFHQDGEPF
FT                   TFAHLINRSENIDGGINYIGKVSARNKKIEDVSDDEIISQFTLENFLESFAVCDELVSH
FT                   YISHITLKEDDGEAERSMILIDFSMTKQDI"
FT   CDS_pept        complement(262904..263110)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00241"
FT                   /old_locus_tag="PAT2276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82334"
FT                   /db_xref="GOA:C7BHG6"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG6"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82334.1"
FT                   /translation="MPFVNIRITREGATAEQKKQLIEGATQLLVDVLGKNPATTFVIID
FT                   EVETDNWGIGGQNVTELRAAAKK"
FT   misc_feature    complement(262925..263107)
FT                   /note="HMMPfam hit to PF01361, Tautomerase enzyme, score
FT                   1.9e-23"
FT                   /inference="protein motif:Pfam:PF01361"
FT   CDS_pept        complement(263166..264206)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00242"
FT                   /old_locus_tag="PAT2277"
FT                   /product="similar to putative membrane protein yhjd of
FT                   escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00242"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82335"
FT                   /db_xref="GOA:C7BHG7"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C7BHG7"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82335.1"
FT                   /translation="MRSLIFIQSNYLRLYMPKDAERQEIAEHQPERLSRTPLEKGIHHG
FT                   KTAISLTVRIGNYIRNIPVVAHFIRATLRFNDRMGNQFGAAITYFSFLSLIPILMLSFA
FT                   IAGFILASNPDLLAKLINGIANSISDPTLANTLKNSVDTAIKQRTTVGLTGLAIALYSG
FT                   VNWVSNLRQAILAQFHPVWLRNQEDEKKIYFKYIRDAISLIGLLLALVITLSLTSIAGS
FT                   AQAIIVEILGLSGIEWLRPSWFLIGLAISIIANYLLFLWLFWVLPHHQPERKALLKGTL
FT                   MAAIGFEVIKYIMTMTLPRLASSPSGAAFGSVIGLMTFFYLFARLTLFCAAWIATADNN
FT                   QDKNTE"
FT   misc_feature    263183..356111
FT                   /note="Region 10"
FT   misc_feature    complement(263184..263981)
FT                   /note="HMMPfam hit to PF03631, Ribonuclease BN-like family,
FT                   score 2.6e-26"
FT                   /inference="protein motif:Pfam:PF03631"
FT   misc_feature    complement(order(263202..263270,263313..263381,
FT                   263415..263483,263541..263609,263703..263762,
FT                   263874..263942))
FT                   /note="6 probable transmembrane helices predicted for
FT                   PAT2277 by TMHMM2.0 at aa 89-111, 149-168, 200-222,
FT                   242-264, 276-298 and 313-335"
FT   CDS_pept        264417..264758
FT                   /transl_table=11
FT                   /locus_tag="PAU_00243"
FT                   /old_locus_tag="PAT2278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00243"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82336"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM43"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82336.1"
FT                   /translation="MQWRSRFNGRIILMSVTMLSLSISAIAAGPDCSDINGWATQLTAN
FT                   SLNDFGIDRHNIDFDKTQTSLILSEKLNKSEVAIILQREIAKAERGKVLNDKHEFDDIY
FT                   LSQPIYRQM"
FT   sig_peptide     264417..264497
FT                   /locus_tag="PAU_00243"
FT                   /note="Signal peptide predicted for PAT2278 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.985 between residues 27 and 28"
FT   misc_feature    264435..264503
FT                   /note="1 probable transmembrane helix predicted for PAT2278
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        264816..265136
FT                   /transl_table=11
FT                   /locus_tag="PAU_00244"
FT                   /old_locus_tag="PAT2279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00244"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82337"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM44"
FT                   /inference="similar to DNA sequence:INSD:U70214"
FT                   /inference="similar to DNA sequence:INSD:BX571871"
FT                   /protein_id="CAQ82337.1"
FT                   /translation="MMNVLLVYTLHPSSCCFVGCFHSPQSHSYLCSWGFVYLPPRCNSK
FT                   FIGYREYLPNFKGNKKILMLALFKNHLHQGGLLSYDLIYKIFVLDGQLLKMVCLAHLLK
FT                   RI"
FT   CDS_pept        complement(265201..269643)
FT                   /transl_table=11
FT                   /gene="hylA"
FT                   /gene_synonym="phlA"
FT                   /locus_tag="PAU_00245"
FT                   /old_locus_tag="PAT2280"
FT                   /product="hemolysin phla protein"
FT                   /note="hemolysin phla protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00245"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82338"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM45"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /inference="similar to DNA sequence:INSD:AL662784"
FT                   /protein_id="CAQ82338.1"
FT                   /translation="MKNKKFKLSPTGKLAASMAIILVSCSTSFANDIVGGGDSAHRPDI
FT                   LAIEGKATVINIVPPSPSGLSHNQYLDYNVGHAGAVLNNALQDGQSQLAGQLAANPNLN
FT                   GQAASLILNEVISRNPSLLLGQQEVFGIAADYVLANPNGITCNGCGFINTNQASLVVGN
FT                   PLVEQGNLQSFNTFNNQNGLKIKSDGLTANAVLNLIAPKIDNRGTVTAQKQINAISGAN
FT                   KISATRDVIDSQQELTGVLDSYYLGSMQAGRIHLLNTAKGSGVNLQGSLTASNEIIVDA
FT                   HGNLNLEAAHLQGGNIDLLGDNIEVKGKVSESKYNRDGSNNYQSYFRSVYTNDSKNSQS
FT                   ITRTKLAGKNISLVANNNHQITATDIVGDDVNLSGANLTLDGQQLNQSTKNIDNQRGYS
FT                   WRYEVTKESEKQHQAGNNIQAKKNVVLNATEGDVKILGSKIDAKDKLAITAKKGVQIAG
FT                   LTETEKTSETGYKKNHTAKLQTGSWEESKQTQRLIASELQAGTDLNIKAGTQADILGAK
FT                   VHAGQNMTVTAGQQLQIDVQKISDNRIVRDDKKYWGGIGGGGNKDNSELKETSHASELT
FT                   ANGRLLLSGQEGISITGSKVKADQGAFVDANSGKLTIDNAVSHLNQKIDERTGTVFNIT
FT                   NSSQKTNSKQQKSHGSELVSEADLKLLGDEDFNIIGSQVKSAGALNLKTAGNIKVLSYG
FT                   EQQQVDKQNTSLDLQSHFQPKADKQYRAGVGIEHTSNSQKNQTVIQKASTLSGGSITLD
FT                   TDKDVILTGSNLVTTKGDAKISGANVHLLAAEGKKSEEKFQSNKHVGVYLTGGIDKVGS
FT                   GIYGGYEGNNSNHTNSTAVVSGSQIAGDLNIKANGELIQEGTDHKVSGTYTAEAGKVSN
FT                   LATSNTESHSNNKLQVGTDIGVNIDYSAVTRPVEKAVKDPVKAALDGTFTKKGTPNLGA
FT                   DLAANGNNIQTEDKKSEAVVTSVQASNVVIKTNGELYDQGTQYHANKGNVTLEAGNHTS
FT                   EAAQNRHESRHNETSGKADLRVYTTTGEDISANGKGKGGTQSSYTATTQSVTSKITAEN
FT                   DINIRVDRDAEYQGTSLDAKTGKTNIDAGGDIRFDHAANSTTKTSTGYHGEASAKGGNS
FT                   PEGKNIHIGLGGGYNTDSKNSSTAQVSKIDGQQGVNLNAGNHLTLKGSEVTGKQIDLKA
FT                   KQGNVELVSAQDRVNNDGWEFNLKGNGGHSNSVKKAEDDSTTTTTKQSFGGELKAGVDR
FT                   LQATTHHNSHIKGENVVINSGGDTTISGARIDADQVTGNIGGDLRVESRKDTEHGLNVG
FT                   VDAGLNYAKESKVKSDDLPKDEATKDSPPQDDSSKDDILKDDPTKNPTEEPQQKGLQER
FT                   LTSAFNTINNLKGINGVTGKFKGNVDIKDRESVSEQSVISGNQGVNLDVKGNTHLVGGQ
FT                   IGSEKGNVILNTQNVEQQSVTGYDNGKGGNIALPDSVSGIVKAVQEGVLSGKIPLVKTY
FT                   SNETENGMTNGEIINHKSQ"
FT   misc_feature    complement(268777..268995)
FT                   /note="HMMPfam hit to PF05594, Haemagluttinin repeat, score
FT                   2.7e-05"
FT                   /inference="protein motif:Pfam:PF05594"
FT   misc_feature    complement(269137..269544)
FT                   /note="HMMPfam hit to PF05860, haemagglutination activity
FT                   domain, score 9.3e-43"
FT                   /inference="protein motif:Pfam:PF05860"
FT   sig_peptide     complement(269554..269643)
FT                   /gene="hylA"
FT                   /locus_tag="PAU_00245"
FT                   /note="Signal peptide predicted for PAT2280 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 30 and 31"
FT   CDS_pept        complement(269705..271372)
FT                   /transl_table=11
FT                   /gene="phlB"
FT                   /locus_tag="PAU_00246"
FT                   /old_locus_tag="PAT2281"
FT                   /product="phla hemolysin secretion/activation protein phlb"
FT                   /note="phla hemolysin secretion/activation protein phlb"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00246"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82339"
FT                   /db_xref="GOA:B6VM46"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM46"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to AA sequence:UniProt:Q0WAT7"
FT                   /protein_id="CAQ82339.1"
FT                   /translation="MIKRISILILWCISSQITASPAEINDILPMTEARRTLQESSREIN
FT                   QLIEQRRYQQLKQQANTVPESTPAPVLPESRQCLPLTGVYLKGVSLLSVRDLNTLSALS
FT                   PECISSHDINRLSHELTRLYISKGYVTARIQFIAPDADGELGLNVVEGFIEKIEGGDRW
FT                   VNSNMLFPSLEKQPLNITQLDQGLDQANRLQSNKTTLDILPGTVNGGSIIKLHNQHSKP
FT                   WLLNVTTDNYGQKSTGKWLARTNASFDSPLGLSDFISLNASSTLDSPSNRYSRAATLLY
FT                   SVPYGAATFSGFGSYSQYASHPYLQNKTVKIYGNTQQFGMRSDFAFYRNQSQINTVSGQ
FT                   LIYKNYNNYINESKIGVSSQTLSVFELGVNHLQIIPTGLITLNLSVEQGLPWFGAQTST
FT                   TDLDKQFTKGKLMVNLHQRFMLFNSLYQLNNLLYGQYNRSGLPGVEWLNITDRNAVRGF
FT                   SKNTLSGDNGWYLQNTLSRTFPIANSTLSMRIGIDVGQIHGYRSPLGWQSSAGISTGAT
FT                   LKYQRMVFDIEASRGKWLSNHKAVDEPVQVLTRFSYTF"
FT   misc_feature    complement(269708..270895)
FT                   /note="HMMPfam hit to PF03865, Haemolysin
FT                   secretion/activation protein ShlB, score 1.8e-228"
FT                   /inference="protein motif:Pfam:PF03865"
FT   misc_feature    complement(270917..271138)
FT                   /note="HMMPfam hit to PF08479, POTRA domain, ShlB-type,
FT                   score 1.2e-24"
FT                   /inference="protein motif:Pfam:PF08479"
FT   sig_peptide     complement(271316..271372)
FT                   /gene="phlB"
FT                   /locus_tag="PAU_00246"
FT                   /note="Signal peptide predicted for PAT2281 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.949 between residues 19 and 20"
FT   CDS_pept        complement(272071..272667)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00247"
FT                   /old_locus_tag="PAT2282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00247"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82340"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM47"
FT                   /inference="similar to DNA sequence:INSD:AF021840"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /protein_id="CAQ82340.1"
FT                   /translation="MSDIIQNRYDSVDGRVVTAEVIFVISVEDILAYLHNHQIDPKLYL
FT                   DSTNPYRLNSGVYIISYTPTLGVHGMHASCSSGEHIKVPVGSNIRWRATTISDNFNYTV
FT                   VLYKFYKLHSSGDDIISPPSKIWSHTSSKIIPALLSGVNANEDSPKLEFTETNDHFFQA
FT                   TALTKGKEQYTWAFCVYDGEDLQGYFKYDPYIKVI"
FT   CDS_pept        complement(273422..273994)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00248"
FT                   /old_locus_tag="PAT2283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00248"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82341"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM48"
FT                   /inference="similar to DNA sequence:INSD:BX950851"
FT                   /inference="similar to DNA sequence:INSD:AF021840"
FT                   /protein_id="CAQ82341.1"
FT                   /translation="MNSIEYIPSEDRSFKPIDVIVCVDAQTIEDDITAGKLKLSKTQNS
FT                   PTGISNKYFYYITSQNQLYAPKNNATGELEITDKVGGIVRWRASSLSTQFDYQVFLYHM
FT                   TGSGVNTYISLPTLIETDFNIVVPEQKGTGLPNHIYPVTFKPRRVYHQQSTLLSPGRAQ
FT                   YTWYISIYNRWNNLIGYCTHDPFINII"
FT   CDS_pept        complement(274025..274546)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00249"
FT                   /old_locus_tag="PAT2284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00249"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82342"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM49"
FT                   /inference="similar to DNA sequence:INSD:CP000380"
FT                   /inference="similar to DNA sequence:INSD:AF021840"
FT                   /protein_id="CAQ82342.1"
FT                   /translation="MSEGIDIMVCVDANAIVQRYNLSKRSDLPTKLDKNNKYLYYITGN
FT                   GNIYAPGNNATAWTAVKVDSGSVIRWRPSSLSQQFEYTVLLYEMKGDAISKGIIDSPSM
FT                   YSGDITIPYLAFDNEETISTIYKQDNVRQYYHQSTAENKGKGSCNWSMMIYRRESLMGY
FT                   ISHEFSIEIM"
FT   CDS_pept        complement(275214..275765)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00250"
FT                   /old_locus_tag="PAT2285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82343"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM50"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AF021840"
FT                   /protein_id="CAQ82343.1"
FT                   /translation="MNDKTSFRKINSIDILVAVDVKSIANDIGKINSKLSQDCKKPTPI
FT                   DDKYFYYITTQDQQYTPKDNATGKTIITGKVGDSIRWRATSLSAQNNHQVFLYHMKALS
FT                   NATYTSSPIINKLSSDIYFSKETINPKTVCTPFTAMYISYLETTLLSPGDVQYISYISI
FT                   YDNNNSLIGYCSHDPLIHII"
FT   CDS_pept        complement(275802..276317)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00251"
FT                   /old_locus_tag="PAT2286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82344"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM51"
FT                   /inference="similar to DNA sequence:INSD:CP000150"
FT                   /inference="similar to DNA sequence:INSD:AF021840"
FT                   /protein_id="CAQ82344.1"
FT                   /translation="MSEIVDVLVCVDVNSIIKEYSSLSNTPNSPTKIDNKFIRHITSNS
FT                   NTYLPEKNATGELKIKINIGDTIKLRVMSLTQQFEYGIYPHKIVMLPEKKVTLNASDNY
FT                   SYTLYLDKSEDSSDICGKYENQQTVDNYIEWKSQTRGQISFYCVLYIYNVKMKLNKYIF
FT                   YDTKINVL"
FT   CDS_pept        276798..277526
FT                   /transl_table=11
FT                   /gene="sdiA1"
FT                   /locus_tag="PAU_00252"
FT                   /old_locus_tag="PAT2287"
FT                   /product="similar to probable transcription regulator SdiA
FT                   of Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00252"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82345"
FT                   /db_xref="GOA:B6VM52"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM52"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82345.1"
FT                   /translation="MNIYRPYISPYKFHELDVDAYFIDEICELIDKISGFRLFSLVLKT
FT                   RFPVSGREVYFFDNYHESWRALYIEKKYWMIDPVLHFRPVPPTFSRVWDLNFFAESNGK
FT                   ELWYMTQEHGFRSGVTFGLPAFSGTYGIFSVAGKDGPIDNDTMYKCSGEILKVYIRIIR
FT                   YLISHTKYLQTFYIDEISFSHRELEVLRYTADGMISSEIASTICVTKSTVDFHLMNIVK
FT                   KLGCRNKFQAIAKAALLGYI"
FT   misc_feature    276861..277301
FT                   /note="HMMPfam hit to PF03472, Autoinducer binding domain,
FT                   score 2.8e-05"
FT                   /inference="protein motif:Pfam:PF03472"
FT   misc_feature    277332..277505
FT                   /note="HMMSmart hit to SM00421, no description, score
FT                   4.8e-16"
FT                   /inference="protein motif:Smart:SM00421"
FT   CDS_pept        277591..277824
FT                   /transl_table=11
FT                   /locus_tag="PAU_00253"
FT                   /old_locus_tag="PAT2288"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00253"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82346"
FT                   /db_xref="GOA:B6VM53"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM53"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82346.1"
FT                   /translation="MIFFKIEKLVQSNTLLLGQNCNITVLLVLYSMFVIDIELYFIPVI
FT                   FQVASLLAALTHPGHRVIYAPGDSLPGRRDAS"
FT   misc_feature    order(277627..277695,277705..277758)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2288 by TMHMM2.0 at aa 13-35 and 39-56"
FT   CDS_pept        complement(277912..278502)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00254"
FT                   /old_locus_tag="PAT2289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00254"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82347"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM54"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:BX950851"
FT                   /protein_id="CAQ82347.1"
FT                   /translation="MMNEIIQGKDNITARNSVTADVTFVIDVDSIIEYLHTNNIKNSLD
FT                   PKNPITIRQHVYIANYTPELGLKVASSSGARVTVPINANIRWRATTVSNNFDYTIILYK
FT                   FKKLSTGEDVISVPSQIWSQNPIGKKVPMVPSGVNADKDEPTVIFIESKDSYFQATAHK
FT                   PGVEQYTWFFAAYDGTKLLGYYRYDPYVEVTNS"
FT   CDS_pept        279005..279733
FT                   /transl_table=11
FT                   /gene="sdiA2"
FT                   /locus_tag="PAU_00255"
FT                   /old_locus_tag="PAT2290"
FT                   /product="similar to probable transcription regulator SdiA
FT                   of Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00255"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82348"
FT                   /db_xref="GOA:B6VM55"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM55"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:X03691"
FT                   /protein_id="CAQ82348.1"
FT                   /translation="MNVYRSYTLPYKFHELDVDAHFVSEVFEIINKISGFSLFSLILKA
FT                   RFPISNREVYFFNNYHESWRNLYIERKYWMIDPTLNFRPVPPSFSKIWDLDFFSESNGQ
FT                   ELWYVSQKHGFRSGITFGLPAFSGTYGIFSVAGKDGHIDNETMYKCSGEILGVYIRIIR
FT                   YLTSHTKYLQFFYVDETSFSNRELEVLRYTADGMTSSEIALTICVTKSTVDFHLMNIVK
FT                   KLGCRNKFQAIAKAVLLGYI"
FT   misc_feature    279059..279505
FT                   /note="HMMPfam hit to PF03472, Autoinducer binding domain,
FT                   score 5e-06"
FT                   /inference="protein motif:Pfam:PF03472"
FT   misc_feature    279539..279712
FT                   /note="HMMSmart hit to SM00421, no description, score
FT                   6.6e-18"
FT                   /inference="protein motif:Smart:SM00421"
FT   CDS_pept        complement(279936..280955)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00256"
FT                   /old_locus_tag="PAT2291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00256"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82349"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM56"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /protein_id="CAQ82349.1"
FT                   /translation="MKLKLLLLLSGVIFMFNAKADDPRLYIRSVFDIQYAFCDIKTNGV
FT                   TGFSNRNSALEGRGFGTASTGSMLFMVNGENEISLEFGALGWFSSDEMSDKARNHFNPE
FT                   AKCQLELTAMRGKNSQILTAIEVAIDENGQPVATKSKDEPKYAAISTPVIRHVIQAEST
FT                   EAGHIEKQYFDPKEFPPNMTLYRFSRNVKISGLPDWEWIKATPYTDTPEQRRQLQQAYM
FT                   AVWQAYHAKDVNTIREQQKVSLKAWAWSTGESEESIFTDQSVYHDIKIKSFKMIPINWD
FT                   DYRVKIMNQGRMVRLVNKSDLRNSPISYYYVDDEDGETVLATVAPIFSLINGRFVQVI"
FT   sig_peptide     complement(280896..280955)
FT                   /locus_tag="PAU_00256"
FT                   /note="Signal peptide predicted for PAT2291 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   CDS_pept        complement(281067..282569)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00257"
FT                   /old_locus_tag="PAT2292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00257"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82350"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM57"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82350.1"
FT                   /translation="MTKQRISPPAGSACMTCNNPNPCLCEVSVTFEKKTQVWPKKPSIN
FT                   MNLVDNGKGQIGTIKITEKCDHAKHQAKLHGGPKEKTLKFNTPEKVTLFYKEELKSIDI
FT                   QNGLKSVASYLSNIANPTDMYKAPRYYKLEIKACTGSRKYATIAVYPSVRFMVSVGFSF
FT                   NLSYDKRSIKERRDEQIKARQAMENVKPKNGNKLRKGWTTRTDEFSLTRETKLKVEYAL
FT                   TVQDKDYSTSFINTKQAKETRKDLDAISLAEKLLGYTKKYLVPAPGSKGKASQNYELLN
FT                   LKLTPSNIGLAYAYDRTTSVEDSTHFVGFYAAPLMGMTAKLDLIQLGATYCKIEFLAAK
FT                   FRQALERKNANDKNYLELECCLIVTCDLSFQLGAAYKSKQWTFDAGNKNNLKLSLEGKV
FT                   SAAFKQKILIVEIALNAKGTIKTAAGFQFDQHNKGIDLVGYHNGITAEIELSADAEIGR
FT                   KKKASKKAKNKWTWVIADPLKASESPLRINVLGKERPITVQK"
FT   CDS_pept        complement(282670..283041)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00258"
FT                   /old_locus_tag="PAT2293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00258"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82351"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM58"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /protein_id="CAQ82351.1"
FT                   /translation="MLKITQEQYAHFNHLFEQRYINKLTHFINEVSYYHEADAINILHS
FT                   VLSALSDKILINSLPNISAAPSHINEEALIRHQNLAEACFYFCQDNEITDERYIRGFRY
FT                   LLMERRIEQFQHIPSTWLT"
FT   CDS_pept        complement(283292..284311)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00259"
FT                   /old_locus_tag="PAT2294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00259"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82352"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM59"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82352.1"
FT                   /translation="MKLKLLLLLSGVLVMSSANADEPRLYIRSVFDIQYAFCDIKTNGV
FT                   TGFSNRNSALGGRGFGTGSTGSMLLMANGENEISLEFGALSWFSQDKLSDKARNHFNPE
FT                   AKCQLELTAMRGKNNQTLTAIEVTIDENGQPVATKSKDEPKYATISTPVIRHVIQADNV
FT                   EAGHIEKQYFDPTEYPPNMTLYRFSRNVKISGLPDWEWIKATPYTDTPEQRQQLQQAYM
FT                   AVWQAYNAKDVNTIREQQKVALQAWAWSTGENEESIFTDQSVYSNIKTKSFRMIPINWN
FT                   DYSVQIMNRGKMVKLVNKSILEYSPISYHYVDDEDGETVLSTISPIFSLINGRFVQVI"
FT   sig_peptide     complement(284252..284311)
FT                   /locus_tag="PAU_00259"
FT                   /note="Signal peptide predicted for PAT2294 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   CDS_pept        complement(284325..285923)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00260"
FT                   /old_locus_tag="PAT2295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82353"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM60"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82353.1"
FT                   /translation="MTQQSTSPPAGAACMTCNNPDPCLCEISVTFEKKTQVWPKKPSIN
FT                   MNLVDDGKGQTGTIQIAEKCDHTKHQAVLLGGPKEKTLKFNTPEKVTLFYKEHLEDTDI
FT                   ESSLESIVSYLSNIANPSDMYKAPRYYKLVTEACTGRQKYVTIAVYPSVRFMVSVGFGF
FT                   DFSHGERPIKERRDEQRKARRAMENVKPKDGNKLRGGWTVHTDKFYLTRETTLSVEYAL
FT                   TVQDMDYSNKFAKANKVRKTRESLDAINRVEKLLGYTKKYLAPAPDSKGKGTHDYQLFD
FT                   LKIAPINIGLAYAYDRTASVDDSTHFVGFSAAPFMGMTAKLDLIQMGAAYCKIDTIAAK
FT                   FRKAIERKNANDKNYLEIECCLILTCNLSFQLGAAYKSKQWTFDAGDKNDLKLSLEGKI
FT                   NAAFKTKIMIMEVALNAKGAVKTAAGFKFDQHDKGIDLVGYHDGITAEIEVEADIEADG
FT                   KENSIAKVKKKWVIADPLKASESPLRISLLGEQRPITRPETVPGAETTPWEMGYNPKPK
FT                   LDNIPFINSGFPGMR"
FT   CDS_pept        complement(285946..286872)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00261"
FT                   /old_locus_tag="PAT2296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82354"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM61"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82354.1"
FT                   /translation="MAEEKHYAVIDGAAEPRLFFILEHFDPPVTCLYDESLQPELLKVA
FT                   PYLVEVTEKVGLFLAEWETPWGIFLHSQADMRTLRQHLRKYLQVLLPDQAKPVFFRFYD
FT                   PRNIWDFLSVLSDWEIHCFLGPIDNIATNYAGIDRQDNFHTARKPFPAEARSRQKMLKI
FT                   TQEQYAHFNHLFEQRYINKLTHFINEVSYYHEADAMNMPHSVLSALSDKILINPLPDIS
FT                   SAPSHINEEALIRHQNLAEACFYFCQDNEITDERSIRGFLYLLMERRIDQFQHIPSTWL
FT                   AQLRDNQGPGYYRMEKLLTSELGFIPK"
FT   CDS_pept        complement(286872..288842)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00262"
FT                   /old_locus_tag="PAT2297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00262"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82355"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM62"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AF044503"
FT                   /protein_id="CAQ82355.1"
FT                   /translation="MADSGLVFTLSVGNLPAHTFAVVEFTLNEALSTPFSLDATLTSAD
FT                   PDIDFKDVLDNAATLSVYRDGLPEREVTGIVTQFEQSTTGRHRTHYSLSLQPALWRAGL
FT                   RVNSRIFQHQSITDIIDTLLKENGIRDIVYTLGYEHPEREFCVQYDESDLAFLHRLLAD
FT                   EGIFYYFEFNQGKNGQTIFFADSCLALGNRFSVPYNPEPDVLGRQGSIQQFRWREQVGI
FT                   QGISLRDRTFKNPPWTAEYHFYESKSANQRTDLTSYYHYDFPGRYKDERGEHMSRYRLE
FT                   ALRRNDLLGHAHSDCFFLWPGLMFTLSHHPKETFNVPWQVISIHHHGRQPQADETRSGD
FT                   TGTTLTNHFTFGDRDRSWRPSPYPKPRIDGLQVATVVGPEGEEIFCDEYGRVRVQFAWD
FT                   QYGQFNDQSSCWIRVSQAWAGKGWGMITIPRVGQEVLVDFLHGDPDQPIITGRAYHASN
FT                   LPPNRLPMAKTQMSIRSKTHKGEGFNELRFEDEKDREEVFIHAQKNLAIQVRNSRDERI
FT                   NYNRTTSIGHDDELVIAHNRKVTVEGQQEHKTTGNYLAQIDGDKALQVKGDVAQKIQGI
FT                   FSVDANGDLTVQSGSKISLRVGGNFIVIHAGGVDIKGPAINLNSGGSPGDLLQPANPAI
FT                   LQAAASAGSMFVAHCPMKDNQ"
FT   CDS_pept        complement(289015..289284)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00263"
FT                   /old_locus_tag="PAT2298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00263"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82356"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM63"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to AA sequence:UniProt:Q0THW5"
FT                   /protein_id="CAQ82356.1"
FT                   /translation="MGNAVKIGDIGTAHDDCEATPVISGSSSVKADGIPLARQGDSLAS
FT                   HSSHPRTIAGGSSTVFIDGKPAARTGDAVSCGGVVIGGGSVNIG"
FT   misc_feature    complement(289039..289128)
FT                   /note="HMMPfam hit to PF05488, PAAR motif, score 1.8e-09"
FT                   /inference="protein motif:Pfam:PF05488"
FT   misc_feature    complement(289129..289221)
FT                   /note="HMMPfam hit to PF05488, PAAR motif, score 0.00073"
FT                   /inference="protein motif:Pfam:PF05488"
FT   CDS_pept        complement(289580..290272)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00264"
FT                   /old_locus_tag="PAT2299"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00264"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82357"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM64"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /inference="similar to DNA sequence:INSD:CP000026"
FT                   /protein_id="CAQ82357.1"
FT                   /translation="MKKIYRIAITLLIVIGSLGLWHQISLKNKMAIFVNNPDPSYLYDK
FT                   VWFDASKWLNSGDYIKINDFYLIKLKPIDLNQVKNSEYFMYYDIYYNIRHRTYGDLDRT
FT                   ANFNELVQKVIGPADIKKETDAKTDLEGTERLSKLISIPRYEYLYSTFDNEKQQPVIDS
FT                   LLVSFSYKDQKYEMVIDAVIDEEDKKNQFPYSYIALTESIQHHGSFYKANDLLTYKLYL
FT                   EEKQKEKK"
FT   misc_feature    complement(290201..290254)
FT                   /note="1 probable transmembrane helix predicted for PAT2299
FT                   by TMHMM2.0 at aa 7-24"
FT   CDS_pept        290892..291038
FT                   /transl_table=11
FT                   /locus_tag="PAU_00265"
FT                   /old_locus_tag="PAT2300"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00265"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82358"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM65"
FT                   /inference="similar to DNA sequence:INSD:AP008232"
FT                   /protein_id="CAQ82358.1"
FT                   /translation="MGFLLSLDSLDSLDSLDSLDSLDSLDSLDSLDNPVMGNFNNNMVR
FT                   KFS"
FT   CDS_pept        complement(291547..292860)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00266"
FT                   /old_locus_tag="PAT2301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00266"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82359"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM66"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /inference="similar to AA sequence:UniProt:"
FT                   /protein_id="CAQ82359.1"
FT                   /translation="MITVDTIIFVYDCFADIGQIQGSHQVQTGTASRGFHYGFLAFTHP
FT                   AISQFRPLSGMDAINEQDGLIVSGFLLEFPVGFYKGPLLFRVELVWHAGRFFITKSIVV
FT                   QPFIHAGNGVTDIPRFFDKVDNRLCGGQKIRGQISDKFLRLCFAEVALRAAIVGLEFAV
FT                   IKVIADMTINGHFMQAQGLSDHDRAPALRGQQDRFDTITLPLITAGVMKVFKFGFLFVG
FT                   NEYFHDGYPEPHLGENQAVSMSTGIEHNISDSSLDIKSENEQLARLLGRNKINHNNEKY
FT                   YYEYSQQFDIKNDYPVWNWVNSYQFSKENNVIDSLPEKYQSALISAYKEYWALLKSKDL
FT                   KGLKQLHKEFLDESVRANGGNNDDYFSSIGLDEIIDSSDLKLLPLDFSQSKIDISLDGR
FT                   VAFMSPSPLVFINKNNSKNKTLLNPKYRFDGNKFILTR"
FT   CDS_pept        complement(293168..293614)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00267"
FT                   /old_locus_tag="PAT2302"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00267"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82360"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM67"
FT                   /inference="similar to DNA sequence:INSD:CP000096"
FT                   /protein_id="CAQ82360.1"
FT                   /translation="MFNYKNFLAVLLFTLPITGSSKESENSINNKIEPTDYRLEIEVNK
FT                   CSIELFINGMRVLSYYDKEPMNTLIGIGEYLKPKNNTIQFYTWPSNRKKDIFDSGSKCN
FT                   FTLEARNRFETPDLKPVMSIKYNPNDNIYPLNLKMQDSESENCH"
FT   sig_peptide     complement(293549..293614)
FT                   /locus_tag="PAU_00267"
FT                   /note="Signal peptide predicted for PAT2302 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.968) with cleavage site
FT                   probability 0.388 between residues 22 and 23"
FT   CDS_pept        complement(293976..294974)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00268"
FT                   /old_locus_tag="PAT2303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00268"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82361"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM68"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82361.1"
FT                   /translation="MYRMKMKKSGCFKSRYLKKNRRTGYLLGSTLLALLLMVNSSISGK
FT                   TNMIEYKYLLSFKSHRSLCVARVNGVMALDNVGSKTGTQSSGFNVTAFVENGQNTMELL
FT                   MGQKSFDNDTERFHPESWCEATLTKASPYGDKDEVISHIKLTVDDKGNVTTRESQSQLP
FT                   NGKPGFDYTAMSKVEAEEGLFAAQKTFTLSGLPDWMWTKARPVSEKNDIEAIKNFYLEI
FT                   SNTLHQRDLNKLWKMSQPAWEEWAIGENSRPETFFNSFGFKEILDDKNYIVRAPDWSRY
FT                   KLISYKEGRLFRLEEGALGSSPLVLDNKATNKNFEYNPYLSIINGKVMIAR"
FT   misc_feature    complement(294843..294902)
FT                   /note="1 probable transmembrane helix predicted for PAT2303
FT                   by TMHMM2.0 at aa 25-44"
FT   sig_peptide     complement(294846..294974)
FT                   /locus_tag="PAU_00268"
FT                   /note="Signal peptide predicted for PAT2303 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.419 between residues 43 and 44"
FT   CDS_pept        complement(295328..295516)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00269"
FT                   /old_locus_tag="PAT2304"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00269"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82362"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM69"
FT                   /inference="similar to DNA sequence:INSD:AF040645"
FT                   /protein_id="CAQ82362.1"
FT                   /translation="MKSISKGCASNNSQCPIGDIYDDNAFQYIARFPPAQPYKGKIAYQ
FT                   LPTGSFSLEENHPILSE"
FT   CDS_pept        complement(295761..296453)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00270"
FT                   /old_locus_tag="PAT2305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82363"
FT                   /db_xref="GOA:B6VM70"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM70"
FT                   /inference="similar to DNA sequence:INSD:AE014613"
FT                   /inference="similar to DNA sequence:INSD:CP000026"
FT                   /protein_id="CAQ82363.1"
FT                   /translation="MKKIYLIIIPFFIMICFFWLWNEINMKNKMAIFVNNPDPNYLYDK
FT                   VWFDASKWLNSGDYIKINDFYLIKLKPINLNQVKNSEYFMYYDIYYNIRHRTYGDLDRS
FT                   ANFNELVQKVIGSTDIQGETDAKTDVEGTERLSKLISRPEYEYLYSRFDKEKRQPVIDS
FT                   LLVSFSYKDQKYEMVISAVIDEEDEKDQFPYSDILLARGIQHYGSFYKANDLLTYKLYL
FT                   EEKQKEKK"
FT   misc_feature    complement(296391..296444)
FT                   /note="1 probable transmembrane helix predicted for PAT2305
FT                   by TMHMM2.0 at aa 4-21"
FT   CDS_pept        complement(296455..297765)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00271"
FT                   /old_locus_tag="PAT2306"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82364"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM71"
FT                   /inference="similar to AA sequence:UniProt:Q23CL0"
FT                   /protein_id="CAQ82364.1"
FT                   /translation="MTTFNAGKACATCPPEEYKEVMKQGIYSQQIKLYNNNEVSIPLEN
FT                   IPYYIRIEKNKHIISGKTDDKFLTERIYTKEAENIRIVVGRDAGKLQRRKSEYITNAKS
FT                   SSTKTALNKPTYEVEYSICGYDYISVVAARTEGPDYSLSGVTRGFSAPIGNQYMFINQG
FT                   IRQLGEYPATTPDYKIQRILVVFTLGYTNHDIKVINQYTQDKGGRIVYVRNSDELVQFL
FT                   SERKSKKRLIKQLDIFSHGIILNIPFHFYAENIFSGYNDPAGDFTLEKIMQIDEKIFDY
FT                   DAVVTSYACRTGIAVDEDDFTNTDPGYEHSLAQLMADTWEVEVRAFAMRSHYGKTYGTK
FT                   TEINEAEKHREEIMKYDKDYRYYTNNKHLNPKLKEPTRPKNYEKYKKQIESIKVRDDNI
FT                   DQGGPIDPHGAWHKPGTAESPKGLPKGLRTYLPRRWE"
FT   CDS_pept        complement(297799..298794)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00272"
FT                   /old_locus_tag="PAT2307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00272"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82365"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM72"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82365.1"
FT                   /translation="MEKVNYYAVIDGALMHDLYDMLEQLNPIASSLYTNISNKEEQINS
FT                   PHLVELTQPVKVWLSRKKDPWGLYLLSTYPFEKLRQHLRKYLQVFIPTEKKPVFFRYYD
FT                   PRVFWIFIDILSHDELNRFLSPIKKVISYHHGIYRESTPFEYNSEESFQNKDKFFKITP
FT                   KQYQIFNDKHYEQYIVALTHHMLAYWCDIFLSEKNVPDDIFYALENKNPNEKFEDISEF
FT                   LMIFPDEYYMINKAAIDRINSKVYYIYYSSLHEKYREINNFVVDIYAFCQQNNIIDDVS
FT                   IKTLMKLCIIKEILSANDIPEGWLHHLMNKDEPGFYNVKIVSELNKRNII"
FT   CDS_pept        complement(298797..300761)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00273"
FT                   /old_locus_tag="PAT2308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00273"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82366"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM73"
FT                   /inference="similar to DNA sequence:INSD:BX571865"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82366.1"
FT                   /translation="MADSGLVFTLSVGNLPAHTFAVVEFTLNEALSTPFSLDATLTSAD
FT                   PDINFKDVLDNSATFSVYRDGLPEREVTGIVTQFEQSTAGRHRSHYSLTLQPALWRAGL
FT                   RVNSRIFQHQSITDIIDTLLKENGIRDIVYTLGYEHPEREFCVQYDESDLAFLHRLLAD
FT                   EGIFYYFEFNQGKNGQTIFFADSCLALGNRFSVPYNPEPDVLGRQGSIQQFRWREQVGI
FT                   QGISLRDRTFKNPPWTAEYHFYESKSANQRTDLTSYYHYDFPGRYKDERGEHMSRYRLE
FT                   ALRRNDLLGHAHSDCFFLWPGLMFTLSHHPKETFNVPWQVISIHHHGRQPQADETRSGD
FT                   TGTTLTNHFTFGDRDRSWRPSPYPKPRIDGLQVATVVGPEGEEIFCDEYGRVRVQFAWD
FT                   QYGQFNDQSSCWIRVSQAWAGKGWGMIAIPRVGQEVLVDFLHGDPDQPIITGRAYHASN
FT                   LPPNRLPMAKTQMSIRSKTHKGEGFNELRFEDEKDREEVFIHAQKNLAIQVRNSRDERI
FT                   NYNRTTSIGHDDELVIAHNRKITVEGQQEHKTTGSYIELIERDKNLVIKGDDIRSVAGT
FT                   LGYQAEGDITIKSDTRITLRVGNNFVVIHHGGVDIKGTAINLNSAGSPGDVSLPAMPSV
FT                   LKAAAALGMPFVAHCSSKE"
FT   CDS_pept        complement(300795..302141)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00274"
FT                   /old_locus_tag="PAT2309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00274"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82367"
FT                   /db_xref="GOA:B6VM74"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM74"
FT                   /inference="similar to DNA sequence:INSD:AY144117"
FT                   /inference="similar to DNA sequence:INSD:BA000007"
FT                   /protein_id="CAQ82367.1"
FT                   /translation="MSENPENLIIRAGGNPMNLPAFTAIREEINKINHPSQPAVNWQLI
FT                   ESLALTLFRSHGVDLQSAIYYTLARMQLSGLAGFTEGCELLAGVIVSQWDELWPPQPTV
FT                   RTEMLDWFNTRSGNALRQHDYTTRDLRMIYRAERALQLIVDRLQQSDLKRLPKVENLLW
FT                   FFQNTAKKLENTRIIPKPAAKPVQMPPLVYLANTEPEPAEPEADYDASYDSNQPKVQVR
FT                   FPEPPPRMSALQGFGLGALLGIFVLTGSWLGFYKPLQQQLTALTGTQDGARLNWLYQPD
FT                   LQTYEQQLTRLADTSPLVVLQNAEQLTDIAQKTWPLDNKQQHETDRWQQLQAVRLENAP
FT                   VQGSWHQTRNQLQQLADKILEQERNRGSFTLSYLKTAIYQIQNSHNREVPLEELLRQFS
FT                   AAIEQGQTVSPALIKKTDDRFNALLSRYYALQKDAGLTTQKQPLNPLSQ"
FT   misc_feature    complement(301380..301448)
FT                   /note="1 probable transmembrane helix predicted for PAT2309
FT                   by TMHMM2.0 at aa 232-254"
FT   misc_feature    complement(301836..302021)
FT                   /note="HMMPfam hit to PF06812, ImpA-related N-terminal,
FT                   score 4.2e-27"
FT                   /inference="protein motif:Pfam:PF06812"
FT   CDS_pept        complement(302194..305739)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00275"
FT                   /old_locus_tag="PAT2310"
FT                   /product="conserved hypothetical protein"
FT                   /note="This entry represents a conserved region within
FT                   several bacterial proteins that resemble ImcF, which has
FT                   been proposed to be involved in cell surface
FT                   reorganisation, resulting in increased adherence to
FT                   epithelial cells and increased conjugation frequency."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00275"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82368"
FT                   /db_xref="GOA:B6VM75"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM75"
FT                   /inference="similar to DNA sequence:INSD:AY144117"
FT                   /inference="similar to DNA sequence:INSD:BA000007"
FT                   /protein_id="CAQ82368.1"
FT                   /translation="MNWLSLLLKNIKKPTMPRLPPLKATFSLILALLPCLALIWIWWWG
FT                   PGWQFKQTYPLENLSARWLATAIIIFMVLGFVGTKIWRRLQQLEKLKLDVELKVVDPVL
FT                   TDIARQDSYLNHWKAQLQRHLGTWDYLYQRPWYLMTGNTGSGKTSLIQEGYKLTDIAAP
FT                   DALKGEDGLPLHLRCWLGEKAVILDPDGFLIDQTAMSDSDKPQLPARLWQALLTWLTEN
FT                   RQRQPLNGIILTVDTHRLLTDNKEQRERYIAALHLRLQDLRLTLHNHLPFYLVLTKLDL
FT                   LHGFGAAFQSLDRPQRAQILGVTFSLNAADEDGWRTELAQFWHQWMQQLNAAMPDMMLN
FT                   KVDSSQRGPLFSFTRQIQGLHSYLVQLLDGLLYNGGPAQPGLRGVYLTSSKQIGQMDDP
FT                   FTQSAAVQYHLGPQAFPTWPVADTAPYFTRALFEEVLLAEPNLAAENRLWLSRNRRKLL
FT                   TFSTAGSVVALALWTGWHYYYQKNYRAGEEVLTQAKNFLSVPPPKGEDRNGNLQLPLLN
FT                   PVRQATLAYGDYHHKGLLADMGLYQGSDVGPYVESTYLQLLSQRFLPALMNGLLDDLNN
FT                   APKGSEEKLEVLRIIRMLEDGSGRNKSLVEQYMQERWSRTFNGQRPVQEQLLTHLDYAL
FT                   DHTDWRAAREAGDPAAISSFAPYKLPLTNAQKELSQLSIYQRVYQNLRLKAQDSLPPPL
FT                   NLRDQIGPSFDSIFIANNDKQLIIPQFLTMNGLNNYFVKQDDQLIDLTVMDSWVLNLSH
FT                   NVQYSETDRKEIQRQITEQYLGDYTATWRSAMNNLDILDFTDIPQAISAIEQVISGEQP
FT                   ISRALQILSDNTRLPVINDTLPAKEQQQLRDAPDYRLLVRINREFAPETAVLMEYGEKN
FT                   STLQEVYQKLTALHRYLLAIQNAPVPGKAALKAVQLRLEQNNSDPIFDVQQLAKNLPEP
FT                   LNRWVGELAEQAWRVVMMEAVRSLEVEWHDSVVKQYQTYLAGRYPFNPDATQDVPLSEF
FT                   DRFFRPGGTLDAFYQQNLKPFVENNLTYSDDGKQLIRPDVLAQLKLADRIRDTFFTPQN
FT                   GLGTQFAIEPISLTGNKRRSLLNLDGQLLDYAHGRSSIVHLVWPNSMRSGVESQLTLIP
FT                   DTSGKSPRSISFTGPWAQLRLINSGKLTNVRQDSFDVLFSVDGGDMTYRIYVDESDNPF
FT                   AGGLFSRFKLPDTLY"
FT   misc_feature    complement(302623..302982)
FT                   /note="HMMPfam hit to PF06744, Protein of unknown function
FT                   (DUF1215), score 1.9e-60"
FT                   /inference="protein motif:Pfam:PF06744"
FT   misc_feature    complement(303262..304203)
FT                   /note="HMMPfam hit to PF06761, ImcF-related, score
FT                   7.6e-126"
FT                   /inference="protein motif:Pfam:PF06761"
FT   misc_feature    complement(order(304303..304371,305506..305565,
FT                   305608..305676))
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2310 by TMHMM2.0 at aa 22-44, 59-78 and 457-479"
FT   sig_peptide     complement(305629..305739)
FT                   /locus_tag="PAU_00275"
FT                   /note="Signal peptide predicted for PAT2310 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.906) with cleavage site
FT                   probability 0.588 between residues 37 and 38"
FT   CDS_pept        complement(305736..307046)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00276"
FT                   /old_locus_tag="PAT2311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00276"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82369"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM76"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0TLB7"
FT                   /protein_id="CAQ82369.1"
FT                   /translation="MIKLGSLAHSTINIEEIQRQALQLFSEKSKDFRLMVHLLRTLQHS
FT                   GNPAELILAMELLADYIKHYWQPAWPQKPLLKRRLAQQVIKRFDSAQASFCEQADETQR
FT                   EEAQGALAHLAQCWHTDEPALAKEIDQLRSRYARKPTPKPVAAPAEPTENTAQPTISPA
FT                   LTPAPDIAVDSTSEKAWKQTLLTVADLLCERQPDSPTGYRLRRYATWHTLTTAPIANGE
FT                   GKTPLAPISADRTADYLAKLPAADKPLLQQIEQSLTLAPYWLDGHAIAAQAAEKLGYTA
FT                   VASAIRDELKAFLDRLPILQTLYFSDMSPFISAATLNWLHPPATAAGNGGSTQDQEAIW
FT                   QCFQQHGLEAALNAAEQHQQQLTEPRDQFYGQLLTAQLLEKAGMTALAQQHYRHLLQAG
FT                   QHMLLTHWEPGLLAGLAEKASINCTSKDTAANRSVNP"
FT   misc_feature    complement(306825..307010)
FT                   /note="HMMPfam hit to PF06812, ImpA-related N-terminal,
FT                   score 6.4e-20"
FT                   /inference="protein motif:Pfam:PF06812"
FT   CDS_pept        complement(307169..307816)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00277"
FT                   /old_locus_tag="PAT2312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00277"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82370"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM77"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0TLB6"
FT                   /protein_id="CAQ82370.1"
FT                   /translation="MSFFLLVSSLIASLTGTPEIQPAQETTTAPSLPTLLQCRSEPSPL
FT                   IRLDCYDRLLDKVDRAAVIPLEKTGPAWQQAMEQEMKRTDHSTGFITTQSKGIPTRVIL
FT                   TTPALGVPPPRPVLVLSCIDSITRIQVALTTPQDNGSVMISTDVTQFSADWFLRENGYL
FT                   LESSRGIPGIETLKRLMTGDTLTIKTSNGNRMTFNISQLEQAVKPLRSACRW"
FT   sig_peptide     complement(307742..307816)
FT                   /locus_tag="PAU_00277"
FT                   /note="Signal peptide predicted for PAT2312 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.846) with cleavage site
FT                   probability 0.343 between residues 25 and 26"
FT   CDS_pept        complement(307813..308613)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00278"
FT                   /old_locus_tag="PAT2313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00278"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82371"
FT                   /db_xref="GOA:B6VM78"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM78"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82371.1"
