(data stored in ACNUC7421 zone)

EMBL: FM178379

ID   FM178379; SV 1; circular; genomic DNA; STD; PRO; 3325165 BP.
XX
AC   FM178379;
XX
PR   Project:PRJEA30703;
XX
DT   01-OCT-2008 (Rel. 97, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Aliivibrio salmonicida LFI1238 chromosome 1 complete genome
XX
KW   complete genome.
XX
OS   Aliivibrio salmonicida LFI1238
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Aliivibrio.
XX
RN   [1]
RP   1-3325165
RA   Hjerde E.;
RT   ;
RL   Submitted (26-JUN-2008) to the INSDC.
RL   Hjerde E., Department of Molecular Biotechnology, University of Tromso,
RL   Breivika, 9037 Tromso, NORWAY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-9-616.
RX   PUBMED; 19099551.
RA   Hjerde E., Lorentzen M.S., Holden M.T., Seeger K., Paulsen S., Bason N.,
RA   Churcher C., Harris D., Norbertczak H., Quail M.A., Sanders S.,
RA   Thurston S., Parkhill J., Willassen N.P., Thomson N.R.;
RT   "The genome sequence of the fish pathogen Aliivibrio salmonicida strain
RT   LFI1238 shows extensive evidence of gene decay";
RL   BMC Genomics 9:616-616(2008).
XX
DR   MD5; 38aa197136e75996aedba323d201450c.
DR   BioSample; SAMEA1705917.
DR   EnsemblGenomes-Gn; EBG00001214453.
DR   EnsemblGenomes-Gn; EBG00001214454.
DR   EnsemblGenomes-Gn; EBG00001214455.
DR   EnsemblGenomes-Gn; EBG00001214456.
DR   EnsemblGenomes-Gn; EBG00001214457.
DR   EnsemblGenomes-Gn; EBG00001214458.
DR   EnsemblGenomes-Gn; EBG00001214459.
DR   EnsemblGenomes-Gn; EBG00001214460.
DR   EnsemblGenomes-Gn; EBG00001214461.
DR   EnsemblGenomes-Gn; EBG00001214462.
DR   EnsemblGenomes-Gn; EBG00001214463.
DR   EnsemblGenomes-Gn; EBG00001214464.
DR   EnsemblGenomes-Gn; EBG00001214465.
DR   EnsemblGenomes-Gn; EBG00001214466.
DR   EnsemblGenomes-Gn; EBG00001214467.
DR   EnsemblGenomes-Gn; EBG00001214468.
DR   EnsemblGenomes-Gn; EBG00001214469.
DR   EnsemblGenomes-Gn; EBG00001214470.
DR   EnsemblGenomes-Gn; EBG00001214471.
DR   EnsemblGenomes-Gn; EBG00001214472.
DR   EnsemblGenomes-Gn; EBG00001214473.
DR   EnsemblGenomes-Gn; EBG00001214474.
DR   EnsemblGenomes-Gn; EBG00001214475.
DR   EnsemblGenomes-Gn; EBG00001214476.
DR   EnsemblGenomes-Gn; EBG00001214477.
DR   EnsemblGenomes-Gn; EBG00001214478.
DR   EnsemblGenomes-Gn; EBG00001214479.
DR   EnsemblGenomes-Gn; EBG00001214480.
DR   EnsemblGenomes-Gn; EBG00001214481.
DR   EnsemblGenomes-Gn; EBG00001214482.
DR   EnsemblGenomes-Gn; EBG00001214483.
DR   EnsemblGenomes-Gn; EBG00001214484.
DR   EnsemblGenomes-Gn; EBG00001214485.
DR   EnsemblGenomes-Gn; EBG00001214486.
DR   EnsemblGenomes-Gn; EBG00001214487.
DR   EnsemblGenomes-Gn; EBG00001214488.
DR   EnsemblGenomes-Gn; EBG00001214489.
DR   EnsemblGenomes-Gn; EBG00001214490.
DR   EnsemblGenomes-Gn; EBG00001214491.
DR   EnsemblGenomes-Gn; EBG00001214492.
DR   EnsemblGenomes-Gn; EBG00001214493.
DR   EnsemblGenomes-Gn; EBG00001214494.
DR   EnsemblGenomes-Gn; EBG00001214495.
DR   EnsemblGenomes-Gn; EBG00001214496.
DR   EnsemblGenomes-Gn; EBG00001214497.
DR   EnsemblGenomes-Gn; EBG00001214498.
DR   EnsemblGenomes-Gn; EBG00001214499.
DR   EnsemblGenomes-Gn; EBG00001214500.
DR   EnsemblGenomes-Gn; EBG00001214501.
DR   EnsemblGenomes-Gn; EBG00001214502.
DR   EnsemblGenomes-Gn; EBG00001214503.
DR   EnsemblGenomes-Gn; EBG00001214504.