FT                   /translation="MKQRLKSALALLENDSIEQLVHHFLQVNHQRQRFDALLVSLLNMN
FT                   ENRLECYRLPAPNQISALQLDVSIGDINHPLVQIMYKGTPMTWESLNQGVRVDNQNFRT
FT                   FIEELPHRCGLHAIPLFNCNGQACGVIAVFAEDVNRFADDKNMFYIYCHVMQHRLKKLQ
FT                   ELEQLREQLRQIRQVFQTQRQKEKQLDELLASLSTTAENKTSANISHDYSKIDNLPQAL
FT                   EEFECAVLVQRQHIYGDNTKRIAESLGIAPRTLTYKLAKYRCKL"
FT   misc_feature    complement(307828..307950)
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 0.00023"
FT                   /inference="protein motif:Pfam:PF02954"
FT   CDS_pept        complement(308610..311249)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00279"
FT                   /old_locus_tag="PAT2314"
FT                   /product="similar to clpa/b-type chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00279"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82372"
FT                   /db_xref="GOA:B6VM79"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM79"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82372.1"
FT                   /translation="MIQIDLPTLVNRLNPMTRHALETAAAQCVSQQQPEITVSQLLLQM
FT                   INTPLSDVRAIFSQAEVDSDLLKEQLDQMIPHHQAMVQAYPNFSPMLVEWLQDSWLLAS
FT                   TEMQHQELRSGVMLMTLLFSPLRYLTPQSARLLSGINRELLRQNFTQWTAGSAEQPVVE
FT                   NDKNGQGRNAANSDSLLARFTQNMTEQARQGKLDPVLCRDTEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIIDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MSEINQSSVPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWGEYKK
FT                   YFEKDAALSRRFQLVKVAEPTAEEAIIIMRGLRAIYEQSHGILIDDEALKASAVLSDRY
FT                   LSGRQLPDKAIDVLDTACARVAINLTSPPRQISALKNQLHQQQMESDVLTREQHMGLNQ
FT                   HTDRLEELQQQQQETAEKLAELETSWQQQQQLVQQVIELRRQLLTNETTDKTEENETPA
FT                   EIVTEELVAKLSELNQQLEQLQQQQTLVSPHVDKNQIAAVIAEWTGVPLNRLSQSELSI
FT                   VTELPTHLGQSIKGQQLAIKCLHQHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVLQ
FT                   LAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLL
FT                   DEVEKAHPDVLNLFYQAFDKGELADGEGRVIDCKNIVFFLTSNLGYQTIVDNADKPEEM
FT                   NDLLYPELAAFFKPALLARMEVVPYLPLGYDTLKTIIQSKLARLDNLLRQRFNAEVTIS
FT                   DDVIEEILQRATRAENGARMLESIIDGALLPPLSLLLLQKMASGKQISAIQLTVDEHKF
FT                   NAVVEELQ"
FT   misc_feature    complement(308907..309407)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   1.4e-06"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(308907..309398)
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 1.1e-07"
FT                   /inference="protein motif:Pfam:PF07728"
FT   misc_feature    complement(308922..309410)
FT                   /note="HMMPfam hit to PF07724, ATPase family associated
FT                   with various cellul, score 8.8e-85"
FT                   /inference="protein motif:Pfam:PF07724"
FT   misc_feature    complement(310161..310601)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   1.3e-08"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(311022..311180)
FT                   /note="HMMPfam hit to PF02861, Clp amino terminal domain,
FT                   score 0.033"
FT                   /inference="protein motif:Pfam:PF02861"
FT   CDS_pept        complement(311260..312030)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00280"
FT                   /old_locus_tag="PAT2315"
FT                   /product="Putative membrane Protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82373"
FT                   /db_xref="GOA:B6VM80"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM80"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82373.1"
FT                   /translation="MKNEAINDNAILMQVETDTTLHRQYQLPLRGESLNPMIDAATPLL
FT                   GMVMRLKDMGDEALPDQLYQQVVTDIQAIEQFLQTKGYEPGAIVSFRYMLCTFIDETAL
FT                   GHGWNSQNGWLQQSLLVQFHNETWGGEKVFVLLERLMGEPQRYQHLLEFIYLCFCLGYR
FT                   GRYKVSSQKGDDFERLFRRIHQQLHALRGEAPPTILHSNANEQDSRYRLGKRLTIKHLF
FT                   WSGIGLLAVVYGFYAVRLHNQTQNILQQLNNLLS"
FT   misc_feature    complement(311317..311385)
FT                   /note="1 probable transmembrane helix predicted for PAT2315
FT                   by TMHMM2.0 at aa 216-238"
FT   CDS_pept        complement(312030..313382)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00281"
FT                   /old_locus_tag="PAT2316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82374"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM81"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82374.1"
FT                   /translation="MPGKNRVIWREGLFIKPQHFQQQQKHNDYLAHNRLTSLTSYGYGF
FT                   SSLTIDKDLLALGRIGIIEASGIMPDGTVFSVPYQDAIPQPLDVVNLHENNSKDIYLAL
FT                   PIASDTLNEISHPESNNAGAMRYREHVNDIRDLHTDGGDVSQIMLAQLTPILKQGSEDL
FT                   SAFTVLPLCQIIEKLPTGTIILNEDFVPTCTSINVSSKLKSYMDEVDRALIERARSLAN
FT                   RIGSPGQQGVADVAEFMMLQLVNRIQPWFTHYARQTILHPEHFFTQLIQTCGELRTFTH
FT                   ESRQVGDIPEYNHDSLTDTFHQVMRSMREAMGVVLTPRAIPIKLQTQSNGIRVANIHDR
FT                   DVLTKADFILAIRAEVPQEQLLRQFVKQTKIASQERIREMVSVQLPGVGLIPLPAAPRQ
FT                   LPYHAGYTYFRFDQQGAAWQDILKGTSIAFHVSGDFPGLDLQFWAVRNGSD"
FT   misc_feature    complement(312042..313370)
FT                   /note="HMMPfam hit to PF05936, Bacterial protein of unknown
FT                   function (DUF87, score 9.4e-214"
FT                   /inference="protein motif:Pfam:PF05936"
FT   CDS_pept        complement(313385..313939)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00282"
FT                   /old_locus_tag="PAT2317"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00282"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82375"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM82"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82375.1"
FT                   /translation="MKRSGNTSWSGIWLVLLAALVLSGCSGAWQATKKVGQVVWDPSTP
FT                   VGQPADLPSTAAITLLAEPDINPNKNGEATPVEIHLIYLSEDSRLLAADYDQLKSDELD
FT                   KALGKNYIDHQDYTLLPGQYKPLPVIPLEKKSRYIGVIVRYADINQSEWKKVIRVKDTG
FT                   QQYNILVHIRANEVELRKEEQ"
FT   misc_feature    complement(313847..313915)
FT                   /note="1 probable transmembrane helix predicted for PAT2317
FT                   by TMHMM2.0 at aa 9-31"
FT   sig_peptide     complement(313850..313939)
FT                   /locus_tag="PAU_00282"
FT                   /note="Signal peptide predicted for PAT2317 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.787 between residues 30 and 31"
FT   CDS_pept        complement(313939..315225)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00283"
FT                   /old_locus_tag="PAT2318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00283"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82376"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM83"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82376.1"
FT                   /translation="MEKQQPTLSLRVLNSDQLESGKSASCLFSIQGGTVGSSESHLWSV
FT                   QDQQGNINPSQFTIQWRDGAFCLHMIAGPLFVNKSPLTPGAGLIRLQQADEITIGKLVI
FT                   KSHISFSDADRTDPMMVSPESLVSSYSNPLDAMMEKSPVQDSAFTEHHSPAPTINHDFS
FT                   HDPLKVLDSETLTTQNQTSVTNEVDQSLQQGHYRTPLFFSPLSDNRGNAMDRDFVDLPS
FT                   ISSPLSEQYQDMEQQHVAITPLMRGLNTQLPLHNSQQANDFLEEMGKTMKAAIEGLLAL
FT                   QRTQHGLRDKQLRPIEDNPLRLNMDYNTTMQVMFADQKSPVHLSAPSAVAESLQNLQLH
FT                   YQANRIAITAALNTMLDAFSPEHLLSRFAQYRRSNETQEKDSTWAWEMYTSYYRELASS
FT                   RQQGFEKLFSEVYEQAYDRALRQGLEDSQ"
FT   misc_feature    complement(314926..315129)
FT                   /note="HMMPfam hit to PF00498, FHA domain, score 0.00012"
FT                   /inference="protein motif:Pfam:PF00498"
FT   CDS_pept        complement(315232..>316212)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00284"
FT                   /old_locus_tag="PAT2319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00284"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82377"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM84"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0TLB0"
FT                   /protein_id="CAQ82377.1"
FT                   /translation="LSKYNFYQLVELLNQLAVAWEKTGQTNRPDRESILFKSSASLAFP
FT                   TRDVVSVKRTEQGRFQVEVSFLGLHGSQSPMPGYYLDSLAWEEAQDENRLTNFLNIFNH
FT                   RSIVMLHQIWRKYRYYICFDKNGMDDFSQRMFALVGLGSDVNRSHLQINHSKMLAYAGL
FT                   LASPGRSPEVISSLVSHCFDLSDVTVHGWQIRKTTIETSQQNRLGGLLKIRGQKKGIEQ
FT                   SVLGRNFFLGSWVKGCNGKFLLCINNLSREHFLSFLPDGKNFLPLVMFICFVLRDQLAW
FT                   DLRLGLAENQADGMVLGTKQNNSLGWTSFLGKPEKKPFITISVGR"
FT   misc_feature    complement(315274..316212)
FT                   /note="HMMPfam hit to PF06996, Protein of unknown function
FT                   (DUF1305), score 4.2e-122"
FT                   /inference="protein motif:Pfam:PF06996"
FT   CDS_pept        complement(316248..318077)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00285"
FT                   /old_locus_tag="PAT2320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00285"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82378"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM85"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0TLA9"
FT                   /protein_id="CAQ82378.1"
FT                   /translation="MSLEKYFREELDYLRQLGRQAAIEHPHLASFLSEQGSDPDVERLL
FT                   EGFAFLAGNLRAKIDDQFPELTHGLLHMLWPNYLRPTPSMTIIQYTPDESVVTKATQIK
FT                   RGVQIKSHLLADDDEDIYSTNTDPNKAERDNRCTFTLCRDVWLFPMSIRDISVNNSNEQ
FT                   GVIGLNFTSKTELNLQELQLDKLRFYLSGDDYSSTQLYFWLSYYLEDAKLTVGDITIPL
FT                   PDFDFVPVGFNREDALLPYPKNSYMGYRILQEYFCFSEGFLFFDVTGFPKLPANLKAKD
FT                   FTLNLYFSEALPPEVKIRQDSFRLHCVPAINLFTMDSEAIRLDNSQAEYPLRASYSHPD
FT                   RYDIFSVDKVESWLLNADGTPNRARGSERVYVPFESFHHQIEHESELNTRYFRIRVKES
FT                   PFRKGLEHYISFVRGDESQLLLNNENVSVRLTCTNRELPLQLRVGDINFPSLGSPSFAA
FT                   FRNITRPSVPLYPLMSGKFHWSLISNMSLNYMTLLDKDALKQVLSTYDLPSRHNRQSSR
FT                   SSQKRLDAIERIETRPIDRLLRGLPVRGLESTLYIQQQAFSSEGELYLFSTILSRFFAL
FT                   YASINSFHILKVINLDNQECYQWPEQIGQHALM"
FT   misc_feature    complement(316251..318077)
FT                   /note="HMMPfam hit to PF05947, Bacterial protein of unknown
FT                   function (DUF87, score 2.3e-212"
FT                   /inference="protein motif:Pfam:PF05947"
FT   CDS_pept        complement(318080..318520)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00286"
FT                   /old_locus_tag="PAT2321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00286"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82379"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM86"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82379.1"
FT                   /translation="MAALYSWNREGSASLFERIQGKNSGSSRQSRMRELLNSVKRHLNN
FT                   ILNTHPGACQSAVDLGVIDLNDATTTATDFKQSIEQAIEHCIRNYEPRISSVSVSAIHD
FT                   DSDPLLLSFHISAQVSLDDIHDVVEFNIQLDNNRRYCLERTQ"
FT   misc_feature    complement(318110..318484)
FT                   /note="HMMPfam hit to PF07025, Protein of unknown function
FT                   (DUF1316), score 1.4e-43"
FT                   /inference="protein motif:Pfam:PF07025"
FT   CDS_pept        complement(318527..320005)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00287"
FT                   /old_locus_tag="PAT2322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00287"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82380"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM87"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82380.1"
FT                   /translation="MSLHEESSTTLAPGSTTSLLDEIMSQARMTPENDGYHIAKQGVAA
FT                   FISSILDTGSNEEPINKLVVDRMIVELDKTLSTQVDEIMHAKEFQELESSWRSLKLLVD
FT                   RTDFRENIKINIIHATKEELLEDFEFSPEIIQSGLYKHVYSTGYGQFGGEPVAAVIGNY
FT                   AFSNSSPDIKLMQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIKDLKSVFEGPAHT
FT                   KWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYQEDVSKDHEHFLWGNTAYLL
FT                   ATCLTDSFAKYRWCPNIIGPQSGGTVSDLPVHLFEAMGQIQAKIPTEVLITDRREFELA
FT                   EEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRLA
FT                   HYIKVLQREQIGSWKERQDLERELNTWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVE
FT                   GDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
FT   misc_feature    complement(318533..319945)
FT                   /note="HMMPfam hit to PF05943, Protein of unknown function
FT                   (DUF877), score 0"
FT                   /inference="protein motif:Pfam:PF05943"
FT   CDS_pept        complement(320029..320526)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00288"
FT                   /old_locus_tag="PAT2323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82381"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM88"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82381.1"
FT                   /translation="MSKNSPGSVAPKERINIKYVPNTGDQVAEIELPLNLLIVGDLKGT
FT                   KEDTPIEERQAVSVHKNNFNAVMNEANINLTFSVPNRLNDNNGDDLPVNLEIKSLNDFS
FT                   PDNVAKKVPELNKLLELREALVALKGPLGNIPAFRTRLQELLGDEKVREQLLKELEIVN
FT                   PK"
FT   misc_feature    complement(320041..320517)
FT                   /note="HMMPfam hit to PF05591, Protein of unknown function
FT                   (DUF770), score 2.6e-80"
FT                   /inference="protein motif:Pfam:PF05591"
FT   CDS_pept        321454..321972
FT                   /transl_table=11
FT                   /locus_tag="PAU_00289"
FT                   /old_locus_tag="PAT2324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00289"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82382"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM89"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AF044503"
FT                   /protein_id="CAQ82382.1"
FT                   /translation="MPTPCYISITGKTQGNITAGSFTAESVGNIFVQGHEDEMLVQEFD
FT                   HVVTVPTDPQSGQPSGQRAHKPFRFTVALNKSVPLLYNALASGEMLTKVELKWYRTSVE
FT                   GKQEHFFTTQLEDATIIDIDCKMPHCQDPTKSEFTQLVRVSLSYRKITWEHTTAGTSGA
FT                   DDWRAPIVA"
FT   misc_feature    321463..321921
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 7.7e-86"
FT                   /inference="protein motif:Pfam:PF05638"
FT   CDS_pept        322635..323477
FT                   /transl_table=11
FT                   /locus_tag="PAU_00290"
FT                   /old_locus_tag="PAT2325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82383"
FT                   /db_xref="GOA:B6VM90"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM90"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:U00039"
FT                   /protein_id="CAQ82383.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAGA
FT                   GRYQLSSEYAERTGEYLEGVARVWQREDLPQELKVYMSAVAALNPSGNLRYYPGSPLIA
FT                   RHLLRQSDKLNLTELHPSDFPLLRNEFSRDNRSRVVREDGYQQLKSQLPPQSRRGFILI
FT                   DPPYELKSDYQAVVQAIQEGYKRFATGVYALWYPVVLRQQIKRLVKDLEATGIRRILQI
FT                   ELAVRPDSDQRGMTASGMIVINPPWKLEQQMKSVLPWLHRVLVPEGIGHTMVKWIAPE"
FT   misc_feature    322731..323468
FT                   /note="HMMPfam hit to PF04378, Protein of unknown function
FT                   (DUF519), score 1.2e-153"
FT                   /inference="protein motif:Pfam:PF04378"
FT   CDS_pept        323573..324940
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="PAU_00291"
FT                   /old_locus_tag="PAT2326"
FT                   /product="glutathione oxidoreductase (gr) (grase)"
FT                   /EC_number="1.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82384"
FT                   /db_xref="GOA:B6VM91"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM91"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82384.1"
FT                   /translation="METIQMSKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKALGG
FT                   TCVNVGCVPKKVMWHAAQIAESIHQYGPDYGFDTTVNRFNWKALIASRTAYIDRIHQSY
FT                   ERGLDKNKVDVIQGFARFVDAHTVEVNGEEITADHILIATGGRPIRPDVPGAEYGIDSD
FT                   GFFELKEMPKRVAVVGAGYIAVEIAGVLHALGSETHLFVRQHAPLRSFDPMVVETLLEV
FT                   INTEGPTLHTESVPKAVIKNADGSLTLQLQNGKEQTVDTLIWAIGREPATDNLNLPVTG
FT                   VELNGKGYIKVDKYQNTNVTGIYAVGDNTGVVELTPVAVAAGRRLSERLFNNKPEEHLD
FT                   YTNIPTVVFSHPPVGTVGLTEPQAKEQFGEDQVKTYQSSFTAMYTAVTQHRQPCRMKLV
FT                   CVGPEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR"
FT   misc_feature    323603..324514
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidored, score 3.4e-72"
FT                   /inference="protein motif:Pfam:PF07992"
FT   misc_feature    324092..324373
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidored, score 2.8e-27"
FT                   /inference="protein motif:Pfam:PF00070"
FT   misc_feature    324602..324937
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidored, score 1.2e-52"
FT                   /inference="protein motif:Pfam:PF02852"
FT   CDS_pept        325106..326020
FT                   /transl_table=11
FT                   /locus_tag="PAU_00292"
FT                   /old_locus_tag="PAT2327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00292"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82385"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM92"
FT                   /inference="similar to DNA sequence:INSD:BX571864"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82385.1"
FT                   /translation="MKRKNTPTPHDAVFKKFLSHVDTARDFLEIHLPVGLRAVCDLGTL
FT                   RLEPESFIEDDLRAHYSDILYSLKTAQGDGYVYCVIEHQSSPDKMMAFRLMRYSISAMQ
FT                   RHLEQGHEKLPLVIPILFYHGKTRPYPWSTNWFDCFNDPALAKEVYSTMFPLVDVTVIP
FT                   DDEILTHKRIALLEMVQKHIRQRDMAERLQELVVLLAYDYYTDEQLKSVLNYLLQAGDT
FT                   ADPEGFIRRLAEQSPKYEEVLMTIAQKLEHKGRQEGRQEGRQEGRQEATLKIAHAMLNI
FT                   GIDRETVMKTTGLSRKELEQIHY"
FT   misc_feature    325109..325951
FT                   /note="HMMPfam hit to PF04754, Putative transposase,
FT                   YhgA-like, score 5.1e-188"
FT                   /inference="protein motif:Pfam:PF04754"
FT   CDS_pept        326139..326315
FT                   /transl_table=11
FT                   /locus_tag="PAU_00293"
FT                   /old_locus_tag="PAT2328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00293"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82386"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM93"
FT                   /inference="similar to DNA sequence:INSD:BX571864"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82386.1"
FT                   /translation="MMTIAQKLEQKGRQEGRKEGFQEAALKIAHAMLSIGIDRKIVMKT
FT                   TGLNQGEFERIRR"
FT   CDS_pept        326731..328149
FT                   /transl_table=11
FT                   /locus_tag="PAU_00294"
FT                   /old_locus_tag="PAT2329"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="3.5.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00294"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82387"
FT                   /db_xref="GOA:B6VM94"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM94"
FT                   /inference="similar to DNA sequence:INSD:AAIT01000018"
FT                   /inference="similar to AA sequence:UniProt:Q0TKU7"
FT                   /protein_id="CAQ82387.1"
FT                   /translation="MEKLKHQSRRDFLGQTGKLTTACAVISLTGGIAQARPSTVLSGTS
FT                   QVQTTFLTDRHYYLSDVLLEEGFEYDDDTVIGTRTALYTLEIKDGRIVAIHAADTLFNM
FT                   NLPCYQAQGQLLLPAFRDMHIHLDKTFYGGPWQAPRPRQRKTIMDMIALEETLIPKLLP
FT                   TSQQRAEGLIALLQSKGSTVARSHCNIDPVSGLKSLEHLQYALENHRDDFTCEIVAFPQ
FT                   HGLLHSKVERLMREAMQMGVQYVGGLDPTNVDAAMEKSLDTMFQIALDNNAGVDIHLHE
FT                   SSPAGVAAMNYMIDTVEKTPNLRGKVTISHAFALTTLDAGALLETASRLAEQQITIAST
FT                   VPIGSLMMPLPQLRTKGVFIMTGTDSVIDHWSPFGTGDMLEKANLYAQLYRGSDEYHLS
FT                   RAMAIATGGVLPLNDRGQRVWPQVGDKAEFVLVAASCSAEAVARVPARQATFHQGRLVA
FT                   GTVVRLSREGEING"
FT   sig_peptide     326731..326835
FT                   /locus_tag="PAU_00294"
FT                   /note="Signal peptide predicted for PAT2329 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974) with cleavage site
FT                   probability 0.965 between residues 35 and 36"
FT   misc_feature    327073..328023
FT                   /note="HMMPfam hit to PF07969, Amidohydrolase family, score
FT                   1.4e-08"
FT                   /inference="protein motif:Pfam:PF07969"
FT   CDS_pept        complement(328230..328751)
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="PAU_00295"
FT                   /old_locus_tag="PAT2330"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein b"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00295"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82388"
FT                   /db_xref="GOA:B6VM95"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM95"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82388.1"
FT                   /translation="MSTKPPLPLLGITAYSGTGKTTLLKKVIPLLRQRQIRVGLIKHTH
FT                   HDMDVDKPGKDSYELRKAGAKQTLVACQQRWALMTETSDSPALDLSYLASRFDSDSLDL
FT                   LLVEGFKDEPINKIALYRRIINRPLNDLIDQHVIAVASDEKLEIALPQLNINQPEQVAD
FT                   FIMNWLNIEH"
FT   misc_feature    complement(328326..328730)
FT                   /note="HMMPfam hit to PF03205, Molybdopterin guanine
FT                   dinucleotide synthesis, score 3.6e-51"
FT                   /inference="protein motif:Pfam:PF03205"
FT   CDS_pept        complement(328748..329560)
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="PAU_00296"
FT                   /old_locus_tag="PAT2331"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein a"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00296"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82389"
FT                   /db_xref="GOA:B6VM96"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM96"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:L19201"
FT                   /protein_id="CAQ82389.1"
FT                   /translation="MRLHIKFPINRNLYKLAGIAPQRKNCSVNKRKGLSLISQLYSNTC
FT                   FKNAKLSSDNPSEKGYIDGNRRVIDRNTMQPKISGVILAGGRATRMGGNDKGLTLLNGL
FT                   PLYQHIANKLRPQVDELILSANRNLEIYRQSRYQVVTDLTPDFSGPLAGMLATLKSASH
FT                   DWVVFVPCDVPDFPANLVAHLWQGKQQAMAAYAADDGNRTHPTLALLHRSLVSQLSNYL
FT                   ADGDRKLMLFMHKIGATAVQFADNPIAFTNLNTPEECQNWEHIQEIKK"
FT   CDS_pept        329738..330730
FT                   /transl_table=11
FT                   /gene="rdoA"
FT                   /locus_tag="PAU_00297"
FT                   /old_locus_tag="PAT2332"
FT                   /product="similar to unknown protein yihe of escherichia
FT                   coli"
FT                   /product="antibiotic resistance protein rdoa"
FT                   /note="This entry consists of bacterial antibiotic
FT                   resistance proteins, which confer resistance to various
FT                   aminoglycosides they include:- aminoglycoside
FT                   3'-phosphotransferase or kanamycin kinase /
FT                   neomycin-kanamycin phosphotransferase and streptomycin
FT                   3''-kinase or streptomycin 3''-phosphotransferase. The
FT                   aminoglycoside phosphotransferases inactivate
FT                   aminoglycoside antibiotics via phosphorylation ."
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00297"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82390"
FT                   /db_xref="GOA:B6VM97"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM97"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82390.1"
FT                   /translation="MLTNQAAFNFRELTPDLIMDALMQTGLYIDSGLTELNSYENRVYQ
FT                   FTDERRKRYVVKFYRPLRWDRQQIQEEHDFSLALQQADLPVAAPLVFDQQTVLTFKDFF
FT                   FAVFPSIGGRQYESDNLFQLEDVGRLLGRIHQIGYQQKFTTRPTIGLNEYLYRPRQLLA
FT                   ECEWVPSAHKVQFLAILDDLINVVESNWREEWQILRLHGDCHPGNILWRDEAWFVDLDD
FT                   ARNGPAIQDLWMLLHGSRQEQLLQLDTLLEAYNEFTNFDPKELSLIEPLRAMRMVHYLA
FT                   WVVRRWQDPAFPKAFPWMTDTDFWLKQTSLFSEQIKLLQEPPLQLSPMY"
FT   misc_feature    329831..330541
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 4.8e-40"
FT                   /inference="protein motif:Pfam:PF01636"
FT   CDS_pept        330739..331374
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PAU_00298"
FT                   /old_locus_tag="PAT2333"
FT                   /product="thiol:disulfide interchange protein dsba
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00298"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82391"
FT                   /db_xref="GOA:B6VM98"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM98"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82391.1"
FT                   /translation="MEIVMKKFWLVLVGMVMAFSASAANFTEGTEFVELKSPVADQPQV
FT                   LEFFSFYCPHCYQFEETFKVPQTVKQNLPAGTKLVRYHVDFLGPLGKELTTAWAVAIAM
FT                   GVEDKVTPVLFEGLQKTQTIKTSDDIRNAFIKAGVTAEDYDAAMSSFVVKSLVVKQQKA
FT                   AQDLQLRGVPAMFVNGKYMVRNNGIDATSDDNYAKSYSDVVNFLLNQK"
FT   sig_peptide     330739..330807
FT                   /gene="dsbA"
FT                   /locus_tag="PAU_00298"
FT                   /note="Signal peptide predicted for PAT2333 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 23 and 24"
FT   misc_feature    330868..331341
FT                   /note="HMMPfam hit to PF01323, DSBA-like thioredoxin
FT                   domain, score 4.3e-47"
FT                   /inference="protein motif:Pfam:PF01323"
FT   CDS_pept        331752..334541
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="PAU_00299"
FT                   /old_locus_tag="PAT2334"
FT                   /product="dna polymerase I polA"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00299"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82392"
FT                   /db_xref="GOA:B6VM99"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6VM99"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0TAJ7"
FT                   /protein_id="CAQ82392.1"
FT                   /translation="MAQIADNPLILVDGSSYLYRAYHAFPPLTNSTGEPTGAMYGVLNM
FT                   LRSLVMQYKPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRAQIEPLHQLVEAMGL
FT                   PLLVVPGVEADDVIGTLALQAEKEGRSVLISTGDKDMAQLVTPNITLINTMNNTILGPE
FT                   EVVEKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTALGLLQGIGGIDDIFANLDKIA
FT                   GLSFRGAKTLANKLEPHKDVAYLSYKLATIKTDVELDKTCVALSVAKPDTEKLHQLFSR
FT                   YEFKRWLSDVANGDWLAAKDKKLASTGSDDSASVESESVSSTLPSDNYQTILDQKSFDE
FT                   WIEKLKRAPVFAFDTETDSLDTLTANLVGMSFAITAGDAAYLPLGHDYLGAPEQLDRDA
FT                   VLAALKPLLEDSNLLKIGQNIKFDCGVLVRYGIELQGIAYDTMLESYVLNSVAGMGRHD
FT                   MDSLAERHLNYKTTTFEEIAGKGKNQLTFNQVPVEQAAMYAAEDADVTLQLHQVIWPQL
FT                   EKVPALEKVFLETEMPLIMVLSRMERAGVLINSDILAEHSKEIAVRLDELEKEAHELAG
FT                   EVFNLASPKQLQTILFEKLNLPVVKKTPGGAPSTNEEVLEELVDHHELPKVILEHRGLA
FT                   KLKSTYTDKLPQMVHPLTKRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRRIRQAF
FT                   IASEGYRIMAADYSQIELRIMAHLSQDQGLLKAFAEGQDIHRATAAEVFDVPLEQVTSE
FT                   QRRSAKAINFGLIYGMSAFGLSRQLGIPRGEAQRYMDLYFERYPGVLAYMERTREQAEE
FT                   QGYVETLAGRRLYLPDIKSRNGTRRKAAEREAINAPMQGTAADIIKKAMIAVDDWIISE
FT                   APKVRMIMQVHDELVFEVHESELENTEQKIRELMEKSVVLDVPLQVDVGIGDNWDQAH"
FT   misc_feature    331770..332555
FT                   /note="HMMSmart hit to SM00475, no description, score
FT                   3.1e-139"
FT                   /inference="protein motif:Smart:SM00475"
FT   misc_feature    331770..332258
FT                   /note="HMMPfam hit to PF02739, 5'-3' exonuclease,
FT                   N-terminal resolvase-, score 1.8e-96"
FT                   /inference="protein motif:Pfam:PF02739"
FT   misc_feature    332262..332582
FT                   /note="HMMPfam hit to PF01367, 5'-3' exonuclease,
FT                   C-terminal SAM fold, score 1.9e-51"
FT                   /inference="protein motif:Pfam:PF01367"
FT   misc_feature    332268..332375
FT                   /note="HMMSmart hit to SM00279, no description, score
FT                   6.1e-14"
FT                   /inference="protein motif:Smart:SM00279"
FT   misc_feature    332736..333305
FT                   /note="HMMSmart hit to SM00474, no description, score
FT                   1.1e-46"
FT                   /inference="protein motif:Smart:SM00474"
FT   misc_feature    333393..334535
FT                   /note="HMMPfam hit to PF00476, DNA polymerase family A,
FT                   score 1.3e-216"
FT                   /inference="protein motif:Pfam:PF00476"
FT   misc_feature    333810..334430
FT                   /note="HMMSmart hit to SM00482, no description, score
FT                   1.3e-124"
FT                   /inference="protein motif:Smart:SM00482"
FT   CDS_pept        complement(334605..335963)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00300"
FT                   /old_locus_tag="PAT2335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82393"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000094"
FT                   /protein_id="CAQ82393.1"
FT                   /translation="MGKINPIRPYQENNMNQHNDFSADTDVGNRLTERNNEYNIYNNNK
FT                   DSTVVANEAAAAMLLQNSNVIAWGLPNFGGQVPPEIAQLQDIVSLCATGSAFAALRLDG
FT                   SVVAWGNPNVGGNVPPNIAELRDIVSLSSTTYSFAALRADRSVVVWGDPRYGGQLPPEI
FT                   AGLQDIVSLHPTVNAFLALRADRSVISWGKPWEPPPPAIAQLRDIVDLSITTGGFTAFS
FT                   ALRANRSVVSWGYNLNGGKLPPEIAQLQDIVSLSSTGFSFAALRANRSVVAWGEASGSG
FT                   TVPPEIAKLQDIVSLSATGDTYAALRSDRSVVAWRFPLNGGQVPPEIAKLKDIVSLHPT
FT                   ASAFAALRTNRSVVAWGNAYSAGQVPPEIAQLQDITSLSATSSSYAALRANHSVVAWGW
FT                   KEGYTGSPVPPEIAQLRDIVSLTGTGNTFAAWRADGRRVAWGGWENKPRGEYN"
FT   misc_RNA        336521..336637
FT                   /inference="similar to RNA sequence:Rfam:RF00021"
FT   CDS_pept        complement(336682..337422)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00301"
FT                   /old_locus_tag="PAT2336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82394"
FT                   /db_xref="GOA:B6VMA1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82394.1"
FT                   /translation="MAQSIRNMSLFLILSTSSGYRYNPLCHIFSAFLREIIILTIKNYN
FT                   YHMTRFITSAPDIRHLPQDVGIEVAFAGRSNAGKSSALNALTNQKNLARTSKTPGRTQL
FT                   INLFEVEEGIRLVDLPGYGYAEVPEEIKRKWQKALGEYLQKRECLLGLVVLMDIRHPLK
FT                   DLDQQMIQWAVTMNVPIMVLLTKADKLTSSARKSQLIKIRGELANLNGDIQVEYFSALK
FT                   KIGIDKLQHKLDIWFNQAAVQTEQ"
FT   misc_feature    complement(336859..337224)
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 4.9e-30"
FT                   /inference="protein motif:Pfam:PF01926"
FT   CDS_pept        337616..338185
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="PAU_00302"
FT                   /old_locus_tag="PAT2337"
FT                   /product="peptidyl-prolyl cis-trans isomerase A precursor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00302"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82395"
FT                   /db_xref="GOA:B6VMA2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82395.1"
FT                   /translation="MFKRILVTLVTACSLSAMAPLALAAGETHVKLTTTEGNIELELNS
FT                   QKAPITTKNFIEYVNEGYYNNTIFHRVIPGFMVQGGGFTKDLQQKATKAPIKNEANNKL
FT                   RNLRGTISMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVVDKISQ
FT                   VKTENVGPYQNVPVKPVVILSAEIIP"
FT   sig_peptide     337616..337687
FT                   /gene="ppiA"
FT                   /locus_tag="PAU_00302"
FT                   /note="Signal peptide predicted for PAT2337 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.992 between residues 24 and 25"
FT   misc_feature    337700..338179
FT                   /note="HMMPfam hit to PF00160, Cyclophilin type
FT                   peptidyl-prolyl cis-tr, score 3.2e-64"
FT                   /inference="protein motif:Pfam:PF00160"
FT   CDS_pept        complement(338280..338630)
FT                   /transl_table=11
FT                   /gene="ycgJ"
FT                   /locus_tag="PAU_00303"
FT                   /old_locus_tag="PAT2338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00303"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82396"
FT                   /db_xref="InterPro:IPR008617"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82396.1"
FT                   /translation="MKTKLIIASLFLLSFPTLATTKVANIFFPVKGVICDKKGEYCADQ
FT                   EGLSLKLTEKYLGKKASKRLKDMIGDGKYFDSSSYTLSNGVHCASKERKCYKDRYFPRS
FT                   EENKEFTQKMYE"
FT   misc_feature    complement(338550..338618)
FT                   /note="1 probable transmembrane helix predicted for PAT2338
FT                   by TMHMM2.0 at aa 5-27"
FT   sig_peptide     complement(338574..338630)
FT                   /gene="ycgJ"
FT                   /locus_tag="PAU_00303"
FT                   /note="Signal peptide predicted for PAT2338 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.974 between residues 19 and 20"
FT   CDS_pept        338863..339447
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="PAU_00304"
FT                   /old_locus_tag="PAT2339"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase, component ii"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00304"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82397"
FT                   /db_xref="GOA:B6VMA4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA4"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82397.1"
FT                   /translation="MFPMLLIIDNYDSFTYNLYQYFCELGTDVLVKRNDELQLEDIERL
FT                   SPTHLVISPGPCTPNEAGISLAAISHFAGRLPILGVCLGHQAIGQAFGASVVKAREVMH
FT                   GKTSAIHHNQQGVFKGLNRPLTVTRYHSLVIAAETLPASFEVTAWSQHDGNVDEIMGIR
FT                   HRTLPLEGVQFHPESILSEQGHQLLSNFLRY"
FT   misc_feature    338878..339444
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 2.6e-85"
FT                   /inference="protein motif:Pfam:PF00117"
FT   CDS_pept        339569..340780
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="PAU_00305"
FT                   /old_locus_tag="PAT2340"
FT                   /product="acetylornithine/succinyldiaminopimelate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00305"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82398"
FT                   /db_xref="GOA:B6VMA5"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:M32796"
FT                   /protein_id="CAQ82398.1"
FT                   /translation="MTEHVVVNRNTYDQVMLPIYSPVQFIPVKGQGSRVWDQQGKEYID
FT                   FAGGIAVMALGHCHPALVDVLKQQGEKLWHISNIFTNEPALILAQKLIDVTFAERVFFA
FT                   NSGAEANEAAFKLARHYAITRHSPYKTKIIAFHQGFHGRTFFTVSVGGQPKYADGFGPK
FT                   PADIIHVPFNDLAAVKAVIDDHTCAVVLEPVQGEGGVTPATSAFIHGVRELCDKHQVLL
FT                   VFDEVQSGMGRTGKLFSYMHYDVVPDILTTAKALGNGFPVSAMLTTANIASVMVPGTHG
FT                   TTYGGNPLACAVANVAFDIINTSEVLDGVEKRHNLIVNFLNGINQRYSVFGEIRGKGLL
FT                   IGAELKGKYQGKSKDILQLAAENGLMLLSAGSDVLRFTPSLIISEEEIAQGMERLEKAI
FT                   SQLV"
FT   misc_feature    339644..340609
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 2e-166"
FT                   /inference="protein motif:Pfam:PF00202"
FT   CDS_pept        complement(340829..341470)
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="PAU_00306"
FT                   /old_locus_tag="PAT2341"
FT                   /product="catabolite gene activator (camp receptor protein)
FT                   (camp-regulator protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00306"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82399"
FT                   /db_xref="GOA:B6VMA6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA6"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82399.1"
FT                   /translation="MKRMVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYY
FT                   IVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERTAWVRAKSACEVAEISYK
FT                   KFRQLIQVNPDILMRLSAQMASRLQTTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTH
FT                   PDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   misc_feature    complement(340838..340984)
FT                   /note="HMMSmart hit to SM00419, no description, score
FT                   4.5e-17"
FT                   /inference="protein motif:Smart:SM00419"
FT   misc_feature    complement(340871..340966)
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp famil, score 1.4e-15"
FT                   /inference="protein motif:Pfam:PF00325"
FT   misc_feature    complement(341096..341458)
FT                   /note="HMMSmart hit to SM00100, no description, score
FT                   1e-26"
FT                   /inference="protein motif:Smart:SM00100"
FT   misc_feature    complement(341126..341401)
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 7.4e-28"
FT                   /inference="protein motif:Pfam:PF00027"
FT   CDS_pept        341783..342190
FT                   /transl_table=11
FT                   /gene="yhfA"
FT                   /locus_tag="PAU_00307"
FT                   /old_locus_tag="PAT2342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00307"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82400"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA7"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:U18997"
FT                   /protein_id="CAQ82400.1"
FT                   /translation="MQARVKWVEGLSLLGESSSGHQIMMDGNAGDKAPSPMEMVLMAAG
FT                   GCSTIDVVSILQKGRYDVIDCEVKLTSRRREEAPRLFTHINLHFIVTGKDLTDKAVERA
FT                   VMLSAEKYCSVSLMLGKSVEITHSFEIKDVG"
FT   misc_feature    341825..342166
FT                   /note="HMMPfam hit to PF02566, OsmC-like protein, score
FT                   5.2e-27"
FT                   /inference="protein motif:Pfam:PF02566"
FT   CDS_pept        complement(342316..343185)
FT                   /transl_table=11
FT                   /gene="prkB"
FT                   /locus_tag="PAU_00308"
FT                   /old_locus_tag="PAT2343"
FT                   /product="putative phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00308"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82401"
FT                   /db_xref="GOA:B6VMA8"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA8"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82401.1"
FT                   /translation="MSAKHPIIAITGSSGAGTTTTSLAFRKIFQQLNISAAQIEGDSFH
FT                   RYTRPEMDAAIRKAKEQGRHISYFGPEANDFGMLEKTMLDYGATGEGRCRKYLHTYDDA
FT                   VPYNQLPGTFTPWESLPQKTDVLFYEGLHGGVVTPQHNVASHVDLLVGVVPIVNLEWIQ
FT                   KLIRDTGERGHSQEAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTVDTSNPFSAKAI
FT                   PSLDESFIVIRFRDLTQIDFPYLLSMLQGSFVSSINTIVVPGGKMGLAMELIMTPLVQR
FT                   LLEGEKIC"
FT   misc_feature    complement(342544..343167)
FT                   /note="HMMPfam hit to PF00485, Phosphoribulokinase /
FT                   Uridine kinase family, score 2.6e-112"
FT                   /inference="protein motif:Pfam:PF00485"
FT   CDS_pept        complement(343206..343424)
FT                   /transl_table=11
FT                   /gene="yheU"
FT                   /locus_tag="PAU_00309"
FT                   /old_locus_tag="PAT2344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00309"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82402"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMA9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:U18997"
FT                   /protein_id="CAQ82402.1"
FT                   /translation="MIIPWQQLAPETLLNLIESFVLREGTDYGEHEKSLEQKVADIRRQ
FT                   LEQGDVMLVWSELHESINIMPKGMFHP"
FT   misc_feature    complement(343215..343424)
FT                   /note="HMMPfam hit to PF06794, Uncharacterised protein
FT                   family (UPF0270), score 9.2e-45"
FT                   /inference="protein motif:Pfam:PF06794"
FT   CDS_pept        complement(343421..344401)
FT                   /transl_table=11
FT                   /gene="yheT"
FT                   /locus_tag="PAU_00310"
FT                   /old_locus_tag="PAT2345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82403"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82403.1"
FT                   /translation="MSDIFRPLTGASNPHLQTLLPRLVRWYPALQPYWQRLNLPDNDFV
FT                   DLAWSEDPTTAAHKPRLILFHGLEGSFNSPYANGLLHICQKRGWLGVVMHFRGCSGEPN
FT                   RQKRLYHSGETNDARYFLNWLKQTYGDAPTSAVGYSIGGNVLACYLAEEKTNAQVNAAV
FT                   VVSAPLMLEACSNRIERGFSQVYERYLLNSLKRNITRKLLRYPNSLPINLSQVKRLKRI
FT                   REFDEIVTAKIHNFKDAVDYYRQCSALPRLPDITVPLLIIHAKDDPFMAPEVIPDLKTL
FT                   PKNIEYQMTEHGGHVGFVSGSFKKPQMWLEQRIPSWLSSYLEQPQ"
FT   misc_feature    complement(343457..344137)
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 1.6e-20"
FT                   /inference="protein motif:Pfam:PF00561"
FT   CDS_pept        344504..345112
FT                   /transl_table=11
FT                   /locus_tag="PAU_00311"
FT                   /old_locus_tag="PAT2346"
FT                   /product="similar to unknown protein yfik of escherichia
FT                   coli-putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82404"
FT                   /db_xref="GOA:B6VMB1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000308"
FT                   /protein_id="CAQ82404.1"
FT                   /translation="MTTSLILSLTTFLFISSITPGPNNMLLTSSGANFGVIRSLGLIFG
FT                   ILLGMQTILYLSAFGIAALLLVYPAIHTIMKIAGSLYLLWLAWKTVTASYRRLDTKDNA
FT                   VIKPVRWYQGWLLQFLNPKAWLIGLGSVGSYSIAGEQYLYSIIVISGAMVLISFLSSIV
FT                   WAGFGSLIGILLRSRNAWFIFNIMMGILTAACVPLIWLG"
FT   sig_peptide     344504..344596
FT                   /locus_tag="PAU_00311"
FT                   /note="Signal peptide predicted for PAT2346 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.786) with cleavage site
FT                   probability 0.354 between residues 31 and 32"
FT   misc_feature    order(344516..344584,344621..344689,344699..344767,
FT                   344927..344995,345038..345106)
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2346 by TMHMM2.0 at aa 5-27, 40-62, 66-88, 142-164 and
FT                   179-201"
FT   misc_feature    344543..345109
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 0.00091"
FT                   /inference="protein motif:Pfam:PF01810"
FT   CDS_pept        join(345432..345659,345656..346072)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PAU_00312"
FT                   /old_locus_tag="PAT2347"
FT                   /product="putative ABC taurine transporter, atpase subunit,
FT                   pseudogene"
FT                   /EC_number="3.6.3.36"
FT                   /inference="similar to DNA sequence:INSD:CP000270"
FT                   /inference="similar to DNA sequence:INSD:AE015451"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /inference="similar to DNA sequence:INSD:D85613"
FT   CDS_pept        346166..346705
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="PAU_00313"
FT                   /old_locus_tag="PAT2349"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent
FT                   (taurine dioxygenase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00313"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82406"
FT                   /db_xref="GOA:B6VMB4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB4"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /inference="similar to AA sequence:UniProt:Q0WKB9"
FT                   /protein_id="CAQ82406.1"
FT                   /translation="MGAILAAKKVPPFGGDTLWCSGIAAFEALSEPFKKLLIGLEAEHD