DR   EnsemblGenomes-Gn; EBG00001214505.
DR   EnsemblGenomes-Gn; EBG00001214506.
DR   EnsemblGenomes-Gn; EBG00001214507.
DR   EnsemblGenomes-Gn; EBG00001214508.
DR   EnsemblGenomes-Gn; EBG00001214509.
DR   EnsemblGenomes-Gn; EBG00001214510.
DR   EnsemblGenomes-Gn; EBG00001214511.
DR   EnsemblGenomes-Gn; EBG00001214512.
DR   EnsemblGenomes-Gn; EBG00001214513.
DR   EnsemblGenomes-Gn; EBG00001214514.
DR   EnsemblGenomes-Gn; EBG00001214515.
DR   EnsemblGenomes-Gn; EBG00001214516.
DR   EnsemblGenomes-Gn; EBG00001214517.
DR   EnsemblGenomes-Gn; EBG00001214518.
DR   EnsemblGenomes-Gn; EBG00001214519.
DR   EnsemblGenomes-Gn; EBG00001214520.
DR   EnsemblGenomes-Gn; EBG00001214521.
DR   EnsemblGenomes-Gn; EBG00001214522.
DR   EnsemblGenomes-Gn; EBG00001214523.
DR   EnsemblGenomes-Gn; EBG00001214524.
DR   EnsemblGenomes-Gn; EBG00001214525.
DR   EnsemblGenomes-Gn; EBG00001214526.
DR   EnsemblGenomes-Gn; EBG00001214527.
DR   EnsemblGenomes-Gn; EBG00001214528.
DR   EnsemblGenomes-Gn; EBG00001214529.
DR   EnsemblGenomes-Gn; EBG00001214530.
DR   EnsemblGenomes-Gn; EBG00001214531.
DR   EnsemblGenomes-Gn; EBG00001214532.
DR   EnsemblGenomes-Gn; EBG00001214533.
DR   EnsemblGenomes-Gn; EBG00001214534.
DR   EnsemblGenomes-Gn; EBG00001214535.
DR   EnsemblGenomes-Gn; EBG00001214536.
DR   EnsemblGenomes-Gn; EBG00001214537.
DR   EnsemblGenomes-Gn; EBG00001214538.
DR   EnsemblGenomes-Gn; EBG00001214539.
DR   EnsemblGenomes-Gn; EBG00001214540.
DR   EnsemblGenomes-Gn; EBG00001214541.
DR   EnsemblGenomes-Gn; EBG00001214542.
DR   EnsemblGenomes-Gn; EBG00001214543.
DR   EnsemblGenomes-Gn; EBG00001214544.
DR   EnsemblGenomes-Gn; EBG00001214545.
DR   EnsemblGenomes-Gn; EBG00001214546.
DR   EnsemblGenomes-Gn; EBG00001214547.
DR   EnsemblGenomes-Gn; EBG00001214548.
DR   EnsemblGenomes-Gn; EBG00001214549.
DR   EnsemblGenomes-Gn; EBG00001214550.
DR   EnsemblGenomes-Gn; EBG00001214551.
DR   EnsemblGenomes-Gn; EBG00001214552.
DR   EnsemblGenomes-Gn; EBG00001214553.
DR   EnsemblGenomes-Gn; EBG00001214554.
DR   EnsemblGenomes-Gn; EBG00001214555.
DR   EnsemblGenomes-Gn; EBG00001214556.
DR   EnsemblGenomes-Gn; EBG00001214557.
DR   EnsemblGenomes-Gn; EBG00001214558.
DR   EnsemblGenomes-Gn; EBG00001214559.
DR   EnsemblGenomes-Gn; EBG00001214560.
DR   EnsemblGenomes-Gn; EBG00001214561.
DR   EnsemblGenomes-Gn; EBG00001214562.
DR   EnsemblGenomes-Gn; EBG00001214563.
DR   EnsemblGenomes-Gn; EBG00001214564.
DR   EnsemblGenomes-Gn; EBG00001214565.
DR   EnsemblGenomes-Gn; EBG00001214566.
DR   EnsemblGenomes-Gn; EBG00001214567.
DR   EnsemblGenomes-Gn; EBG00001214568.
DR   EnsemblGenomes-Gn; EBG00001214569.
DR   EnsemblGenomes-Gn; EBG00001214570.
DR   EnsemblGenomes-Gn; EBG00001214571.
DR   EnsemblGenomes-Gn; EBG00001214572.
DR   EnsemblGenomes-Gn; EBG00001214573.
DR   EnsemblGenomes-Gn; EBG00001214574.
DR   EnsemblGenomes-Gn; EBG00001214575.
DR   EnsemblGenomes-Gn; EBG00001214576.
DR   EnsemblGenomes-Gn; EBG00001214577.
DR   EnsemblGenomes-Gn; EBG00001214578.