FT                   FVKSFPEHRHRGSEEEYQRWLVGKEKNPPLLHPVVRTHPVSDRLALFVNEGFTTRIVGL
FT                   SDKESEAILNFLFVHITKPEFQVRWRWQENDIAIWDNRVTQHYANADYLPQRRIMHRAT
FT                   ILGDKPRYFGKENEGA"
FT   misc_feature    346166..346678
FT                   /note="HMMPfam hit to PF02668, Taurine catabolism
FT                   dioxygenase TauD, TfdA fa, score 1.3e-25"
FT                   /inference="protein motif:Pfam:PF02668"
FT   CDS_pept        complement(346729..348180)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00314"
FT                   /old_locus_tag="PAT2350"
FT                   /product="putative PTS system EIIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00314"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82407"
FT                   /db_xref="GOA:B6VMB5"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AP009048"
FT                   /protein_id="CAQ82407.1"
FT                   /translation="MAKINQTVTVQILNAIGNAGNVIQCSNCMTRLRLTLRDQTQVDKA
FT                   ALKQIPNVLGIIESDNQFQVVLGPGKAQAAADIMNKLLESSSHVPQPEQNHANLTDIAS
FT                   ANKRHLKEKQVSVVHKFLTKFATIFTPLIPGFIAVGLLLGVATLLEQIAMQGAQSPNTV
FT                   LVEIIGYMKVFSKGMFSFLSILIGYNAQKAFGGSGINGAIIASLFVLGYNPDATSGFYS
FT                   GISTFFGYSIDPRGNIIGVLIAAILGAWVERQVRKIIPDNLDMILTSAITLLIMGAIAF
FT                   TLIMPLGSYLFSGMSWLFLHLNGNPFGTAILAGLFLLAVMFGVHQGFVPVYFALMDAQG
FT                   FNSLFPILAMAGGGQVGAALALYIKANKDSLLRTQIKGAIIPGFLGIGEPLIYGVTLPR
FT                   IKPFITACLGGAAGGFFIGLVAYLGLPVGLNTVFGPSGLVALPLMTSNNGIFVGMAVYA
FT                   TGLVVAYLSGFVLTLLFGRKNVDLT"
FT   misc_feature    complement(order(346768..346836,346894..346962,
FT                   346981..347049,347092..347160,347194..347262,
FT                   347305..347373,347434..347502,347545..347604,
FT                   347623..347691,347734..347802))
FT                   /note="10 probable transmembrane helices predicted for
FT                   PAT2350 by TMHMM2.0 at aa 127-149, 164-186, 193-212,
FT                   227-249, 270-292, 307-329, 341-363, 378-400, 407-429 and
FT                   449-471"
FT   misc_feature    complement(346951..347805)
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 8.6e-41"
FT                   /inference="protein motif:Pfam:PF02378"
FT   misc_feature    complement(348052..348156)
FT                   /note="HMMPfam hit to PF00367, phosphotransferase system,
FT                   EIIB, score 2.3e-10"
FT                   /inference="protein motif:Pfam:PF00367"
FT   CDS_pept        complement(348211..349164)
FT                   /transl_table=11
FT                   /gene="yfeU"
FT                   /locus_tag="PAU_00315"
FT                   /old_locus_tag="PAT2351"
FT                   /product="similar to putative regulator yfeu protein of
FT                   escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00315"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82408"
FT                   /db_xref="GOA:B6VMB6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB6"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82408.1"
FT                   /translation="MVHFTLSAFYISLENNMKINLHNMVTESRNPASANIDTLPTLEML
FT                   QVINDEDKKVALAVEQTLPQVAKTVDKIAEAFHQGGRLIYIGAGTSGRLGILDASECPP
FT                   TYGTQPEQVIGLIAGGHQAILRAVENAEDNRQLGENDLKALHFNSKDVLVGIAASGRTP
FT                   YVLAAMVYAKSVGATVACISCNPDSPMTQAADIAITPVVGPETVTGSSRMKAGTAQKLI
FT                   LNMLTTGAMIRTGKVYSNLMVDVAATNAKLIERQKNIVMAATECNREQAEQALAECAGH
FT                   CKTAIVMILAGIDAQQATALLKKHHGFIRPAISTIR"
FT   misc_feature    complement(348469..348945)
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 0.032"
FT                   /inference="protein motif:Pfam:PF01380"
FT   CDS_pept        complement(349198..350061)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00316"
FT                   /old_locus_tag="PAT2352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00316"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82409"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB7"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /inference="similar to DNA sequence:INSD:AE016853"
FT                   /protein_id="CAQ82409.1"
FT                   /translation="MPEVKGFSERNLKRMLRFYREYAFPPEMKQQSRIYSSGKPVSAIV
FT                   PQPVAQLPWGHNILLIERIKDQTERFWYAEQIQRQGWSRDSLIQMIKGNAYARQGSVVS
FT                   NFKNRLSVSQSELVQQTLKDPYVFDFLTLSEPFKERELEMGLLKHLEKFLLELGEGFAF
FT                   VGRQYRITVSEQDYYIDLLFYHLTLRAFVVIELKRGEFKPEHAGKMNFYCSVVDEKLRH
FT                   STDQPTIGLILCQTKDRILAEYALRGIQKPIGVSDYELTRALPEDLKSSLPSIEELEAE
FT                   LSQPST"
FT   misc_feature    complement(349237..350061)
FT                   /note="HMMPfam hit to PF06250, Protein of unknown function
FT                   (DUF1016), score 3e-75"
FT                   /inference="protein motif:Pfam:PF06250"
FT   CDS_pept        350321..350551
FT                   /transl_table=11
FT                   /locus_tag="PAU_00317"
FT                   /old_locus_tag="PAT2353"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00317"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82410"
FT                   /db_xref="GOA:B6VMB8"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB8"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /inference="similar to DNA sequence:INSD:AE004432"
FT                   /protein_id="CAQ82410.1"
FT                   /translation="MLHKRGNAKTLTQLNKYKLLIYIPFILQVAALLAAFTHPSHRVIY
FT                   APGDSFTCRRAATRNLLGINDHIMNMYFGNF"
FT   sig_peptide     350321..350446
FT                   /locus_tag="PAU_00317"
FT                   /note="Signal peptide predicted for PAT2353 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.918) with cleavage site
FT                   probability 0.691 between residues 42 and 43"
FT   misc_feature    350375..350434
FT                   /note="1 probable transmembrane helix predicted for PAT2353
FT                   by TMHMM2.0 at aa 19-38"
FT   CDS_pept        complement(350983..351462)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00318"
FT                   /old_locus_tag="PAT2354"
FT                   /product="putative membrane protein similar to hcp protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00318"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82411"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMB9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82411.1"
FT                   /translation="MSYMTYLSLNGKKQGLISAGCSTLDSIGNRYQKGHEDQIQILSLN
FT                   HMITREQHVNHHPVQFIKPVDKSSPLLSVAISSNELLHAVFLFYRTNTAGQLELFYEVK
FT                   LTEASIVDLSCTYPHSINDNEMMPYEKVFLKYKSISWNHVIAGTSAYSIWDDRVY"
FT   misc_feature    complement(351031..351453)
FT                   /note="HMMPfam hit to PF05638, Protein of unknown function
FT                   (DUF796), score 1.1e-67"
FT                   /inference="protein motif:Pfam:PF05638"
FT   CDS_pept        352260..352967
FT                   /transl_table=11
FT                   /locus_tag="PAU_00319"
FT                   /old_locus_tag="PAT2355"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00319"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82412"
FT                   /db_xref="GOA:B6VMC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0WD40"
FT                   /protein_id="CAQ82412.1"
FT                   /translation="MDEAKNVLEDIDSPKPKSPFMKKVFSVADPISSYASNIHDAFDFI
FT                   NVVREFKRLGIKATEYVGKNGEKYIKISGYAGVRKIITASRYRASNMKMISMGIGQQGL
FT                   NSGIVKGMKFSIFFSAAYRTVEFIFKDEYTLADFLGNIAVDLAKTVVAAFVSWAIGSLM
FT                   LATSVAGASVIFVAGIVVGVGFVTVYGLNVLDTKFKISETIINLIKKEMERKPRILEAN
FT                   FNQFLHNWDRYGK"
FT   misc_feature    order(352671..352739,352767..352835)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2355 by TMHMM2.0 at aa 138-160 and 170-192"
FT   CDS_pept        352957..353358
FT                   /transl_table=11
FT                   /locus_tag="PAU_00320"
FT                   /old_locus_tag="PAT2356"
FT                   /product="similar to putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82413"
FT                   /db_xref="GOA:B6VMC1"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82413.1"
FT                   /translation="MENKKKIVRIIGALAIFILTLVSFFFAGNDLISLVKMDDKITFSS
FT                   SVFIVFCSFPLISYAIFFIVFVNVTGYYPKYHDGFVKYLGSIWVFLFFFSFPTSLYVNY
FT                   KLRSDNYLVCPRISWMSPNTYVKDIKLCD"
FT   sig_peptide     352957..353037
FT                   /locus_tag="PAU_00320"
FT                   /note="Signal peptide predicted for PAT2356 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.649 between residues 27 and 28"
FT   misc_feature    352966..353355
FT                   /note="HMMPfam hit to PF06836, Protein of unknown function
FT                   (DUF1240), score 4.4e-42"
FT                   /inference="protein motif:Pfam:PF06836"
FT   misc_feature    order(352975..353043,353086..353154,353191..353259)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2356 by TMHMM2.0 at aa 7-29, 44-66 and 79-101"
FT   CDS_pept        353406..353807
FT                   /transl_table=11
FT                   /locus_tag="PAU_00321"
FT                   /old_locus_tag="PAT2357"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82414"
FT                   /db_xref="GOA:B6VMC2"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82414.1"
FT                   /translation="MGNKRKVIHIICALFIFILTSFTFFLTGGNLNSLIKMDEKIIFSS
FT                   GVFMIFFSSPLVFYYVIFVIFVNITGRYPKHHDGFNKYLGTIAIISFFLGFPTSLYVNY
FT                   KLKSDGYLVCPRISWMSPNTYVKDIKLCD"
FT   sig_peptide     353406..353489
FT                   /locus_tag="PAU_00321"
FT                   /note="Signal peptide predicted for PAT2357 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.699 between residues 28 and 29"
FT   misc_feature    353415..353804
FT                   /note="HMMPfam hit to PF06836, Protein of unknown function
FT                   (DUF1240), score 9.1e-45"
FT                   /inference="protein motif:Pfam:PF06836"
FT   misc_feature    order(353424..353492,353535..353603,353640..353708)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2357 by TMHMM2.0 at aa 7-29, 44-66 and 79-101"
FT   CDS_pept        353813..354256
FT                   /transl_table=11
FT                   /locus_tag="PAU_00322"
FT                   /old_locus_tag="PAT2358"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00322"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82415"
FT                   /db_xref="GOA:B6VMC3"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82415.1"
FT                   /translation="MYLISINFFIPGETMGNKRKILHIIGALAIFILALSTFFLTGENI
FT                   ISLIEMDEQITFSGGVVIIFFSSPLVLYYMVAVICVSITGRSPKHHDGFVNCFGTIAII
FT                   SFFLGFPTSLYVNYKLRSDSYLVCPRISWMSPNTYVKDIKLCD"
FT   sig_peptide     353813..353935
FT                   /locus_tag="PAU_00322"
FT                   /note="Signal peptide predicted for PAT2358 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.827) with cleavage site
FT                   probability 0.463 between residues 41 and 42"
FT   misc_feature    353864..354253
FT                   /note="HMMPfam hit to PF06836, Protein of unknown function
FT                   (DUF1240), score 1.3e-46"
FT                   /inference="protein motif:Pfam:PF06836"
FT   misc_feature    order(353873..353932,353990..354058,354092..354160)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2358 by TMHMM2.0 at aa 21-40, 60-82 and 94-116"
FT   CDS_pept        354273..354674
FT                   /transl_table=11
FT                   /locus_tag="PAU_00323"
FT                   /old_locus_tag="PAT2359"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00323"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82416"
FT                   /db_xref="GOA:B6VMC4"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC4"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82416.1"
FT                   /translation="MDNKRKIIHIICAIFILSLMSFSMFIVSEYLISLVLMDEKITFSS
FT                   SVFMTFFSFPLVLYYMVFVVFVNVVGRYPKHHDSFNKYFCSIAIVSIVLSFPTSLYVNY
FT                   KLKSDGYLVCPRISWMSPNTYVKDIKLCD"
FT   sig_peptide     354273..354383
FT                   /locus_tag="PAU_00323"
FT                   /note="Signal peptide predicted for PAT2359 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.407 between residues 37 and 38"
FT   misc_feature    354282..354671
FT                   /note="HMMPfam hit to PF06836, Protein of unknown function
FT                   (DUF1240), score 7.4e-47"
FT                   /inference="protein motif:Pfam:PF06836"
FT   misc_feature    order(354291..354356,354414..354482,354519..354578)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2359 by TMHMM2.0 at aa 7-28, 48-70 and 83-102"
FT   CDS_pept        354680..355123
FT                   /transl_table=11
FT                   /locus_tag="PAU_00324"
FT                   /old_locus_tag="PAT2360"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00324"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82417"
FT                   /db_xref="GOA:B6VMC5"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82417.1"
FT                   /translation="MNLILINFFIIGVVMENKRKIVRIISALAIFILTLVSFFFSGNDL
FT                   ISLVKMDDKITFSSSVFIVFCSFPLISYAVFFIVFVNVTGYYPKYHDGFVKYLGSIWVF
FT                   LFFLSFPTSLYVNYKLRSDNYLICPRISWMSPNTYVKDIKLCD"
FT   sig_peptide     354680..354805
FT                   /locus_tag="PAU_00324"
FT                   /note="Signal peptide predicted for PAT2360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.945) with cleavage site
FT                   probability 0.792 between residues 42 and 43"
FT   misc_feature    354731..355120
FT                   /note="HMMPfam hit to PF06836, Protein of unknown function
FT                   (DUF1240), score 1.9e-40"
FT                   /inference="protein motif:Pfam:PF06836"
FT   misc_feature    order(354740..354799,354857..354925,354959..355027)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2360 by TMHMM2.0 at aa 21-40, 60-82 and 94-116"
FT   CDS_pept        355662..356585
FT                   /transl_table=11
FT                   /locus_tag="PAU_00325"
FT                   /old_locus_tag="PAT2361"
FT                   /product="similar to putative lysr-family trancsriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00325"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82418"
FT                   /db_xref="GOA:C7BI60"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI60"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AAPM01000013"
FT                   /protein_id="CAQ82418.1"
FT                   /translation="MKGINLNGGDMDIRNLKAFIVLAETLNYHKASQILHISQPALTKR
FT                   INALEEEFGALLFSRGPGGTRLTDFGQKTFENAQKLLGHFEQFQTQVNHDLQDDAPHYL
FT                   YVSSCFSIYNSGKMKEQFFLGKQEKVVLVLMTGLTFEQQMSLLKSGLLHIAIVPLPFTS
FT                   SLIPKKIFTEKLVYLFKKDSNWQHNSAELNTEMASLYQLISTDERDIPIDFTGGINIFS
FT                   IYDNSNMNLILKTNDIMVMTELIIKHNGFSLIPQKVIRSIPSQYLNLLEVLETDMEIDF
FT                   GILCSPVIDSGLINETELFSLLIDNI"
FT   misc_feature    355698..355877
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protei, score 1.4e-19"
FT                   /inference="protein motif:Pfam:PF00126"
FT   CDS_pept        complement(356964..358934)
FT                   /transl_table=11
FT                   /gene="yheS"
FT                   /locus_tag="PAU_00326"
FT                   /old_locus_tag="PAT2362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00326"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82419"
FT                   /db_xref="GOA:C7BI61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI61"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82419.1"
FT                   /translation="MSVILNLTYYIQTTRMIVFSSLQIRRGTRVLLDNASATINPGQKV
FT                   GLVGKNGCGKSTLLALLKDELQTEAGTFTFPNNWALAWVNQETPALETPALEYVIDGDR
FT                   EFRQLEQQLQIANEKNNGNLIAHLHSQLDTIQAWTIRSRASSLLHGLGFSQEQLDQPVR
FT                   AFSGGWRMRLNLAQALLCRSDLLLLDEPTNHLDLDAVIWLEKWLKSYPGTLILISHDRD
FT                   FLDPIADKILHIEQQSLFEYSGNYSSFERQRATKLAQQQALYKSQQEKVAHLQSYIDRF
FT                   RAKASKAKQAQSRIKMLERMELIAPAHVDNPFHFSFRKPENLPNPLLKMEKVSAGYGER
FT                   TVLSSIKLNLVPGSRIGLLGRNGAGKSTLIKLLANELKSQGGEVELAKGIKLGYFAQHQ
FT                   LEYLRADESPLQHLVRIAPQETEQQLRDYLGGFGFKGDQVTDPSGRFSGGEKARLVLAL
FT                   MVWQRPNLLLLDEPTNHLDLDMRQALTEALIDFDGALVVVSHDRHLLRSTTDELYLVHD
FT                   GRVESFNGDLEDYQQWLTDQQRQQNQQLRESSDKEREPSSKSAQERKDQKRRQADFRNQ
FT                   TQPLRKQLTNLEKQMEKLSDELVVLENQLSDSAIYDNSRKTELTEFLQKQNQAKSKLEE
FT                   TELEWMEIQEQLEQMTQEFNG"
FT   misc_feature    complement(357378..357881)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   4.6e-15"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(357381..357878)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.4e-44"
FT                   /inference="protein motif:Pfam:PF00005"
FT   misc_feature    complement(358221..358814)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   1.8e-13"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(358224..358811)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.9e-46"
FT                   /inference="protein motif:Pfam:PF00005"
FT   CDS_pept        359008..359562
FT                   /transl_table=11
FT                   /gene="kefG"
FT                   /locus_tag="PAU_00327"
FT                   /old_locus_tag="PAT2363"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein kefg"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00327"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82420"
FT                   /db_xref="GOA:C7BI62"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI62"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82420.1"
FT                   /translation="MMLQPPKVLLLYAHPESQDSVANRVLLQPVLDLEHVTVHDLYGAY
FT                   PDFFIDVHYEQQLLREHQVIVFQHPLYTYSCPALLKEWMDRVLTRGFASGITGLALQGK
FT                   YWRSVITTGEPEGAFQPDGYNLYPMEEILRPFEQTASMCRMHWLPPMVIYWARRQKPEF
FT                   LAIHANAYREWLKSPLPLGGL"
FT   misc_feature    359023..359547
FT                   /note="HMMPfam hit to PF02525, Flavodoxin-like fold, score
FT                   3.9e-68"
FT                   /inference="protein motif:Pfam:PF02525"
FT   CDS_pept        359566..361371
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="PAU_00328"
FT                   /old_locus_tag="PAT2364"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein kefb (k(+)/h(+ antiporter) (nem-activable k(+)/h(+)
FT                   antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00328"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82421"
FT                   /db_xref="GOA:C7BI63"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI63"
FT                   /inference="similar to DNA sequence:INSD:U18997"
FT                   /inference="similar to AA sequence:UniProt:Q0WKB5"
FT                   /protein_id="CAQ82421.1"
FT                   /translation="MEHSAQLSASILFLFAAVVAVPIAQKFRIGAVLGYLLAGIVLGPW
FT                   GLSFIRDVDDILHFSELGIVFLMFIIGLELNPSKLWQLRRSIFGVGAAQVILTAGVLAA
FT                   LLYLTDFAWQAAVIGGIGMAMSSTAMALQLMKEKGMNRNEGGQLGFSVLLFQDIAVIPA
FT                   LALIPLLAGETASSDWYRIMLKIAAFAGMLLGGRYLLRPLFRLVVRSGVREVFTAAALL
FT                   VVLSSALFMEVLGFSMALGTFIAGVLLADSEYRHELEISIEPFKGLLLGLFFISVGMSL
FT                   NLGVLLIHLTDVLLGVLVLVVVKGIVLYLIALISGLRNSSRLQFSGVLSQGGEFAFVLF
FT                   SAALSQNVLNSDQMALLLVVVTLSMMTTPLVMQLIDAILARRYNAQDETDEQPFVEDNE
FT                   PQVILVGFGRFGQVIGRLLMVNKIRITVLERDVSVISTMRRYGYKVYYGDAAELELLRA
FT                   AGADKAKAIVITCNEPENTMMIVHLCQKHFPNLHIMARARGRLEAHELLQSGVENFTRE
FT                   TFSSALELGRKTLVGLGMHPHKAHRAKQHFQRLDMRMLRELMPQLHGDVAHISRIKEAR
FT                   RELEELFEREMLNERRQPDGWNEYE"
FT   sig_peptide     359566..359625
FT                   /gene="kefB"
FT                   /locus_tag="PAU_00328"
FT                   /note="Signal peptide predicted for PAT2364 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.922) with cleavage site
FT                   probability 0.770 between residues 20 and 21"
FT   misc_feature    order(359578..359637,359650..359718,359731..359784,
FT                   359821..359889,359899..359967,360004..360072,
FT                   360100..360168,360229..360297,360367..360435,
FT                   360448..360516,360544..360612,360631..360690)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PAT2364 by TMHMM2.0 at aa 5-24, 29-51, 56-73, 86-108,
FT                   112-134, 147-169, 179-201, 222-244, 268-290, 295-317,
FT                   327-349 and 356-375"
FT   misc_feature    359596..360684
FT                   /note="HMMPfam hit to PF00999, Sodium/hydrogen exchanger
FT                   family, score 4.4e-76"
FT                   /inference="protein motif:Pfam:PF00999"
FT   misc_feature    360769..361128
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   2.3e-27"
FT                   /inference="protein motif:Pfam:PF02254"
FT   CDS_pept        361383..361586
FT                   /transl_table=11
FT                   /gene="yheV"
FT                   /locus_tag="PAU_00329"
FT                   /old_locus_tag="PAT2365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00329"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82422"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI64"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AP009048"
FT                   /protein_id="CAQ82422.1"
FT                   /translation="MSVSRKRFIAGAVCPECHSQDTLAMWQEDQVDVVECIHCGHQQRQ
FT                   TDEKVTSHVRKQEQVIGIFTPQ"
FT   CDS_pept        361651..362259
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="PAU_00330"
FT                   /old_locus_tag="PAT2366"
FT                   /product="fkbp-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82423"
FT                   /db_xref="GOA:C7BI65"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI65"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82423.1"
FT                   /translation="MDPRVGDVMKVAKDLVISLAYQVRTEDGVLVDESPVSAPLDYLHG
FT                   RGSLISGLEKALEGREAGESFDVSVQADDAYGQYDDNLVQRVPKDVFVGVDELEVGMRF
FT                   LADTDMGPVPVEITAVEDEHVVVDGNHMLAGQNLKFNVEIIAIREATEEELAHGHVHGA
FT                   HGHEHGEGGCCGGHGHNHDDGHHHHNNEGHGCCGGGGCH"
FT   misc_feature    361666..362085
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomeras, score 0.00023"
FT                   /inference="protein motif:Pfam:PF00254"
FT   CDS_pept        362474..363178
FT                   /transl_table=11
FT                   /locus_tag="PAU_00331"
FT                   /old_locus_tag="PAT2367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82424"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI66"
FT                   /inference="similar to DNA sequence:INSD:BX950851"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82424.1"
FT                   /translation="MKNPYCTVDELGFPKFTAVDGIRYKLLPNNWKYLTGEAYLWAYKI
FT                   AYLEYNREKIIHYAHQEKIPVLLLAGVAVAEVGGKPDRIKAYGVLQYRQIVDKFRGNNS
FT                   YSNSTSVGALAIQLRAAAETMGIDPSTLTTTQQLQLANCLLADDFNIKIVARHLRELIL
FT                   YDYPGIDTEKLNDEQLILAGSRYNRGTARNKEDFIKSINAEKGTPERIYSEYGRSILRK
FT                   RNSINQIMGISE"
FT   CDS_pept        363175..363489
FT                   /transl_table=11
FT                   /locus_tag="PAU_00332"
FT                   /old_locus_tag="PAT2368"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00332"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82425"
FT                   /db_xref="GOA:C7BI67"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI67"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /inference="similar to AA sequence:UniProt:Q0WIS5"
FT                   /protein_id="CAQ82425.1"
FT                   /translation="MNKLSTVLIVGYVFFCVLFIYMMSYFEKEYYIDGIDIKNICDVYN
FT                   ALVVDDTRDFDAPVSLLFLFPLFYHAAKKRFKSLFFNVISVVLLAYWVWRFFIRLIVCI
FT                   "
FT   misc_feature    order(363193..363252,363337..363390,363409..363468)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2368 by TMHMM2.0 at aa 7-26, 55-72 and 79-98"
FT   CDS_pept        364425..365201
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="PAU_00333"
FT                   /old_locus_tag="PAT2369"
FT                   /product="fkbp-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82426"
FT                   /db_xref="GOA:C7BI68"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI68"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82426.1"
FT                   /translation="MEKQMKSLFKVTLLATTLAMVFSAPQVLAAKADNQSSIELNSAFK
FT                   TEDQQNAYALGASLGRYMENTLKEQKSLGIPLDKDQLLAGVQDAFKDKSKLTDSEIENT
FT                   LRAFEGKVKSAAEAKMEKEASDNEAKGAKYREAFAKEKGVVKSQTGLLYKIEKEGNGKK
FT                   PVASDTVVVNYKGALIDGKEFDSSYKRNEPLSIRLDGVIPGWTEGLQKVQKGGKIKLVI
FT                   PPELAYGKAGVPGIPANSTLVFDIELLDVKADTKAK"
FT   sig_peptide     364425..364511
FT                   /gene="fkpA"
FT                   /locus_tag="PAU_00333"
FT                   /note="Signal peptide predicted for PAT2369 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.987 between residues 29 and 30"
FT   misc_feature    364503..364889
FT                   /note="HMMPfam hit to PF01346, Domain amino terminal to
FT                   FKBP-type peptidyl-, score 1.4e-42"
FT                   /inference="protein motif:Pfam:PF01346"
FT   misc_feature    364899..365171
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomeras, score 1.9e-45"
FT                   /inference="protein motif:Pfam:PF00254"
FT   CDS_pept        complement(365274..365456)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00334"
FT                   /old_locus_tag="PAT2370"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00334"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82427"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI69"
FT                   /inference="similar to DNA sequence:INSD:AACM01000162"
FT                   /protein_id="CAQ82427.1"
FT                   /translation="MLKTQRNKLIKISCENSTSTTCTEISVKDLCITSDIDVKTTRHHR
FT                   QAIAAQTFGLYHSFQ"
FT   CDS_pept        365478..366212
FT                   /transl_table=11
FT                   /gene="yheO"
FT                   /locus_tag="PAU_00335"
FT                   /old_locus_tag="PAT2371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00335"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82428"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI70"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82428.1"
FT                   /translation="MVYLMSNPLLSGDASDIDLLENQPFTETDHEILKSYEAAVDGLAM
FT                   LIGGHCEIVLHSLEDLKCSAVRIANGEHTGRKIGSPITDLALRMLHDITDEDCSASKAY
FT                   FTRAKSGSLMKSVTIAIRNRNRRVIGLLCINMNLDVPFSEIIQTFIPEETHDVAPNVNF
FT                   ASSVDDLVAQTLEYTIEEVNIDRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVAERLNI
FT                   SKHTVYLYIRQFKNGECLGPER"
FT   misc_feature    365571..365921
FT                   /note="HMMPfam hit to PF08348, YheO-like protein, score
FT                   2.6e-56"
FT                   /inference="protein motif:Pfam:PF08348"
FT   CDS_pept        366212..366607
FT                   /transl_table=11
FT                   /gene="tusD"
FT                   /locus_tag="PAU_00336"
FT                   /old_locus_tag="PAT2372"
FT                   /product="sulfurtransferase tusd"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00336"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82429"
FT                   /db_xref="GOA:C7BI71"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI71"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82429.1"
FT                   /translation="MPSLSYCLLVTGPAYGTQQASSAYQFAQTLIAMGHKLNTVFFYRE
FT                   GVYNGNQLTAPASDEFNLVSAWQMMATEHQFGMHICVAAALRRGVLDTQQANELNLPVA
FT                   NLAEGFELSGLGTLAEAMLTCDRVVQF"
FT   sig_peptide     366212..366292
FT                   /gene="tusD"
FT                   /locus_tag="PAU_00336"
FT                   /note="Signal peptide predicted for PAT2372 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.641) with cleavage site
FT                   probability 0.204 between residues 27 and 28"
FT   misc_feature    366221..366604
FT                   /note="HMMPfam hit to PF02635, DsrE/DsrF-like family, score
FT                   1.6e-51"
FT                   /inference="protein motif:Pfam:PF02635"
FT   CDS_pept        366617..366976
FT                   /transl_table=11
FT                   /gene="tusC"
FT                   /locus_tag="PAU_00337"
FT                   /old_locus_tag="PAT2373"
FT                   /product="protein tusc (trna 2-thiouridine synthesizing
FT                   protein c)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00337"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82430"
FT                   /db_xref="GOA:C7BI72"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI72"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82430.1"
FT                   /translation="MKKIAFVFTQAPHGNAGGREGLDALLATSALTEHIGVFFISDGVF
FT                   QLLPDQRPDRVLARNYIATFKVLPLYDIEACYLCQEDLVMRGLSSASRFILDVEVLSIE
FT                   TIREKLVGYDVVLTF"
FT   misc_feature    366620..366973
FT                   /note="HMMPfam hit to PF02635, DsrE/DsrF-like family, score
FT                   8.6e-36"
FT                   /inference="protein motif:Pfam:PF02635"
FT   CDS_pept        366997..367284
FT                   /transl_table=11
FT                   /gene="tusB"
FT                   /locus_tag="PAU_00338"
FT                   /old_locus_tag="PAT2374"
FT                   /product="protein tusb (trna 2-thiouridine synthesizing
FT                   protein b)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00338"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82431"
FT                   /db_xref="GOA:C7BI73"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI73"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82431.1"
FT                   /translation="MLYTVSRSPYQCDFNAIFNLLTGGDDILFIQDGVLAGIEANRYLP
FT                   TLINSGITLYALKEDIEARGLLGQVSDKVQVIDYTDFVNLTVKHHQQFAW"
FT   misc_feature    367015..367278
FT                   /note="HMMPfam hit to PF04077, DsrH like protein, score
FT                   7.3e-25"
FT                   /inference="protein motif:Pfam:PF04077"
FT   CDS_pept        367307..367795
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="PAU_00339"
FT                   /old_locus_tag="PAT2375"
FT                   /product="30s ribosomal protein s12"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00339"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82432"
FT                   /db_xref="GOA:C7BI74"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI74"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82432.1"
FT                   /translation="MTPRRVSHKIPRPRVLPSGQTRDLIRVYEAKKPGVFLIMATINQL
FT                   VRKPRSMKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSY
FT                   IGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGVKKPKA"
FT   misc_feature    367424..367789
FT                   /note="HMMPfam hit to PF00164, Ribosomal protein S12, score
FT                   2.5e-74"
FT                   /inference="protein motif:Pfam:PF00164"
FT   CDS_pept        367892..368362
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="PAU_00340"
FT                   /old_locus_tag="PAT2376"
FT                   /product="30s ribosomal subunit protein s7"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82433"
FT                   /db_xref="GOA:C7BI75"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI75"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82433.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYS
FT                   ALETLAQRSGKEHLEAFELALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VDAARKRGDKSMALRLANELSDAAENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   misc_feature    367895..368338
FT                   /note="HMMPfam hit to PF00177, Ribosomal protein S7p/S5e,
FT                   score 7.8e-87"
FT                   /inference="protein motif:Pfam:PF00177"
FT   CDS_pept        368443..370551
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="PAU_00341"
FT                   /old_locus_tag="PAT2377"
FT                   /product="elongation factor g (ef-g)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82434"
FT                   /db_xref="GOA:C7BI76"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI76"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82434.1"
FT                   /translation="MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWSGMAKQFDAHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYRVPRIAFVNKMDRMGANFLRVVEQIKTRLA
FT                   ANPVPLQLAIGAEDAFTGVVDLVKMKAINWNDEDQGTTFTYEDIPADMQDLAEEWRNNL
FT                   IEAAAEASEELMEKYLSGEELTEEEIKAGLRHRVLTNEIILVTCGSAFKNKGVQAMLDA
FT                   VVEYLPAPTDVESIKGILPDGKDTPAERHSDDKEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GVVNSGDTVLNPVKDKKERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCD
FT                   ISAPIILERMEFPEPVISVAIEPKTKADQEKMGIALGRLAQEDPSFRVSTDEESGQTII
FT                   AGMGELHLDVLVDRMRREFKVEANVGKPQVAYRETIRSTVEQEGKFVRQSGGRGQFGHV
FT                   WLRIEPMEPGGKGYEFANEIVGGVVPKEYIPAVDKGVQEQMKNGVLAGYPIVDVKVALF
FT                   DGSYHEVDSSEMAFKIAGSMGFKEGFMKAKPVLLEPIMKVEVETPEDYMGDVIGDLNRR
FT                   RGMIDGMEDIATGKTVRAQVPLSEMFGYATDLRSQTQGRASYSMEFLKYNEAPSNVAQA
FT                   IIEARKAK"
FT   misc_feature    368464..369312
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 1.2e-110"
FT                   /inference="protein motif:Pfam:PF00009"
FT   misc_feature    369433..369636
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 1.6e-21"
FT                   /inference="protein motif:Pfam:PF03144"
FT   misc_feature    369898..370260
FT                   /note="HMMPfam hit to PF03764, Elongation factor G, domain
FT                   IV, score 7.6e-72"
FT                   /inference="protein motif:Pfam:PF03764"
FT   misc_feature    370264..370527
FT                   /note="HMMPfam hit to PF00679, Elongation factor G
FT                   C-terminus, score 5.4e-51"
FT                   /inference="protein motif:Pfam:PF00679"
FT   CDS_pept        370622..371806
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /gene_synonym="tufB"
FT                   /locus_tag="PAU_00342"
FT                   /old_locus_tag="PAT2378"
FT                   /product="elongation factor tu-b (ef-tu-b)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00342"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82435"
FT                   /db_xref="GOA:C7BI77"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI77"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82435.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKKYGGNAR
FT                   AFDQIDNAPEEKARGITISTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGEAEWEDKILELAEALDSYIPEPERAVDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIQMKVTLIAPIAMDQGLRFAIREGGRTVGAGVVAKVIA"
FT   misc_feature    370649..371233
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 1.1e-99"
FT                   /inference="protein motif:Pfam:PF00009"
FT   misc_feature    371294..371503
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 2.9e-25"
FT                   /inference="protein motif:Pfam:PF03144"
FT   misc_feature    371516..371800
FT                   /note="HMMPfam hit to PF03143, Elongation factor Tu
FT                   C-terminal domain, score 1.9e-60"
FT                   /inference="protein motif:Pfam:PF03143"
FT   CDS_pept        371889..372059
FT                   /transl_table=11
FT                   /locus_tag="PAU_00343"
FT                   /old_locus_tag="PAT2379"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00343"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82436"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI78"
FT                   /inference="similar to DNA sequence:INSD:AE000782"
FT                   /protein_id="CAQ82436.1"
FT                   /translation="MFLIIGEIGSDATNWLYISQICNAILNYGAKSDTITQIFWFGLIC
FT                   FALARQAGYLY"
FT   CDS_pept        372081..372464
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="PAU_00344"
FT                   /old_locus_tag="PAT2380"
FT                   /product="inner membrane preprotein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00344"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82437"
FT                   /db_xref="GOA:C7BI79"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI79"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82437.1"
FT                   /translation="MSANTDAQGSRRSLEVVKWLLVAVLLTVAIVGNYLYREYSLPLRA
FT                   IAVVVIVALAGAAALWTAKGKTTLAFAREARIEMRKVIWPTRQEALHTTLIVAAVTALM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   misc_feature    order(372135..372188,372201..372269,372345..372413)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2380 by TMHMM2.0 at aa 19-36, 41-63 and 89-111"
FT   misc_feature    372279..372449
FT                   /note="HMMPfam hit to PF00584, SecE/Sec61-gamma subunits of
FT                   protein translo, score 3e-23"
FT                   /inference="protein motif:Pfam:PF00584"
FT   CDS_pept        372465..373010
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="PAU_00345"
FT                   /old_locus_tag="PAT2381"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00345"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82438"
FT                   /db_xref="GOA:C7BI80"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI80"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82438.1"
FT                   /translation="MSDSPKKRWYVIQAFSGFEGRVAQSLREHIKLHDMEDSFGEVMVP
FT                   TEEVVEIRSGQRRKSERKFFPGYVLVQMIMNDATWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVSDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKV"
FT   misc_feature    372480..372809
FT                   /note="HMMSmart hit to SM00738, no description, score
FT                   1.3e-48"
FT                   /inference="protein motif:Smart:SM00738"
FT   misc_feature    372483..372782
FT                   /note="HMMPfam hit to PF02357, Transcription termination
FT                   factor nusG, score 1.8e-55"
FT                   /inference="protein motif:Pfam:PF02357"
FT   misc_feature    372843..372926
FT                   /note="HMMSmart hit to SM00739, no description, score
FT                   1e-06"
FT                   /inference="protein motif:Smart:SM00739"
FT   misc_feature    372846..372959
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 1.6e-11"
FT                   /inference="protein motif:Pfam:PF00467"
FT   CDS_pept        373165..373593
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="PAU_00346"
FT                   /old_locus_tag="PAT2382"
FT                   /product="50s ribosomal protein l11"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00346"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82439"
FT                   /db_xref="GOA:C7BI81"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI81"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82439.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSA
FT                   QIREIAETKAADMTGASVDAMMRSIEGTARSMGLVVEG"
FT   misc_feature    373186..373365
FT                   /note="HMMPfam hit to PF03946, Ribosomal protein L11,
FT                   N-terminal dom, score 1.8e-38"
FT                   /inference="protein motif:Pfam:PF03946"
FT   misc_feature    373189..373587
FT                   /note="HMMSmart hit to SM00649, no description, score
FT                   6.5e-84"
FT                   /inference="protein motif:Smart:SM00649"
FT   misc_feature    373378..373584
FT                   /note="HMMPfam hit to PF00298, Ribosomal protein L11, RNA
FT                   binding do, score 4.2e-37"
FT                   /inference="protein motif:Pfam:PF00298"
FT   CDS_pept        373597..374298
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="PAU_00347"
FT                   /old_locus_tag="PAT2383"
FT                   /product="50s ribosomal subunit protein l1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00347"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82440"
FT                   /db_xref="GOA:C7BI82"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI82"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82440.1"
FT                   /translation="MAKLTKRMRTIREKVDSTKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVQNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPSSAKGVYIKKVSLSTTMGAGV
FT                   AIDQSGLTASA"
FT   misc_feature    373639..374259
FT                   /note="HMMPfam hit to PF00687, Ribosomal protein L1p/L10e
FT                   family, score 7.1e-137"
FT                   /inference="protein motif:Pfam:PF00687"
FT   CDS_pept        374608..375105
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="PAU_00348"
FT                   /old_locus_tag="PAT2384"
FT                   /product="50s ribosomal subunit protein l10"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00348"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82441"
FT                   /db_xref="GOA:C7BI83"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI83"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82441.1"
FT                   /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVAVDKMTELRKAG
FT                   REAGVYIRVVRNTLIRRAVEGTAYECLKEAFIGPTLIAFSNEHPGAAARLFKEFAKANP
FT                   AFEIKAAAFEGEFISAANIDRLATLPTYEEAIARLMSTMKEAVAGKLVRTLAALREKRE
FT                   AA"
FT   misc_feature    374614..374910
FT                   /note="HMMPfam hit to PF00466, Ribosomal protein L10, score
FT                   1.2e-36"
FT                   /inference="protein motif:Pfam:PF00466"
FT   CDS_pept        375169..375534
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="PAU_00349"
FT                   /old_locus_tag="PAT2385"
FT                   /product="50s ribosomal subunit protein l7/l12"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00349"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82442"
FT                   /db_xref="GOA:C7BI84"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI84"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82442.1"
FT                   /translation="MSITKEQILDTVATMSVMDVVELITAMEEKFGVSAAAAVAVVAGA
FT                   AEAVEEKTEFDVVLSAIGGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDDA
FT                   EALKKSLEEAGASVEIK"
FT   misc_feature    375328..375531
FT                   /note="HMMPfam hit to PF00542, Ribosomal protein L7/L12
FT                   C-terminal dom, score 1.7e-37"
FT                   /inference="protein motif:Pfam:PF00542"
FT   CDS_pept        375873..379901
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="PAU_00350"
FT                   /old_locus_tag="PAT2386"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82443"
FT                   /db_xref="GOA:C7BI85"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI85"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AP009048"
FT                   /protein_id="CAQ82443.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QNGLEAAFRSVFPIQSYSGSSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRAMDYSTEEILN
FT                   LFFSKTIFEIRDNRLQMTLVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VNRIEVPVEYIAGKVVARDYIDVNTGEIICAANMELSLDLLARLSQAGHKSIETLFTND
FT                   LDHGAYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLSREEVEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRLVRDGVVTDEIHYLSAIEEGNFVIAQANTVLDDEGHFVEDLIT
FT                   CRNFGESSLFNREQVEYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVSLAEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLRQAKKDLTEELQIFEAGLFARIRSVLVSGGIEAEKL
FT                   DKLPRERWLELGLADEEKQNQLEQLAEQYDELKAEFEKKLDAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQKAYDLGDETRQKVDLNTFSD
FT                   EEVLRLAENLKKGMPIATPVFDGAKEKEIKELLKLGDLPTSGQITLFDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   misc_feature    375951..377399
FT                   /note="HMMPfam hit to PF04563, RNA polymerase beta subunit,
FT                   score 6.8e-38"
FT                   /inference="protein motif:Pfam:PF04563"
FT   misc_feature    376323..377234
FT                   /note="HMMPfam hit to PF04561, RNA polymerase Rpb2, domain,
FT                   score 1.7e-06"
FT                   /inference="protein motif:Pfam:PF04561"
FT   misc_feature    377409..377618
FT                   /note="HMMPfam hit to PF04565, RNA polymerase Rpb2, domain,
FT                   score 1.8e-43"
FT                   /inference="protein motif:Pfam:PF04565"
FT   misc_feature    378015..379664
FT                   /note="HMMPfam hit to PF00562, RNA polymerase Rpb2, domain,
FT                   score 5.2e-185"
FT                   /inference="protein motif:Pfam:PF00562"
FT   misc_feature    379668..379898
FT                   /note="HMMPfam hit to PF04560, RNA polymerase Rpb2, domain,
FT                   score 4.1e-52"
FT                   /inference="protein motif:Pfam:PF04560"
FT   CDS_pept        379957..384252
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="PAU_00351"
FT                   /old_locus_tag="PAT2387"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82444"
FT                   /db_xref="GOA:C7BI86"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI86"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82444.1"
FT                   /translation="MVALVIGGSDMGRSPDRSNSDRSHFVKDLLKFLKAQTKTEEFDAI
FT                   KIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLK
FT                   HRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERV
FT                   LYFESYVVVEGGMTSLERSQILTEEQYLDALEEFGDEFDAKMGAEAIQSLLKNLDLENE
FT                   CETLREELNETNSETKRKKLTKRIKLLEAFIQSGNKPEWMVLTVLPVLPPDLRPLVPLD
FT                   GGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRA
FT                   ITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMAL
FT                   ELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLG
FT                   IQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILS
FT                   PASGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERVYRAGLASLHARVKVR
FT                   ITEEVKDGEGNITTSTGLVDTTIGRAILWMIVPRGLPYSLVNQPLGKKAISKMLNTCYR
FT                   VMGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQ
FT                   SGLVTAGERYNKVIDIWAAANERVAKAMMENLSTETVINRDGEEEQQVSFNSIFMMADS
FT                   GARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTA
FT                   LKTANSGYLTRRLVDVAQDLVVTEDDCGTHDGILMTPVIEGGDVKEPLRERVLGRVTAE
FT                   DVLKPGTADILVPRNTLLNEKWCDLLEESSVDSIKVRSVVSCETDFGVCANCYGRDLAR
FT                   GHIINKGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVRNKGSLKLFNAK
FT                   SVMNSAGKLVITSRNTELCLIDEFGRTKESYKVPYGAVLGKGDGEAVNGGETVANWDPH
FT                   TMPVVSEVSGIIRFADMIDGQTITRQTDELTGLSSLVVLDSAERTGSGKDLRPALKIVN
FT                   ANGDDVLIPGTDMPAQYFLPGKAIVQLDDGVSISAGDTLARIPQESGGTKDITGGLPRV
FT                   ADLFEARRPKEPAILAEVSGIVSFGKETKGKRRLVISPLDGGDAYEEMIPKWRQLNVFE
FT                   GEVVERGDVISDGPESPHDILRLRGVHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQ
FT                   MLRKATIESAGSSEFLEGEQVEYARVKVANRKLEQEGKVPATYGRDLLGITKASLATES
FT                   FISAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHRDRMRRRQLNE
FT                   ASEAPQVSVDEATANLAELLNAGFGSDKK"
FT   misc_feature    380071..381057
FT                   /note="HMMPfam hit to PF04997, RNA polymerase Rpb1, domain,
FT                   score 1.6e-158"
FT                   /inference="protein motif:Pfam:PF04997"
FT   misc_feature    380734..381573
FT                   /note="HMMSmart hit to SM00663, no description, score
FT                   2.7e-184"
FT                   /inference="protein motif:Smart:SM00663"
FT   misc_feature    381061..381489
FT                   /note="HMMPfam hit to PF00623, RNA polymerase Rpb1, domain,
FT                   score 2e-83"
FT                   /inference="protein motif:Pfam:PF00623"
FT   misc_feature    381496..381963
FT                   /note="HMMPfam hit to PF04983, RNA polymerase Rpb1, domain,
FT                   score 6.9e-49"
FT                   /inference="protein motif:Pfam:PF04983"
FT   misc_feature    382048..382323
FT                   /note="HMMPfam hit to PF05000, RNA polymerase Rpb1, domain,
FT                   score 1.7e-29"
FT                   /inference="protein motif:Pfam:PF05000"
FT   misc_feature    382327..383997
FT                   /note="HMMPfam hit to PF04998, RNA polymerase Rpb1, domain,
FT                   score 1.8e-109"
FT                   /inference="protein motif:Pfam:PF04998"
FT   CDS_pept        384934..385215
FT                   /transl_table=11
FT                   /locus_tag="PAU_00352"
FT                   /old_locus_tag="PAT2388"
FT                   /product="prophage protein gp48"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00352"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82445"
FT                   /db_xref="GOA:C7BI87"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI87"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CR942285"
FT                   /protein_id="CAQ82445.1"
FT                   /translation="MKKYKTHSEILAEMMKDSEFKAAYEAEERKERLQETLAEWRKFAG
FT                   LTRSQVAERMGVTPPTVTKMENNVTKASIETLVRYAQACGIQNPQITL"
FT   misc_feature    385039..385206
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   3.8e-12"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    385042..385206
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.5e-10"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        385350..385553
FT                   /transl_table=11
FT                   /locus_tag="PAU_00353"
FT                   /old_locus_tag="PAT2389"
FT                   /product="similar to putative phage transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00353"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82446"
FT                   /db_xref="GOA:C7BI88"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI88"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CR753847"
FT                   /protein_id="CAQ82446.1"
FT                   /translation="MATLDELLEKRSPESHRRIAKKVGERKREIDLYQIRKVRDVSLTE
FT                   LATVLGIKQPTVAKIEQPDNDP"
FT   CDS_pept        385786..386043
FT                   /transl_table=11
FT                   /gene="chpR"
FT                   /locus_tag="PAU_00354"
FT                   /old_locus_tag="PAT2390"
FT                   /product="putative transcriptional regulator pemi-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00354"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82447"
FT                   /db_xref="GOA:C7BI89"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI89"
FT                   /inference="similar to DNA sequence:INSD:AM286690"
FT                   /inference="similar to AA sequence:UniProt:Q445J5"
FT                   /protein_id="CAQ82447.1"
FT                   /translation="MTAVVIRQSGGANIVSLPKAIVKALSLHTGSKLDLSIQDNKIVLT
FT                   PIEEELTLESLLAGSPKECFTVTDEDREWIDVNPVGKEVI"
FT   misc_feature    385804..385941
FT                   /note="HMMPfam hit to PF04014, SpoVT / AbrB like domain,
FT                   score 5.1e-08"
FT                   /inference="protein motif:Pfam:PF04014"
FT   CDS_pept        386043..386372
FT                   /transl_table=11
FT                   /locus_tag="PAU_00355"
FT                   /old_locus_tag="PAT2391"
FT                   /product="putative transcriptional regulator pemk-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00355"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82448"
FT                   /db_xref="GOA:C7BI90"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI90"
FT                   /inference="similar to DNA sequence:INSD:AAAK03000006"
FT                   /inference="similar to DNA sequence:INSD:AAIK01000031"
FT                   /protein_id="CAQ82448.1"
FT                   /translation="MYVPDKGDIVSLDFDPSAGKEIMKRRPAFVISRKMFNEHTGFAVV
FT                   APITSTVRGMKLEVVLPEELSIQGAILIHQVKSLDFSDRQVKFIEKAPQDIIDKVTELT
FT                   KVIIS"
FT   misc_feature    386055..386369
FT                   /note="HMMPfam hit to PF02452, PemK-like protein, score
FT                   4.8e-14"
FT                   /inference="protein motif:Pfam:PF02452"
FT   CDS_pept        386419..386826
FT                   /transl_table=11
FT                   /locus_tag="PAU_00356"
FT                   /old_locus_tag="PAT2392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00356"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82449"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI91"
FT                   /inference="similar to DNA sequence:INSD:BX571871"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82449.1"
FT                   /translation="MNVFLFNIQFPPQGIDELKVAKIVVSACGGSCQTYQASLMLIGIY
FT                   TRYLSSCLFVGCTRSPRSHSLLCSRGFTPLPSRCILKSIGYTLMIKYSIPFILQVAALL
FT                   AAFTHPSHIVIYAPGDSFTCRCAATRNLLGI"
FT   CDS_pept        387185..388063
FT                   /transl_table=11
FT                   /locus_tag="PAU_00357"
FT                   /old_locus_tag="PAT2393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00357"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82450"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI92"
FT                   /inference="similar to DNA sequence:INSD:AAFI02000012"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /protein_id="CAQ82450.1"
FT                   /translation="MESGINLKYEDITEENYILINNFYKRDVGSLYYFIWKNMEEKKYN
FT                   LSSEIKAFLYKRNDIYLSILITRKCEFSLKHRRVSINMLSDFGIDESIKSRTLIIESAK
FT                   QTHSNDVDATVCYSDERKIKCYAKIFEKYLCSRVDVFDFTEIVVEGCTKIDVDLRDFNE
FT                   IDNINKINFFGREVNNNWIAYSKQCPHYRDIKLLTVGKELAILGFDDTTVEVIGLSNTA
FT                   SDTIISVVDSCLAIREKCRIILPNPIYSELQSRLNKHSIINKFSMMIAWHTEEDFNLFH
FT                   ENIFISRIDKR"
FT   CDS_pept        388075..388749
FT                   /transl_table=11
FT                   /gene="CWF19L1"
FT                   /locus_tag="PAU_00358"
FT                   /old_locus_tag="PAT2394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00358"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82451"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR040194"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI93"
FT                   /inference="similar to DNA sequence:INSD:BC008746"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /protein_id="CAQ82451.1"
FT                   /translation="MGCIFCHPESSFEKDKILLQGKYFYVFVPKGQIIEGYIIIATNKC
FT                   ENDLGGYRCFAEIYDEEAIKELKKFKNIINDFYREYYNISNPLCYENGRAGGCIVMDPN
FT                   QKYCYHAHLCCFPTAIDLHNKLKNQFKIHTIDSLDELKIFGEVGPYIYVEDSGNKYIFT
FT                   IGESDFIERGMIRTVLANSLNVPERSDWRVNEGINEMDATAKKFKLYIKNHMEIEECYM
FT                   QM"
FT   CDS_pept        388731..389891
FT                   /transl_table=11
FT                   /gene="CsdB2"
FT                   /locus_tag="PAU_00359"
FT                   /old_locus_tag="PAT2395"
FT                   /product="similar to nifs family aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00359"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82452"
FT                   /db_xref="GOA:C7BI94"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI94"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE013216"
FT                   /protein_id="CAQ82452.1"
FT                   /translation="MLYADVASTSWPKSQEVKDIINMYLDTLGVTPGRSLSQQSKKVTE
FT                   LIEECRYEFIEQIGLNGHGTVIFNSGATYSLNECIKGTLKPGDNVITTHLEHNSVLRPI
FT                   EHLKDIGVSSQLIDVTDGEIDMSHLEFLLKDKKTKLLVVHSCSNTIGTFCNIDEIGKLA
FT                   HLYGAMVLVDGSQSFGSQAIDLSKGNIDYLVFSGHKSLGGVSGIGGYFILDNGFSHNEL
FT                   IQGGTGVLSRLTTQPTGIPYKYESGTQNTIGILSLLASIRRLKKIGIKNIQNQLQTLRI
FT                   NLIDELSQLKKIKLICKHKIGLPTILFTVEGYHPGEVSYILENKYNIITRPGLQCAPLA
FT                   HKKFGTYPDGAVRVSLDTSHTMEDILKIKLALLEITEENYAGNTYN"
FT   misc_feature    388734..389834
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 4.2e-41"
FT                   /inference="protein motif:Pfam:PF00266"
FT   CDS_pept        390173..390811
FT                   /transl_table=11
FT                   /locus_tag="PAU_00360"
FT                   /old_locus_tag="PAT2396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82453"
FT                   /db_xref="GOA:C7BI95"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI95"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AAAH02000008"
FT                   /protein_id="CAQ82453.1"
FT                   /translation="MPNKNERYLIDLINGKLNCIHIDGNGDFNNTNIDWKDTLILSGSF
FT                   NPLHKGHEQLKEIATAMTKRKPYYELSIKNAVKLTISTDEIFERIRQFKGKGDIILSDA
FT                   KFFTEKSYIYQGAIFVIGADLCQEINNPIYYGGEEGLKKSLMTIKNNDCRFLVAGRFFN
FT                   NKYHTIHDLVNIKNEHRFLFESIPENLFRLDISSTEIRLMNKRKERDYE"
FT   CDS_pept        390804..391586
FT                   /transl_table=11
FT                   /locus_tag="PAU_00361"
FT                   /old_locus_tag="PAT2397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82454"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI96"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:U62057"
FT                   /protein_id="CAQ82454.1"
FT                   /translation="MSKENNKKLLDGKINLNSIYLTKEIQRRLKQASFIFNPDGRSLNS
FT                   QLNNLQIKLFYEICSFLEQDGNLDILASCIHDLWCAKYLVDNKTAMQDSITKLEVEYNL
FT                   QINFLKPYQAFTEKEKKFEKRLIKSDLSIISEVIKDIYLYDDNIISDNFNYEILLSTND
FT                   AIFSDLITILGHNDNIIEIAAKRIHAGWFDIMKEFYANDERVQFQEKPNIDNSDFIKNR
FT                   DGIRIDLAAIYIVLMEIKYIPNRFQDASRRTGSESPGA"
FT   CDS_pept        391677..392456
FT                   /transl_table=11
FT                   /locus_tag="PAU_00362"
FT                   /old_locus_tag="PAT2398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00362"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82455"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI97"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE008397"
FT                   /protein_id="CAQ82455.1"
FT                   /translation="MIHLFLSPHLDDVALSAGGLIHKLVSENQKVVVLTFFTEYDENLI
FT                   SHYLHSEHNDNMNSFIKFYSKRANEDIAFCNKLSAIPIHGKILDCIYRTDQYSEPMYKN
FT                   SVMIYSGQIHKSDNASDMAEDLINKTLLNYQPDYIYAPLGIGRHVDHIIINNLVYNIKG
FT                   PRKFKILLYEDFPYVLGKYPIIHPDNLESALLRNNKFDKHAILVDINLKEKMQNILFYE
FT                   SQLEPLFDNKLNLLISLRKYHHSINKAKTQERFWLIK"
FT   misc_feature    391686..392162
FT                   /note="HMMPfam hit to PF02585, GlcNAc-PI de-N-acetylase,
FT                   score 5.7e-23"
FT                   /inference="protein motif:Pfam:PF02585"
FT   CDS_pept        392467..393540
FT                   /transl_table=11
FT                   /gene="rfaB"
FT                   /locus_tag="PAU_00363"
FT                   /old_locus_tag="PAT2399"
FT                   /product="lipopolysaccharide 1,6-galactosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00363"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82456"
FT                   /db_xref="GOA:C7BI98"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI98"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AP009048"
FT                   /protein_id="CAQ82456.1"
FT                   /translation="MKKIFIIYHDLFLNGYGGVETVCSNLMNLIDRGNIGINFFFISLN
FT                   KKNKIENRAWLSNAKHIALASNSDESRQDITYELSLILKRFQPEILISLDTTSCNIARL
FT                   SCEKINLPLRTYSWLHTSIRNPTPQKIKDLCCADEHLVISSGLRDQMLSFGIKMDKLHL
FT                   IFNPIKMNSLIIPQPKHIAKFLYVGRILAYKSKNLTELFLALAQLHGDWELHMLGSGED
FT                   VDSLKELSSQLNINNNIIWHGWKEQPWEFVMDNIKEVSAVILTSKYEGFGMVLAEAISY
FT                   GIYCISSDCKCGPNDIINSLNGELYKSGNILELSKKLQLIIDGSKIRDHHAIKNSIAFL
FT                   YENNFLLRITKALSLQS"
FT   misc_feature    392962..393483
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 2.4e-27"
FT                   /inference="protein motif:Pfam:PF00534"
FT   operon          393619..401262
FT                   /operon="mal"
FT   CDS_pept        complement(393619..394539)
FT                   /transl_table=11
FT                   /operon="mal"
FT                   /gene="malM"
FT                   /locus_tag="PAU_00364"
FT                   /old_locus_tag="PAT2400"
FT                   /product="maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00364"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82457"
FT                   /db_xref="GOA:C7BI99"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:C7BI99"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82457.1"
FT                   /translation="MKIKLLSFCLSTLLCSAIPLIGYATPITTTNKATTAALDAIAPYL
FT                   STTALQKLNWQPVNTNDTQTITLNATSQQLNEGDIQGPIAAFALPANRGSLDIALSSLV
FT                   KDKQVYVPNVLVFDQELRPAAFYPSSYFPYERPGVMSTDRLEGTLKLTPALGQQQIYVL
FT                   VYTTRTDLQKSTQMIDPAKAYAQGVGNAVPAIPDPVAHHTQTGTLKLKVRSEQNAGNIT
FT                   IGQVFSTPAQQPTIVGPTQTTVTPSTPQKVKPVLSDTERYFSDAIKKEISKGNIDKALK
FT                   LLDEAERLGSSTARETFINSIKNKG"
FT   misc_feature    complement(393622..394515)
FT                   /note="HMMPfam hit to PF07148, Maltose operon periplasmic
FT                   protein precursor, score 1.6e-115"
FT                   /inference="protein motif:Pfam:PF07148"
FT   misc_feature    complement(394459..394527)
FT                   /note="1 probable transmembrane helix predicted for PAT2400
FT                   by TMHMM2.0 at aa 5-27"
FT   sig_peptide     complement(394468..394539)
FT                   /gene="malM"
FT                   /locus_tag="PAU_00364"
FT                   /note="Signal peptide predicted for PAT2400 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.879 between residues 24 and 25"
FT   CDS_pept        complement(394660..395946)
FT                   /transl_table=11
FT                   /operon="mal"
FT                   /gene="lamB"
FT                   /locus_tag="PAU_00365"
FT                   /old_locus_tag="PAT2401"
FT                   /product="maltoporin precursor (maltose-inducible porin)
FT                   (lambda recepto protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00365"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82458"
FT                   /db_xref="GOA:C7BIA0"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82458.1"
FT                   /translation="MKSMHILPISLTVMAGLLSMQASAVEFHGYARSGIGWTGSGGEQQ
FT                   CFQSTGAQSKYRLGNECETYAELKLGQELWKDGNKSFYFDTNVAYSVAQQNDWESTDPA
FT                   FREVNVQAKNIIDWLPGSTLWAGKRFYQRHDVHMIDFYYWDISGPGAGLQDIDLGFSKL
FT                   SLAVTRNTESGGSHGWIAGQRNQIPTSNDVYDIRLSGLEVNPGGNLELGFDYGRANARD
FT                   HYHLDRHASKDGFMFTAEHTQSMLGGFNKFVVQYATDSMTSHNSGHSEGASVNNDGHML
FT                   RILNHGAVNLAEKWDLMYVAMYQDTDRDNNNGNTWYTVGVRPMYKWTPTMSTLMDIGYD
FT                   NVKSQRTNDTNDQYKITLAQQWQAGDSIWSRPAIRLFATYAKWDEKWGYANKNKGYTNG
FT                   VAYRDTSMHKFSRGNDDEFTFGVQFEAWW"
FT   misc_feature    complement(394663..395868)
FT                   /note="HMMPfam hit to PF02264, LamB porin, score 4.6e-212"
FT                   /inference="protein motif:Pfam:PF02264"
FT   sig_peptide     complement(395875..395946)
FT                   /gene="lamB"
FT                   /locus_tag="PAU_00365"
FT                   /note="Signal peptide predicted for PAT2401 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 24 and 25"
FT   CDS_pept        complement(395983..397179)
FT                   /transl_table=11
FT                   /operon="mal"
FT                   /gene="malK"
FT                   /locus_tag="PAU_00366"
FT                   /old_locus_tag="PAT2402"
FT                   /product="maltose/maltodextrin import ATP-binding protein"
FT                   /EC_number="3.6.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00366"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82459"
FT                   /db_xref="GOA:C7BIA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82459.1"
FT                   /translation="MDDLLTRYLTHTLVYYFSPRVAVISPGEHMSSVTLRNVSKAYGET
FT                   IISKNINLEIQEGEFVVFVGPSGCGKSTILRMIAGLEDVTSGDLLINNIRMNDIPPAKR
FT                   GVGMVFQSYALYPHLSVADNMSFGMKLAGAKKSDIQQRVKQIAEMLQLAHLLDRRPKAL
FT                   SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLQRTMIYVTHD
FT                   QVEAMTLADRIVVLDGGDVAQIGKPLELYHYPANRFVASFIGSPKMNFLPVKVTATAID
FT                   QVQITLPNRQQIWLPVESRGVKVGSNVSLGIRPEHLLPSDIADVTLEGIVQVVEQLGNE
FT                   TQIHIGIPSIHQNLVYRQTDIVLAKEGSTFTIGLPPHRCHLFREDGTACQRLHKEPGV"
FT   misc_feature    complement(396034..396252)
FT                   /note="HMMPfam hit to PF08402, TOBE domain, score 1.1e-13"
FT                   /inference="protein motif:Pfam:PF08402"
FT   misc_feature    complement(396037..396219)
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 4.8e-06"
FT                   /inference="protein motif:Pfam:PF03459"
FT   misc_feature    complement(396223..396387)
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 1.1e-08"
FT                   /inference="protein motif:Pfam:PF03459"
FT   misc_feature    complement(396460..397011)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   6.1e-13"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(396463..397008)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.6e-58"
FT                   /inference="protein motif:Pfam:PF00005"
FT   CDS_pept        397477..398676
FT                   /transl_table=11
FT                   /operon="mal"
FT                   /gene="malE"
FT                   /locus_tag="PAU_00367"
FT                   /old_locus_tag="PAT2403"
FT                   /product="maltose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00367"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82460"
FT                   /db_xref="GOA:C7BIA2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82460.1"
FT                   /translation="MTKRTLKVGARTLALSALTTLVLSASAFAKIEEGKLVIWINGDKG
FT                   YNGLAQVGEKFEKDTGVKVTVEHPDKLAEKYSQVAATGDGPDIIFWAHDRFGGYAQSGL
FT                   VAEITPDQNLKDKLFPFTWDAVRHDGKLVGYPIAVEALSLIYNKDLVKTPPKTWEEIPA
FT                   LDKGLKSKGKSAIMFNLQEPYFSWPLIAADGGYAFKMENGSYDAKNVGVNNAGSKAGLN
FT                   FIIDLVKNKHLNADTDYSIAEAAFNKGETAMTINGPWAWANIDKSKINYGVALLPTFNG
FT                   QPSKPFVGVLTAGINAASPNKELAKEFLENYLLTNDGLEMVNKDKPLGAVSLKSYHDIL
FT                   AKDPRIAATMENAKNGEIMPNISQMSSFWYAMRNAVVNALTSRQTVDAALSDAEARMTK
FT                   "
FT   sig_peptide     397477..397563
FT                   /gene="malE"
FT                   /locus_tag="PAU_00367"
FT                   /note="Signal peptide predicted for PAT2403 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 29 and 30"
FT   misc_feature    397510..398436
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 5.5e-37"
FT                   /inference="protein motif:Pfam:PF01547"
FT   CDS_pept        398803..400359
FT                   /transl_table=11
FT                   /operon="mal"
FT                   /gene="malF"
FT                   /locus_tag="PAU_00368"
FT                   /old_locus_tag="PAT2404"
FT                   /product="maltose transport system permease protein malf"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00368"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82461"
FT                   /db_xref="GOA:C7BIA3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82461.1"
FT                   /translation="MSATLEKTSWWQHSALKWFAVSLCTLFTGYLVVLMYSQGEYLFAI
FT                   LTLVLLGTGIYVFANRNTYAWRYTYPGVAGMGLFVLFPLICTIAIAFTNYSSTNQLTFE
FT                   RAQSVLMSRQYQSGQTFTFKLYPKSDLWVLALSVPDQTKQLVSEPFALSAIKETTLHVS
FT                   EQDNIPDGEAATLRVITQNRQVLNRLVVVLPDGNRLKMSSLRQFSGVNPQYSLAEDGET
FT                   LTNNQTGMLYRPNMDTGFYQSINAEGKWGSETLTPGFTISIGWKNFLRVIQDEGIQKPF
FT                   LAIFVWTVVFALFTVVLTVAVGMVLACIVQWEALKGRAIYRMLLILPYAVPSFISILIF
FT                   KGLFNQSFGEINLLLNGLFGLKPAWFADPTMARTMLIVVNTWLGYPYMMILCMGLLKAI
FT                   PDDLYEASAIDGAGPLQNFFKITFPLLIKPLTPLMIASFAFNFNNFVLIQLLTLGGPDR
FT                   IGTTAPAGYTDLLVSYTYRIAFDGSSGQDFGLAAAIATVIFLLVGALAIINLKATRIKF
FT                   D"
FT   misc_feature    order(398845..398904,398923..398976,399019..399087,
FT                   399643..399711,399754..399822,399928..399996,
FT                   400264..400332)
FT                   /note="7 probable transmembrane helices predicted for
FT                   PAT2404 by TMHMM2.0 at aa 15-34, 41-58, 73-95, 281-303,
FT                   318-340, 376-398 and 488-510"
FT   misc_feature    399655..400344
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.4e-14"
FT                   /inference="protein motif:Pfam:PF00528"
FT   CDS_pept        400372..401262
FT                   /transl_table=11
FT                   /operon="mal"
FT                   /gene="malG"
FT                   /locus_tag="PAU_00369"
FT                   /old_locus_tag="PAT2405"
FT                   /product="maltose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00369"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82462"
FT                   /db_xref="GOA:C7BIA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA4"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82462.1"
FT                   /translation="MAMVQSKSQKWRLLATHLLMLTFIAIILFPLLMVITISLRPGNFA
FT                   TGSLIPESISWEHWKLALGYSVVSPDGRVTPPPFPVMLWLWNSVKVAFITAVGIVTLST
FT                   TCAYAFARMRFRGKSTLLKGMLIFQMFPAVLSLVALYALFDRLGEYVPFIGLNTHGGVI
FT                   FAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRMVLLPLSVPILAVVFILS
FT                   FIGVITEVPVASLLLRDVNNYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITIVFLIA
FT                   QRWLVSGLTAGGVKG"
FT   sig_peptide     400372..400506
FT                   /gene="malG"
FT                   /locus_tag="PAU_00369"
FT                   /note="Signal peptide predicted for PAT2405 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.650) with cleavage site
FT                   probability 0.216 between residues 45 and 46"
FT   misc_feature    order(400408..400476,400636..400704,400741..400800,
FT                   400828..400896,400987..401055,401143..401211)
FT                   /note="6 probable transmembrane helices predicted for
FT                   PAT2405 by TMHMM2.0 at aa 13-35, 89-111, 124-143, 153-175,
FT                   206-228 and 258-280"
FT   misc_feature    400624..401244
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.3e-16"
FT                   /inference="protein motif:Pfam:PF00528"
FT   CDS_pept        complement(401454..403469)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00370"
FT                   /old_locus_tag="PAT2406"
FT                   /product="similarities with putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82463"
FT                   /db_xref="GOA:C7BIA5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE016795"
FT                   /protein_id="CAQ82463.1"
FT                   /translation="MWFCRFKQAFIALLLPWLLAVATQMTGRIFLLFTYGSHQLFADSF
FT                   QDVERMFWIGGLFDIRIASLLFVPCLLLASLLAMNNNSFNIWQRFWPWLATILNTLIGA
FT                   LTVGNIYYYATYERSIDLFIFGLVEDDTTAVLHTLWNDYPVIRGLLSLALFAVIVFRLC
FT                   LLWQHRLIQRIERKTSLPTSAIATLTILAICFVGMRGSIGTFPLRQSNTQVSEVKMLNM
FT                   LTPNGPMALNWAFNDHYKNSYFPEATDEQGNRLLSQFLDKPTPTSLSPFMAKTTDNLVA
FT                   QKKPPHVIFNVMESMGYHLQSLDRPDLDVFGALRPHWQNDWRFDRFVSEGDGTIDSLSR
FT                   FFIRSPNSAISQSTAQNLDFTSNMFKPYLANGYKIIFVTSGNGAWRNLNQFLPNLGVSE
FT                   FIDQNGLKKRYPEAKFDTWGVPDEFMFRYIKERLTQAEKDREHVLIMSLSTTHHPPYKS
FT                   PENYKKTDIKLNDIEKQRLNHLASGNELQEVFHTLRYTNDQLGQFISWVKSQSLAAHTI
FT                   IAVTGDHNIRGIGYPDAHELAIGHGVPFYLYVPSAYRQNTVFDATRVGSHKDIWPTLYH
FT                   LSLSNTAYYRTGCDLLAEHLDPIWCQGYNPEVIITPQGSYIMIGKGEFRPWANQKGLLL
FT                   GEPQPMTADQTKQFQRWQVFTDLLSWQLNRQVHHQQ"
FT   misc_feature    complement(401682..402617)
FT                   /note="HMMPfam hit to PF00884, Sulfatase, score 1.7e-22"
FT                   /inference="protein motif:Pfam:PF00884"
FT   misc_feature    complement(order(402870..402938,402975..403043,
FT                   403134..403202,403239..403307,403365..403433))
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2406 by TMHMM2.0 at aa 13-35, 55-77, 90-112, 143-165 and
FT                   178-200"
FT   sig_peptide     complement(403344..403469)
FT                   /locus_tag="PAU_00370"
FT                   /note="Signal peptide predicted for PAT2406 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.905 between residues 42 and 43"
FT   CDS_pept        403759..404637
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="PAU_00371"
FT                   /old_locus_tag="PAT2407"
FT                   /product="arginase/agmatinase/formimionoglutamate
FT                   hydrolase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82464"
FT                   /db_xref="GOA:C7BIA6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA6"
FT                   /inference="similar to DNA sequence:INSD:AE008692"
FT                   /inference="similar to DNA sequence:INSD:CP000075"
FT                   /protein_id="CAQ82464.1"
FT                   /translation="MTNRSNTIRLVMPQWQGGNNPAYRFGAEMLNWLAPETDVPVIHVP
FT                   VLGPASPLSVENGIIGREALKTQLNSVWKIIHEYQPDNIVMFGGDCLVDLAPFAWLSER
FT                   WGEKLGILWIDSHPDVMTPAQFQYAHAHVLGALMGNGDPDLTTTVARPVSSQRVMIAGI
FT                   HSPLEYEKKFIADNAIRTCSPEEVRAGGAAVMQWIEEEKIECLAIHIDLDVLDYHNFRS
FT                   VLFARPGACEHDFDGIAKGKLNIPDVLTLVQKAASRAKVVGVGIAEHLPWDAMNLKDML
FT                   EQLPLIGRSGS"
FT   CDS_pept        complement(405149..405559)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00372"
FT                   /old_locus_tag="PAT2408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00372"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82465"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIA7"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:BX571965"
FT                   /protein_id="CAQ82465.1"
FT                   /translation="MPNVRPNWVWLQLNLNIDSHQFDILRLINLVSYLALSRNSPYIQV
FT                   ESNEYTLKGKQVFPDRLSVGWMLYQPRVIDKSYLPMAEDVIPVYQNNEQTGTLIITKKG
FT                   IFDGQNQDDIDKSNDVEIQLVNLGLLPLITEI"
FT   CDS_pept        complement(405733..405870)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00373"
FT                   /old_locus_tag="PAT2409"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00373"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82466"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW2"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /protein_id="CAQ82466.1"
FT                   /translation="MAIIRLEINVYYEQQETITVDTALMDLFNITQQIDIFFGQKKLGI
FT                   "
FT   CDS_pept        complement(405883..406191)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00374"
FT                   /old_locus_tag="PAT2410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00374"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82467"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW3"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:AP008229"
FT                   /protein_id="CAQ82467.1"
FT                   /translation="MIQEFQCLKVTFDGWQPMYCRFLEAKARYDQFFKDNKPKKWWVGR
FT                   YSARNQAERHQTVCDALEGTPHVEWHFLQPISYGYFKVLFSKYKNISVHYTPCNSLI"
FT   CDS_pept        complement(406363..406647)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00375"
FT                   /old_locus_tag="PAT2411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00375"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82468"
FT                   /db_xref="GOA:C7BIW4"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW4"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /protein_id="CAQ82468.1"
FT                   /translation="MPIPLLAPVAVGAAEYVITACTGVLIAVGVMEAGKKSSVEDDDNI
FT                   IRHQKTDFVISPEITDEDRNVVWSEEAHADFWEDDDLNDGPVDTSAVQT"
FT   misc_feature    complement(406567..406635)
FT                   /note="1 probable transmembrane helix predicted for PAT2411
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(407603..409690)
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="PAU_00376"
FT                   /old_locus_tag="PAT2412"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00376"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82469"
FT                   /db_xref="GOA:C7BIW5"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82469.1"
FT                   /translation="MEEKSLDHLATEAGIVASYINAYGKLQAIPAETRYHLLDAMNINK
FT                   PASAPVSPVPTVKVFTQGQNFAITLKNEGDYQWQIQTEQGEEFQGHCSHKLILPNTLAL
FT                   GYHRLTLTQGSQCWPMQIIVAPKRCYEPDVLLKGEKLWGACVQLYTLRSETNWGIGDFG
FT                   DLKYMLKEVATRGGAFIGLNPLHALHPAMPESASPYSPSSRNWLNIIYIDVNQVEDFKC
FT                   SEEAQRWWQAPTTQHILQHARNAEWVDYTTVTALKIAALHLAYQQFNTRPEIDSQQVSF
FT                   RQFIIQGGECLYYQGVYDALHYQLYAEDSACWGWPMWPEKYRDPHGEAVQAFCQSHPQE
FT                   VEFFIWLQWLADTQLADCFAQSQASEMPIGLYRDLAVGVAEGGSETWCNRNVYCPKASV
FT                   GAPPDALGPLGQNWGLPPMNPHVLQTQAYQPFINLLRTNMTHCGALRIDHVMSMLRLWW
FT                   IPYGETADKGAYVHYPVDDLMAILALESQRHRCLVIGEDLGIVPEEIVSKLRDSGVYSY
FT                   KVFYFERHSNGEYRAPENYPIQAMATITTHDLPTLRGFWQSDDLTLGESLKLYPDRDLL
FT                   QELYTERQASKQGLLEGLHRHGYIPEHISRIAKEVAMSPAINQGLHRYISHSTCSLLGL
FT                   QPEDWLDMDKPVNVPGTVMEYPNWRRKLNTTLEIMFDDDHVNQLLKDVDKCRKKAGTAR
FT                   N"
FT   misc_feature    complement(407639..409255)
FT                   /note="HMMPfam hit to PF02446, 4-alpha-glucanotransferase,
FT                   score 5.4e-196"
FT                   /inference="protein motif:Pfam:PF02446"
FT   CDS_pept        complement(409700..412102)
FT                   /transl_table=11
FT                   /gene="malP"
FT                   /locus_tag="PAU_00377"
FT                   /old_locus_tag="PAT2413"
FT                   /product="maltodextrin phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00377"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82470"
FT                   /db_xref="GOA:C7BIW6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW6"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82470.1"
FT                   /translation="MQQSRLDKAQFQAALTRQWQRFGLGSAQEMTQHQWWQAVSMALSE
FT                   LLPACPVINHSDQQRHVNYISMEFLIGRLTANNLLNLGWYEDVQNYLAEENIVLSDLLE
FT                   QETDPALGNGGLGRLAACFLDSMATVDQPAVGYGLNYQYGLFRQSFEQGQQIEKPDNWE
FT                   RESYPWFRHNTQLDVEVNIGGKVVKTADGGETWIPEFTLIGEAWDLPIIGYHNGVTQPL
FT                   RLWQATHADPFDLSQFNDGQFLKAEQQGVEAAKLTKVLYPNDNHQDGKRLRLMQQYFQC
FT                   ACSVADILRRHHLAGRKTEDLPKYEVIQLNDTHPTIAIPEMMRILLDKHQMSWETAWEI
FT                   TSHTFAYTNHTLMPEGLERWDEALVSHLLPRHYSIIKEINYRFKKLVDTAWPGDQAVWE
FT                   KLAVHYDRQIRMANLCVVAGFAVNGVAALHSQLIVKDLFPEYHQLWPNKFLNVTNGVTP
FT                   RRWLKQCNPALSGLLDRTLNREWVNDLDALKALEPYADDSAFREEYRAIKQNNKILLSN
FT                   YVNKVMGLKLDPNAIFDVQIKRLHEYKRQHLNLLHILSLYKQIQENPALDIVPRVFLFG
FT                   AKAAPGYYLAKSIISAINQVAEKINNDPIVRDRLKIAFIPDYKVSVAELMIPAADVSEQ
FT                   ISTAGKEASGTGNMKLALNGALTIGTLDGANVEIAEQVGDDNIFIFGHTVEEVKALKAA
FT                   GYDPLKLLQENQHLDNILKSLASGEFSYSDKHAFDMLLHSLIDGGDPYLVLADFATYCD
FT                   AHKRIDTLYRDTKSWTRSAILNTARMGMFSSDRTIRDYQQRIWQAKR"
FT   misc_feature    complement(409703..411829)
FT                   /note="HMMPfam hit to PF00343, Carbohydrate phosphorylase,
FT                   score 0"
FT                   /inference="protein motif:Pfam:PF00343"
FT   CDS_pept        complement(412216..412434)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00378"
FT                   /old_locus_tag="PAT2414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00378"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82471"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW7"
FT                   /inference="similar to DNA sequence:INSD:AM039952"
FT                   /protein_id="CAQ82471.1"
FT                   /translation="MPLISPTKFSEIHSLCKQVCAPHVLSCAPYHILEQQIPSSTYKLW
FT                   KQLANFLIDSRTESGFNRCQNEAKYDY"
FT   CDS_pept        412525..415239
FT                   /transl_table=11
FT                   /gene="malT"
FT                   /locus_tag="PAU_00379"
FT                   /old_locus_tag="PAT2415"
FT                   /product="hth-type transcriptional regulator malt
FT                   (atp-dependent transcriptiona activator malt)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00379"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82472"
FT                   /db_xref="GOA:C7BIW8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW8"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82472.1"
FT                   /translation="MLIPSKLSRPVRLNNTVVRKRLLIRLNESPNYRLVLITSPAGYGK
FT                   TTLVSQWAAEQDNLGWYSLDESDNQPERFASYLIAALQQATQGHCVKSEVLAQKHQYAN
FT                   LPALFAQLFIELNEWRRPIFLVIDDYHLIMNNVIHEAMRFFLRHQPENLTLTILSRNLP
FT                   SLGVANLRVREQLLEIDSQQLAFDYQETQQFFDKRLTTSLDADDCKRLCNEVAGWATAL
FT                   QLIALSARQSCDAAELSAKRLSGINASHLSDYLVDEVLNQVDESTREFLLRSAILRSMN
FT                   DGLIVRLTGEENGQQRLEETERQGLFIQRMDDSGEWFRFHPLFASFLRQRCQWEMALQL
FT                   SELHRAAAEGWLAQGYPGEAIHHALSAGDTAMLRDILLQHAWALFNHSELSLLEECMNA
FT                   LPYEQLLESPRLVLLQAWLAQSQHRYSEVNTLLNQAEQALQQKQIAIEPDLLAEFDALR
FT                   AQVAMNSGKPEMADKLAKQALAALLPQNQYSRIVATSVEGEVLHCKGELADALMRMQQT
FT                   EQLARRFQVHHYALWALLQQSEILLAQGYLQTAYETQNKAFELIREQHLEQLPMHEFLL
FT                   RIRSQLLWCWSRLDEAEEAARRGLEVLANFQPQQQLQCLTQLAKCSLTRGDIDNARRYL
FT                   ARCENLLNNGQYHRDWRTNTDKLRVIIWQSMEDKSAAIRWLAQTERPESVSNHFNQGQW
FT                   RNIARAQILLGLYDEAEPILDTLNRHARKLQLISDLNRNLLLCNLLYWHTGRKSEAQSV
FT                   LIEALALANRTGFVSHFVIEGELMAQQLRQLIQLSTLSELELHRAQRILRDINRQHRHK
FT                   FAHFDEGFVTQLLTHPDVPELIRNSPLTQREWQVLGLIYSGYSNDQIAAELDVATTTIK
FT                   THIRNLYQKLGIANRQDAIQQAQQLMQMMGLGV"
FT   misc_feature    415030..415203
FT                   /note="HMMSmart hit to SM00421, no description, score
FT                   2e-21"
FT                   /inference="protein motif:Smart:SM00421"
FT   CDS_pept        complement(415376..416572)
FT                   /transl_table=11
FT                   /gene="cmlA1"
FT                   /locus_tag="PAU_00380"
FT                   /old_locus_tag="PAT2416"
FT                   /product="putative membrane protein similar to multidrug
FT                   resistance proteins"
FT                   /note="similar to multidrug resistance proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82473"
FT                   /db_xref="GOA:C7BIW9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIW9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AB212941"
FT                   /protein_id="CAQ82473.1"
FT                   /translation="MRNYILLLLSLVLFGPLGIDLFLPTIPAIAKDFQVNNEVIQSTIS
FT                   LFLLIMGLGQLIAGPLVDKFGRRPVALMGITLYILGSAIAALSTNSEIFTAARIIQGCA
FT                   VCCTSVVCISGVRDRLNGDEAAKAYGFLNSTLNIVPALAPLLGGLLAEIFNWRAPFWSL
FT                   VCYSVIVLFIIATWLPETRPANTKQIHGLPLKQYYQILSNARFMHFALVNAVIMGIVIT
FT                   YVSFAPTVLMTEGHISPLIFSLIFGGNGLWTMIAFLIANKIIHRAGRPFCLLLGSILIA
FT                   LGSLSLFSGIYLLPNVASQHWLSYMLPVAFACAGLAFVMGPATSYALEPYSNEAGIASA
FT                   LAGFIQMAIGSIISLIAMILPFPPKQSLMLVMLLGAMLALSARSLSRSLKGQIVSLRS"
FT   misc_feature    complement(415406..416569)
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 0.00011"
FT                   /inference="protein motif:Pfam:PF00083"
FT   misc_feature    complement(order(415415..415474,415502..415570,
FT                   415589..415657,415694..415762,415796..415864,
FT                   415892..415960,416039..416107,416120..416188,
FT                   416225..416293,416306..416365,416390..416458,
FT                   416486..416554))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PAT2416 by TMHMM2.0 at aa 7-29, 39-61, 70-89, 94-116,
FT                   129-151, 156-178, 205-227, 237-259, 271-293, 306-328,
FT                   335-357 and 367-386"
FT   misc_feature    complement(415490..416551)
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 5.3e-46"
FT                   /inference="protein motif:Pfam:PF07690"
FT   sig_peptide     complement(416483..416572)
FT                   /gene="cmlA1"
FT                   /locus_tag="PAU_00380"
FT                   /note="Signal peptide predicted for PAT2416 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.993 between residues 30 and 31"
FT   CDS_pept        417229..418479
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="PAU_00381"
FT                   /old_locus_tag="PAT2417"
FT                   /product="4-aminobutyrate aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82474"
FT                   /db_xref="GOA:C7BIX0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000038"
FT                   /protein_id="CAQ82474.1"
FT                   /translation="MENGKRFEDMLSRFVGNGPYLEIDGEKYIDAASGTFNLPLGYTNR
FT                   RIAEKLKQQIDRCTHLSSAYTHEMSQYILGKLVKHTPEGINKIWLRDVSGSGAVECAIR
FT                   IAQKATGRSGVISFFLAHHGQSLATAQISGNAFRIKDFHVNIDGSLKVPTPASVMSELE
FT                   PDTEPNQYFDLEQFIQLGSNDNIACLIIEPIQGNGGNIVFPVDFYRKIREICHKHNIII
FT                   IADEVQTGFGRTGTFFASTGYAKELQPDIIVFAKGAGGIGIPTGGVLMRSSLDVLESFE
FT                   HSSTSGANPLSLTALNEIIDIIEDEHVLENVQRNEAYLRDGLLALQHKYPEITGVRGVG
FT                   YMFGFDTPSPEFAAQAIAIANSHNLIIRGSRYGKGRALKVRPPLICTQAHLNEILHKLD
FT                   LTFADLTLGMLDNKEVA"
FT   misc_feature    417274..418275
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 2.5e-63"
FT                   /inference="protein motif:Pfam:PF00202"
FT   CDS_pept        418479..419540
FT                   /transl_table=11
FT                   /locus_tag="PAU_00382"
FT                   /old_locus_tag="PAT2418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00382"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82475"
FT                   /db_xref="GOA:C7BIX1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000247"
FT                   /protein_id="CAQ82475.1"
FT                   /translation="MKALKFNRVWDVEIRDVESLRCVESDDVVVDIAVCGVCGTDVGII
FT                   TGSYPVAIPGTTLGHETTGVVAQIGKSVTRFNVGDRVVINPTYSCGHCRMCQTGNLNHC
FT                   EKKLGTEAGVSYDGAFAEQYLAKESSLIKLDDHVSMEEASLTEPLSCTLTGVDKLAITH
FT                   TNIRAAVTGAGPMGMLYLWALHARGVKAFMVEKNESRVQFARENLPPECELYTDFDEAL
FT                   TQQYGDKSALIDLCVDTTGQLTEYVFEHLAPGGKLLNVALKDKHASLDILKIADKSLSV
FT                   IGSIDSLNNSFERAYTMIRDGVIPAGRLVSQIFDFNDYLQAFLTVGCDIAGKTQKPLST
FT                   PNCKVLIRISDLK"
FT   misc_feature    418551..418880
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 3.7e-41"
FT                   /inference="protein motif:Pfam:PF08240"
FT   misc_feature    418968..419381
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 2.2e-06"
FT                   /inference="protein motif:Pfam:PF00107"
FT   CDS_pept        419554..420186
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="PAU_00383"
FT                   /old_locus_tag="PAT2419"
FT                   /product="similarities with phosphoglycolate phosphatases
FT                   an phosphoglucomutases"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00383"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82476"
FT                   /db_xref="GOA:C7BIX2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82476.1"
FT                   /translation="MDKFNVIFDIDGVIVDSEQLHFDVLCALAPDYTHHVQPQQLIGLS
FT                   LEETLDYIGVPVQQQKEITAQIVSVYKDKLSKSYLRPGISGLISALQQHNISFGFVSTA
FT                   PREVCLANLGLLELRESPVLISGDDVVRTKPHPDPYLAMLKLKSMDVHQTLVIEDTDLG
FT                   ITAATQAGIPYIYAWPHALSAAEQYQQATRIIGALTDIPQFFKINFA"
FT   misc_feature    419560..420093
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 4.6e-14"
FT                   /inference="protein motif:Pfam:PF00702"
FT   CDS_pept        420247..421398
FT                   /transl_table=11
FT                   /locus_tag="PAU_00384"
FT                   /old_locus_tag="PAT2420"
FT                   /product="similar to putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00384"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82477"
FT                   /db_xref="GOA:C7BIX3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82477.1"
FT                   /translation="MSDQNIVSLVKQPIMATRAAFFIAGFSLASWAPLIPLAKERLQLD
FT                   NGAMGLLMLAFGVGSFIMMPMAGMLAARFGCRQIFTLCTLLVLLMLPGLSVLPTPLTLA
FT                   CALFIFGAGIGAMDVVVNIHAVMVEKMALRPIMSGFHALFSLGGIAGAGSVSALLSLGV
FT                   SPFQVMIMAVLLIILLLLPAWSGLLNEAESGNTPFFAVPRGVVILLGFLCFVAYIMEGS
FT                   MLDWSGILLTSVHNISSHQAGVGYTLFAIAMTSGRFLGDRIIALYGHRRIFICSALLAT
FT                   FGFILIYSASTAIILGLSFLMVGAGLSNIAPMLFTASGQQKIMPDSLAVAAVSTMGYSG
FT                   ILLGPAIIGGLAHIVTLHGAFACVALLSVSLLAGYKFIHSSGR"
FT   sig_peptide     420247..420333
FT                   /locus_tag="PAU_00384"
FT                   /note="Signal peptide predicted for PAT2420 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.780) with cleavage site
FT                   probability 0.570 between residues 29 and 30"
FT   misc_feature    order(420283..420351,420394..420462,420481..420549,
FT                   420562..420630,420664..420732,420742..420810,
FT                   420844..420912,420955..421023,421060..421113,
FT                   421123..421191,421225..421293,421303..421371)
FT                   /note="12 probable transmembrane helices predicted for
FT                   PAT2420 by TMHMM2.0 at aa 13-35, 50-72, 79-101, 106-128,
FT                   140-162, 166-188, 200-222, 237-259, 272-289, 293-315,
FT                   327-349 and 353-375"
FT   misc_feature    420295..421305
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 9.8e-20"
FT                   /inference="protein motif:Pfam:PF07690"
FT   CDS_pept        421413..421994
FT                   /transl_table=11
FT                   /locus_tag="PAU_00385"
FT                   /old_locus_tag="PAT2421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00385"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82478"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015987"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX4"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE016853"
FT                   /protein_id="CAQ82478.1"
FT                   /translation="MSLSQYHWLNEPADWQCGSDWLDVTTDHKTDFWQQTWYGFERHNG
FT                   HVFGRYIEDDFTFQLCIEGCFEHLYDQAGVMLLVDEKHWLKGGVEYSDGQATIGSVLTR
FT                   NHSDWSMGIFPGNCNKFWLRLTCEEGYLRLQYSIDGLLWPLLRLSPFFKGKQRVFIGAM
FT                   CCSPERHGLQVRFSDFRLTPPIKKPLHDLS"
FT   misc_feature    421431..421979
FT                   /note="HMMPfam hit to PF07081, Protein of unknown function
FT                   (DUF1349), score 4.2e-79"
FT                   /inference="protein motif:Pfam:PF07081"
FT   CDS_pept        complement(422213..422698)
FT                   /transl_table=11
FT                   /gene="hmu"
FT                   /locus_tag="PAU_00386"
FT                   /old_locus_tag="PAT2422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00386"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82479"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX5"
FT                   /inference="similar to DNA sequence:INSD:AM180088"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /protein_id="CAQ82479.1"
FT                   /translation="MNIKKMLHSADYSDTKNANKELVNSSFNEGYRGWRIPTPETVEIL
FT                   SENSINFLSIQSYSSSGVIDQIITGLEPNVRYRLTGTARLSTKQIPQRALSAYFGLQNR
FT                   TFGPESFVVNNFNFTTGSVELNTDEEGLLRVYMLKDQFVGLPEEATADFTGFILEKA"
FT   CDS_pept        complement(423006..423482)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00387"
FT                   /old_locus_tag="PAT2423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00387"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82480"
FT                   /db_xref="GOA:C7BIX6"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX6"
FT                   /inference="similar to DNA sequence:INSD:CP000282"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /protein_id="CAQ82480.1"
FT                   /translation="MNVQEILNNEDYSDNKKHSYKELVNGSFEEGYNGWRIPAPESVEI
FT                   LSENGIHFIRIQSVTGSGVIDQIIEGLEPNTKYKLIGTARVSAEWASSAYFGLQSRTDG
FT                   PNSFAVNSTNFTTGSIELSTDQEGLLRVYLLKDQVGHRPDGETADFTGFVLEKA"
FT   misc_feature    complement(423009..423425)
FT                   /note="HMMPfam hit to PF02018, Carbohydrate binding domain,
FT                   score 0.0016"
FT                   /inference="protein motif:Pfam:PF02018"
FT   CDS_pept        complement(423866..424345)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00388"
FT                   /old_locus_tag="PAT2424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00388"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82481"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX7"
FT                   /inference="similar to DNA sequence:INSD:CP000251"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /protein_id="CAQ82481.1"
FT                   /translation="MNIKEILDNIDYSGQVNSNKELVNGSFNEGYKGWIIPNPEKIKIL
FT                   SENGINFLRIQNDPSFEAVFQIIEGLEPNVKYKLTGKARLSKWKIYDGSLAIFGLHNDT
FT                   LGPVTFVTDTQYFKTGTVELSADAEGLLRVFLIKTQVEDISAVTADFTGFIFEKA"
FT   CDS_pept        complement(425040..426164)
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="PAU_00389"
FT                   /old_locus_tag="PAT2425"
FT                   /product="thiamin biosynthesis, thiazole moiety (thiamin
FT                   biosynthesis protei thih)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00389"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82482"
FT                   /db_xref="GOA:C7BIX8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX8"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82482.1"
FT                   /translation="MNNSFSHRWRQLDWDDITLRINSKTSQEVEQALSNSKLNLDDLMA
FT                   LLSPAAKPYIEPLAQRAQKLTRQRFGNTVGFYVPLYLSNLCANDCTYCGFSMSNHIKRK
FT                   TLNKDEIIAECQAIKALGFDNLLLVTGEHQNKVSMDYFRRYLPLIREHFSSIMMEVQPM
FT                   TQEEYSELKTLGLDGVMVYQETYHEPTYLLHHLRGRKRDFHWRLETPDRLGRAKIDKIG
FT                   LGALIGLSNHWRTDCYMVAEHLFFLQRTYWQSRYSISFPRLRPCAGGIEPASLISEAEL
FT                   VQLICAFRLFAPEVELSISTRESPFFRDHVIPLAINNVSAGSKTQPGGYADNSHEELEQ
FT                   FTPHDNRSVYQVADALIKAGLQPIWKDWDGYLGR"
FT   misc_feature    complement(425076..425396)
FT                   /note="HMMPfam hit to PF06968, Biotin and Thiamin Synthesis
FT                   associated d, score 9.9e-37"
FT                   /inference="protein motif:Pfam:PF06968"
FT   misc_feature    complement(425433..425927)
FT                   /note="HMMPfam hit to PF04055, Radical SAM superfamily,
FT                   score 3.8e-09"
FT                   /inference="protein motif:Pfam:PF04055"
FT   CDS_pept        complement(426179..426946)
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PAU_00390"
FT                   /old_locus_tag="PAT2426"
FT                   /product="thiazole biosynthesis protein thig"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82483"
FT                   /db_xref="GOA:C7BIX9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIX9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82483.1"
FT                   /translation="MLKIADTTFNSRLFTGTGKFANSDLMIQAIKASGSQLVTMAMKRI
FT                   DLQRGNDAILTPLQKLGVKLLPNTSGAKTAEEALFAARLAREALATNWIKLEIHPDVKY
FT                   LLPDPVETLKGAEMLVKDGFVVLPYCSADPVLCKRLEEVGCAAVMPLGAPIGSNQGLLT
FT                   RDFLRIIIEQTQVPVIVDAGIGAPSHALEAIELGADAVLVNTAIAVARNPVKMAQAFRV
FT                   AIEAGELSYEAGLANPKQHAVASSPLTDFLGVF"
FT   misc_feature    complement(426188..426946)
FT                   /note="HMMPfam hit to PF05690, Thiazole biosynthesis
FT                   protein ThiG, score 1.7e-166"
FT                   /inference="protein motif:Pfam:PF05690"
FT   CDS_pept        complement(426948..427148)
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PAU_00391"
FT                   /old_locus_tag="PAT2427"
FT                   /product="thiamin biosynthesis, probable sulfur donor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82484"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82484.1"
FT                   /translation="MKITVNDQTIEITAPLVVQQLLEQLGQMQPGTSLAINQTIIPRSE
FT                   WNTYPVNDGDSILLFQAIAGG"
FT   misc_feature    complement(426951..427142)
FT                   /note="HMMPfam hit to PF02597, ThiS family, score 1.9e-17"
FT                   /inference="protein motif:Pfam:PF02597"
FT   CDS_pept        complement(427145..427894)
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="PAU_00392"
FT                   /old_locus_tag="PAT2428"
FT                   /product="4-methyl-5-(beta-hydroxyethyl)thiazole
FT                   monophosphate synthesis protein"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00392"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82485"
FT                   /db_xref="GOA:C7BIY1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82485.1"
FT                   /translation="MLNDQEFMRYSRQLLLEDIGPEGQEKLKSSSVLIVGLGGLGAPAS
FT                   LYLAAAGVGTIYLADNDQLHISNLQRQILYRTEDIPSAKVELAANQLNALNPLIKTTVF
FT                   NQRQDVESLTKIVKQVDLVLDCCDNMATRHAINAACVAARKPLISGSAVGFSGQLMVFE
FT                   PPYPHGCYTCLYPEQEEPQRNCRTAGVLGPVVGVIGTLQALEAIKMLTGLPSPLSGKLR
FT                   LFDGKQQSWSTLQLSQSRQCPICGDIA"
FT   misc_feature    complement(427148..427396)
FT                   /note="HMMPfam hit to PF05237, MoeZ/MoeB domain, score
FT                   1.7e-38"
FT                   /inference="protein motif:Pfam:PF05237"
FT   misc_feature    complement(427409..427813)
FT                   /note="HMMPfam hit to PF00899, ThiF family, score 1.4e-60"
FT                   /inference="protein motif:Pfam:PF00899"
FT   CDS_pept        complement(427884..428555)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="PAU_00393"
FT                   /old_locus_tag="PAT2429"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00393"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82486"
FT                   /db_xref="GOA:C7BIY2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82486.1"
FT                   /translation="MNNLPNSPFASTEYKLGLYPVVNSLEWISRLLKAGVTTIQLRIKD
FT                   LPEAQVEEDIQQAILLGRQYNARLFINDYWQLAIKHGAYGVHLGQEDLVTADLNAIQKT
FT                   GLRLGISTHDEQELARAKSLRPSYIALGHIFPTTTKVMPSSPQGLKALKRQVENTPDYP
FT                   TVAIGGISLERVPDVIATGVGGVALVSAITQAKDWRQATSQLLQRVEGIESKVLRGSYA
FT                   E"
FT   misc_feature    complement(427980..428504)
FT                   /note="HMMPfam hit to PF02581, Thiamine monophosphate
FT                   synthase/TENI, score 7.9e-74"
FT                   /inference="protein motif:Pfam:PF02581"
FT   CDS_pept        complement(428539..430476)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="PAU_00394"
FT                   /old_locus_tag="PAT2430"
FT                   /product="thiamine biosynthesis protein thic"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00394"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82487"
FT                   /db_xref="GOA:C7BIY3"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82487.1"
FT                   /translation="MSHNTVIPTTDISPKPNPARPRKAQRDAAQEFINSIQGVTFPKSR
FT                   RIYLQGSRDNIQVPMREILLSPTLIGGTKEEPQYEENEAIPVYDTSGAYGDPDAKLDVH
FT                   VGLTKLRQQWINERQDAEPVTTLSSDFTQQRLADVGLDHLRFHHRPHPLKARKGKCVTQ
FT                   LHYARKGIITPEMEFIALRENMGRERIRGDVLHQQHAGQSFGAQLPENITPEFVRQEVA
FT                   AGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSSVTSSIEEEVEKLIWSTRWGADTV
FT                   MDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLTWEIFRDTLLEQAEQG
FT                   VDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAT
FT                   YDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHIPMQMIR
FT                   RNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLG
FT                   LPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPDTA
FT                   RAYHDETLPQASGKIAHFCSMCGPKFCSMKISQEVRDYAAGMEQMSEEFRARGSELYHS
FT                   AGGASHEQSA"
FT   misc_feature    complement(428641..429993)
FT                   /note="HMMPfam hit to PF01964, ThiC family, score 0"
FT                   /inference="protein motif:Pfam:PF01964"
FT   misc_RNA        complement(430585..430710)
FT                   /inference="similar to RNA sequence:Rfam:RF00059"
FT   CDS_pept        430994..432235
FT                   /transl_table=11
FT                   /locus_tag="PAU_00395"
FT                   /old_locus_tag="PAT2431"
FT                   /product="major facilitator superfamily (mfs_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00395"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82488"
FT                   /db_xref="GOA:C7BIY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY4"
FT                   /inference="similar to DNA sequence:INSD:CP000152"
FT                   /inference="similar to DNA sequence:INSD:AE016796"
FT                   /protein_id="CAQ82488.1"
FT                   /translation="MKLNDDFWKIRSSEALYILSSRIIVALVTLSLIKSNHLILSSYFL
FT                   FVYFLSRTISGLVLSHLFDHLDKKKILVALNLIFLFLTIYYLYNISYDGSIYFFFIISI
FT                   ILGLIDALYSPVVNAYIPFIVSKHELDEAYRKTFLLQASLNVFGIGLGMAGYEVIGIIN
FT                   MTWTLCGLIVLSVYILYGINNRGIGILQKKEYNPSSALNSLRLFFRYRFEPYWALSSLL
FT                   VNMILVPFSSLVIPYFVESVKHSSAIVIGIIEASAAIGAICASVFFQSYFEKIYGKVRT
FT                   VIFSFFMIGLCLVGLSFFISHIVWCLLAFLIGVSVVLNNISIESSRSIAIPERHRVKIQ
FT                   TIHTAFIGLGNPFGFILFSMIIEKWNYSIVLLIGGFLICVVALLLKYIPMFDDLLSKNK
FT                   EEIDSIYDKNYGDL"
FT   misc_feature    431021..432082
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1e-12"
FT                   /inference="protein motif:Pfam:PF07690"
FT   misc_feature    order(431036..431089,431108..431176,431204..431257,
FT                   431276..431344,431465..431533,431636..431704,
FT                   431732..431800,431837..431905,432011..432079,
FT                   432098..432166)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PAT2431 by TMHMM2.0 at aa 15-32, 39-61, 71-88, 95-117,
FT                   158-180, 215-237, 247-269, 282-304, 340-362 and 369-391"
FT   CDS_pept        432232..432786
FT                   /transl_table=11
FT                   /locus_tag="PAU_00396"
FT                   /old_locus_tag="PAT2432"
FT                   /product="conserved hypothetical protein"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00396"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82489"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY5"
FT                   /inference="similar to DNA sequence:INSD:AE010301"
FT                   /inference="similar to DNA sequence:INSD:AE016824"
FT                   /protein_id="CAQ82489.1"
FT                   /translation="MSILTKVKKFYQIDKDKIYDRHHSSHLVNTAKLLNKYGCEESVCN
FT                   AGMLHSIYDENSIYNNSGASYKDREQLRQIVGKDVELLIYYYGEVHYVKNYDNISKNDD
FT                   VVTLRSQTEDISIPEDIFSNLANIIVADILEQIIWCVEKKGIFTYQDAREHLKKLFPIL
FT                   SYCCHGIQIDFNRFWSLSCRT"
FT   CDS_pept        432762..434243
FT                   /transl_table=11
FT                   /gene="PFI0330c"
FT                   /locus_tag="PAU_00397"
FT                   /old_locus_tag="PAT2433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00397"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82490"
FT                   /db_xref="GOA:C7BIY6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY6"
FT                   /inference="similar to DNA sequence:INSD:AL929356"
FT                   /inference="similar to AA sequence:UniProt:Q3NDD2"
FT                   /protein_id="CAQ82490.1"
FT                   /translation="MEFIMQNINSIHSEMAILHDKYILEQISHNNFFLTFSQLEKKLAD
FT                   CVIHIPNWEGFAKDIYIGHGIYNGNVNVFNEIKNLKNIIRFLTDKLLSDISGMNFISTD
FT                   KHHLKSFFSDCNNIDNLHIAYEVKHSINDVNKEVLNKIFYLIDKMVGARNYFVQRLGYK
FT                   DFASYKCNYLFNKDPENVKNTLEIYYHKLISSLKALCDHFGIDVKQFTDPATFRMYQKN
FT                   LVNRLSLPCFNFHLSEILGLIFTYFNKHSQAHFSIEHESMNRYVIRVSTHNDRSFCFVI
FT                   QVCQIQCTVTAISCDEIFDSSVSTTYLKSALFHQPLGIAEIKTVVHEIGHLISIGMSSI
FT                   NGGLYHSDFRATIEIPSQLSEHIFLNELVCNTAMNESQKMVFDNFICMDVLDEMRQIEF
FT                   AFIDFYLHSGVAISDLTPEKLINGSPCFFNYPTIQTKPVYLEHIISGGREGAYSLYPLN
FT                   NIVAHSLSATIPPTCILDYYTNAEMLNNAIHSMII"
FT   CDS_pept        complement(434349..435011)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00398"
FT                   /old_locus_tag="PAT2434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00398"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82491"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY7"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE004269"
FT                   /protein_id="CAQ82491.1"
FT                   /translation="MSQLLAVFDLDDTLISGDSSAIWTEFLWEKGIITDPSFIEADKKM
FT                   MADYNAGSLDMSGYLAFSLQTLHKVPQEQVDLWLAEFINEKIKPRFYPQAKALITEYQQ
FT                   QQVPVMIISATVSFIVKKIAIELGIHTALGIDMVVENGCYTGQIDGIATFREGKVKRIK
FT                   QWLEQQNNYPEIIRFYSDSINDLPMCQFADEVITVNADARLKAEAQQHGWQQLTWSL"
FT   CDS_pept        435111..435884
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="PAU_00399"
FT                   /old_locus_tag="PAT2435"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00399"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82492"
FT                   /db_xref="GOA:C7BIY8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY8"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82492.1"
FT                   /translation="MMMQQQVTGIERGWWIISNENRIWLPKGELPFGIAAQWSLQGKIA
FT                   LPIGEWQGEKVWLIRQKMSSNMVSLREIISSERGLFQLAGRGVQLAEFYRSHQYCGYCG
FT                   NEMHHSVSEWACLCHHCHERYYPQIAPCIIVGIRRDDQILLAQHQHHRSGIHTVLAGFV
FT                   EVGETLEEAVSREVMEESNIKIRNLRYVASQPWPFPHSLMMAFLADYESGEICHDPKEL
FT                   ISADWYHYDQLPLIPPHNTIARRLIEDTVVLCRNA"
FT   misc_feature    435495..435857
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 3e-19"
FT                   /inference="protein motif:Pfam:PF00293"
FT   CDS_pept        435982..437058
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="PAU_00400"
FT                   /old_locus_tag="PAT2436"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82493"
FT                   /db_xref="GOA:C7BIY9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIY9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82493.1"
FT                   /translation="MEPVMNELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKVTRA
FT                   EAGDFISLCKNTELACEVTLQPLRRYPLDAAILFSDILTIPDAMGLGLYFEAGEGPRFK
FT                   SPILSRADVEKLPIPDPEMELSYVLDAVRVIRKTLAGQVPLIGFSGSPWTLATYMVEGG
FT                   SSKAFTKIKKMMYAEPAVMHQLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTGRD
FT                   YREFSLRYMHQIVDGLIRENEGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTTDIAD
FT                   ARRRVGNKVALQGNMDPSMLYASPERIEQEVLTILQGFGVGSGHVFNLGHGIHQDVLPE
FT                   HAGVFVEAVHKLSAKYHQ"
FT   misc_feature    436003..437037
FT                   /note="HMMPfam hit to PF01208, Uroporphyrinogen
FT                   decarboxylase (URO-D), score 8.4e-203"
FT                   /inference="protein motif:Pfam:PF01208"
FT   CDS_pept        437064..437732
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="PAU_00401"
FT                   /old_locus_tag="PAT2437"
FT                   /product="endonuclease V (deoxyinosine 3'endoduclease)"
FT                   /EC_number="3.1.21.7"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82494"
FT                   /db_xref="GOA:C7BIZ0"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82494.1"
FT                   /translation="MINTKALRQEQIEKAQQVICYDDFSSPKLIAGADVGFEQQGRITR
FT                   AAIVVLSYPELELVEYQMARIETTLPYIPGLLSFREYPALMAAWQLLKHTPDLVMVDGH
FT                   GIAHPRRLGVASHFGLLTNVPTIGVAKRRLCGESEPLGEQPGSCQPLMDKEEQIGWVWR
FT                   SKKRCNPLYISTGHKISLNSALLWVERCVKGYRLPETTRWADGIASNRAFFKQIMQKNP
FT                   "
FT   misc_feature    437091..437687
FT                   /note="HMMPfam hit to PF04493, Endonuclease V, score
FT                   4.6e-93"
FT                   /inference="protein motif:Pfam:PF04493"
FT   CDS_pept        437809..438399
FT                   /transl_table=11
FT                   /gene="yjaG"
FT                   /locus_tag="PAU_00402"
FT                   /old_locus_tag="PAT2438"
FT                   /product="conserved hypothetical protein"
FT                   /product="similar to unknown protein yjag of escherichia
FT                   coli"
FT                   /product="hypothetical protein yjag"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00402"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82495"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AP009048"
FT                   /protein_id="CAQ82495.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMASLCERMYPNYQMFCCQTGFAEP
FT                   VLYRRILDLVWEILVVKDAKVNFDNQLEKLEQIIPSADDYDIYGVYPAIDACIALGEII
FT                   HSRLSGETLMHAIAVSEISIRTVAMLEMTRAGKEMTDEELKELPAIEEEWDIQWEIYRL
FT                   LAGCEERDIELIKGLKADLRESAISNIGINLTQ"
FT   misc_feature    437812..438390
FT                   /note="HMMPfam hit to PF04222, Protein of unknown function,
FT                   DUF, score 5.3e-140"
FT                   /inference="protein motif:Pfam:PF04222"
FT   CDS_pept        438586..438858
FT                   /transl_table=11
FT                   /gene="dbhA"
FT                   /gene_synonym="hupA"
FT                   /locus_tag="PAU_00403"
FT                   /old_locus_tag="PAT2439"
FT                   /product="dna-binding protein hu-alpha (ns2) (hu-2)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00403"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82496"
FT                   /db_xref="GOA:C7BIZ2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82496.1"
FT                   /translation="MNKTELVDAIAESTDLTKAQAKAALESTLNAITESLKAGDSVQLV
FT                   GFGTFKVNHRAERTGRNPQTGKEITIAAANVPAFSAGKALKDAVK"
FT   misc_feature    438586..438855
FT                   /note="HMMPfam hit to PF00216, Bacterial DNA-binding
FT                   protein, score 1.3e-51"
FT                   /note="HMMSmart hit to SM00411, no description, score
FT                   9.8e-46"
FT                   /inference="protein motif:Pfam:PF00216"
FT                   /inference="protein motif:Smart:SM00411"
FT   CDS_pept        438864..439565
FT                   /transl_table=11
FT                   /gene="yjaH"
FT                   /locus_tag="PAU_00404"
FT                   /old_locus_tag="PAT2440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00404"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82497"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82497.1"
FT                   /translation="MQKRKNRRGVHPLLLVRQGLMTLGFVFALSACTNQLKEPLFSASG
FT                   FIADDGVVRLWRLNDQNNKPLVLMSVYSPYRNENTIVTFYEYKQGDLRQIRREILNDEN
FT                   PLAEQLRLDKFGDVIFMQKRLKTRRERLSNDDIVRMRFDAKRILELSDALIVGNVRLMQ
FT                   GHWNNGKVTTCSGETVSVEFEPYAKSWLEQREKNSYGQLTIAWLEASAGRELLLVANND
FT                   FCRWEPTKDSL"
FT   sig_peptide     438864..438956
FT                   /gene="yjaH"
FT                   /locus_tag="PAU_00404"
FT                   /note="Signal peptide predicted for PAT2440 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.953) with cleavage site
FT                   probability 0.542 between residues 31 and 32"
FT   misc_feature    438879..439562
FT                   /note="HMMPfam hit to PF07356, Protein of unknown function
FT                   (DUF1481), score 9.3e-89"
FT                   /inference="protein motif:Pfam:PF07356"
FT   misc_feature    438900..438956
FT                   /note="1 probable transmembrane helix predicted for PAT2440
FT                   by TMHMM2.0 at aa 13-31"
FT   CDS_pept        complement(439584..440867)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="PAU_00405"
FT                   /old_locus_tag="PAT2441"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00405"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82498"
FT                   /db_xref="GOA:C7BIZ4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ4"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82498.1"
FT                   /translation="MNILIIGSGGREHALAWKAAQSPLADKIYVAPGNAGTELENHLEN
FT                   IDISATDIDGLLAFAQSHDIELTIVGPEAPLVMGIVDVFQNAGLTIFGPTQAAAQLEGS
FT                   KAFTKDFLARHKIPTAAYQNFTEIEPALTYLDKVGVPIVIKADGLAAGKGVIVAMTREE
FT                   ARSAIKDMLAGNAFGDAGHRIVIEEFLTGEEASFIVMVDGKNVIPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDEIHQRIMEEVIYPTVNGMAAEGHVYTGFLYAGLMINQDGE
FT                   PKVIEFNCRFGDPETQPIMMRMHSDLIELCLAGAKGELAGKTSDWDKRPALGVVLAANG
FT                   YPADYHKGDIIHGLPQQENGSNKVFHAGTALQDNNVITSGGRVLCVTALGETIANAQKN
FT                   AYQQAEQITWNGCFYRKDIGYRAINRLK"
FT   misc_feature    complement(439599..439880)
FT                   /note="HMMPfam hit to PF02843, Phosphoribosylglycinamide
FT                   synthetase, C d, score 4.4e-48"
FT                   /inference="protein motif:Pfam:PF02843"
FT   misc_feature    complement(439980..440561)
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase, ATP, score 6.5e-133"
FT                   /inference="protein motif:Pfam:PF01071"
FT   misc_feature    complement(439986..440561)
FT                   /note="HMMPfam hit to PF02655, ATP-grasp domain, score
FT                   0.00014"
FT                   /inference="protein motif:Pfam:PF02655"
FT   misc_feature    complement(440562..440867)
FT                   /note="HMMPfam hit to PF02844, Phosphoribosylglycinamide
FT                   synthetase, N d, score 9.1e-61"
FT                   /inference="protein motif:Pfam:PF02844"
FT   CDS_pept        complement(440889..442514)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="PAU_00406"
FT                   /old_locus_tag="PAT2442"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00406"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82499"
FT                   /db_xref="GOA:C7BIZ5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82499.1"
FT                   /translation="MLLPHKIQGIKPMQQLRPIRRALLSVSDKSGIVEFAKALSERGVE
FT                   LLSTGGTAYLLAESGLKVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDEIMTQ
FT                   HQISPIDMVVVNLYPFAQTVAKPNCTLADAVENIDIGGPTMVRSAAKNHKDVAIVVNSN
FT                   DYEKIIEEMDNNQDSLTQSTRFNLAIKAFEHTAAYDSMIANYFGKLVAPYYGDTTQPSG
FT                   RFPRTLNLNFIKKQDMRYGENSHQDAAFYIEENLSESSIATATQLQGKALSYNNIADTD
FT                   AALECVKEFVEPACVIVKHANPCGVAIGKDIHEAYDRAFKTDPTSAFGGIIAFNREIDT
FT                   KTAQTIIDRQFVEVIIAPSINEEALPLLATKQNIRVLISGKWETRIAGLDFKRVNGGLL
FT                   VQDRDLGMVTANDLRVVSKRQPTEQEMKDALFCWKVAKFVKSNAIVYAKNDMTIGIGAG
FT                   QMSRVYSAKIAGIKAADEGLEVQGCAMASDAFFPFRDGIDAAAAVGVSCVIQPGGSIRD
FT                   DEVIAAADEHDIAMIFTGMRHFRH"
FT   misc_feature    complement(441096..442070)
FT                   /note="HMMPfam hit to PF01808, AICARFT/IMPCHase bienzyme,
FT                   score 1.6e-205"
FT                   /inference="protein motif:Pfam:PF01808"
FT   misc_feature    complement(442083..442424)
FT                   /note="HMMPfam hit to PF02142, MGS-like domain, score
FT                   2.1e-62"
FT                   /inference="protein motif:Pfam:PF02142"
FT   CDS_pept        442513..442638
FT                   /transl_table=11
FT                   /gene="pdxY"
FT                   /locus_tag="PAU_00407"
FT                   /old_locus_tag="PAT2443"
FT                   /product="Hypothetical protein"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00407"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82500"
FT                   /db_xref="GOA:C7BIZ6"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ6"
FT                   /inference="similar to DNA sequence:INSD:CP000359"
FT                   /protein_id="CAQ82500.1"
FT                   /translation="MLLGRTHYIRTEKMSTAITFQYSQIKSLDDFNHRIVTKTFA"
FT   rRNA            443069..444557
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            444688..444760
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:444722..444724,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score58.81"
FT   rRNA            445593..447974
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            448110..448225
FT                   /inference="similar to RNA sequence:Rfam:RF00001"
FT   CDS_pept        complement(448398..448589)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00408"
FT                   /old_locus_tag="PAT2447"
FT                   /product="transposase, IS30 family"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00408"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82501"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ7"
FT                   /inference="similar to DNA sequence:INSD:BX571869"
FT                   /protein_id="CAQ82501.1"
FT                   /translation="MIQFQGKTSQDSMIESRKITPEVRKWIKRLIWKELSPEQIADYLK
FT                   QHKGIFLHHETIYMARQC"
FT   CDS_pept        448809..449750
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="PAU_00409"
FT                   /old_locus_tag="PAT2448"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00409"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82502"
FT                   /db_xref="GOA:C7BIZ8"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ8"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82502.1"
FT                   /translation="MPICIPDELPAVNFLRNENVFVMTSTRANIQNIRPLKVLLLNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRVDNRKCRNTPAEHLDNFYCDFERIKHQNFDGLI
FT                   VTGAPLGLVEFEDVAYWGQIERIISWAKEHVTSTLFICWAVQAALNILYGLPKFTREVK
FT                   LSGVYSHSTLDPLALLTRGFDESFFAPHSRYADFPEHIIREHTDLEVLSSSEEAGAYLL
FT                   ASKDKRMVFVTGHPEYDSETLASEYLRDLAADLDPKIPVNYFPDNNPERKPLASWRSHG
FT                   HLLFSNWLNYYVYQITPYDLINFDINLINSYD"
FT   misc_feature    448812..449705
FT                   /note="HMMPfam hit to PF04204, Homoserine
FT                   O-succinyltransferase, score 1.4e-212"
FT                   /inference="protein motif:Pfam:PF04204"
FT   CDS_pept        complement(450127..450333)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00410"
FT                   /old_locus_tag="PAT2449"
FT                   /product="phage-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82503"
FT                   /db_xref="UniProtKB/TrEMBL:C7BIZ9"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /inference="similar to DNA sequence:INSD:AF198256"
FT                   /protein_id="CAQ82503.1"
FT                   /translation="MHSLLTKAEYEKRSISDDKAKQFDELRPLNAEIARYEVLAGEERS
FT                   RMSNPVQRGDRLSNKENRLLRAA"
FT   CDS_pept        complement(450511..450900)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00411"
FT                   /old_locus_tag="PAT2450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82504"
FT                   /db_xref="GOA:C7BJ00"
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ00"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82504.1"
FT                   /translation="MNNKYVKITYGTILLLVVTSIMYLVSDCVFSLILMKEKIIFSGPI
FT                   VMYFISFNILCYIRFYFFFVFDRLPKLNKLIIRYLTMLMIASFIVSFPISLYVNYKLKN
FT                   DGYLTCDKISWMSPTTYVKNLSLCE"
FT   misc_feature    complement(450514..450897)
FT                   /note="HMMPfam hit to PF06836, Protein of unknown function
FT                   (DUF1240), score 2.7e-48"
FT                   /inference="protein motif:Pfam:PF06836"
FT   misc_feature    complement(order(450610..450678,450715..450783,
FT                   450796..450864))
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2450 by TMHMM2.0 at aa 13-35, 40-62 and 75-97"
FT   CDS_pept        complement(450897..451487)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00412"
FT                   /old_locus_tag="PAT2451"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00412"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82505"
FT                   /db_xref="GOA:C7BJ01"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ01"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /inference="similar to DNA sequence:INSD:AL590842"
FT                   /protein_id="CAQ82505.1"
FT                   /translation="MIFFGFSAIVREFKSIGITATEYFDKNGKCYIKISGHAGPRRIIT
FT                   GTRYGANNPKMLAMGIEQQGLNSSIVKGVKFCIIFSVMYRTIEAVFKDEYTLADFIGNI
FT                   TVDMAKTAVIAATSWAVGSFLTTTAILGGSIIAVAGIVILIGFGVAVGLEILDTKYGIS
FT                   KKLIELIKEEMKRKPKSPEGNLQHVFNSLGKIK"
FT   misc_feature    complement(451020..451088)
FT                   /note="1 probable transmembrane helix predicted for PAT2451
FT                   by TMHMM2.0 at aa 134-156"
FT   CDS_pept        complement(451447..451782)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00413"
FT                   /old_locus_tag="PAT2452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00413"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82506"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ02"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /protein_id="CAQ82506.1"
FT                   /translation="MTYKKYDPSVEGYMGDFLRGNVGINQLKPQHEFFDAIGLEKVLSD
FT                   NTIYIALLIPEEAVSILSDINPFSPTKPKIKLNNYHEKVFTVTDSISPFTGNIHDFFWI
FT                   FRDCPRV"
FT   CDS_pept        complement(452159..>452299)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00414"
FT                   /old_locus_tag="PAT2453"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00414"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82507"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ03"
FT                   /inference="similar to DNA sequence:INSD:AE014299"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82507.1"
FT                   /translation="VQYLPEKLDALKKWCERLDMLAGNYENMVLISSKSTQDYFYNVKF
FT                   R"
FT   CDS_pept        complement(452519..452620)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00415"
FT                   /old_locus_tag="PAT2454"
FT                   /product="putative integrase of prophage"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00415"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82508"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ04"
FT                   /inference="similar to DNA sequence:INSD:AP008232"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82508.1"
FT                   /translation="MCKQALKFCRVRKFSINHALDDLTIPDVGKKTK"
FT   CDS_pept        452968..454566
FT                   /transl_table=11
FT                   /gene="aceB"
FT                   /locus_tag="PAU_00416"
FT                   /old_locus_tag="PAT2455"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00416"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82509"
FT                   /db_xref="GOA:C7BJ05"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ05"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:U00006"
FT                   /protein_id="CAQ82509.1"
FT                   /translation="MTQKTLVTELSFVKRFGAAEQEILTSEALDFLTDLIIRFSDTRNK
FT                   LLADRDIWQKKIDDGELPDFISETSSIRDGEWKIQNIPADLRDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPAWDKVIEGQINLRDAVNGTISYVNDQGKQYQLRSDPAVLI
FT                   ARVRGLHLPEKHVLYQAEPIAGGLFDFALYFYHNYKQLLAKGSGPYFYLPKIQSYHEAQ
FT                   WWSDVFSFTEDRFDLPRGTIKATVLIETLPAVFQMDEILYHLRYHIVGLNCGRWDYIFS
FT                   YIKTLKNHSDRVLPDRQSVTMDQPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDIER
FT                   NNWVLDKVQADKELEARNGHDGTWIAHPGLADTVMEVFDKVLAERQNQLDIFREGDAPI
FT                   TAAQLLEPCPGDRTEEGMRANIRVAIQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHEKSLSNGKKITKSLFRQMLAEEMEVIKQEVGETRFSLGRFDDAAKLMERITTQD
FT                   ELIDFLTLPGYQLLD"
FT   misc_feature    452995..454563
FT                   /note="HMMPfam hit to PF01274, Malate synthase, score 0"
FT                   /inference="protein motif:Pfam:PF01274"
FT   misc_feature    454544..539175
FT                   /note="Region 11"
FT   CDS_pept        454630..455931
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="PAU_00417"
FT                   /old_locus_tag="PAT2456"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00417"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82510"
FT                   /db_xref="GOA:B6VMC8"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC8"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82510.1"
FT                   /translation="MTISRTQQIAQLEQEWKSDRWKGIIRPYSAEDVVKLRGSVNPEHT
FT                   LAQLGAKKLWELLHGKAKKGYVNALGALTGGQALQQAKAGIEAIYLSGWQVAADANTAS
FT                   SMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWANGTDSQEYIDYFLPIVADAEAGFGG
FT                   VLNAFELMKAMIEAGAAAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVS
FT                   GVPTLLIARTDADAADLLTSDSDTYDSEFITGERTAEGFFRTRAGIDQAISRGLAYAPY
FT                   ADLVWCETSTPDIEMARHFAEAIHAEYPGKLLAYNCSPSFNWKKNLDDKTIARFQDELS
FT                   AMGYKFQFITLAGIHSMWFNMFDLAHAYAQGEGMRHYVEKVQEREFESMERGYTFSSHQ
FT                   QEVGTGYFDKVTTIIQGGTSSVTALTGSTEEQQF"
FT   misc_feature    454651..455928
FT                   /note="HMMPfam hit to PF00463, Isocitrate lyase family,
FT                   score 1.3e-266"
FT                   /inference="protein motif:Pfam:PF00463"
FT   CDS_pept        455996..457753
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="PAU_00418"
FT                   /old_locus_tag="PAT2457"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00418"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82511"
FT                   /db_xref="GOA:B6VMC9"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMC9"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82511.1"
FT                   /translation="MGIDSAHLIAQTILQGFDAQYGRFLEVTSGAQQRFEQADWHAVQQ
FT                   AMKKRINLYDHHVGLVVEQLKCIHGAFEYDEDYIAKVKVVYTSLLPDYPRFEIAESFFN
FT                   SVYCRLFEHRNLTPDKLYIFTSQPVRRFRDIPRPLSRDFFPNGNLASMLRTMLNDLPLR
FT                   LPWEDLERDIRYIMDYLQRTFPAEEILQTTFQIANELFYRNKAAWLVGKIRIGNKVYPF
FT                   LLPIHHNESGGIFIDTCLTDHADASIVFGFARSYFMVYAPLPAALVEWLREILPAKSTA
FT                   ELYMAIGCQKHGKTEYYREYLAFITFSKEQFIIAPGVKGMVMLVFTSPSLDRVFKVIKD
FT                   KFAPQKEVTQERVQECYRLVKEHDRVGRMADTQEFENFVINKAHISPELLEELQKEVPE
FT                   KLEDLGNKLLIKHLYMERRMIPLNIYMEQVDEQKLKDAIEEYGNAIKQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELASEPWYSVAPNDVFPEE
FT                   FRHFLCTDSRIRCYFEEMHGDLFKPDYWRALQERIKSGHVEDVFAYRRKQRFSQRTEIE
FT                   TNSIAKVSA"
FT   misc_feature    456020..457705
FT                   /note="HMMPfam hit to PF06315, Isocitrate dehydrogenase
FT                   kinase/phosphatase, score 0"
FT                   /inference="protein motif:Pfam:PF06315"
FT   CDS_pept        458077..458637
FT                   /transl_table=11
FT                   /locus_tag="PAU_00419"
FT                   /old_locus_tag="PAT2458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00419"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82512"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD0"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AJ937740"
FT                   /protein_id="CAQ82512.1"
FT                   /translation="MASVILYGDKLHIRNNYLGNGGYLDTNGYATAQGAKYNVYTATSP
FT                   TRGPGTGTWQILSTAGKGIGTEVYSGDTVFLVNLYQNNGGYLGTNGHAPSPELYNIYTA
FT                   DKTARPVETLTWYIFSDTTSGYDGKVREGDITRFLNGYNNVHGGFLDTCFTAGIPGEVY
FT                   KVYTSLLSNRGNGTGTWNLSKAI"
FT   CDS_pept        complement(459026..459856)
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="PAU_00420"
FT                   /old_locus_tag="PAT2459"
FT                   /product="acebak operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82513"
FT                   /db_xref="GOA:B6VMD1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD1"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82513.1"
FT                   /translation="MSTAVTIKKTKRIRITANNAAANGQVQSLSRGLTLLEYISESPGG
FT                   IALTDLAQQAGLPNSTTHRLLTTLQQHGFVRQIGDLGLWVIGSHTFIVGSSFLQSRNLL
FT                   ALIHPILRRLMEDSGETVNLAILDHSEYEAVIVDQVQCNALMRMSAPIGGKLPMHASGA
FT                   GKALLSTLPDNKLVQLLHKKGLHSYTQYTRTTPSALKENLEQTRKQGYSFDDEEHALGL
FT                   RCIAACIYDEHHQAFAAISISGPVSRITDDRITELGALVIRAAKEISKEYGGIR"
FT   misc_feature    complement(459044..459421)
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator, score 4.6e-52"
FT                   /inference="protein motif:Pfam:PF01614"
FT   misc_feature    complement(459509..459781)
FT                   /note="HMMSmart hit to SM00346, no description, score
FT                   8.7e-33"
FT                   /inference="protein motif:Smart:SM00346"
FT   CDS_pept        460388..461926
FT                   /transl_table=11
FT                   /locus_tag="PAU_00421"
FT                   /old_locus_tag="PAT2460"
FT                   /product="similarities with unknown protein. putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82514"
FT                   /db_xref="GOA:B6VMD2"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD2"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AAIA01000053"
FT                   /protein_id="CAQ82514.1"
FT                   /translation="MGDRPLLLEWESLMKRIFLIICFLAALIVAIIQGIGLVLPDKVSV
FT                   ESFRENGFKNVMRTLGVIAAEPHPAASKRQELVRAYLIREMNEMGYKVTEQKFHYTAND
FT                   LVFRQKKVSSELNSQQRQTFDKKFVRDGRGNVEDEISTHSELSGTNLIAKLKVPSPKGT
FT                   MLIVSHYDSVRTAPGASDNGMAVASVLQLMRDLSKRTDIKNNVIFLFSDAEELGLLGVR
FT                   HFVKNIDEITSQSIDLVFNFDARGNNGVPLLFETSEKNFALVSEWNRSAYKPVAFSFSP
FT                   IVYQMLTNETDFSVFLDMGFAGINFATILGYEHYHRMSDTVENLNLGTLWRYQRTIRDL
FT                   GIHFAIKEVTRFSRESVDAVYFPVPYIGLIIMPVFVALIAGLLAFVLSISLAMKNIWFS
FT                   HSSKTVSNMQTILRIFAGLLSLAAALIVPTASYLIALPVLLFLLMDLMLREFNKFSIAL
FT                   IMLIICTYITCIIYVPVIYLVVVGLHVNVVGGLLALLLIIFLGLGTASLWNRAN"
FT   misc_feature    order(460436..460504,461498..461566,461627..461695,
FT                   461753..461821,461840..461908)
FT                   /note="5 probable transmembrane helices predicted for
FT                   PAT2460 by TMHMM2.0 at aa 17-39, 371-393, 414-436, 456-478
FT                   and 485-507"
FT   misc_feature    460871..461380
FT                   /note="HMMPfam hit to PF04389, Peptidase family M28, score
FT                   6.9e-53"
FT                   /inference="protein motif:Pfam:PF04389"
FT   misc_feature    460880..461404
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 0.00057"
FT                   /inference="protein motif:Pfam:PF01546"
FT   CDS_pept        462804..463640
FT                   /transl_table=11
FT                   /locus_tag="PAU_00422"
FT                   /old_locus_tag="PAT2461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00422"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82515"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD3"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE011807"
FT                   /protein_id="CAQ82515.1"
FT                   /translation="MKNNIKGDSFEVAGKFICKYEIYQGDGNGSVIVLLPAIGVEIRKY
FT                   ETLIQQLVKEGFQVVTAEMPGYGNNQPKPSRENDYNYSDLLRDYLPAMLDKAIELNAKE
FT                   IPIVFGHSLGGHIATLFACSTDRPFSLFCVATGNVGYKNWQGIGQIQIITAAVVFRILT
FT                   ALYGYLPGKKIGFGIREAKGLMRDWSRTACTGNYYHVSAYKGKKNNNLSEAVYICFKGD
FT                   NWAPLKSTQKLAGLIPHSEVSEIAMDIKGNPHSAWIKQPGEIIKIMKRKMLEKKND"
FT   CDS_pept        463633..464016
FT                   /transl_table=11
FT                   /locus_tag="PAU_00423"
FT                   /old_locus_tag="PAT2462"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00423"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82516"
FT                   /db_xref="GOA:B6VMD4"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD4"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AY116644"
FT                   /protein_id="CAQ82516.1"
FT                   /translation="MINTLKMLRWEFLGLFFISLFLTWQLEDYISWWQFILLFFLIDII
FT                   GYYPGRIWSLLNKKEVPPAGFYTIYNICHNVFTLSMISLLWLWLFKDNYSVIALFVHIC
FT                   LDRGVLGNFPKLSINVFKQPTVH"
FT   misc_feature    order(463651..463710,463738..463797,463834..463902)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2462 by TMHMM2.0 at aa 7-26, 36-55 and 68-90"
FT   CDS_pept        464064..464960
FT                   /transl_table=11
FT                   /locus_tag="PAU_00424"
FT                   /old_locus_tag="PAT2463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82517"
FT                   /db_xref="GOA:B6VMD5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD5"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AY116644"
FT                   /protein_id="CAQ82517.1"
FT                   /translation="MGLIKQASEIEMQAKEWGLDEWFAEQVKVEQRKKTSYANDPKLTY
FT                   LPGDLRESLIRELSFKSISEYEATKALLLLADKAPDNINFDYMLTQIFDEGRHAKLFRE
FT                   HLVKIGFADINNVASKMESLLRGKMTNMLETLRTYFDKWVVLKNDYIAGVLIITVVLEG
FT                   VLAPTSELSEIKWRPFDIAAAETQARANADELRHLTVCANIVKTAIENDRSLKQPALEC
FT                   IEEGLALWNQVSVDDLFVERETFYQRGMQSNLRFIEGYELAPGVLLSESTVESRLELSH
FT                   FLVEQMQQSRLEYMGLV"
FT   CDS_pept        464975..466057
FT                   /transl_table=11
FT                   /locus_tag="PAU_00425"
FT                   /old_locus_tag="PAT2464"
FT                   /product="conserved hypothetical protein"
FT                   /note="similarities with isobutylamine n-hydroxylase and
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00425"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82518"
FT                   /db_xref="GOA:B6VMD6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD6"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AAII01000004"
FT                   /protein_id="CAQ82518.1"
FT                   /translation="MRVVWVFRGELEMTDIVEEIRKSSEKCQNLTPEGVKKLLLDSGAA
FT                   SQCLRLAAQSNIEGLCQVGNTIREVSSWLPSIGIALTMHNHIVLACAKFPDIFEDNNKL
FT                   LNEVMASEVLVASAFAEGLPGTNIFAPSLKMHSKEGKLFVNGSKKPCSLSSIADYYVLS
FT                   VSDTDNDNEMRVVLVSKSAQNINVIPFWRLKVLFESDNQEVKFSDTEVSPQLLSRYKGI
FT                   EQQVVLSYGLSLFNYFAANTYSGILNGLARFIPGRVAEQQSIKYTLIQADYKINAILGQ
FT                   MLTIAHDAYRDENAIRNILALRYTLEKILEETASFILRCCGGIQVMTMPEIMNFYSAIQ
FT                   LFKFHPIGEFQMVSQIMQQI"
FT   CDS_pept        466147..468714
FT                   /transl_table=11
FT                   /locus_tag="PAU_00426"
FT                   /old_locus_tag="PAT2465"
FT                   /product="aminotransferase class-iii"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82519"
FT                   /db_xref="GOA:B6VMD7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD7"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AAKU01000002"
FT                   /protein_id="CAQ82519.1"
FT                   /translation="MFVNQYRESLLNSVGLELDIQSAQDNRLTLSDGRVVKDFLAQYGA
FT                   LPFGHNPDFAIAEIDKFIKNKEAIFVQPNIHKKVRLLAEMLSGQIDKEKYTHCVFTNSG
FT                   AETVEAAIKFARLVTGRKSILSLNRSFHGKTYSALSATGSNRFKADFIHDDKLYEHVDS
FT                   EDLAEIKRKLESREFAAFIVEPVQGEGGMKVIPSDTLSSILKLCKENGTLSVFDEVQTG
FT                   IGRLGAFCAATLYSLKPDVILFSKALGAGMSPIGAMLYSNELYLSEFDKKHSSTFANNV
FT                   LAATMGIAVIQHLTKDDGKALTHVQEVSHCVDECLEQLSAKYPEHFCWQGAGLMRGLEI
FT                   QDSKAVSNVFINFSQRSGGLAYIICSFLLKHYGIFTMPLMSRPCSVRFEPPLNVSKEDI
FT                   KTFFAAFDEVCNLVRNGRYDVLFAHLIDMPVTDLPPPSVSYPISVNNNIAQIKAPIPQL
FT                   VEGKKFAFLIHSTSVNEFAHSYCLSIKENYTAEQQRQLGNWIMQISAIDFNPDIAVEFG
FT                   VESSTAYVNGMLLFSPISPEDMMALPTKERAALMKEYLDLAEKNGAEIVGLGAYTSVIT
FT                   DGGNSLVNNRQGRILTNGNSLTAMAVVEGIRSMLTENAHRQTLAVVGARGSVGRLSVTG
FT                   LAHNFGRIILVSRPNKARVLLSELTKALLSSVLKTHDVIQPDSVMDKIRKWLFKQNPGV
FT                   TDARVLHEQILEVIGTLGLEAIESYEQSLSQADFIVSATSEGKPFLNTHYLKGSAVVFD
FT                   AARPFDFIRDGNRHIYEGGLVHQPEKVTYSDCNLIDVPAGVNLACLSETIAVALEGVTV
FT                   HQSIGKSIDYNDALAIRDIARKHGFIPVQYTRNDQGERYEHVA"
FT   misc_feature    466201..467172
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III,
FT                   score 3.9e-43"
FT                   /inference="protein motif:Pfam:PF00202"
FT   CDS_pept        468698..469735
FT                   /transl_table=11
FT                   /locus_tag="PAU_00427"
FT                   /old_locus_tag="PAT2466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82520"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD8"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000249"
FT                   /protein_id="CAQ82520.1"
FT                   /translation="MSMLPDVPQVITTGNAQDVLGNSHLRKVLCYSKHPLSSLLFNTET
FT                   HWFTNQKGAIGFFQDKNLHMCVGGILAPGEERVALLQSFLSFTREKRAFPVFLHGDESD
FT                   FALLRNNGFFVNQLGASYSVLLDGYSMTGKRFQQLRNKISKSRRAGVSIREICSQEEYY
FT                   RLKPQLEHINQLWLKEKHAKALKKLVIDFNTVEVNSGEHRVYIATRGEQIQAYIVYSYT
FT                   WGETSGWFHNLSRKKPDIPDGTMQFINETAINDFLAEGAVSYLHMGFTPLVEFGEDSCF
FT                   NDSAIFHKIAKWMSSKGGIVYPAASQRQYKMSWRPSLIAPEYIAFPKGKAMKALWSTLR
FT                   TTNSI"
FT   CDS_pept        470261..470965
FT                   /transl_table=11
FT                   /gene="orf24"
FT                   /locus_tag="PAU_00428"
FT                   /old_locus_tag="PAT2467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00428"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82521"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMD9"
FT                   /inference="similar to DNA sequence:INSD:AE008911"
FT                   /inference="similar to DNA sequence:INSD:AF550679"
FT                   /protein_id="CAQ82521.1"
FT                   /translation="MDDIDLIKASTTTFSNFTKYITKAGYFLTLVTNDMKYDKTWIGDL
FT                   LGGSLMSRESCLIAEVMLQSPSKEQWQRHLVTENILQTSSERTAIRYARTLRLRLSMLD
FT                   SQGLELVVHGGERERQQCLMVALMLQSPVVAAFISSVVNDAKRQFRESLPANVWAVFVE
FT                   DQRRVHPELASFSESSLRKMGNNAIKALSEARYLDAPCRRHLQTVFLLPEVHDLLVRLE
FT                   RSDLIPLMEGKQ"
FT   CDS_pept        470962..471564
FT                   /transl_table=11
FT                   /gene="orf23"
FT                   /locus_tag="PAU_00429"
FT                   /old_locus_tag="PAT2468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00429"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82522"
FT                   /db_xref="InterPro:IPR014858"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME0"
FT                   /inference="similar to DNA sequence:INSD:AE008911"
FT                   /inference="similar to DNA sequence:INSD:AF550679"
FT                   /protein_id="CAQ82522.1"
FT                   /translation="MIDKVLEYRLAQIESRIEMEGIPRNTRPGNEISFWIFDYPAEKEI
FT                   RVREFLRYLVKRLEKKRTFVHLNIFKILIDMLEARNLFERVCEREKQMGTEAMKKQLSG
FT                   LLSQKKIAEHIANTTSLKDQELAIISGLGNAWPFVRGHELMSALQDVMGFTPLLMFYPG
FT                   TYSGYDLTPLTGIDSRNYYRAFRLVPETGPTVLLNNP"
FT   CDS_pept        471573..475223
FT                   /transl_table=11
FT                   /gene="orf22"
FT                   /locus_tag="PAU_00430"
FT                   /old_locus_tag="PAT2469"
FT                   /product="putative atpase involved in dna repair"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82523"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME1"
FT                   /inference="similar to DNA sequence:INSD:AE008911"
FT                   /inference="similar to DNA sequence:INSD:AF550679"
FT                   /protein_id="CAQ82523.1"
FT                   /translation="MMNIEQIFTKPLTRNINGVVKAEQIDNESAYIELDEYVITRELDR
FT                   HFRAFFAAYLPAVGPERGCVKNNIGVWVSGFFGSGKSHFIKILSYLLANRQVIHNGDRR
FT                   SALSFFEDKVEDALLLADIRKAVQYPAEVLLFNIDSRANADDREDAILKVFLKVFNERV
FT                   GYCADFPHIAHLERELDRRGQYQAFKDAFAAISGSSWETERDAYDFFRDEMAQALSIAS
FT                   GQSEESSRQWAEQFDANFPLDITNFCKWVEEYLDSRENGNILFMVDEVGQFIGKNTQMM
FT                   LKLQTITENLGTICSGRAWVIVTSQADIDAAIGGIEHRDGLDFSKIQGRFTTRLQLSSS
FT                   NTCEVIQKRLLTKTESAVEALRTIFAQKGDILRNQLGFDATTKATLKPYTQSAEFVDNY
FT                   PFVPWHFQLVQKVFESIRTKGATGKHLAMGERSLLAAFQSAAQQVQSDDLNTLIPFWRF
FT                   YEPIEGFLEPAVKRTIEQAEGLGLHEQDIQLLKTLFLIRYVNLLKSTLDNLVTLTIDRI
FT                   DTDKITLRRQLENSLQCLENQRLIARSGDEYLFLTNEEKEIENEIRNVEVEYTTINRRL
FT                   SNLIFDDLLKNRKYRYPVNKQDFPISRFCNGHPLDGANLEDLVVKILTPLDTCYNHYRD
FT                   DITCIPYSAEGNGCILIRLADELLVWKDLQIMVQTDSFLNKQCGQRPEQDVLLKEKDRE
FT                   NQSREKTLRVRIEQLLAEATVYAIGVRLPKKSASPTAIVDEACRYVIENSFAKLKLLRP
FT                   TSRDINREIHSLLTIEDSAQINLDMCSEECNPEAMREVEAWISMSVDYHKPVYLRDVLN
FT                   HFGRRPFGWPEDEVKLLVARLARSGKINFTLQNNQISLKQAWDVFSNTRRHSELRLLKV
FT                   RQHDEEQLRKAAHIMNKVAQESFNEREEQGLAKHIRTTLESWEREYVGYQITAQTGQFP
FT                   GEKAVQEGLQLIKSLLAQKEAFSLVEKVIDESNALEDFAETRDDLSDFYGNQLQSWQQL
FT                   AMVLNGSFKANRSALEKDENAHQALTKLCHIYQMAKPYSQLCCIVPLIEQVQEVNQRLL
FT                   TEAREYGLQRIDTRIEEVKKQMQQSQIPDSLLNRALYPMQQSRERVVNTQSIPEIYHEQ
FT                   SEVQLQQGQAEQLMNGWIDEQLKKRQMIEKSVSNDGQRSPVTSIPVSDPPTVQPIPVLK
FT                   KTLAIHATREMKKAVDGDVLETIEQMEKALEQLRKTLFDALKAGDRVRLQ"
FT   CDS_pept        475265..478891
FT                   /transl_table=11
FT                   /locus_tag="PAU_00431"
FT                   /old_locus_tag="PAT2470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82524"
FT                   /db_xref="GOA:B6VME2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME2"
FT                   /inference="similar to DNA sequence:INSD:AE008911"
FT                   /inference="similar to DNA sequence:INSD:AF550679"
FT                   /protein_id="CAQ82524.1"
FT                   /translation="MNTSNIKKYAPLARIQFCHAITQKLTSLGISVDKNSDLQIADVTE
FT                   IGDWVRFGRYEYPKTVLARRNRLVERAHVQGYTQLIEHVAYTWFNRLCAIRYMELHGYL
FT                   DHGFRVLSHPTDPIGFEVLAHVPEVVGNLALSNPQQLVEMKLAGDQDEALYRELLLGQC
FT                   HFLHKAMPFLFDSLNDETELLLPDNLTRTDSILRGLVDSIPEEDWKQVEIIGWLYQFYI
FT                   SERKEQVIGKVVKSEDIPAATQLFTPNWIVQYLVQNSVGRQWLQTYPDSPLKECMPYYI
FT                   EPAEQIAEVQVQLATITPDSIEPESIKVLDPACGSGHILIEAYNVLKRIYEERGYRRRE
FT                   IPRLILENNIFGLDIDDRAVQLSGFVLLMMARQDDRRIFTRNIRLNVLSLQESSQLDIS
FT                   ALWQGINLHQQSCTGSTFDMFAQNEISTNSQSADEYQLLERTLALFTQAKTFGSLIQVP
FT                   QQDEEALEVLLRQLIELEASGDTHQKEAARILIPFIHQAWLLAQRYDVVVANPPYMGTK
FT                   GMNGDLREFARKQFPDSKSDLFAMFMQHAFSLLKMNGFNAQVNMQSWMFLSSYEALREW
FT                   LLDTKIFVTMAHLGSRAFGQISGEVVQTTAWIMSKYHVDGYLPVFFRLIEGGEEEKKSL
FT                   LIEKKNRFDKVKQDSFRQIPGVPIAYWISTGLMNLFKSNLPMEHYADISTGLSTGNNDR
FT                   FLKMWTEINHLNRDWVPCQKGGSYRKWYGNNEFVIDWGNNGERLKKFKGSTLRNVHNYF
FT                   REGISWTRVSSASTAFRYFEDSFIFESTGPSLFPKESDKKTLYFFAGLLNSKLATVLLE
FT                   FIAPTLDFLSGHIAKLPCLQGNWIDVISENSSKLIKIAKEDWDNYEISWDFKRNPMVEN
FT                   NERRLLSSYKKMRADFSNNIEIMKDLEFENNSVIVKNSSLEQDVCIDIVLNEITLTCNP
FT                   HYRYGNESTEQELENRLQSDTLAELISYIIGCMMGRYSLDQAGLVYAHASNQGFAELVA
FT                   QGAYKTFPADNDGILPLMTSDWFDGDITVRVREFVRKVWGEDHLQENLDFIAKSLCLYA
FT                   IKEKRGESSLETIRRYLSSQFWKDHLKTYKKRPIYWLFSSGKEKAFESLVYLHRYNDST
FT                   LARMRTEYVVPLLARYQRHIDLLQDQRDGASSAAETNLLKKRQEGFTRKFNELRSFDDR
FT                   LRHYADMRITLDLDDGVKVNYGKFGDLLVDVQVITGNPPEVA"
FT   CDS_pept        478891..481491
FT                   /transl_table=11
FT                   /gene="orf19"
FT                   /locus_tag="PAU_00432"
FT                   /old_locus_tag="PAT2471"
FT                   /product="Hypothetical Protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00432"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82525"
FT                   /db_xref="GOA:B6VME3"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR014060"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME3"
FT                   /inference="similar to DNA sequence:INSD:AY090559"
FT                   /inference="similar to DNA sequence:INSD:AF550679"
FT                   /protein_id="CAQ82525.1"
FT                   /translation="MQHADLLRRLMDHFIHHRIVFWYDPKQHFSEVLPKLELDGISVLN
FT                   MHGASLLATKKLIELDQPEQKFLLYFARERPARELDWLLDIRLYSSEFHADHAAMILSD
FT                   LKIPQSGLREYIQRRQDFFSVNTRIQTLKSWITEDESEDSLDKKMLAVVVGAKSFETKE
FT                   ILFSLLQQYVGQHKDEEDSALENTLAVMEHLQLAPVLWWLLEQEMSYQSEKPLLDDFIL
FT                   KLFCTDLWLQGDKAHRDWLSNNVLPTAAGKASALAFMVGWRADRRFSEDYDFIAGQLAG
FT                   KFDLTEHYRHSSPYALQECETFEAIEQFIIKALVTQLLEESTTLDRVMFKNLLSQRLAA
FT                   HWCQTRPEYHAIYEALRHAERLLNLRNHHIDGFKYPDSSSLWQAYTTEIYRFDQAYRLF
FT                   NEQAMLVHRKGADILRDLDGHIEALYTNWYLAELSREWNRLLDGEQRIHSWEFSGIPLQ
FT                   RNFYSDVVKRELSTSQVKRVFVIISDALRYEVAQELASLIKREKRFSAELRSQTSVLPS
FT                   YTQLGMAALLPHKELSYLPDNSGVVYADGQSTQGIAHRDAILRKVNGMAVSANELFNWN
FT                   NSEGRDKIRNAEVVYIWHDTIDAIGDKGATEEKTFEACRKAINELKDLVARVINRLNAT
FT                   RVYITADHGFLFQQQPLSETDKTKLQIKPENTIEAKKRFIIGHQLPDDAFCWHGRLSDT
FT                   AGSRDNSEFLLPKGIQRFHFTGGARFAHGGAMLQEICVPILQVKILQKTRVERRQQRLV
FT                   GVVAKSQNIKLVSNIDKVSFIQTEPVNEQYRARQLTIYIVDSENHVVSAKETVNFDSDN
FT                   HGMEQRVRDVTLKLTGKRFDRRHSYTLVLEDSETRTYFSRYAVTIDLAIQDDFF"
FT   CDS_pept        complement(481794..482447)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00433"
FT                   /old_locus_tag="PAT2472"
FT                   /product="conserved hypothetical protein"
FT                   /note="probable transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00433"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82526"
FT                   /db_xref="GOA:B6VME4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR040804"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME4"
FT                   /inference="similar to DNA sequence:INSD:CP000133"
FT                   /inference="similar to DNA sequence:INSD:AE004569"
FT                   /protein_id="CAQ82526.1"
FT                   /translation="MKKKNSSFISVRKAPKQTRSMHLVANILEAATRILLQEGVHCFTT
FT                   SRIAEKAGVSIGSLYQYFPNKQAILFSLQENEWKQTQQDLANILFDFTIPPLQRLRLAI
FT                   KKFFHTECEEAVLRTALSDAAPFFRDSYETTQQEQETMLLVLRFINETIPNIADEHRYF
FT                   ISKLFLEMMLSIGERLASHTNSLEEVDKWAEAVSDMLCYYIENNISKDSNNKLR"
FT   misc_feature    complement(482229..482369)
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 4.4e-15"
FT                   /inference="protein motif:Pfam:PF00440"
FT   CDS_pept        482544..483209
FT                   /transl_table=11
FT                   /locus_tag="PAU_00434"
FT                   /old_locus_tag="PAT2473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00434"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82527"
FT                   /db_xref="GOA:B6VME5"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME5"
FT                   /inference="similar to DNA sequence:INSD:CP000152"
FT                   /inference="similar to DNA sequence:INSD:AE004569"
FT                   /protein_id="CAQ82527.1"
FT                   /translation="MNTLTTHPLSTILEKLFSESDNSQARLFQTLGALPETEQQALMKE
FT                   AVGENYKLFYTRAKHHYMSISRDTGNLLYILCRANNSKSVIEFGTSFGISTLHLAAAVK
FT                   DNGGGKVISTEFEHEKVVQARINMEKAGVEHLVEIREGDAIETLGRNLPEGIDFILLDG
FT                   AKSLYHPILMMLEDRMHTGTLIVADNADWAPEYCHYVRISDNYVSVPFAKDIELSIRL"
FT   misc_feature    482670..483206
FT                   /note="HMMPfam hit to PF01596, O-methyltransferase, score
FT                   8.3e-09"
FT                   /inference="protein motif:Pfam:PF01596"
FT   CDS_pept        483437..483748
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="PAU_00435"
FT                   /old_locus_tag="PAT2474"
FT                   /product="transcriptional regulator, hipb ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00435"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82528"
FT                   /db_xref="GOA:B6VME6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME6"
FT                   /inference="similar to DNA sequence:INSD:AE017340"
FT                   /inference="similar to DNA sequence:INSD:BX571875"
FT                   /protein_id="CAQ82528.1"
FT                   /translation="MGDNMSITSAKMLAHALRNERKKRKLSQGKVADSIGIKQSTVSEF
FT                   ENYPDGTRLETLFKLLAALDLELQVTKRGASLNSWSSSSNTAQNQEGLHDQQGWDQEW"
FT   misc_feature    483482..483649
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   4.2e-10"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    483485..483649
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   9.5e-11"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        483752..483943
FT                   /transl_table=11
FT                   /gene="hipA"
FT                   /locus_tag="PAU_00436"
FT                   /old_locus_tag="PAT2475"
FT                   /product="hipa protein, dna binding regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00436"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82529"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME7"
FT                   /inference="similar to DNA sequence:INSD:AAOJ01000001"
FT                   /inference="similar to DNA sequence:INSD:M61242"
FT                   /protein_id="CAQ82529.1"
FT                   /translation="MNKLVVALNGTIVGLLEKSAGGAMLFTYHESWLSRPGARAISLSL
FT                   PLQKDSSDNRDRCYRILN"
FT   CDS_pept        complement(484085..484894)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00437"
FT                   /old_locus_tag="PAT2476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00437"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82530"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME8"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE004872"
FT                   /protein_id="CAQ82530.1"
FT                   /translation="MKEKCGVSDTMKQHILQKLAQLETEQQIRILYACESGSRGWGFAS
FT                   TNSDYDVRFIYVHAPSWYLRVDPPRDVIELPINDELDISGWELRKTLGLLKRANPTLME
FT                   WADSPVVYREDVEFMTALRTLLPDYFSNNRARYHYLSMAKKNFRGHLQGKEIRLKKYLY
FT                   VLRPLLAVRWIEAGKGAPPMKFDTLLAATVEDADLMQEIQTLLTIKRNANETDFGPRFK
FT                   HIHKFICHELDHSSTRCRLKDERLLSDTKLDLLLMHTVFSNNTGGIC"
FT   CDS_pept        complement(484899..486125)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00438"
FT                   /old_locus_tag="PAT2477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00438"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82531"
FT                   /db_xref="GOA:B6VME9"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B6VME9"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:U18997"
FT                   /protein_id="CAQ82531.1"
FT                   /translation="MKTNDYELITAPNSVPVKMWTHGVPVEAEAREQLLNTAKMPFIFS
FT                   HLAVMPDVHLGKGSTIGSVIPTRGAIIPAAVGVDIGCGMMAVRTSLNASDLPDNLYAIR
FT                   RAIEIAVPHGRTVNRSGHDKGSWQKPPATVDHHWNMLQSGFKRLTDKYPQLLKTNNYQH
FT                   LGTLGTGNHFIELCLDESDQVWVMLHSGSRGVGNAIGNLFITLAQQDMKQHITNLPDRN
FT                   LAYFEEGSRHFADYMEAVGWAQNFARHNREVMMKHTLTALATVITKPFTAMAEAVNCHH
FT                   NYVQQEQHFGQNVLVTRKGAVAAHKGVMGIIPGSMGVKSFIVRGLGNEESFCSCSHGAG
FT                   RVLSRTAAKKRFTIEDQKRATAHVECRKDSDVIDEIPMAYKDIEAVMAAQSSLVEIVHT
FT                   LRQVVCVKG"
FT   misc_feature    complement(484902..486101)
FT                   /note="HMMPfam hit to PF01139, Uncharacterized protein
FT                   family UPF0027, score 6.1e-180"
FT                   /inference="protein motif:Pfam:PF01139"
FT   CDS_pept        complement(486784..486993)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00439"
FT                   /old_locus_tag="PAT2478"
FT                   /product="Hypothetical protein"
FT                   /product="had-superfamily hydrolase subfamily ia, variant 1
FT                   and 3"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00439"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82532"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMF0"
FT                   /inference="similar to DNA sequence:INSD:CP000094"
FT                   /protein_id="CAQ82532.1"
FT                   /translation="MGAKLLGLRIADILIFEYSTTGIIAALWSGTTLGVIGDCHSACNS
FT                   EWLKLPDFTHISIKSTLSSVHFIA"
FT   CDS_pept        complement(487299..489071)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00440"
FT                   /old_locus_tag="PAT2479"
FT                   /product="biotin carboxylase/biotin carboxyl carrier
FT                   protein"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82533"
FT                   /db_xref="GOA:B6VMF1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMF1"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000058"
FT                   /protein_id="CAQ82533.1"
FT                   /translation="MNNKDNPMKKILIANRGEIAVRIIRACRDYGLQSIAIYADSDINA
FT                   QHVQLADEAYGLGGNNPAETYLNIPRLLDIAKRSGASMVHPGYGFLSERAEFARAVIDA
FT                   GLIWIGPEPETIDALGDKVKARKIAQRVGAPLVSGTEEPVKNAEEALTFAEKYGLPIAI
FT                   KAAYGGGGRGLKVAWRLDEVTELYNSAVREATVAFGRGECFIEQFLDKPRHIEAQILAD
FT                   KHGNVIVLGTRDCSLQRRNQKLVEEAPAPFLTDNQRQRIHQAARDICAEARYTGAGTVE
FT                   FLLSADGTISFLEVNTRLQVEHPITEETTGIDIVIEQFRIAEGKPLSLTTTPIPSGHSF
FT                   EFRINAEDTGKGFLPTPGTVTLFSPPSGPGIRLDSGVVTGSVIPSTFDSLMAKLIVTGK
FT                   TRQQAIARAQRALQEFNIEGVASVLPFHQAVMQHPDFISDDTFKVHTRWIETDFINQVK
FT                   ISPRQENHYPEKVTRTFIEIDGRRHQLGLPAELLRGLLLSDPEQNSVTKNLNSAAEETI
FT                   TASNQIPAPISGILQSWYVQEGDEVKQGDVIAVMEAMKMETQLTAHRSGKIIIHAEKGS
FT                   YQQAGNALASINED"
FT   misc_feature    complement(487311..487511)
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 6.9e-15"
FT                   /inference="protein motif:Pfam:PF00364"
FT   misc_feature    complement(487722..488051)
FT                   /note="HMMPfam hit to PF02785, Biotin carboxylase
FT                   C-terminal domain, score 5.9e-59"
FT                   /inference="protein motif:Pfam:PF02785"
FT   misc_feature    complement(488070..488711)
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain,, score 2.1e-104"
FT                   /inference="protein motif:Pfam:PF02786"
FT   misc_feature    complement(488178..488714)
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase,, score 0.00032"
FT                   /inference="protein motif:Pfam:PF01071"
FT   misc_feature    complement(488715..489053)
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain,, score 4.8e-45"
FT                   /inference="protein motif:Pfam:PF00289"
FT   CDS_pept        complement(489064..490746)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00441"
FT                   /old_locus_tag="PAT2480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82534"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMF2"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE016853"
FT                   /protein_id="CAQ82534.1"
FT                   /translation="MSWHHAPFYILIINAASFREYSVRFLPVNLNAIIVELCNLDETLA
FT                   LFDSLNSSPISGVEEIIPAARTLLIRFRPNIIADSQLAREINRRNLNTRDRTTGKLVEI
FT                   PVYYTGEDLAEVADILGITIKEVIKRHTENEYTVAFTGFAPGFAYLVANSNVLHVPRRM
FT                   TPRARLPAGSVGLAGEFSGIYPQTSPGGWQIIGITPERMWDLSRNPPALLQPGFRVRFR
FT                   DKSKGTTVTITKPESQITPTIDVISSQVDKRPSLAILSTGIQTLFQDLGRSGQAGLGIA
FT                   AAGALDKTALRSANRIVGNPSDSACLEIVEGGLSFISHGCVIIAVTGADCPIVIQTASG
FT                   RKFQAGSYQPVDLSEGDKVTLGTPKAGVRSYLAVRGGFAQQPILSSRSYDTLAHIGPKP
FT                   VATGDLLNILSVTRSFAVSMDEGPAFNMPAPDDIVTLDIILGPRTDWFTEEALSLLQNQ
FT                   LWRVTPQSNRVGIRLNGGTPLSRINHEELPSEGTAVGAIQVPASGQPVLFLADHPLTGG
FT                   YPVIGSVASYHLDLAGQIPINAHIRFNPINEFHEIQEALTVHE"
FT   misc_feature    complement(489070..489918)
FT                   /note="HMMPfam hit to PF02626, Allophanate hydrolase
FT                   subunit, score 1.8e-58"
FT                   /inference="protein motif:Pfam:PF02626"
FT   misc_feature    complement(490108..490653)
FT                   /note="HMMPfam hit to PF02682, Allophanate hydrolase
FT                   subunit, score 1.9e-52"
FT                   /inference="protein motif:Pfam:PF02682"
FT   CDS_pept        complement(490752..491522)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00442"
FT                   /old_locus_tag="PAT2481"
FT                   /product="upf0271 protein plu4304"
FT                   /product="lamb/ycsf"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00442"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82535"
FT                   /db_xref="GOA:B6VMF3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMF3"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000267"
FT                   /protein_id="CAQ82535.1"
FT                   /translation="MIKTIDLNSDLGESFGQWKMGDDNAMLSIVTSANVACGFHAGDPA
FT                   GILQTLKAAHENQVVIGAHVSYPDLVGFGRRNMDIASDELIADVIYQIGALKGLAAAAG
FT                   TTVSYVKPHGALYNTIANDEYQALAVITAIREVDDNLTLVGLAGAKILDLAREKGLRTV
FT                   AEAFADRAYTPQGTLVSRREKGAVLHDANVVAQRMLQLVTEGGVEAIDGSFTRIQADSI
FT                   CVHGDSPGAVEMARQVKMTLQQAGITIQSFIQNG"
FT   misc_feature    complement(490788..491513)
FT                   /note="HMMPfam hit to PF03746, LamB/YcsF family, score
FT                   1.1e-140"
FT                   /inference="protein motif:Pfam:PF03746"
FT   CDS_pept        complement(491534..492742)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00443"
FT                   /old_locus_tag="PAT2482"
FT                   /product="membrane protein, putative precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00443"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82536"
FT                   /db_xref="GOA:B6VMF4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMF4"
FT                   /inference="similar to DNA sequence:INSD:CP000075"
FT                   /inference="similar to DNA sequence:INSD:AE016853"
FT                   /protein_id="CAQ82536.1"
FT                   /translation="MKVRRSSLIAAIFLMATSAIGPGFITQTATFTATMGASFAFGILA
FT                   SIVIDFFVQQNIWRIVTLTRMRAADIANTAIPGSGYLLALLVIFGGLVFNIGNIAGSGL
FT                   GLNALIGLEPKWGGLLSAIMAIFIFSSQRAGIAIDRIIIVLGVAMIILTLFVAYVSNPP
FT                   LGEALRQTVLPDNINFATITTIVGGTVGGYVCYAGAHRLLDKGIAGTENIQAISRAATN
FT                   GILVVGLMRYILFLAILGVVASGVVIDISSQDANPASQAFQAAAGQFGLRIFGLILWAA
FT                   AITSVIGASYTSISFITVFSQKFTERKRNIATIIFIALSLLVYLVLGTPPAALLVFAGG
FT                   FNGLILPIGLTIFIYVGWCRADLMQGYHYPRWLLWLGAITCALTWYMAFMSIEPIFSFL
FT                   KTA"
FT   misc_feature    complement(order(491576..491629,491666..491734,
FT                   491744..491812,491846..491914,492008..492076,
FT                   492137..492205,492263..492322,492359..492427,
FT                   492455..492523,492584..492652,492665..492724))
FT                   /note="11 probable transmembrane helices predicted for
FT                   PAT2482 by TMHMM2.0 at aa 7-26, 31-53, 74-96, 106-128,
FT                   141-160, 180-202, 223-245, 277-299, 311-333, 337-359 and
FT                   372-389"
FT   sig_peptide     complement(492608..492742)
FT                   /locus_tag="PAU_00443"
FT                   /note="Signal peptide predicted for PAT2482 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.330 between residues 45 and 46"
FT   CDS_pept        493298..493591
FT                   /transl_table=11
FT                   /locus_tag="PAU_00444"
FT                   /old_locus_tag="PAT2483"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to hemolysin secretion/activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00444"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82537"
FT                   /db_xref="UniProtKB/TrEMBL:B6VMF5"
FT                   /inference="similar to DNA sequence:INSD:CP000305"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /protein_id="CAQ82537.1"
FT                   /translation="MWNRKAMKSSILVLAVFYSTASGSQAADLSDQQRIHQQARQQALE
FT                   AQLAPSPEAVRLSVLEKTSPAAFPTAAHGFPLARVPPFSTGRIHSNNPAARV"
FT   sig_peptide     493298..493375
FT                   /locus_tag="PAU_00444"
FT                   /note="Signal peptide predicted for PAT2483 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.989 between residues 26 and 27"
FT   CDS_pept        493612..502473
FT                   /transl_table=11
FT                   /locus_tag="PAU_00445"
FT                   /old_locus_tag="PAT2484"
FT                   /product="similar to hemagglutinin/hemolysin-related
FT                   proteins. putativ transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00445"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82538"
FT                   /db_xref="GOA:C7BJ34"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ34"
FT                   /inference="similar to DNA sequence:INSD:BX571871"
FT                   /inference="similar to DNA sequence:INSD:AY275838"
FT                   /protein_id="CAQ82538.1"
FT                   /translation="MNKQLYRLIFNRSRNRLMVVAEIARAGQGSTARRRGRPSAQRLCR
FT                   LTAFQFGLLLALGGISLTAQAAIVADGQAPGQQQPTIIPSANGTPQVNIQTPSAAGVSH
FT                   NTYRQFDVDKRGVILNNSAKATETQLGGMVAGNPWLAKGEAKVILNEVNSRDPSHLNGW
FT                   IEVAGRKAEVVIANPSGITCNGCGFINAHRTTLTTGEALMERGHLTGFDVNQGEVRIEG
FT                   QGMDSRQQNYTDIIARAVALNAKLHAQNLKVTTGRNRVDAAHQTITKKSAAEDEAHPLF
FT                   ALDSTALGGMYAHKILLIGTEAGVGVRNAGDIGVPAGEVFVTADGRIENRGTISSRDAL
FT                   QLTSTAGIDNQGKLLSQSTVTLQAGGPLHNRGRIEARGDISATAQTIQSDRHSVWAAGL
FT                   DDNGNTTRPGSLTLTAQQVQAGGKNLATHTLNIHGQQIDLSGSQTVAGDIQLTASQPGI
FT                   STAHASVNADRFTAHTPGQFNNNGGQLTAREIHLTTPDIANQQGKMTQTGPGELTLHTR
FT                   TLNNRGGTLFNAGSRLTITTDQLDNRQGNLVNQGDNFHLTAQTADNTQGQVQLAGNGQL
FT                   SLTAQHWLGHQGKLLTNGTLAIQAGDLQLNQAETRAHRITLNADTLNHQQGVMQQSGTD
FT                   TLALTVNTLNNQGGKIAGNGNLNVEATTVDNRHGNIVAAENGSLTLTVNDTLDNQNGRL
FT                   EAGNDIQLTATQLDNRRGTLAASGGSATLTIGQQIQNTHGHIEAKTRLTTTSQALDNTQ
FT                   GTLLAQHITSQTTGHRFTNTAGQVIAQDTLTLHSGELENTAGLLQSGGDMTVKTHGHWL
FT                   ANTATTDQKGGQLLSGGHLTLHTGDIDNTGGIIAADGHTTLSSTALNNTRGQIAGNGGL
FT                   DIHSQQLTNRQGTLQSADALNLDTDGQGLDNQQGRILGDGITTVTSGPLDNRHGHLQGG
FT                   QLVIDTRQAQTDNRDGKLLSAGTFNLKTQQLDNRHGQVQAVGDTVLNVKTQTDNTGGLI
FT                   RGGAQLTLSTAHLINRDTAQTDKGLEAQNLTVSTQQADNSQGTLRAADHLQANISQTLN
FT                   NTQGLVSAGKQLTINREAQQPPLRINNPQGTLIAGKQVDIQANTLSGDGQLLSQGDMAV
FT                   TLTEDFHHTGNTAANGNLTLKTTGNLLNDRPIKAGQALHLGAQNLTNSATGEISAEQTQ
FT                   IKVHDTLTNTGLIDGNLTHLTAHTLTNTGTGRIYGDHLALQTGTLNNTAHAGNAAVIAA
FT                   RDRLAIGTDTLNNQHHAQIYSVGETHIGGQLDNTLSATGQARELTNHAATLEAGGNLTI
FT                   DANQLHNTNAGLVTQVAETEHARHHDAALSGQTARYDWAQVDTARRDKYGVHTARMPDG
FT                   SRSDNFYEYQYTRTVTETQVKHSDPGKILAGGHLTLNSANVTNHDSQIIAGGALTGTIG
FT                   ELHNLATQGERITTETGSQTHWYAKKKRNKLGIGGTKTSQGKSRSGYNPAPVVETIDLK
FT                   TLAWQDHARPQNTDITITDRQTGQIHAAPTAVKPVSGINDQPRVLPPGQPFELSLPPET
FT                   VKGQPIDPVIRVVTPNTRLPDNSLYTVQPASDSHYLVETDPKFTQYKQWLGSDYMRQQL
FT                   THDPALVHKRLGDGFYEQRLVREQITQLTGQRYLPGYHNDEAQFKALMDAGVAFGKEQQ
FT                   LTPGIALSPAQMALLTADIIWLTNQTVTLPDGSTQVVTVPQVYARVRPGDLSGDGALLA
FT                   GNTVALNSQGDITNSGTISGRDVTQLTANNLTNSGFIRGGKVDVTAQQTLTNRGGQIQG
FT                   DDRVTLKGRDITSASTVRGDETNRGLDRPAGIYVQNDQGTLSLNAINNVQITASEVKNT
FT                   GKASHTEITAGHNLTLDTLSTHRTEQGDWGKDNYRHLTQQQDIGSQITGAGEVTLQAGQ
FT                   DLTATAAHVNAGQQLTAQAGNNLTLTTGTASSDLVEHSKQTSKGWLSTSSVETHDEVHD
FT                   RQALSTTFSGDKVTLQAGKDLHIRGSNVAGTQDVRLNAGHQLTVTTAAESHGETHLRQE
FT                   KKSGLMGTGGIGFTLGQASQKVTTDSDSQRNKGSTVGSSQGHVTLNAGTQLNLHGSDLV
FT                   ASKDITLTGQNVNITSAANHHTTLTKTEQKQSGLTVALSGTAGGALNSAVQTARAAQQT
FT                   EDPRLKALQHTQAALSGVQATQAARLAEAQGSDKGNNTLAGVSLSYGRQSSRSEQQHQQ
FT                   TTQQGSHLTAGDNLTITAHGDDKGASGPNGDIRIQGSQLQAGKDLQLNASRDIALSSSQ
FT                   NTEQTTGKSRSHGSAMGMGVTAGPGGTGFSVSANVSRGNGHETGHGVSHNNTTLAAGQA
FT                   VTLNSGRDTTLQGAQVSGEQMTAEVKRHLTLSSEQDSQRYDSQQHNARAGVSTTVGPQP
FT                   DGTLSLNASRSKLHSNYDSVQEQTGLFAGKGGYQVNVGDHTQLDGAVIASQADNAKNTL
FT                   NTGTLGFKDIQNKADFSVEQQSAGVSLGQPTTGQVLNNLAVNALTGSNNQGHDRSTTHA
FT                   AVSDGTLIIRDKDHQTQDIANLSRDTDNAANVLRPIFDKEKAQQRLKQAQLMGELSAQM
FT                   TEIAGTEGKIIATKAAKAKLNHISEQDKADAREKLINAGNKAPSPADINKQVYDTAYTQ
FT                   ALNDSGFGTGGPYQKALQAATAAIQGLAGNNLGQALAGGASPYLAGVIKELTTDPQTHQ
FT                   VDIATNTLAHAILGAVAAEVSGNNALAGAAGAASGELAAQVLIKQLYGDAAKVSELTEE
FT                   QKQTISTLSTLAAGLAGGIAGDSTASVLTGAQAGKNATDNNALAVPMPPPPIASSNTGE
FT                   AVNEANQTIASALDKKLKEIGETLDKATECSFGRVCSSDYVDGENQPNVGKSLTNEEKT
FT                   KYGGVGSGSPDGWEPRDEENARNNSALPSKDNLNQAASAPNRNGLTDAGRALQKHGGRE
FT                   GSVYSYSSQKASVLNQEAQTIVSEILSNPNTKIESRIVFENKQRITVVEATAPDGRALR
FT                   FNADGTRLIGFREPSSK"
FT   CDS_pept        502470..502715
FT                   /transl_table=11
FT                   /locus_tag="PAU_00446"
FT                   /old_locus_tag="PAT2485"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00446"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82539"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ35"
FT                   /inference="similar to DNA sequence:INSD:AE014837"
FT                   /inference="similar to DNA sequence:INSD:CP000305"
FT                   /protein_id="CAQ82539.1"
FT                   /translation="MIERKNMLEYSVGSSADRDDLYAELSFNRVQWGEISLSEDKKSVN
FT                   IIIYPDNNILEFRYDEFLHIVEKAKAHLLSLEPLSE"
FT   CDS_pept        502764..503579
FT                   /transl_table=11
FT                   /gene="hecA1"
FT                   /locus_tag="PAU_00447"
FT                   /old_locus_tag="PAT2486"
FT                   /product="hemolysin/hemagglutinin-like protein HecA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82540"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ36"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /inference="similar to DNA sequence:INSD:AF501263"
FT                   /protein_id="CAQ82540.1"
FT                   /translation="MDNNHLSVDQNRSRSEELVNCQGDSSCRTTVRDKYRQEYDQVQAR
FT                   IATCSGADQCVAVAKELRALQGDYSARMSEIQEKARMQGLDSLTPAEVREWADLRGAMS
FT                   NIDASRNLVLHRAQVTGGSEETTQEIVKIMGQTGIAASAGVAGGIGKAGTKGVKGGAIP
FT                   VPNPVTANNGLVYKSNPKHTLGGDGNRLSAGIEPQNSFNLFEKSIPTKDPKVRLAIDEK
FT                   GNIHRFFNERKDGSGSFHWSGSTGDGKNALGHNELRKFNSEIKQLGGKK"
FT   CDS_pept        503576..504082
FT                   /transl_table=11
FT                   /locus_tag="PAU_00448"
FT                   /old_locus_tag="PAT2487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00448"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82541"
FT                   /db_xref="InterPro:IPR028958"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ37"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /protein_id="CAQ82541.1"
FT                   /translation="MIYGLPDEFAVTYEVCESSEDEYWQYGIFNFVIDDVIVPAIGSNY
FT                   TLHMVINHLKDSLMEFPLCKKIDTSLLSKNKEIMEFIAHSHHILLDTDDDDGLEFPEME
FT                   QQGIDLTPVEFTDVGFYIFYYITSNSEDEFIIYTCDRGLTVEIKRLKKNTVKNVIEQLP
FT                   RFKNI"
FT   CDS_pept        504226..504489
FT                   /transl_table=11
FT                   /locus_tag="PAU_00449"
FT                   /old_locus_tag="PAT2488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00449"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82542"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ38"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /protein_id="CAQ82542.1"
FT                   /translation="MNGNLRNAGIEPKDSLKLFENSIPSSKNYGNKEVRFAKDEKGNIH
FT                   RFDGTNGEYHWNGSTGDVKNPLNKNDIPNEVKKQLGLSGKWR"
FT   CDS_pept        504492..505034
FT                   /transl_table=11
FT                   /locus_tag="PAU_00450"
FT                   /old_locus_tag="PAT2489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82543"
FT                   /db_xref="InterPro:IPR028958"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ39"
FT                   /inference="similar to DNA sequence:INSD:BX571859"
FT                   /inference="similar to DNA sequence:INSD:AAJL01000004"
FT                   /protein_id="CAQ82543.1"
FT                   /translation="MIFGDPYRFAVLIQHLPEWSDDTYKNGLFHFCIDGYFFPEEIRTS
FT                   TLWVDVLSLKDNTNALFSFQENKVLFEKGTKDAFSFMLGMISPELIGQDEPENFEQSYQ
FT                   YQASTENINDAGFIVFAVSHDDMVRILGAKYSELKQDEHGNGFWETIANPDIREAILYK
FT                   SEVNEIISKVFEYYSTI"
FT   CDS_pept        505189..505986
FT                   /transl_table=11
FT                   /gene="hecA2"
FT                   /locus_tag="PAU_00451"
FT                   /old_locus_tag="PAT2490"
FT                   /product="hemolysin/hemagglutinin-like protein HecA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82544"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ40"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /inference="similar to DNA sequence:INSD:AF501263"
FT                   /protein_id="CAQ82544.1"
FT                   /translation="MECVAVDNNHLSVDQNRSRSEELVNCQGDSSCRTTVRDKYRQEYD
FT                   QVQARIATCSGADQCVAVAKELRALQGDYSARMSEIQEKARMQGLDSLTPAEVREWADL
FT                   RGAMSNIDASRNLVLHRAQVTGGSEETTQEIVKIMGQTGIAASAGVAGGVGKVGAKGGK
FT                   EKYQPNQGAVGNMGEFFRQTGFGSQAKSNSQKTSKMYDGQSIYQASSDIGTHIKKGDQF
FT                   YLDGDHKNHLEIFDKRGNFKVVVNLDGTINQAKTDKAMGRKLK"
FT   CDS_pept        505983..506351
FT                   /transl_table=11
FT                   /locus_tag="PAU_00452"
FT                   /old_locus_tag="PAT2491"
FT                   /product="Hypothetical protein"
FT                   /product="otthump00000017444 (fragment)"
FT                   /note="putative pyocin r2_pp, tail length determination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00452"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82545"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ41"
FT                   /inference="similar to DNA sequence:INSD:AE015451"
FT                   /inference="similar to DNA sequence:INSD:AL049548"
FT                   /protein_id="CAQ82545.1"
FT                   /translation="MNGLDQIKRAILELSKINTADFKFVDSDWSIDYQLDLDKRLQEDL
FT                   AKLETELNLLTDAVQRKDMVTAKCALVMARVISLDLSNFFLNIFEDIEKVGWGELCELP
FT                   SIPENYVIPEHYNYPLDK"
FT   CDS_pept        507723..509459
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /gene_synonym="ppsE"
FT                   /locus_tag="PAU_00453"
FT                   /old_locus_tag="PAT2492"
FT                   /product="similar to antibiotic synthetases"
FT                   /EC_number="5.1.1.3"
FT                   /note="similar to antibiotic synthetases - bacitracin
FT                   synthetase 1 (ba1) [includes: atp-dependent isoleucin
FT                   adenylase (ilea) (isoleucine activase); atp-dependent
FT                   cystein adenylase (cysa) (cysteine activase); atp-dependent
FT                   leucine adenylas (leua) (leucine activase); atp-dependent
FT                   glutamate adenylase (glua (glutamate activase);
FT                   atp-dependent isoleucine adenylase (ilea (isoleucine
FT                   activase); glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00453"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82546"
FT                   /db_xref="GOA:C7BJ42"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ42"
FT                   /inference="similar to DNA sequence:INSD:AF007865"
FT                   /inference="similar to DNA sequence:INSD:Z99113"
FT                   /protein_id="CAQ82546.1"
FT                   /translation="MDILNRFSDSVNKFPDLIAIKEGKRRLTYRQLDAASDLVAKYLQE
FT                   NQFTEQLIGLHLKSSIELVICILGSIKAGNGYVCIDPTYPDNRKQFVAEKAELSLVITI
FT                   EPVTFDINKAVCYSEILEQRDNLQQTIIKPLTYDLATVIFTSGSTGTPKGIMLRQENIV
FT                   SFVGTFVDVTEQDCIAQFSSISFDAFVFELWVALSYGASMCVVDSETLLYKNRFYETAI
FT                   ENKISMAFITTALINNGILDHFIGIASFRRLYFGGEAVQRNALIPVFNKLDFEIVHVYG
FT                   PTETTVFCLKKTLNELWESIPLGKPFANATAMLIDEQGKQITEAGVKGEILIGGAGVSR
FT                   GYLGDPQLTHASFIELEGKRYFKTSDLATLNEFGEFVFIGRKGNTVKLHGYRVDLNEVT
FT                   YAIQAIEPNVIAETLLYCDDQENRYLVSFICHGKMSESEVSQALKQVLPDYMLPSQIIK
FT                   LDAFPVNFNGKVDKGSLVKILDGFKAENSESESIEDRVLNIWRKVLGNRSVSYDDKYFE
FT                   VGGNSVLLLKLKRELDKEFGIKIKMNDLFSNATVLDQANMLQLNMDLQRISSRSPVAVK
FT                   EI"
FT   misc_feature    507804..508952
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   1.8e-85"
FT                   /inference="protein motif:Pfam:PF00501"
FT   misc_feature    509202..509396
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 2.8e-10"
FT                   /inference="protein motif:Pfam:PF00550"
FT   CDS_pept        509642..515206
FT                   /transl_table=11
FT                   /locus_tag="PAU_00454"
FT                   /old_locus_tag="PAT2493"
FT                   /product="putative polyketide synthase"
FT                   /note="nvolved in the biosynthesis of a polyketide
FT                   antibiotic; polyketide antibiotic synthase enzyme systems"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00454"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82547"
FT                   /db_xref="GOA:C7BJ43"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ43"
FT                   /inference="similar to DNA sequence:INSD:BA000019"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82547.1"
FT                   /translation="MRSCESQRCDIAVIGISCEFPGGQNIDEYWDIISRNICVTKLQGA
FT                   QNQGNKIAAEGILKTPYCFDAHYFNINPKDAEFMDPQLRKLLEHAVKSLQDANVVDNLT
FT                   ENNIGAFLSVGANHYLHNCLMKGGHHEDKNNHYRLAIGNDKNCVATQVAYHLNLQGPAL
FT                   TISTACSSSLVAIHEACKSLLAGESHCALAGGATVLTPHGEGYEYATGGVLSEKGECRP
FT                   FSSDSDGTIPSSGIGIVVLKRLSDALADRDNIYAVIKGSAVNNDGAEKVGYTAPSIQGQ
FT                   AKVIEQALENSAISASDIEYIECHGTGTLLGDPIEIEALASAYEGQHRQTCAIGSVKWN
FT                   IGHTDSAAGVAGFIKAVLSLKYNMIIGSPYLSEPNPELGLETSPFYIPRQNKPFHGQEP
FT                   KVAISSFGMGGTNCHLILSKYSVKTESVHTENKDSLCLIPFSARSKTSLDQNIEQLIQF
FT                   VDASESYTLGNIAGTLIGCRAEEPVRSFAVASSLAELTAAMKTERVVVNARAGVELVVA
FT                   VEGQGDQVSGAAAQYYQQLHRFREHFDTCMALFLACEGIPQDLVQVALDTEMARDISSQ
FT                   QTLYAQPILFSTQYAIARMLEEMGLRFAGFIGHSLGEWIAAVIAGLWDLREAVELIALR
FT                   AVELQRCQDGQMAVFFTGADVLTPYLNGSLSITGFNGPAMTVVAGLAEDLALLMESLRE
FT                   KRIKSKRLNTNKAFHHPLIMPAIEPLKAKLESMTFQKASGWLYSNLTGERMAWRTASTP
FT                   AYWLQQLLKPVKMATAIEHINPERTVVVDLGQNGTMSQLLAANQPELRERCCSVRRITC
FT                   LAEVYTLIGTVWAHGASINWRTFLPEHWSKLRLPSYVFDSNEYFMAPTPSTSASVALKK
FT                   PVNQWLYKEAWCIDPVGSFNKTRNHLSSEQDDWYRDGEVAIYVGFWHKTTLTPHKIEKF
FT                   LQTVSTLGDAIKQCHILVRYSSLPFPGDLADCYMGALETLVTVLNQENQALSTRLYNIT
FT                   CDWSLEQLLHYDLSALSPNSEVVYFDGAQAWTKKYVPYAGSDHRQYQWQDDGFILITGG
FT                   LGNIGLALALYLTSRTQATIILMGRKGAQSGHLALSELPESISSSIQNRYAFDQLRENL
FT                   NVYYVSQSIEDESVADGVIAGLVSQFGKLMGIVHCAGYTAVAGLRPVLNETQDNIERHY
FT                   QPKILGTQILANICETYRPDFCILMSSISTLLGGMGLGLYGYVNGFMNGYSWLKRADAT
FT                   QWMSISWDGWDLNDDPTLPASIKLTAIGRDDCEAIFDEVFSHLHMSHMVVSTHSLDDRL
FT                   SKWVKGESATHSVVKVNPTITADEIRQKVREIFCSILGVTDLQDQSNFFDLGGQSVLFT
FT                   ELAAEIRSSLGLQLPLHKFINEPTVDNITRLLVQEITAGNWTKMTIREPLLSLIGALLG
FT                   INEIKMEDNFFDLGGNSLLFTQLTSQIKAQFNFNLPLHEFINQPTVNALADMIVGQSQS
FT                   PDMINHYDVILPDDYQPLTPVTEQQNSVYLVTGAAGLLGVNIVIALLKQSNVKKVYALV
FT                   RADNTDQAYQRVLREIARFVSEDKISLNKLQVLCGDVTHPHFGLNDDDYRAISQEATDI
FT                   IHNAAHVHHILDYQSLKSTNTDSMVSVIELAGTYQAKRIHFISTLACAFSLSENNQYEE
FT                   VLPDEHVYPFGKANGYARSKWAAERLLAQAKARGFSVNVIRPSSIVGDTQTGMFNPDND
FT                   HLWLFIKGCLQLGTYPEMENEVNMSPVDFVARLVVAICQNNENKVYNIPNPHVIQMNDI
FT                   FVYLKNRGYSLMPLSHEAWVDTELVKVTKDNALYPILSYYTYREEADTSLPHDLHNVEI
FT                   INTTTLIQQSEITYPHPDVFLAALVGYLEQVAFFPSQPM"
FT   misc_feature    509666..510382
FT                   /note="HMMPfam hit to PF00109, Beta-ketoacyl synthase,
FT                   N-terminal do, score 6.1e-65"
FT                   /inference="protein motif:Pfam:PF00109"
FT   misc_feature    510404..510901
FT                   /note="HMMPfam hit to PF02801, Beta-ketoacyl synthase,
FT                   C-terminal do, score 9.9e-70"
FT                   /inference="protein motif:Pfam:PF02801"
FT   misc_feature    511199..512131
FT                   /note="HMMPfam hit to PF00698, Acyl transferase domain,
FT                   score 3.8e-10"
FT                   /inference="protein motif:Pfam:PF00698"
FT   misc_feature    512762..513316
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 5.4e-11"
FT                   /inference="protein motif:Pfam:PF00106"
FT   misc_feature    order(512765..512824,513200..513268)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2493 by TMHMM2.0 at aa 1042-1061 and 1187-1209"
FT   misc_feature    513572..513766
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1e-15"
FT                   /inference="protein motif:Pfam:PF00550"
FT   misc_feature    513812..514006
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.1e-16"
FT                   /inference="protein motif:Pfam:PF00550"
FT   misc_feature    514109..514879
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase f, score 3.4e-06"
FT                   /inference="protein motif:Pfam:PF01370"
FT   misc_feature    514112..514882
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/i, score 0.00041"
FT                   /inference="protein motif:Pfam:PF01073"
FT   misc_feature    514115..514834
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 1.2e-68"
FT                   /inference="protein motif:Pfam:PF07993"
FT   CDS_pept        515290..521499
FT                   /transl_table=11
FT                   /gene="tycC"
FT                   /gene_synonym="grsB"
FT                   /locus_tag="PAU_00455"
FT                   /old_locus_tag="PAT2494"
FT                   /product="gramicidin s synthetase 2 (gramicidin s
FT                   synthetase ii) [includes: atp dependent proline adenylase
FT                   (proa) (proline activase); atp-dependen valine adenylase
FT                   (vala) (valine activase); atp-dependent ornithin adenylase
FT                   (orna) (ornithine activase); atp-dependent leucine adenylas
FT                   (leua) (leucine activase)]"
FT                   /note="similar to antibiotic synthetase - gramicidin s
FT                   synthetase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00455"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82548"
FT                   /db_xref="GOA:C7BJ44"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ44"
FT                   /inference="similar to DNA sequence:INSD:AF004835"
FT                   /inference="similar to DNA sequence:INSD:D00938"
FT                   /protein_id="CAQ82548.1"
FT                   /translation="MTVQSHFVAIVDQYPDQIAIADDNQRLTYRELDQLSNQVANFLEK
FT                   TAGVSSHPVALFMDRSLSAIIVMLGILKAGRTYLPIDTSYPKEQLEFILADSQAACMIS
FT                   DAPLALNIPCYISQQVIEHVVEIDVDRRSEASLNPAYIMYTSGSTGRPKGVIVGHEGIK
FT                   RLVINANYISCTPGDIVGHCSSIGFDASTLEIWLPLLNGGTVYVIKKEYLLDFEQLARQ
FT                   IDLGQVKTMWLTVALFNTLYLQYPKLFLSLRRLIIGGDALNISIVRDFLHSPYCHLTQF
FT                   LNGYGPTENTTFTTTFDIRQLRPEHSSVPIGKAISGTQLLIVDDNLNQVIDGDVGELLI
FT                   GGTGLALGYTSQQETEKKFLQLDGQMFYRSGDLVQRLETGDLVFVGRRDNEVKIRGLRI
FT                   NLSQIELCLTQMDDVQVAYVRPDKQLGQEGLVAYVQLVTAHPEDAATVTTHIRARLSRA
FT                   LPAYMIPNTIVIVDKVPLTRNGKVNVAALAEQYAISEPAIFAYSTPMEYEVGQIYQSVL
FT                   RPNKMQVTVDHSFFELGGNSLQIYQTVNLIQRRLKVTVSVKEFIENNTIAGLAALLESR
FT                   IIDVEQDNPAMQPITTGMRIALSPAQRRLWFIESLEHPVSPNLLTFGYQITGNLLPDVI
FT                   SHACHTIVEHNIALRCAISLYQDELCQQIVNPYANFDFIQLKTPDEWRSLFLDEAKRPF
FT                   DLAKGDVIRFRLVEIGAHDYLFFIYANHIVVDGWSISLLIEQLSNAYHLHLNGNAGEAS
FT                   REERGDYWGVTRNLLNFRHSPVFAHARDFWVQYLDGCHTENLLPVTQVAMTHELERETF
FT                   SCHNLVCDSFNVEQTRLFERFAATHNVTLFTYLLTLFSQSLAEFAAVEELLLAVPTANR
FT                   EGCSDVVGMFVNTLPIRISYDKNTDLATRLQSVSDNLKQCISHSSVYLDEIKQTLSTQK
FT                   VDANIDVLQVGIALQNTGHDSVLMLPNCDSQRLELPVLASQFSLFLHCSYDQGELIFKY
FT                   EFDSAHVQRSYVDTIAALMKRAILNTIESDQREVKPAYPAAVSALRSPAPILGTLTQRF
FT                   FNIVERFSDCTAVLEPDCQMTYRQLCRQIQVVREVFIQHGIESGCRIGVQLTSSIQYIY
FT                   SLFAILHHDCSFVPLDVSYPKERLDFILQDSGIKSVLLPTALVDGEEDVVPITSELSLK
FT                   ILGSSPIPISPDEACLLYTSGSTGVPKGVQISHQSLLRLCVEPNYLAVCPADRFLVASS
FT                   VAFDASLFEIFVPLLNGASCGIITKADVLNYPVFEQILQDMAVNTAWLTVSLFNDIYTT
FT                   QPGILEHFDNLIIGGDALNISLVRSFISGPHNKLRQFINGYGPTECTTFSTYFNILNLS
FT                   ATDNSVPIGKAINHTTVYVMDDAENICQPGQIGEIYIGGVWLKPNYHNRDELNRHQFVI
FT                   NPYCHVDGVQILYKTGDMARYKPDFNIEYIGRKDKMVKVRGHRVELNGINAVICQHPQI
FT                   KNAVVHVDESQGQKRICAYLVKSDKDADNVQVRAELNAYLTIKLEPYQCPSLFVFLDEI
FT                   PLTVNGKVDYRRLKPLPTSVKLSATLPRTPEEEFLFKTWAKVLGHEEIGIFDNFFHLGG
FT                   HSLLIPRIIAQLESNYGCSVTLSDFLANPTISTLAGKLGNKHDNGTYPTLQKSAQKLYV
FT                   ATESQLNLLFSHELAEYKALYNIPYARVFSPALEVDRVSCSIQALIELDRTLSAALVFD
FT                   DDETLCLQPHQYTCAEMKTWQVKDLDSAQLLCTELAEYQFDLLAEPLVNFHYIDIEDQD
FT                   TSVLFINIHHIIADGQSIDVIFKHIVEHYYQQTTEFPPSLDYCDYIQSMGSKCMPSQAI
FT                   EFWQERLMGYHGVATLKPSKERTCLPVPLGYQSRFNLPITYVEQLKMIAMQSQASYFEV
FT                   LCAIYQMSFQKVAAQADVVIGFPYSDRIEHGIVDRIGYFVEIVPLRCTEGSITQPYDSI
FT                   KKTVQEIRASIKHRVSSIPALSQKLGIPRYDYYSPLIQNVFSFHRGNRDEKYGKTLELT
FT                   SPYCRFDTVFTATLFDDELVLIIECSQDLYSSDMPLVLFNSFKGVLDDMISVNFYHGKH
FT                   IAEGIVTAELGTKNELTI"
FT   misc_feature    515371..516546
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   2.8e-111"
FT                   /inference="protein motif:Pfam:PF00501"
FT   misc_feature    516808..517008
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 2.8e-08"
FT                   /inference="protein motif:Pfam:PF00550"
FT   misc_feature    517063..517965
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   8.6e-23"
FT                   /inference="protein motif:Pfam:PF00668"
FT   misc_feature    518494..519687
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
FT                   5.4e-101"
FT                   /inference="protein motif:Pfam:PF00501"
FT   misc_feature    519946..520140
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.1e-15"
FT                   /inference="protein motif:Pfam:PF00550"
FT   misc_feature    520186..521061
FT                   /note="HMMPfam hit to PF00668, Condensation domain, score
FT                   1.4e-20"
FT                   /inference="protein motif:Pfam:PF00668"
FT   CDS_pept        521597..522103
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /gene_synonym="def2"
FT                   /locus_tag="PAU_00456"
FT                   /old_locus_tag="PAT2495"
FT                   /product="peptide deformylase 2"
FT                   /EC_number="3.5.1.88"
FT                   /note="post translational modification"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00456"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82549"
FT                   /db_xref="GOA:C7BJ45"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ45"
FT                   /inference="similar to DNA sequence:INSD:BA000038"
FT                   /inference="similar to DNA sequence:INSD:AE004356"
FT                   /protein_id="CAQ82549.1"
FT                   /translation="MATLEILTIPDERLRQKCVEVTNVEAIQGLIDDMLDTMYSTDNGI
FT                   GLAAPQVGRKEAVIIIDISATRDEPLILVNPKIVEKDRSVIGQEGCLSVPGYYADVERF
FT                   EKVKVEALNRHGETITVESEDFLAIVMQHEIDHLHGKIFIDYLSPLKRQMALKKIKKYK
FT                   NNKVS"
FT   misc_feature    521603..522055
FT                   /note="HMMPfam hit to PF01327, Polypeptide deformylase,
FT                   score 7.4e-62"
FT                   /inference="protein motif:Pfam:PF01327"
FT   CDS_pept        522323..523147
FT                   /transl_table=11
FT                   /gene="yjhP"
FT                   /locus_tag="PAU_00457"
FT                   /old_locus_tag="PAT2496"
FT                   /product="putative sam-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00457"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82550"
FT                   /db_xref="GOA:C7BJ46"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ46"
FT                   /inference="similar to DNA sequence:INSD:AE014613"
FT                   /inference="similar to DNA sequence:INSD:AE008911"
FT                   /protein_id="CAQ82550.1"
FT                   /translation="MNDKHLSEFLVEDSLQDKYAMDFGDEAFSERMLYEHLSQEHDFAS
FT                   RNRAEIGTQVEFIYNQYLNANSHVLDLACGPGLYLSKLAKYGVRSRGYDISPASIRYAQ
FT                   KNASVLEEYVHCDLNQFECSEKFDLVLMLFGIANNIVDLKKLLKKVKNNLKPQGKILLE
FT                   FMSVQFMKQLANDDGSWEYFPQGGLLSSRPHYKLCKRIWQNDEKVLIDRNMVIEMTGKS
FT                   NIYEGYFKGYDIEDINCLLTELGFASATLVGQDLPRGELTSHFFFVESSLLV"
FT   misc_feature    522530..522808
FT                   /note="HMMPfam hit to PF08241, Methyltransferase domain,
FT                   score 5.9e-12"
FT                   /inference="protein motif:Pfam:PF08241"
FT   misc_feature    522530..522802
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 8.3e-14"
FT                   /inference="protein motif:Pfam:PF08242"
FT   CDS_pept        523416..523652
FT                   /transl_table=11
FT                   /locus_tag="PAU_00458"
FT                   /old_locus_tag="PAT2497"
FT                   /product="similar to transcription regulator and to
FT                   restriction enzyme control elements"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00458"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82551"
FT                   /db_xref="GOA:C7BJ47"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ47"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82551.1"
FT                   /translation="MKKPNNIKSLFGQRVRYIRMASGMSQEAFADRCGLDRTYISGIER
FT                   GVRNPTLEVINVIASGLQIELKDLFDFSSSQKI"
FT   misc_feature    523455..523622
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   4.8e-14"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    523458..523622
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.6e-15"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        complement(523745..523954)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00459"
FT                   /old_locus_tag="PAT2498"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00459"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82552"
FT                   /db_xref="GOA:C7BJ48"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ48"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /protein_id="CAQ82552.1"
FT                   /translation="MKNQDWHPADIIAELKKRGTSLAAVSRKAGLASSTLANTLQRRWP
FT                   KGQQLIADALDRDPTEIWPSRYIR"
FT   CDS_pept        524102..524338
FT                   /transl_table=11
FT                   /locus_tag="PAU_00460"
FT                   /old_locus_tag="PAT2499"
FT                   /product="similar to transcription regulator and to
FT                   restriction enzyme contro elements"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82553"
FT                   /db_xref="GOA:C7BJ49"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ49"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82553.1"
FT                   /translation="MKKPNAIKSLFGQRVRHLRQSSGMSQEAFADKCGIDRTYISGIER
FT                   GIRNPTLEVINIIASGLQIELTDLFDFSTELKN"
FT   misc_feature    524141..524308
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   1.5e-15"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    524144..524308
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   6.5e-17"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        524581..524736
FT                   /transl_table=11
FT                   /gene="pks2A"
FT                   /gene_synonym="LnmG"
FT                   /locus_tag="PAU_00461"
FT                   /old_locus_tag="PAT2500"
FT                   /product="Hypothetical protein"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82554"
FT                   /db_xref="GOA:C7BJ50"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ50"
FT                   /inference="similar to DNA sequence:INSD:AJ634061"
FT                   /inference="similar to DNA sequence:INSD:AF484556"
FT                   /protein_id="CAQ82554.1"
FT                   /translation="MAGIAEIFHDYLMGFKFATLRVSVISNVTVQPYGFADTFEKLVQQ
FT                   LTQLVR"
FT   CDS_pept        524876..525901
FT                   /transl_table=11
FT                   /locus_tag="PAU_00462"
FT                   /old_locus_tag="PAT2501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00462"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82555"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ51"
FT                   /inference="similar to DNA sequence:INSD:BX571862"
FT                   /inference="similar to AA sequence:UniProt:Q0S8A5"
FT                   /protein_id="CAQ82555.1"
FT                   /translation="MINIIKRASIPIINSVFKDGVEHMIGAVQPLAQHPQYQDFVKNQQ
FT                   PLSISFAELAPGEVHKPHQHNVASMVIITSGKATLIGDTTAFVEKGDVICIPAGDKHGF
FT                   RCDRGEILSALSIQYDADGLFSEKHANINFSASETPQQALLNFNEQCCVKAEQTLFFQM
FT                   FKDGRMNDESNLNIFKSHLRQWSEIFQYIMYARQSMVVDSRYHPLFLEHFKDELGHDEL
FT                   LPPKRGWDAQIDSYGNWFVLKMFQLDNLEKLIIVHLVLEKCADMFHLLASSQISEPGEY
FT                   IAAHSTLDHGHSALGSEFYQHISHEESLALQQLCAQAWEIMVLLLERIAVLTLNEIEQM
FT                   G"
FT   misc_feature    524957..525295
FT                   /note="HMMPfam hit to PF00190, Cupin, score 0.0049"
FT                   /inference="protein motif:Pfam:PF00190"
FT   misc_feature    525023..525229
FT                   /note="HMMPfam hit to PF07883, Cupin domain, score 6.9e-10"
FT                   /inference="protein motif:Pfam:PF07883"
FT   CDS_pept        525937..526578
FT                   /transl_table=11
FT                   /locus_tag="PAU_00463"
FT                   /old_locus_tag="PAT2502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00463"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82556"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ52"
FT                   /inference="similar to DNA sequence:INSD:AE017226"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /protein_id="CAQ82556.1"
FT                   /translation="MSKLYKGMSEEAFENGYFYVAELRQFAKSLGITPSNLKKHELELH
FT                   VRSHLFGYSGDLPVAIPNKRDRSGRDLLTLKSLVINYVSDKQTKNFLLEQVGRRYGPLP
FT                   DKSGQWYWLNHWRKMQIANDNKITYGDLVEHLASLRQQEGRLPQIPSARLNNFISDFIA
FT                   DPENKGKGKKQALKIWQALKEKNLPKTYLAYKKNKDLPDNKVEFFIDIKD"
FT   CDS_pept        complement(526646..527839)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00464"
FT                   /old_locus_tag="PAT2503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00464"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82557"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ53"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000124"
FT                   /protein_id="CAQ82557.1"
FT                   /translation="MKKQGKTTCRAFISASLLTLIAGCSHMKKTPITEENKPVLSTKLN
FT                   IHQPTALIIPVTISGKKYQFWLDTGASYTVIDNKLAKTLTQTTPESKIPVTFHRMLSEG
FT                   VTTTSGTLHKADLTLWQPLAITIGSYTVPGSDPWIGLDMNLFSQSIGQKIDGILGIDTF
FT                   RQLSWEINNLNHTLTVWRHAPSILNYQQCEPYSDSYNRSPAIQVSNVIFNIDTGASHSY
FT                   ASQEFIEYLKKEHKDRISEGINVKYASASGLDSSKEYLIDGFYLQQLPVGRLRVSENKQ
FT                   DLYSLGLNFFSRFDDYLFIPNKMLLCFNAKNFTRYDNKLFRAIMVRYFNNKIEVFYNEP
FT                   KDIEKFGLKNGDIVLEINGQKILPKDITYVRNQLSETPAGKLTIKIERNGTQQIINI"
FT   sig_peptide     complement(527759..527839)
FT                   /locus_tag="PAU_00464"
FT                   /note="Signal peptide predicted for PAT2503 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.810) with cleavage site
FT                   probability 0.786 between residues 27 and 28"
FT   CDS_pept        528392..529381
FT                   /transl_table=11
FT                   /gene="yibD"
FT                   /locus_tag="PAU_00465"
FT                   /old_locus_tag="PAT2504"
FT                   /product="similar to glycosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00465"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82558"
FT                   /db_xref="GOA:C7BJ54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ54"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82558.1"
FT                   /translation="MSISLKLSIVASVYNGERFLPQFFANLSRQNLTDFELILVDDGST
FT                   DNSNQILAKYAGKFLKTEIITQKNQGVSIARNTGLARASGDYVAFPDIDDVIYPGMYNR
FT                   LLEIARNNDLDIATCNGHYIYEDGRPARKIFPSDRLSSTAVLSGPEWLQRALNSRKFLH
FT                   VTWLNVYKRAFLTKHHYQFEPGLHHQDIPWTTELLLTASRVQYIDESFYDYLIHSSSVS
FT                   HTPADDRIKVRTAHHYMKILEMLNNINQRYPQQVKQVPACHWQIAKEGLGILHTINEIE
FT                   SSAMKRQIVHELFERGIWSMIWKNARGFRLRWRLARRYLRLRAALKAV"
FT   misc_feature    528413..528904
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase family,
FT                   score 1.4e-32"
FT                   /inference="protein motif:Pfam:PF00535"
FT   CDS_pept        complement(529404..530354)
FT                   /transl_table=11
FT                   /gene="iunH"
FT                   /gene_synonym="rihB"
FT                   /locus_tag="PAU_00466"
FT                   /old_locus_tag="PAT2505"
FT                   /product="inosine-uridine preferring nucleoside hydrolase
FT                   (iu-nucleosid hydrolase) (purine nucleosidase)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00466"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82559"
FT                   /db_xref="GOA:C7BJ55"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ55"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:U00007"
FT                   /protein_id="CAQ82559.1"
FT                   /translation="MTTKKIILDCDPGHDDAIAMLLAHGNPDIELLAVTTVVGNQTLDK
FT                   VTHNALTIAHIAGITGVPFAAGCHRPLVRNIETAPDIHGESGLDGPKLPKHTRTLDPRH
FT                   ATDLIIDTIMSHPPKTVTLVPTGGLTNIALAVRKAPQIVDRVKEVVLMGGGYHTGNRSA
FT                   VAEFNIKIDPEAAHIVFNEKWPLTMVGLDLTHQAQATPEVKETISRINSKISRFVIEML
FT                   DFYGKNYQKRRGFNYAPVHDPCAVAYVIDPTVMTTQKVPVNIELNGTLTVGMTVADFRY
FT                   PLPEDCHTQVAVKLDHQKFWQLIIDALKNISDTCN"
FT   misc_feature    complement(529419..530348)
FT                   /note="HMMPfam hit to PF01156, Inosine-uridine preferring
FT                   nucleoside hy, score 1.3e-162"
FT                   /inference="protein motif:Pfam:PF01156"
FT   CDS_pept        530618..531373
FT                   /transl_table=11
FT                   /locus_tag="PAU_00467"
FT                   /old_locus_tag="PAT2506"
FT                   /product="similar to luxr family transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00467"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82560"
FT                   /db_xref="GOA:C7BJ56"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ56"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000076"
FT                   /protein_id="CAQ82560.1"
FT                   /translation="MDIHMDRLSMVIESVATREFYPNLLTWLKQFIAFDNAIVYAFGQG
FT                   VPPRCLTKAEKKNSDVVNQLYQQGAYLQDPFYQALTNGAETDLFTLRELAPVGFYHTDY
FT                   YLNFYSKTGWQDEAGVLLKLSPQRQLGLFFGNENRLLLIQKQHKKSLRTVLEIIRSVAR
FT                   LHDEMMLQAPAAEMVCLDTQIRYALTPRECEIVELILQGKGSPQIAEKLFISTGTVKNH
FT                   RKNIYQKLQIRSQAELFNLFMTPTARYFA"
FT   misc_feature    531170..531343
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 3.5e-22"
FT                   /note="HMMSmart hit to SM00421, no description, score
FT                   5.5e-22"
FT                   /inference="protein motif:Pfam:PF00196"
FT                   /inference="protein motif:Smart:SM00421"
FT   CDS_pept        531470..532786
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="PAU_00468"
FT                   /old_locus_tag="PAT2507"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00468"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82561"
FT                   /db_xref="GOA:C7BJ57"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ57"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82561.1"
FT                   /translation="MGYHMNNGVDSLTYYAATKKYDLRFPTLREDLDVDVVIIGGGFSG
FT                   INTALELAEKGITNIAILEGRYLGYGSTGRNGGQVMAGIGHDLEVIKRHIGNKGLETIF
FT                   KISNLGAGIIRDRIAKYNIDADLCRGYSYLGMNNRQEKTLRSWLKDFQAVSPDEDIELY
FT                   TGSDVKKVIGSDAYTCALKHMGAGHVHSLNLLLGEAKAATDFGVKIFENSQVLNVEYGS
FT                   RVTVRTAMGSVRASKMLWACNAFLNSGLEPYIYKKVVNTYAFQLMTEKLSDDLIEKVSP
FT                   IRGAYSDIRPVIDYFRVTKENRLLFGSATPFIEHIPSDLKAWNRHLMLKVFPYLKDVKV
FT                   ELAWGGPLCCSANLFPQIGSLPQHNNVFFVQGYSGFGVTPSHIVCKVLAEGMSEGSERY
FT                   DLMSSIPHVNIFGKDKLRHLMVSAGKIWHQTSGYWKGRR"
FT   misc_feature    531572..532642
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.2e-79"
FT                   /inference="protein motif:Pfam:PF01266"
FT   CDS_pept        532976..533344
FT                   /transl_table=11
FT                   /locus_tag="PAU_00469"
FT                   /old_locus_tag="PAT2508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00469"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82562"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ58"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE008843"
FT                   /protein_id="CAQ82562.1"
FT                   /translation="MIKSLLLNKPLPELLDIGSVSNLGSIVLEGDPQASVAMVFGEPTD
FT                   NLTCGIFACTRGKFSMVYPFDEHATVSEGSVKLTDVKSGETVEYHPGDSWFAAKGTEVL
FT                   WEVTTDRFVKHYLACIKS"
FT   misc_feature    533096..533323
FT                   /note="HMMPfam hit to PF05899, Protein of unknown function
FT                   (DUF861), score 2.9e-21"
FT                   /inference="protein motif:Pfam:PF05899"
FT   CDS_pept        533373..534866
FT                   /transl_table=11
FT                   /gene="feaB"
FT                   /locus_tag="PAU_00470"
FT                   /old_locus_tag="PAT2509"
FT                   /product="phenylacetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82563"
FT                   /db_xref="GOA:C7BJ59"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ59"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:D23670"
FT                   /protein_id="CAQ82563.1"
FT                   /translation="MSDITLLQQVTAFLQRNHGHYINGQSVHGQENQTFSVVNPAVDEV
FT                   IATVNQGGETEVNAAMQAAHTAFHGVWAQTSPMERGHCLNRLADLLLAHREELAQLESL
FT                   CSGKTIQLSRMLEIDSSAQFLRYFAGWSSKISGETLNVSLPSFKGEQYTAFTRREPIGV
FT                   VVGIIPWNFSIMVAIWKMAAALTCGCTIVLKPSEYTPLTMLRVAELAKEAGIPDGVINV
FT                   INGSGSVLGPALIGHPLCAKVTFTGSVPTGITVGKSAMEQGLTRATLELGGKNGAAFLA
FT                   DMPVEKIVDGVLEAGYLNQGQICAAAERFYIPASHMDEVLKLLSERLAAMKMGSPLDES
FT                   TEMGPLANKEHYNKILSLFEQARQEGSEIVYGGHALTGPGFFVAPTVIRANSAEDSLMK
FT                   EETFGPVGTFFSYNDEEELIELMNSTPFGLAASLWTNDLSKAMRMIPRIEAGTVWVNMH
FT                   TFLDPALPFGGVKSSGIGREFGSAFIEHYTELKSVMVRY"
FT   misc_feature    533433..534851
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 7e-206"
FT                   /inference="protein motif:Pfam:PF00171"
FT   CDS_pept        535373..535714
FT                   /transl_table=11
FT                   /locus_tag="PAU_00471"
FT                   /old_locus_tag="PAT2510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82564"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ60"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AJ627388"
FT                   /protein_id="CAQ82564.1"
FT                   /translation="MDTCPRCRFTEGSITLPAGYQEQTVNIIIAPDAPALNISRDQLVE
FT                   GEDLARYLTRQKDLLKKGLRDWQLLAEQPATLGDNLLPGMILHSRYRPKKGQQVCQYQA
FT                   VFLLDEKKH"
FT   CDS_pept        535807..535998
FT                   /transl_table=11
FT                   /gene="api89"
FT                   /locus_tag="PAU_00472"
FT                   /old_locus_tag="PAT2511"
FT                   /product="putative membrane-bound sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00472"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82565"
FT                   /db_xref="GOA:C7BJ61"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ61"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AJ627388"
FT                   /protein_id="CAQ82565.1"
FT                   /translation="MPEAARVGDTIGHSSAMAGLIAGTVIGSLISAAGGILSGALFIAG
FT                   LAASCIGVGVLLIGAAIH"
FT   misc_feature    order(535849..535917,535924..535992)
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2511 by TMHMM2.0 at aa 15-37 and 40-62"
FT   CDS_pept        536043..536333
FT                   /transl_table=11
FT                   /locus_tag="PAU_00473"
FT                   /old_locus_tag="PAT2512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00473"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82566"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ62"
FT                   /inference="similar to DNA sequence:INSD:AY681274"
FT                   /inference="similar to DNA sequence:INSD:AE002098"
FT                   /protein_id="CAQ82566.1"
FT                   /translation="MTWIDPWGWSFLEIVGDAAQTTGKKFQGAEIYKFTGKVKVEGVAF
FT                   KKNDYFYLDNLHKDHYETFSSLDKSKGVFNLDGSYNEKKSIKAAKRKGPGC"
FT   CDS_pept        536335..536667
FT                   /transl_table=11
FT                   /locus_tag="PAU_00474"
FT                   /old_locus_tag="PAT2513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00474"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82567"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ63"
FT                   /inference="similar to DNA sequence:INSD:AF472530"
FT                   /inference="similar to DNA sequence:INSD:CP000302"
FT                   /protein_id="CAQ82567.1"
FT                   /translation="MNENIKLRLLENKDDLIEGTFCYSLFEESIFYPNLMTEFIEIAEI
FT                   FLSYDNDLEIKKLLKWVIGCVEQCFLSHHDENDYYHIKNYSIDIESKWKNIWKPKLDYL
FT                   LDINGS"
FT   CDS_pept        complement(537103..537762)
FT                   /transl_table=11
FT                   /gene="moaR"
FT                   /locus_tag="PAU_00475"
FT                   /old_locus_tag="PAT2514"
FT                   /product="similar to monoamine regulon transcriptional
FT                   regulator moar"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00475"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82568"
FT                   /db_xref="GOA:C7BJ64"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ64"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:D15072"
FT                   /protein_id="CAQ82568.1"
FT                   /translation="MSTLPSTSRENTLIYSCLNTIAHLVPISAAAFYLVNDKLRPENYI
FT                   LYGISDETHKNYLTHFQHLDPLKPVNFQQNDINMVGMDQSTLTKHNKYYYEFMLPNNIQ
FT                   DIAEIFIRQHSRIIAGVSLLRNTLFTPKDFNRLSTILPLIELATRDLLPETPTILTAKE
FT                   QEIINLVRAGSSNKRIAQVLNISLSTVKTHLRNIFIKTKVTNRTELVSSGFITRHL"
FT   misc_feature    complement(537124..537297)
FT                   /note="HMMSmart hit to SM00421, no description, score
FT                   3.5e-17"
FT                   /inference="protein motif:Smart:SM00421"
FT   misc_feature    complement(537160..537318)
FT                   /note="HMMPfam hit to PF08281, Sigma-70, region, score
FT                   0.0025"
FT                   /inference="protein motif:Pfam:PF08281"
FT   misc_feature    complement(537658..537726)
FT                   /note="1 probable transmembrane helix predicted for PAT2514
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        538205..539701
FT                   /transl_table=11
FT                   /locus_tag="PAU_00476"
FT                   /old_locus_tag="PAT2515"
FT                   /product="putative amino acid transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00476"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82569"
FT                   /db_xref="GOA:C7BJ65"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJ65"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE008843"
FT                   /protein_id="CAQ82569.1"
FT                   /translation="MMNMSTRLTSHIEKGVVGFPTTLASSVGVIMASPVILTVTSGFGI
FT                   GGDTFVLAMLISFIMMQAQVTTFSEAAAILPTSGSVYDYISCGMGRFWAITGALSAYLI
FT                   VHIFAGTAETILSGIMALVNFDSLNTVMESNNTSWMVGVGLVITFGLLNALGIEAFSKV
FT                   EIVLTFCMWSTLVIFSICGLLMPFSVPLESWFGEGLNLSDPLGVLSLVGMAMFMFVGCE
FT                   LVTPMAPEIKNSAKVIPRAMMTGLCGVAFCMGLYGASISHQVENVLVDVENNVRLLETP
FT                   MAIPAFAGQVMGDFGKYWIGIGLLLAGAATINTLMAAVPRILYGMALDGALPRIFAYLH
FT                   PRFKTPIFGILVAVMIPCLHAFIIQGDLNRIMPLVLAAVCAWCVAYLLVTCSVILLRIR
FT                   RPDLHRAYKSPFFPLPQIISSVGIILAIIHITPPGMNPGDVYIPFAIMLGLTASYALFW
FT                   TLCVQRVNPFKPVPVEQVLSHTFTKGELSEAQLEPLRSLN"
FT   sig_peptide     538205..538300
FT                   /locus_tag="PAU_00476"
FT                   /note="Signal peptide predicted for PAT2515 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.654) with cleavage site
FT                   probability 0.518 between residues 32 and 33"
FT   misc_feature    order(538247..538315,538334..538393,538421..538489,
FT                   538508..538576,538619..538687,538706..538774,
FT                   538817..538876,538913..538981,539108..539176,
FT                   539237..539296,539324..539392,539429..539494,
FT                   539522..539590)
FT                   /note="13 probable transmembrane helices predicted for
FT                   PAT2515 by TMHMM2.0 at aa 15-37, 44-63, 73-95, 102-124,
FT                   139-161, 168-190, 205-224, 237-259, 302-324, 345-364,
FT                   374-396, 409-430 and 440-462"
FT   misc_feature    538253..539605
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   1.6e-06"
FT                   /inference="protein motif:Pfam:PF00324"
FT   CDS_pept        539718..540296
FT                   /transl_table=11
FT                   /locus_tag="PAU_00477"
FT                   /old_locus_tag="PAT2515A"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00477"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82570"
FT                   /db_xref="InterPro:IPR021500"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJQ4"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000826"
FT                   /protein_id="CAQ82570.1"
FT                   /translation="MNKPRHPSGYQAGMTLNWLQQNLSPYCCERLSAESLQIMLPDGLQ
FT                   IEVYEKPKALFLAYIVSCCFRLQGITSLKEKIVIKAKVKGIFRRKAVIYYCCHGAEFGQ
FT                   PIIDLLNQYPLIGETLVELDFRYLTLSIYQGQWQLEVEHFAASEVVSRLPASRRYLRLS
FT                   PEQRHLLLSTLLMFSQLIGKLDEKNVKYA"
FT   CDS_pept        540859..542304
FT                   /transl_table=11
FT                   /locus_tag="PAU_00478"
FT                   /old_locus_tag="PAT2516"
FT                   /product="similar to 4-hydroxyphenylacetate
FT                   3-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00478"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82571"
FT                   /db_xref="GOA:C7BJQ5"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJQ5"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000152"
FT                   /protein_id="CAQ82571.1"
FT                   /translation="MSRTGEEYIESLRDGRTIFLNGEKITNHVDHPAFRNAIRTVASLY
FT                   DYQAEHADRMTFQIPGGKHVGLSWELPDTQEKLIARGEAAYAWAMQSCGWLGRSPDHVA
FT                   SALAGMITHLEVFEEYSKDRAEALKNYYLYARDKDIYLTFTLVNPQGDRSKTPSEHVKN
FT                   VFHTLRVLEEKPQGIIVRGAKMLGTAAVLAEEVFVGVFNPLKEFVDDQYALSFALPLNT
FT                   KGIKTLSRKSYEMGSNKFDSPLSHQFDENDAVVYFDDVFVPWERVFVYKNTGMCRRQFQ
FT                   ATAADVLMDVQGMARYAVKLHFLSGLAHQLTEAIGINEFPAVRQSLAELACHATNMEGL
FT                   FRGLLHNPVRCNEYYIPSRLQLYACQVVLQSIYPKVMENIRKLSGGGVIMLPSNYVDFA
FT                   NPEIRGLIEKTQYSTLLEPIERVKLLKLVWDAIGSEFASRHTQYEMFYSGAHFMALSRV
FT                   YEQYDWDFAKSMSRGILDSIDMN"
FT   misc_feature    541180..542289
FT                   /note="HMMPfam hit to PF03241, 4-hydroxyphenylacetate
FT                   3-hydroxylase family, score 1.2e-93"
FT                   /inference="protein motif:Pfam:PF03241"
FT   CDS_pept        542584..544149
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="PAU_00479"
FT                   /old_locus_tag="PAT2517"
FT                   /product="similarities with enterochelin esterase fes"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00479"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82572"
FT                   /db_xref="GOA:C7BJQ6"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJQ6"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82572.1"
FT                   /translation="MKKNIEICTLMDSVNVFVSESYQIKSTENSQVVTGNFNSQGMVCI
FT                   EFDISAEHYVRGTVFGMQKLVVQKDGQQHIRTLFTNSPIDAHQSIAFTVPQAGKYRLVA
FT                   KGKAGELWQFTLSFPVYIPRDNDYGQQPESPRLKQLQIEVAAGKGTEAFWQEITCNGAP
FT                   LFEDYDSKNKRVTFLWRGAKANVFIFGAPSHEHDPMSRLAGTDVWFRSYIIPSDTLMQY
FT                   KLAPDLPLVEGAVDEQRRSILITAQADPLNKNVVPEVSEDVFNHDSLLALRPVLCDVAQ
FT                   LKQLPFQGNTKVHQFESKILGNCREISIYQPVIPMKQPAMLVLFDGVIYRKQYYIDRFF
FT                   DSLIEAGKIPPMYVVFVDSLDNVRRGQELPPNPDFAAFMANELMPWLATQGIEAPARHT
FT                   IISGSSYGGLASSWVAFNHPELFGNVLSMSGSYWWAPKGEAPEWLIREFAKAEKKPLRF
FT                   YLQAGLLEARDGLKSILHNNRHLKETLLQKGYPVESSEISSGHNYIAWCETLYYGTKSL
FT                   VARW"
FT   misc_feature    543451..544134
FT                   /note="HMMPfam hit to PF00756, Putative esterase, score
FT                   1.3e-21"
FT                   /inference="protein motif:Pfam:PF00756"
FT   CDS_pept        544255..545697
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="PAU_00480"
FT                   /old_locus_tag="PAT2518"
FT                   /product="alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82573"
FT                   /db_xref="GOA:C7BJQ7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJQ7"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82573.1"
FT                   /translation="MSQKYTKNLMAVMISALISGGSLPVLAVGDQGANQIMMEERAVKG
FT                   NITEFGGARRMTHNQTEALKAAINNNKAKNVILFIGDGMGDSEITIARNYAEGAGGFFK
FT                   GIDALPFTGQYTHYSLNKGTHKPNYVTDSAASATAWATGIKTYNGALAVDVFGKDHQTL
FT                   LELAKANGKGTGNVTTARVQDATPAALYAHVTGRDCYGPKETTKECPTNALENGGRGSI
FT                   TEQLLVARADVTLGGGAKIFTQKSVAGDRKGKTLEEQALEQGYQLVRDAKSLASINEAN
FT                   QKKPLLGLFHEGNMDIAWEGPKAVYHGNIDNPPVSCKVNSKRNPNAPTLAQMTEKAIDL
FT                   LKENKNGFFLQVESGSIDKQDHKANPCGQIGETVVLDEAVQVGLKYAREHGDTLVIVTA
FT                   DHAHSSQIIEAGVKSPGLAQALVTKDGSVMAVSYSDSEGEEQEHTGAQLRVAAYGPQAA
FT                   NVVGLTDQTDLFFTIRSAMELK"
FT   sig_peptide     544255..544335
FT                   /gene="phoA"
FT                   /locus_tag="PAU_00480"
FT                   /note="Signal peptide predicted for PAT2518 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.994 between residues 27 and 28"
FT   misc_feature    544279..544338
FT                   /note="1 probable transmembrane helix predicted for PAT2518
FT                   by TMHMM2.0 at aa 9-28"
FT   misc_feature    544453..545535
FT                   /note="HMMPfam hit to PF00245, Alkaline phosphatase, score
FT                   8.3e-118"
FT                   /inference="protein motif:Pfam:PF00245"
FT   misc_feature    544474..545694
FT                   /note="HMMSmart hit to SM00098, no description, score
FT                   2.9e-171"
FT                   /inference="protein motif:Smart:SM00098"
FT   CDS_pept        545981..546751
FT                   /transl_table=11
FT                   /gene="attM/aiiB"
FT                   /locus_tag="PAU_00481"
FT                   /old_locus_tag="PAT2519"
FT                   /product="similar to zn-dependent hydrolases and to
FT                   ahl-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82574"
FT                   /db_xref="GOA:C7BJQ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJQ8"
FT                   /inference="similar to DNA sequence:INSD:BX571866"
FT                   /inference="similar to DNA sequence:INSD:AY052389"
FT                   /protein_id="CAQ82574.1"
FT                   /translation="MLQTGSIKCKVHNIKMNQGNGANYEIPIPFFLLTHPKGHTLIDGG
FT                   NAVETATDPEGYWGTITKIYWPVMREDEGCVAQVKKLGIDPADIRYVVQSHLHLDHTGA
FT                   IGRFPNATHIVQRREYEYAYTPDWFAAGGYIRRDFDRPGLKWEFLDGERNDLFDVYGDG
FT                   ILKTVFTPGHSPGHQSLLVTLPNSGSLLLTVDAAYTLDHWEERALPGFLTSTVETVRSV
FT                   QKLRHLAERTDAIVVTGHDPDVWPTFRKAPEYYD"
FT   misc_feature    546059..546700
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 4.9e-16"
FT                   /inference="protein motif:Pfam:PF00753"
FT   CDS_pept        547488..549260
FT                   /transl_table=11
FT                   /locus_tag="PAU_00482"
FT                   /old_locus_tag="PAT2520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00482"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82575"
FT                   /db_xref="GOA:C7BJQ9"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJQ9"
FT                   /inference="similar to DNA sequence:INSD:DQ367408"
FT                   /inference="similar to AA sequence:UniProt:Q449T3"
FT                   /protein_id="CAQ82575.1"
FT                   /translation="MNIIGISANFHDSSCALISDGQLVAAASEERFSRFKNDSRLPVRA
FT                   FRYCLEEGGIDITDIDCVAYYENPYKKLSRQLASNFNFSATDGLPWLDCHKPFRDITEI
FT                   LGYEKEIKFYDHHIAHAAGSYLFSGFTDAAILTSDGVGEWETSTFGYAHGESINLFEKI
FT                   EYPNSVGLFYSTITNYLGFKVLSGEYKVMGLAPYGKPIYTDKLREMFSMENKFSFKLNM
FT                   KFFDFSQMNRMYTDAFIDLIGFPPREQESVMLQHHMDLAKSLQVVLEEILIAQVYNLRE
FT                   KVDSINLCLSGGVALNCVATHAIRRTGLFNNIFIPPAAGDSGSALGAAALAHIEIMGKR
FT                   HSDEPFTNPYLGPQFDNEKVLEMLTSMEIEALDFREDRESFEQTIVEMLTNGKVIGWFQ
FT                   GRMEFGPRALGARSIIADPRDPTMRDRLNALVKKREGFRPFAPAILEEEAASHIELSIP
FT                   TPFMLETCQVTSDLSLPAITHVDGSCRPQTVTADTNPKFHSLLKAFYNATNCPILVNTS
FT                   FNVRGEPIVCTPLDAIRCFGNSGIDVLVLEDFIIDRSMLSETFSEMAAREFSLIKPSND
FT                   LFTGQAIEAIYTFI"
FT   misc_feature    547851..548948
FT                   /note="HMMPfam hit to PF02543, Carbamoyltransferase, score
FT                   1.8e-120"
FT                   /inference="protein motif:Pfam:PF02543"
FT   CDS_pept        549357..551423
FT                   /transl_table=11
FT                   /locus_tag="PAU_00483"
FT                   /old_locus_tag="PAT2521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82576"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR0"
FT                   /inference="similar to DNA sequence:INSD:CP000360"
FT                   /inference="similar to DNA sequence:INSD:CP000252"
FT                   /protein_id="CAQ82576.1"
FT                   /translation="MEVMRLAQIYLMSEDQNNNDAKFFNNIPSCSENIDGYTAIGTWHP
FT                   AKIDGEIIFVRREQSDSIFWESSQQQLTVNKAKNVKRVCLVGESVALGMLFSPHTTPAK
FT                   TLAHLLNRYTNIEWEVIDLAKSCMNAGGLLETCKASLQLQPDYVVILAGNNWFSDVLFE
FT                   HNPPLERRRNYANVLANSGPNGIAVEYKEKLEKNTEILISRIDEISKESGTEFIFALPA
FT                   VNYADWERKTPLHWLGNGKTAEWYELYRHASQAIMSGQYVEALELGLSMIDIDGGAAAT
FT                   SNRIVANSLIALNRAEEAKPYLDAECSYALMYDLVTSFPNTPSFVKERIFQQSVGIKII
FT                   DLEYYFTKYLGTSLLDDALFFDYCHMTPEGFKVAMSSVAEWLINHGKDKQDVNWEVMAR
FT                   EAIDLNVSSYDLAVSYFYTALYNSHINRPIDEVAERRRVVKLFDKAVQHSAEILDIMEL
FT                   YVKARSCEKGAGFSLSRAGQKLLELVNSPHDFYIAQTSPGTDAQTIDAICEILNKYGRH
FT                   GHVLKEYYQKSYIDQLKYGVDLTEPQYIERASAVIRVSIDPEVNTRRSVPYFKSWWPTS
FT                   SFTLITSGNRDLNMAITSRVKKYIEESKVRILINGELLEEMAPSSEWSRRQFIIPGSLT
FT                   KPGFNTITFEWPKLAQDEEEEVLNISSRYNKGLKTEIFPVFGELFSLRVSYSE"
FT   CDS_pept        551543..551695
FT                   /transl_table=11
FT                   /locus_tag="PAU_00484"
FT                   /old_locus_tag="PAT2522"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00484"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82577"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR1"
FT                   /inference="similar to DNA sequence:INSD:AL591978"
FT                   /protein_id="CAQ82577.1"
FT                   /translation="MVMLWGYVVINVNGQRLCINLCHYHLIKEDQLGCTSYFFVYDIGN
FT                   HYHSY"
FT   CDS_pept        551704..551970
FT                   /transl_table=11
FT                   /locus_tag="PAU_00485"
FT                   /old_locus_tag="PAT2523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00485"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82578"
FT                   /db_xref="GOA:C7BJR2"
FT                   /db_xref="InterPro:IPR009885"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR2"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE009952"
FT                   /protein_id="CAQ82578.1"
FT                   /translation="MIRAKERQRSLFWQGMTSLWGVGLSSLAGMLFIIVNPGVEQFKIG
FT                   VVIAMLLTLLMLLNQRSRHFLLIPSGFAVLCALLAGVHRFGCF"
FT   misc_feature    order(551737..551805,551833..551877,551896..551964)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PAT2523 by TMHMM2.0 at aa 12-34, 44-58 and 65-87"
FT   tRNA            complement(552026..552109)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:552073..552075,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAG, Cove score55.24"
FT   tRNA            complement(552161..552244)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:552208..552210,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAG, Cove score57.06"
FT   CDS_pept        complement(552562..553587)
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /gene_synonym="yjjT"
FT                   /locus_tag="PAU_00487"
FT                   /old_locus_tag="PAT2525"
FT                   /product="ribosomal rna small subunit methyltransferase c
FT                   (rrna (guanine-n2-) methyltransferase) (16s rrna m2g1207
FT                   methyltransferase)"
FT                   /EC_number="2.1.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00487"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82579"
FT                   /db_xref="GOA:C7BJR3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR3"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82579.1"
FT                   /translation="MSALTPASEVILRHREQFCSHHLLFAGDIQDTLATQIDAASVRVH
FT                   TNQYHHWQSLIRTLGDNAWFGLVAEKAFTQGCDTLIYYWPKSKQEARFQLRSLFSVLPK
FT                   GINIFIVGENRSGVRSVDKLMDGMATFQKIDSARRCSLFYGQLEHEVLFEQDNWWNSYQ
FT                   VENTIVNTLPGVFSQNELDVGSRLLLSTFDKPLSGNLLDIACGAGVLAAVLGKKNPELA
FT                   LTLSDVNSAAIASSKATLKANKLEGKVVVSNVYSNIEDKFDWIISNPPFHEGLRTSLLA
FT                   ADDLIRQAPSYLKPGGKLRIVANAFLPYPDLLDKTFGTHEVIAQTGKFKVYQAIKAIKR
FT                   S"
FT   misc_feature    complement(552589..553092)
FT                   /note="HMMPfam hit to PF05175, Methyltransferase small
FT                   domain, score 1.6e-92"
FT                   /inference="protein motif:Pfam:PF05175"
FT   misc_feature    complement(552691..552987)
FT                   /note="HMMPfam hit to PF08242, Methyltransferase domain,
FT                   score 1.2e-06"
FT                   /inference="protein motif:Pfam:PF08242"
FT   misc_feature    complement(553102..553566)
FT                   /note="HMMPfam hit to PF08468, Methyltransferase small
FT                   domain N-term, score 2.6e-89"
FT                   /inference="protein motif:Pfam:PF08468"
FT   CDS_pept        553716..554129
FT                   /transl_table=11
FT                   /gene="holD"
FT                   /locus_tag="PAU_00488"
FT                   /old_locus_tag="PAT2526"
FT                   /product="DNA polymerase III, Psi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00488"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82580"
FT                   /db_xref="GOA:C7BJR4"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR4"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82580.1"
FT                   /translation="MVTRRDRLLAQLGITQWTLRNPAVLQGELAVHLPDATRLLIITND
FT                   HIDLTNSLLIDIFTAMGLNKSSVYCITSDNVTMLPEQVKCPCWLLGVDITLSWQGISLR
FT                   SPALNDLYCDGQAKRSLWQQISQYEQHFSINSR"
FT   misc_feature    553722..554027
FT                   /note="HMMPfam hit to PF03603, DNA polymerase III psi
FT                   subunit, score 1.2e-22"
FT                   /inference="protein motif:Pfam:PF03603"
FT   CDS_pept        554098..554565
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="PAU_00489"
FT                   /old_locus_tag="PAT2527"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00489"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82581"
FT                   /db_xref="GOA:C7BJR5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR5"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82581.1"
FT                   /translation="MNNISLLTPADLPSAFLVEKASHAFPWNEKTFFSNQGERYLNYKI
FT                   EINEQLIGFAIVQLVLDEATLFNIAVHPDYQGKGYGKALLEYLISVLPGKGMNTLWLEV
FT                   RRSNHSAIRLYEQLGFNQVSVRKNYYPTATGKEDAIIMALPLFSDWCNEID"
FT   misc_feature    554224..554460
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 2.1e-24"
FT                   /inference="protein motif:Pfam:PF00583"
FT   CDS_pept        554700..556289
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="PAU_00490"
FT                   /old_locus_tag="PAT2528"
FT                   /product="peptide chain release factor 3 (rf-3)"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82582"
FT                   /db_xref="GOA:C7BJR6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR6"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82582.1"
FT                   /translation="MSNSPFQQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQKAGT
FT                   VKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYQDCLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELMDEVENELN
FT                   IACCPITWPIGCGKSFKGVYHLYLDETYLYQTGQGHTIQEVRAIKGLNNPELEVAIGED
FT                   LAEQLRQELELVQGASHEFDHQAFLQGELTPVFFGTALGNFGVNHMLDGLVKWAPAPMP
FT                   RQTDVRAVSAQEDKFTGFIFKIQANMDPKHRDRVAFLRVVSGKYEKGMKLHQVRIKKDV
FT                   VISDALTFMAGDRSHVDHAYPGDIIGLHNHGTIQIGDTFTQGEDLKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLMNNDLIVGAVGVLQFDVVVARLKSEYN
FT                   VEALYEPVNVSTARWVECHDAKKLEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLTGER
FT                   YPDVNFRKTREH"
FT   misc_feature    554730..555539
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 5.5e-59"
FT                   /inference="protein motif:Pfam:PF00009"
FT   misc_feature    555636..555839
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 1.2e-09"
FT                   /inference="protein motif:Pfam:PF03144"
FT   CDS_pept        556605..556982
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="PAU_00491"
FT                   /old_locus_tag="PAT2529"
FT                   /product="osmotically inducible protein y precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82583"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR7"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82583.1"
FT                   /translation="MKNVKLTHSLMAVVLGTALVSGNVLAEESFKNKATQAFDSAGQKI
FT                   DDSMKSVDGYVGDSATTAKIKSELLAERGISSNDISVKTEKGVVYISGFVKSEEQSRKI
FT                   LAVIAKMKGVKSIQNGLTIKK"
FT   sig_peptide     556605..556682
FT                   /gene="osmY"
FT                   /locus_tag="PAU_00491"
FT                   /note="Signal peptide predicted for PAT2529 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 26 and 27"
FT   misc_feature    556788..556979
FT                   /note="HMMPfam hit to PF04972, Putative
FT                   phospholipid-binding domain, score 5e-13"
FT                   /note="HMMSmart hit to SM00749, no description, score
FT                   1e-07"
FT                   /inference="protein motif:Pfam:PF04972"
FT                   /inference="protein motif:Smart:SM00749"
FT   CDS_pept        557164..558231
FT                   /transl_table=11
FT                   /gene="yjjU"
FT                   /locus_tag="PAU_00492"
FT                   /old_locus_tag="PAT2530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00492"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82584"
FT                   /db_xref="GOA:C7BJR8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR8"
FT                   /inference="similar to DNA sequence:INSD:BX571873"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82584.1"
FT                   /translation="MGKRIPITLGNIDLLSYKYKSPVKFGKIALVCEGGGQRGIFTAGV
FT                   LDEFMRVEFNPFDLLLGTSAGAQNLSAYICGQRGYARRAISRYTTNPAFFNPLRFVRGG
FT                   HLVDLDWFVDTASKELPLDIPAALRKFEAGCEFYMCACRADNFEPTYFHPDEKNWLQVI
FT                   KASSAIPGFYRNGVTINGVVYYDGGISDAIPVEEAYRRGADTIVVIRTVPSQLYYTPDW
FT                   VKRMEHWLGDSSLQKMVRMLQQHAKSYYRTQKFIENPPDDVQIFEIYPPAPLAASALGS
FT                   RLPALNKDYHLGRRCGRYFLATVGHAFVDNKFGIAERKNYNLNRNFLHQSVKSGDSVKP
FT                   SATLVESPEQQINNG"
FT   misc_feature    557251..557760
FT                   /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
FT                   score 7e-24"
FT                   /inference="protein motif:Pfam:PF01734"
FT   CDS_pept        558236..559009
FT                   /transl_table=11
FT                   /gene="yjjV"
FT                   /locus_tag="PAU_00493"
FT                   /old_locus_tag="PAT2531"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82585"
FT                   /db_xref="GOA:C7BJR9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJR9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82585.1"
FT                   /translation="MFIDTHCHFDFPPFCDDERQSLQQAAQVGVDKIIVPAVSGQNLQR
FT                   VFELARNYSEIYAGLGLHPLYINEHQESHLADLERLLKQKNEKLVAVGEIGLDLYMAEP
FT                   QFAVQERLLCAQLRLAKQYELPVMLHSRKSHDQLAAILRKINLPRTGVVHGFAGSLSQA
FT                   EAFVGLGYYIGVGGTITYERAQKTRHVVAELPLTSLVLETDAPDMPLSGFQGEPNRPER
FT                   IAGVFTSLCELRRESPDEIARQLYNNGMELFGLNC"
FT   misc_feature    558236..558997
FT                   /note="HMMPfam hit to PF01026, TatD related DNase, score
FT                   1.6e-93"
FT                   /inference="protein motif:Pfam:PF01026"
FT   CDS_pept        559299..560576
FT                   /transl_table=11
FT                   /gene="yeiM"
FT                   /locus_tag="PAU_00494"
FT                   /old_locus_tag="PAT2532"
FT                   /product="similar to hypothetical transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00494"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82586"
FT                   /db_xref="GOA:C7BJS0"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82586.1"
FT                   /translation="MQLFMSLVGMVVLILIAVLFSSNYRAIKLRTVLGAFLIQIAIGAF
FT                   VLYVPAGKKILVGMSEGVSSVIQYGQKGMDFIFGGLVSPRMLELFGGDGFVFALRVLPI
FT                   IVFFSSLIAVLYYIGLMQLVIKILGGGLQKVLGTSRTESLSATANIFVGQTEAPLVVRP
FT                   YIATMTQSELFAVMCGGLASVAGSVLAGYASMGVSLDYLIAASFMAAPGGLLFAKLIVP
FT                   ETEKTCDTVDAMSLVAEEDRPANIIDAAASGAAAGMQLALNVGAMLLAFVALIALVNGI
FT                   LGGIGAWWDYPQLSLELVLGWICAPIAYLIGVPWDEATVAGSFIGQKLVVNEFVAFMNF
FT                   GAYLKPDDVVAASGLQVLSGHTKAIISFALCGFANLSSVAILLGGLGGMAPSRRGDVAR
FT                   MGMKAVIAGTLSNLMSATIAGFFLAL"
FT   misc_feature    559299..559544
FT                   /note="HMMPfam hit to PF01773, Na+ dependent nucleoside
FT                   transporter N, score 1.3e-30"
FT                   /inference="protein motif:Pfam:PF01773"
FT   sig_peptide     559299..559376
FT                   /gene="yeiM"
FT                   /locus_tag="PAU_00494"
FT                   /note="Signal peptide predicted for PAT2532 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.907) with cleavage site
FT                   probability 0.400 between residues 26 and 27"
FT   misc_feature    order(559308..559364,559383..559451,559584..559652,
FT                   559815..559883,559893..559961,560094..560162,
FT                   560190..560243,560262..560330,560388..560456,
FT                   560511..560570)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PAT2532 by TMHMM2.0 at aa 4-22, 29-51, 96-118, 173-195,
FT                   199-221, 266-288, 298-315, 322-344, 364-386 and 405-424"
FT   misc_feature    559590..559898
FT                   /note="HMMPfam hit to PF07670, Nucleoside recognition,
FT                   score 1.3e-18"
FT                   /inference="protein motif:Pfam:PF07670"
FT   misc_feature    559902..560567
FT                   /note="HMMPfam hit to PF07662, Na+ dependent nucleoside
FT                   transporter C, score 4.5e-106"
FT                   /inference="protein motif:Pfam:PF07662"
FT   CDS_pept        complement(560677..560907)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00495"
FT                   /old_locus_tag="PAT2533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00495"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82587"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS1"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000124"
FT                   /protein_id="CAQ82587.1"
FT                   /translation="MVKQWRTLMSKAVILLGDTTDHSGKVITAIDQYTYNGISIAGKGD
FT                   QVECSRCKGVFPIIEGTHTLQYLMKLTSSPP"
FT   CDS_pept        complement(560929..561651)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00496"
FT                   /old_locus_tag="PAT2534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00496"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82588"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS2"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82588.1"
FT                   /translation="MAIIRIEINVRYEQQETITVNSALMDLYFITRQIDIFFEKKKTWY
FT                   LTGYSRKEALKHVVFDEQGPTEKTVSYFEKSYKKDFPSLIEDMWDGEQDEIASSISYNK
FT                   LSTRGPNWVKLELNLKIDSNQLNISRLVELVKYLVNSRDFPYIQVETNEYTLQNKQVFP
FT                   DRLSVGWMLYQPRIIDQSCLPMAEEILPIYQNDQQIGTLIITKKGIFDGENQDDIDKSN
FT                   DVEIQLLNLGLLPLITEI"
FT   CDS_pept        complement(561664..562452)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00497"
FT                   /old_locus_tag="PAT2535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00497"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82589"
FT                   /db_xref="GOA:C7BJS3"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS3"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82589.1"
FT                   /translation="MKDEGYIPLLAPVAVSAAEYVITACTGVLIAVGVMEAGKKSSVEE
FT                   DDNIIRHQKTDFVISPEITDQDRNIVWSAEAHADFWEDDDLDDGPVDASAVQTQATTKT
FT                   EECESTEKQKACEECLAIPVTSEKYRKVNRWSAITINYQRFIAKTRYDPVAQIIQEFQC
FT                   LKVTFDGWQPKRCLFLEAKARYDQFFDSKGKPKSWWKGAKSGKKQAERHQTVCNALDNM
FT                   PHVEWHFLQPISYKYFKALFIEHKNISVHYTPCSDLMITV"
FT   misc_feature    complement(562357..562425)
FT                   /note="1 probable transmembrane helix predicted for PAT2535
FT                   by TMHMM2.0 at aa 10-32"
FT   CDS_pept        complement(562646..562912)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00498"
FT                   /old_locus_tag="PAT2536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00498"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82590"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS4"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:AE016825"
FT                   /protein_id="CAQ82590.1"
FT                   /translation="MSKAVILLGDTTDHSGKVITAIDQYTYNGISIAGKGDQVECSRCK
FT                   GVFPIIEGADSLQYQGKSIALEGMQTACGARLIARQHKLTFVS"
FT   misc_feature    complement(562676..562765)
FT                   /note="HMMPfam hit to PF05488, PAAR motif, score 0.17"
FT                   /inference="protein motif:Pfam:PF05488"
FT   misc_feature    complement(562772..562861)
FT                   /note="HMMPfam hit to PF05488, PAAR motif, score 0.23"
FT                   /inference="protein motif:Pfam:PF05488"
FT   CDS_pept        complement(562959..563681)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00499"
FT                   /old_locus_tag="PAT2537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00499"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82591"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS2"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82591.1"
FT                   /translation="MAIIRIEINVRYEQQETITVNSALMDLYFITRQIDIFFEKKKTWY
FT                   LTGYSRKEALKHVVFDEQGPTEKTVSYFEKSYKKDFPSLIEDMWDGEQDEIASSISYNK
FT                   LSTRGPNWVKLELNLKIDSNQLNISRLVELVKYLVNSRDFPYIQVETNEYTLQNKQVFP
FT                   DRLSVGWMLYQPRIIDQSCLPMAEEILPIYQNDQQIGTLIITKKGIFDGENQDDIDKSN
FT                   DVEIQLLNLGLLPLITEI"
FT   CDS_pept        complement(563694..564470)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00500"
FT                   /old_locus_tag="PAT2538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82592"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS6"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82592.1"
FT                   /translation="MPIPLLVPVAVGAAEYVITACTGVLIAVGVMEAGKKSSVEEDDNI
FT                   IRHQKTDFVISPEITDQDRNIVWSAEAHADFWEDDDLDDGPVDASAVQTQATTKTEECE
FT                   STEKQKACEECLAIPVTSEKYRKVNRWSAITINYQRFIAKTRYDPVAQIIQEFQCLKVT
FT                   FDGWQPKRCLFLEAKARYDQFFDSKGKPKSWWKGAKSGKKQAERHQTVCNALDNMPHVE
FT                   WHFLQPISYKYFKALFIEHKNISVHYTPCSDLMITV"
FT   CDS_pept        complement(564551..564841)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00501"
FT                   /old_locus_tag="PAT2539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82593"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS7"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:AE016825"
FT                   /protein_id="CAQ82593.1"
FT                   /translation="MVKQWRTLMSKAVILLGDTTDHSGKVITAIDQYTYNGISIAGKGD
FT                   QVECPQCKGVFPIIEGADSLQYQGKSIALEGMQTACGARLIARQHKLTFVS"
FT   CDS_pept        complement(564863..565585)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00502"
FT                   /old_locus_tag="PAT2540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00502"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82594"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS8"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82594.1"
FT                   /translation="MAIIRLKINVRYEQQETITPHTALMDLFHTTRQIDIFFGKKKSWY
FT                   LTGYSRKQALQHIVFDEQGPTEVAIKDFEKDYKKNFPILITGIWDGEKDELSSSISYKK
FT                   MRRISPNWVWLEMNLRIDSSQFEISRLIDLIKYLASSRTSPYIQVENNGYTVKGRQVFP
FT                   DRLSVGWMLYQPRIIDQSYLPMAEDVLPVYQNDQQIGTLIITKKGIFDGENQDDIDKSN
FT                   DVEIQLLNLGLLPLITEI"
FT   CDS_pept        complement(565598..566365)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00503"
FT                   /old_locus_tag="PAT2541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00503"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82595"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS9"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82595.1"
FT                   /translation="MPIPLLVPVAAGAAEYVITACTGVLIAVGVMEAGKKSSVEEDDNI
FT                   IRHQKTDFVISPEITDQDRNIVWSAEAHADFWEDDDLDDGPVDASAVQTQTAAKTEECE
FT                   STEKQKACEECLAIPVTSEKYRKVNRWSAITINYQRFIAKTRYDPVAQIIQEFQCLKVT
FT                   FDGWQPKRCLFLEAKARYDQFFISEDEPKGWWKGINSARNQAIKHQTVCDVLKGTPHVE
FT                   WHFLQPISYAYFKVEFSEHKNISVHYTPCDNLV"
FT   CDS_pept        complement(566446..566736)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00504"
FT                   /old_locus_tag="PAT2542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00504"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82596"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT0"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000094"
FT                   /protein_id="CAQ82596.1"
FT                   /translation="MVKQWRTLMSKAVILLGDTTDHSGKVITAIDQYTYNGISIAGKGD
FT                   QVECPQCKGVFPIIEGADSLQYQGKSIALDGMQTACGARLIARQYKFTLVS"
FT   CDS_pept        complement(566758..567480)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00505"
FT                   /old_locus_tag="PAT2543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00505"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82597"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT1"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82597.1"
FT                   /translation="MAIICLKINAYYEQQETITVNTALTGLFNITRQIDIFFGQKKTWY
FT                   LTGYSRKQALQHVVFDEQGPTEVAIKDFERNYKKNFPSLITGIWDGEKDELSCGISYRK
FT                   MSSVRPNWIWLTLDLSINSNQLNIFKLIDLIKYLAISCDCPYIQVETNSYTLSQHNVFP
FT                   DRLSVGWMLYQPRIIDQSCLPMAEDVLPIYQNDQQIGTLIITKKGIFDGENQDDIDKSN
FT                   DVEIQLLNLGLLPLITEI"
FT   CDS_pept        complement(567493..568257)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00506"
FT                   /old_locus_tag="PAT2544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00506"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82598"
FT                   /db_xref="GOA:C7BJT2"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT2"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000085"
FT                   /protein_id="CAQ82598.1"
FT                   /translation="MPIPLLVPVAIGAAEYVITACTGVLIAVGVMEAGKKSSVEEDDNI
FT                   IRHRKTDFVISPEITDQDRNIVWSAEAHADFWEDDDLDDGPVDASAVQTQATTKTEECE
FT                   STEKQKACEECLAIPVTSEKYRKVNRWSAITINYQRFIAKTRYDPVAQIIQEFQCLKVT
FT                   FDGWQPKRCLFLEAKARYDQFFKGKAPKKWWRGVFSAQEQAERHQKVCDALEGTPHVEW
FT                   HFLQPISYAYFKIVFSKHKNISVHYTPCDSLV"
FT   CDS_pept        complement(568338..568604)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00507"
FT                   /old_locus_tag="PAT2545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82599"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJS4"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:AE004091"
FT                   /protein_id="CAQ82599.1"
FT                   /translation="MSKAVILLGDTTDHSGKVITAIDQYTYNGISIAGKGDQVECSRCK
FT                   GVFPIIEGADSLQYQGKSIALEGMQTACGARLIARQHKLTFVS"
FT   CDS_pept        complement(568651..569373)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00508"
FT                   /old_locus_tag="PAT2546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00508"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82600"
FT                   /db_xref="InterPro:IPR028969"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT4"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82600.1"
FT                   /translation="MTTVRIEINVRYEQHETITVDTALMDLFYITRELNTVFNQKKTWF
FT                   LQGYSRKEALKYRVFDEHGPTKMAIADFEKSYKKDFPLLIEGIWDGEKDDLSSGIRYRK
FT                   MLSARPNWVWLALNLTIDTSHLYISKLTSLIKYLSMTRDTPYIQVETNGYTRREKRVFP
FT                   DRLSVGWMLYQPRIIDQSCLPMAEEILPIYQNDQQIGTLIITKKGIFDGENQDDIDKSN
FT                   DVEIQLLNLGLLPLITEI"
FT   CDS_pept        complement(569386..570162)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00509"
FT                   /old_locus_tag="PAT2547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00509"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82601"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT5"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:CP000086"
FT                   /protein_id="CAQ82601.1"
FT                   /translation="MPIPLLAPVAVGAAEYVITACTGVLIAVGVMEAGKKSSVEEDDNI
FT                   IRHQKTDFVISPEITDQDRNIVWSAEAHADFWEDDDLDDGPVDASAVQTQATTKTEECE
FT                   STEKQKACEECLAIPVTSEKYRKVNRWSAITINYQRFIAKTRYDPVAQIIQEFQCLKVT
FT                   FDGWQSKRCLFLEAKARYDQFFNNMGNPKDWWKGDISGIKQADRQQTVCDLLNNTPHVE
FT                   WHFLQPVSYSYFKEIFINYKNISVYYTPCSELSGGV"
FT   CDS_pept        complement(570164..570505)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00510"
FT                   /old_locus_tag="PAT2548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82602"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT6"
FT                   /inference="similar to DNA sequence:INSD:CP000124"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /protein_id="CAQ82602.1"
FT                   /translation="MIKLTQGQFDKIIELEKQEFVEKMEKEILAEYANLIPCNSHLSKR
FT                   LKGAYDYLLALNFQEKNAIRAYLYLVAFNPDFQNASPIKDVFESSGQNLEQQFKDFLRI
FT                   AKNRMNRRH"
FT   CDS_pept        complement(570502..570999)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00511"
FT                   /old_locus_tag="PAT2549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82603"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT7"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to AA sequence:UniProt:Q3F557"
FT                   /protein_id="CAQ82603.1"
FT                   /translation="MILELNEKLMNYQKEHPETRLYALVNGLQYECYFQAEIKYIAGVN
FT                   NPLFRYYPDSKIAFAGPWLFDMEYGHHWHDKLSELENTYPSVSWILTPLSLDQLTRHLL
FT                   PYLNIQLPTKQTALFRFYDPRVLHRIRDVLNDEQLVEFTRGMTKWLYQHNAIYYSVSGA
FT                   ML"
FT   CDS_pept        complement(570996..573014)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00512"
FT                   /old_locus_tag="PAT2550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00512"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82604"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT8"
FT                   /inference="similar to DNA sequence:INSD:BX571874"
FT                   /inference="similar to DNA sequence:INSD:AY496066"
FT                   /protein_id="CAQ82604.1"
FT                   /translation="MLMVNDFNSERSGLIFTLTADDLPEKTFAVAEFSLQEELSQLFIL
FT                   NLTLVSKRADIDLESLLLQSVKFRVVFNGVEQRQVSGVIARAERGNTDAHQTTYFLIVR
FT                   PALWRLTLNQDSRIYHQQSIPQILNSLLQKHRVLSDSQLDSSHLTREYVTQKRESDYEF
FT                   FTRLAAEEGLSFWFEDDKLFFSDSHLGMMATPPLVYNPQIRQATEMNVINQIHLGVSMT
FT                   PQRVIYKDRNPRNPDYRLTHRADINPDIYGQETLFTIFESYGRFQKDAEAKPFVRHRQQ
FT                   EYQNQRQTGSGQSNCFQLMPGKIFEMSEHPVDAMNDRWQIITIRHYGRCPQVLQEAYGE
FT                   QGTFFSNEFSFISGYDDWRPPYYYKPLADGKEVATVVGPAEEEIYVNEDGCIRIHFHWN
FT                   RYDEADDSASCWVRFTQGWNGSGYGFMAIPRIGQEVIVSYLNGDIDRPIVTGCTYNGLN
FT                   RPPLDLPAEKTRTTFKTQTHKGEGFNELRFEDEKDREEIFIHAQKDMKTQILNDETINI
FT                   EHDQIHHIKHDAHLRVDNEYRVLANNDISVSSRKKLHVKADDALLMLGENEIHLSSGAT
FT                   LVIDAGSELTLQAAGHFIKIDAGGITSSAGINFGSGTPGIGSGWGGKLPDTLQKEIKQI
FT                   SANIPAQIPKIPNKGLCISCLLKAELEGATMVIRGQS"
FT   misc_feature    complement(571668..571904)
FT                   /note="HMMPfam hit to PF04524, Protein of unknown function,
FT                   DUF586, score 1.3e-38"
FT                   /inference="protein motif:Pfam:PF04524"
FT   CDS_pept        573699..574478
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="PAU_00513"
FT                   /old_locus_tag="PAT2551"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00513"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82605"
FT                   /db_xref="GOA:C7BJT9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023649"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJT9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82605.1"
FT                   /translation="MTDLTAAAQRALSLMDLTTLNDNDTDDKVAALCHQAKSPAGNTAA
FT                   ICIYPRFIPLARKVLREQGTPEIRIATVTNFPHGNDDIDIALAETHAAIAYGADEVDVV
FT                   FPYRALIAGNEQIGFEMVKVCKEACAEAGVLLKVIIETGELKEVSLIRKAAEISIKAGA
FT                   DFIKTSTGKVPVNATLESAEIMIQVIHDMGVGETVGFKPAGGVRTAEEAAQYLALADRI
FT                   MGDKWADARHFRFGASSLLGDLLNILGHQGQKPSSDY"
FT   misc_feature    573726..574436
FT                   /note="HMMPfam hit to PF01791, DeoC/LacD family aldolase,
FT                   score 1.8e-70"
FT                   /inference="protein motif:Pfam:PF01791"
FT   CDS_pept        574552..575877
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="PAU_00514"
FT                   /old_locus_tag="PAT2552"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00514"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82606"
FT                   /db_xref="GOA:C7BJU0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU0"
FT                   /inference="similar to DNA sequence:INSD:BX936398"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82606.1"
FT                   /translation="MLLAQEIIRKKRDGYPLNEEEIRFFINGICEDTVSEGQIAALAMS
FT                   IYFHDMTMEERVALTLAMRDSGTVLNWKNLHLNGPIVDKHSTGGVGDVTSLMLGPMIAA
FT                   CGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDERFRKIIQDVGVAIIGQTHSLAPA
FT                   DKRFYATRDITATVDSIPLITASILGKKLAEGLDALVMDVKVGSGAFMPTYEKSEQLAE
FT                   SIVSVANGAGCKATALLTDMNQVLASSAGNALEVREAVRFLTGEYRNPRLLEVTMALCV
FT                   EMLVSGNLVTGREDARNKLQSVLDNGKAAEIFGRMIAAQQGPTDFVERYDRYLPTASFS
FT                   KPVLAEQHGFITDMNTRALGMSVVSLGGGRRKVVDLIDYSVGLSNIVALGSEVSADTPL
FT                   AIIHANNENQWQEAAEAVRKAIVLGAEAKPATPMVYRQISES"
FT   misc_feature    574558..574755
FT                   /note="HMMPfam hit to PF02885, Glycosyl transferase family,
FT                   helical, score 4.8e-19"
FT                   /inference="protein motif:Pfam:PF02885"
FT   misc_feature    574783..575550
FT                   /note="HMMPfam hit to PF00591, Glycosyl transferase family,
FT                   a/b doma, score 8.9e-70"
FT                   /inference="protein motif:Pfam:PF00591"
FT   misc_feature    575599..575823
FT                   /note="HMMPfam hit to PF07831, Pyrimidine nucleoside
FT                   phosphorylase C, score 3.8e-23"
FT                   /inference="protein motif:Pfam:PF07831"
FT   CDS_pept        575945..577168
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="PAU_00515"
FT                   /old_locus_tag="PAT2553"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00515"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82607"
FT                   /db_xref="GOA:C7BJU1"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU1"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82607.1"
FT                   /translation="MKRTFIMVLDSFGIGASEDAEKFGDQGSNTLGHIAEVCARGDADV
FT                   GRKGLLHLPNLSRLGLGKAAEESCGTFPVGLDKDADIIGAYAYASELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFKDEENSFPQELLDKLVERANLPGYLGNCHSSGTVILDKLGEEHMQT
FT                   GKPIFYTSADSVFQIACHEETFGLDRLYELCEIAREELTDGGYNIGRVIARPFVGDKAG
FT                   DFQRTGNRHDLAVEPPAPTILKKLVDEKNGTVVSIGKIADIYANVGITQKVKATGIDAL
FT                   FDATLVEMEKAGDDTIVFTNFVDFDSSYGHRRDVPGYAAALELFDRRLPEMLELVKDDD
FT                   ILILTADHGCDPTWPGTDHTREHIPVLIYGPKVKPGSLGHRETFADIGQTVAKYFGLSP
FT                   MEYGKSMF"
FT   misc_feature    575951..576265
FT                   /note="HMMPfam hit to PF08342, Phosphopentomutase
FT                   N-terminal, score 7.3e-67"
FT                   /inference="protein motif:Pfam:PF08342"
FT   misc_feature    576770..577099
FT                   /note="HMMPfam hit to PF01676, Metalloenzyme superfamily,
FT                   score 1.5e-44"
FT                   /inference="protein motif:Pfam:PF01676"
FT   CDS_pept        577245..577961
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="PAU_00516"
FT                   /old_locus_tag="PAT2554"
FT                   /product="purine nucleoside phosphorylase DeoD-type"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00516"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82608"
FT                   /db_xref="GOA:C7BJU2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU2"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82608.1"
FT                   /translation="MATPHINAEIGDFADVVLMPGDPLRAKYIAETFLENVRQVNNVRG
FT                   MLGFTGTYKGRPISVMGHGMGIPSCSIYAKELIADFGVKVLIRVGSCGSVRHDIKLRDV
FT                   VIGMGACTDSKVNRIRFKDHDFAAIADFDLVRNAVDAAKAKNIKAHVGNIFSIELFYTP
FT                   DLEMYDVMEKYGILGVEMEAAGIYSVAAEYGAKALTICTVSDHIRTGEQIVAEERQTTF
FT                   NEMIEIALESVLLGDK"
FT   misc_feature    577287..577943
FT                   /note="HMMPfam hit to PF01048, Phosphorylase family, score
FT                   9.3e-110"
FT                   /inference="protein motif:Pfam:PF01048"
FT   CDS_pept        complement(578058..579212)
FT                   /transl_table=11
FT                   /locus_tag="PAU_00517"
FT                   /old_locus_tag="PAT2555"
FT                   /product="similar to cystathionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00517"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82609"
FT                   /db_xref="GOA:C7BJU3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU3"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE004091"
FT                   /protein_id="CAQ82609.1"
FT                   /translation="MTKFDTKTVHAGYTPDHTGAVMPAIYATSTYAQPAPGQHTGYEYS
FT                   RSGNPTRDSLESAIAELENGSRGYAFSSGLAASSTVLELLDKDSHLVAVDDLYGGTYRL
FT                   LEKVRRRTAGLRVTYVKADDITGLKAAIRPDTKMIWVETPTNPLLKLADLAAIAQIAQQ
FT                   HEIISVADNTFASPYIQRPLDLGFDIVVHSATKYLNGHSDVIAGLAVVGKNQELAEKLG
FT                   FLQNSVGGVLDPFSSFLVLRGMRTLALRMQRHIDSAAKIAHWLEQQPQIETVFYPGLAS
FT                   HPQHELAKRQMQGFGGMISVHLEGDDDYARRLIQELKLFTLAESLGGVESLISQPFSMT
FT                   HASIPLEKRLSSGITPQLVRISVGIEDAEDLIADLAQALEKAAQ"
FT   misc_feature    complement(578073..579200)
FT                   /note="HMMPfam hit to PF01053, Cys/Met metabolism
FT                   PLP-dependent enzy, score 1.6e-234"
FT                   /inference="protein motif:Pfam:PF01053"
FT   CDS_pept        complement(579234..580601)
FT                   /transl_table=11
FT                   /gene="mtcB"
FT                   /locus_tag="PAU_00518"
FT                   /old_locus_tag="PAT2556"
FT                   /product="similar to cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00518"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82610"
FT                   /db_xref="GOA:C7BJU4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU4"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:DQ643993"
FT                   /protein_id="CAQ82610.1"
FT                   /translation="MTTSRSVLDMIGNTPLLELTHLNTGPCQLFIKLENQNPGGSIKDR
FT                   VALSMIEQAEKQGLLQPGGTIIEATAGNTGIGLALVAALKGYKLILIVPDKMSREKVFH
FT                   LRALGTDVRLTRSDVSKGHPEYYQDYALRLAQEIPGSYYIDQFNNPANSAAHTTTTGPE
FT                   IWQQMDHNVDAVVIGVGSGGTLGGLSNYFAQVSPETEFVLADPNGSILVDYIEHGEYGE
FT                   AGSWQVEGIGEDFVPPLGDFNRVHHAYRVSDAEAFSSARDLLLKEGVLAGSSSGTLLAA
FT                   ALRYCRSQTTPKRVVTLACDSGNKYLSKMFNDYWMLEQGFQSRIPQHDLSDYITYRYQD
FT                   GATVFVSPEDTLKTAHTRMRLYEISQLPVLKDEQIVGIIDEWDLMHTVQANPLNFTLSV
FT                   SHAMTHQVQTLDKSASLQQLMATFDAGHVALIVDNGCFLGLVTRTDVLNAWRQQLN"
FT   misc_feature    complement(579249..579593)
FT                   /note="HMMPfam hit to PF00571, CBS domain pair, score
FT                   5.6e-21"
FT                   /inference="protein motif:Pfam:PF00571"
FT   misc_feature    complement(579249..579386)
FT                   /note="HMMSmart hit to SM00116, no description, score 9.4"
FT                   /inference="protein motif:Smart:SM00116"
FT   misc_feature    complement(579435..579578)
FT                   /note="HMMSmart hit to SM00116, no description, score
FT                   0.092"
FT                   /inference="protein motif:Smart:SM00116"
FT   misc_feature    complement(579696..580583)
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 3.6e-95"
FT                   /inference="protein motif:Pfam:PF00291"
FT   CDS_pept        complement(582186..582824)
FT                   /transl_table=11
FT                   /gene="smp"
FT                   /locus_tag="PAU_00519"
FT                   /old_locus_tag="PAT2557"
FT                   /product="small membrane protein smp"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00519"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82611"
FT                   /db_xref="GOA:C7BJU5"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU5"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82611.1"
FT                   /translation="MTKAKLKFRLHKTAIILICIALLVLLMQGVSYFSRSHQQAQIDQF
FT                   EELAKTLAKQVAFSLSDYMESGSKDLNNEQILANLNYLTKNSRILDASVYLQNGTQVAH
FT                   SGENVSVRDRLSLDGKKAGSYFNHQIVVPIPGKDEPKGFLRLTLDTHKLATESKQVDNT
FT                   TNLLRIMILLALAIGFILAHNLLQLAPSRWQQSPYLLTANSKSSEKEEE"
FT   misc_feature    complement(order(582267..582335,582729..582788))
FT                   /note="2 probable transmembrane helices predicted for
FT                   PAT2557 by TMHMM2.0 at aa 13-32 and 164-186"
FT   sig_peptide     complement(582711..582824)
FT                   /gene="smp"
FT                   /locus_tag="PAU_00519"
FT                   /note="Signal peptide predicted for PAT2557 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.469 between residues 38 and 39"
FT   CDS_pept        582941..583918
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="PAU_00520"
FT                   /old_locus_tag="PAT2558"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82612"
FT                   /db_xref="GOA:C7BJU6"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU6"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82612.1"
FT                   /translation="MSNNLAYRYLPEEVHKWPGLPLSLSGEEVMPLDYRAGDSGWLIYG
FT                   RGLDKQRISNFQHRLGAAIVIVSSWRIDDYQVVRIAGSLTPRIKKLADECRLDVVPLGQ
FT                   IPRLRSPGLLVMDMDSTAIQIECIDEIARLAGVGDKVAEITERAMQGELDFSESLRERV
FT                   SQLAGADADILRQVVEDLPLMPGLTSLVRKLQSFDWHVAIASGGFTYFADHLRQNLRLV
FT                   AAVANQLEVKNSKLTGKVKGPIVDAKYKAATLVRLAKKLDIPLEQTVAIGDGANDLKMI
FT                   RKAGLGIAYHAKPKVYAQSKVTIRHADLMGVLCVLSGGLKHEER"
FT   misc_feature    583271..583822
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 2.8e-25"
FT                   /inference="protein motif:Pfam:PF00702"
FT   misc_feature    583280..583888
FT                   /note="HMMPfam hit to PF08282, haloacid dehalogenase-like
FT                   hydrolase, score 0.0001"
FT                   /inference="protein motif:Pfam:PF08282"
FT   CDS_pept        583943..585325
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /gene_synonym="sms"
FT                   /locus_tag="PAU_00521"
FT                   /old_locus_tag="PAT2559"
FT                   /product="dna repair protein rada"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82613"
FT                   /db_xref="GOA:C7BJU7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU7"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE014075"
FT                   /protein_id="CAQ82613.1"
FT                   /translation="MAKAAKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLAAVPSS
FT                   RSDRFSGYAGDAGVSRVQKLSEISLEELPRFSTGFKEFDRVLGGGVVPGSAILIGGNPG
FT                   AGKSTLLLQTMCQLSVQMKTLYVTGEESLQQVAMRAYRLGLPVDNLNMLSETSIEQICL
FT                   IAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRSIAIIMVGHVTK
FT                   DGSLAGPKVLEHCIDCSVMLDGEADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREVSN
FT                   PSAIFLSRGDEVTAGSSVMVVWEGTRPLLVEIQALVDHSMMTNPRRVAVGLEQNRLAIL
FT                   LAVLHRHGGLQMSDQDVFVNVVGGVKVAETSADLALLLSLVSSFRDRPLPRDLVVFGEV
FT                   GLAGEIRPVPSGQERISEAAKHGFKRAIVPYANMPKKELPGMKVFGVKKLADALSVMDD
FT                   LD"
FT   misc_feature    584219..584680
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   1.2e-08"
FT                   /inference="protein motif:Smart:SM00382"
FT   CDS_pept        585338..586591
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="PAU_00522"
FT                   /old_locus_tag="PAT2560"
FT                   /product="transcriptional regulator nadr"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00522"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82614"
FT                   /db_xref="GOA:C7BJU8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU8"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:CP000243"
FT                   /protein_id="CAQ82614.1"
FT                   /translation="MGQFDYLKQAIKQTGCTLQQVADVSGMTKGYLSQLINNKIKSPSA
FT                   QKLASLHNYLGLQYPVQNKTVGVIFGKFYPLHTGHIYLIQRAYSQVDELHVILCHDEPR
FT                   DRELFVNSSMSQQPTVSDRLRWLLQTFKYQKNIHIHSFDEQGIEPYPHGWDVWSKGMKA
FT                   FMSNKGINPSYIYSSETQDASRYKEQLGIETVLIDPQRSFMKISGRQIRQDPFRHWEYI
FT                   PTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQY
FT                   SDYDKIALGQAQYIDFAIKYANKVTFVDTDFVTTQAFCKRYEGREHPFVQALIDEYRFD
FT                   LVILLENNTPWIADGLRSLGSDQDRKEFQQLLEYMLKNNNIEYVNVDSPDYEQRFLRCI
FT                   ELIQQLLAANPNPKRNIS"
FT   misc_feature    585353..585523
FT                   /note="HMMSmart hit to SM00530, no description, score
FT                   1.5e-05"
FT                   /inference="protein motif:Smart:SM00530"
FT   misc_feature    585356..585523
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   9.7e-08"
FT                   /inference="protein motif:Pfam:PF01381"
FT   CDS_pept        587260..588006
FT                   /transl_table=11
FT                   /locus_tag="PAU_00523"
FT                   /old_locus_tag="PAT2561"
FT                   /product="similar to abc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00523"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82615"
FT                   /db_xref="GOA:C7BJU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJU9"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to AA sequence:UniProt:Q0X7B1"
FT                   /protein_id="CAQ82615.1"
FT                   /translation="MNLNQIATIEAIDISYGFSNSKTNQKMISDITLSIFPGEFTLITG
FT                   DLGSGKSTLLAMISGLLHLDRGKILIAEHELGKLNNCELDRFHSINCGFIFQRINLSNE
FT                   LTVLDNLLLSLSCGIMTSCQESIAKATKALNIVGLKHKKDVYPKELRDSERQRVAIARA
FT                   IVNSPRYLFTDEPTCYLDKYDCQTAIDILSFIARHQRGTVVVASQDNRLIKHADRIITL
FT                   KEGKIIHDTHFTYSIMNKTMSLYEDN"
FT   misc_feature    587368..587958
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   5.8e-07"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    587371..587934
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.9e-38"
FT                   /inference="protein motif:Pfam:PF00005"
FT   CDS_pept        complement(588044..589711)
FT                   /transl_table=11
FT                   /gene="yjjK"
FT                   /locus_tag="PAU_00524"
FT                   /old_locus_tag="PAT2562"
FT                   /product="abc transporter atp-binding protein yjjk"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00524"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82616"
FT                   /db_xref="GOA:C7BJV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJV0"
FT                   /inference="similar to DNA sequence:INSD:BX571860"
FT                   /inference="similar to DNA sequence:INSD:AE005174"
FT                   /protein_id="CAQ82616.1"
FT                   /translation="MAQYVYSMHRVGKIVPPKRHILKNISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGIDKDIEGEARPQPGIKIGYLPQEPKLNLEHTVREAVEEAVSEVKHALTRL
FT                   DEVYAAYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPPWDAKIEHL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDARLAQEASTEAARRKSIEKELEWVRQNPK
FT                   GRQAKGKARLARFEELNSVEYQKRNETSELFIPPGSRLGDKVLEVENLTKSYGDRVLID
FT                   NLSFSLPKGAIVGIIGPNGAGKSTLFRMLSNQEQPDSGTITLGETVKLASVDQFRDNMD
FT                   DKKTVWEEISGGQDIMRIGNFELPSRAYVGRFNFKGVDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDIETLRALENALLEFPGCAMVISHDRWFLDRIATHIIDYQDE
FT                   GKVTFFEGNFSEYEDYKKRTLGAEALEPHRIKYKKISK"
FT   misc_feature    complement(588146..588670)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   3.1e-11"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(588158..588667)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2e-52"
FT                   /inference="protein motif:Pfam:PF00005"
FT   misc_feature    complement(589004..589621)
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   2.5e-08"
FT                   /inference="protein motif:Smart:SM00382"
FT   misc_feature    complement(589007..589618)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-58"
FT                   /inference="protein motif:Pfam:PF00005"
FT   CDS_pept        590121..590267
FT                   /transl_table=11
FT                   /locus_tag="PAU_00525"
FT                   /old_locus_tag="PAT2563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PAU_00525"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ82617"
FT                   /db_xref="GOA:C7BJV1"
FT                   /db_xref="UniProtKB/TrEMBL:C7BJV1"
FT                   /inference="similar to DNA sequence:INSD:BX571863"
FT                   /inference="similar to DNA seq