DR   EnsemblGenomes-Gn; EBG00001214579.
DR   EnsemblGenomes-Gn; EBG00001214580.
DR   EnsemblGenomes-Gn; EBG00001214581.
DR   EnsemblGenomes-Gn; EBG00001214582.
DR   EnsemblGenomes-Gn; EBG00001214583.
DR   EnsemblGenomes-Gn; EBG00001214584.
DR   EnsemblGenomes-Gn; EBG00001214585.
DR   EnsemblGenomes-Gn; EBG00001214586.
DR   EnsemblGenomes-Gn; EBG00001214587.
DR   EnsemblGenomes-Gn; EBG00001214588.
DR   EnsemblGenomes-Gn; EBG00001214589.
DR   EnsemblGenomes-Gn; EBG00001214590.
DR   EnsemblGenomes-Gn; EBG00001214591.
DR   EnsemblGenomes-Gn; EBG00001214592.
DR   EnsemblGenomes-Gn; EBG00001214593.
DR   EnsemblGenomes-Gn; EBG00001214594.
DR   EnsemblGenomes-Gn; EBG00001214595.
DR   EnsemblGenomes-Gn; EBG00001214596.
DR   EnsemblGenomes-Gn; EBG00001214597.
DR   EnsemblGenomes-Gn; EBG00001214598.
DR   EnsemblGenomes-Gn; EBG00001214599.
DR   EnsemblGenomes-Gn; EBG00001214600.
DR   EnsemblGenomes-Gn; EBG00001214601.
DR   EnsemblGenomes-Gn; EBG00001214602.
DR   EnsemblGenomes-Gn; EBG00001214603.
DR   EnsemblGenomes-Gn; EBG00001214604.
DR   EnsemblGenomes-Gn; EBG00001214605.
DR   EnsemblGenomes-Gn; EBG00001214606.
DR   EnsemblGenomes-Gn; EBG00001214607.
DR   EnsemblGenomes-Gn; EBG00001214608.
DR   EnsemblGenomes-Gn; EBG00001214609.
DR   EnsemblGenomes-Gn; EBG00001214610.
DR   EnsemblGenomes-Gn; EBG00001214611.
DR   EnsemblGenomes-Gn; EBG00001214612.
DR   EnsemblGenomes-Gn; EBG00001214613.
DR   EnsemblGenomes-Gn; EBG00001214614.
DR   EnsemblGenomes-Gn; EBG00001214615.
DR   EnsemblGenomes-Gn; EBG00001214616.
DR   EnsemblGenomes-Gn; EBG00001214617.
DR   EnsemblGenomes-Gn; VSAL_I0013.
DR   EnsemblGenomes-Gn; VSAL_I0036.
DR   EnsemblGenomes-Gn; VSAL_I0037.
DR   EnsemblGenomes-Gn; VSAL_I0041.
DR   EnsemblGenomes-Gn; VSAL_I0055.
DR   EnsemblGenomes-Gn; VSAL_I0063.
DR   EnsemblGenomes-Gn; VSAL_I0064.
DR   EnsemblGenomes-Gn; VSAL_I0067.
DR   EnsemblGenomes-Gn; VSAL_I0068.
DR   EnsemblGenomes-Gn; VSAL_I0071.
DR   EnsemblGenomes-Gn; VSAL_I0094.
DR   EnsemblGenomes-Gn; VSAL_I0130.
DR   EnsemblGenomes-Gn; VSAL_I0145.
DR   EnsemblGenomes-Gn; VSAL_I0153.
DR   EnsemblGenomes-Gn; VSAL_I0154.
DR   EnsemblGenomes-Gn; VSAL_I0156.
DR   EnsemblGenomes-Gn; VSAL_I0166.
DR   EnsemblGenomes-Gn; VSAL_I0175.
DR   EnsemblGenomes-Gn; VSAL_I0178.
DR   EnsemblGenomes-Gn; VSAL_I0200.
DR   EnsemblGenomes-Gn; VSAL_I0202.
DR   EnsemblGenomes-Gn; VSAL_I0213.
DR   EnsemblGenomes-Gn; VSAL_I0237.
DR   EnsemblGenomes-Gn; VSAL_I0245.
DR   EnsemblGenomes-Gn; VSAL_I0248.
DR   EnsemblGenomes-Gn; VSAL_I0257.
DR   EnsemblGenomes-Gn; VSAL_I0281.
DR   EnsemblGenomes-Gn; VSAL_I0285.
DR   EnsemblGenomes-Gn; VSAL_I0314.
DR   EnsemblGenomes-Gn; VSAL_I0318.
DR   EnsemblGenomes-Gn; VSAL_I0357.
DR   EnsemblGenomes-Gn; VSAL_I0378.
DR   EnsemblGenomes-Gn; VSAL_I0395.
DR   EnsemblGenomes-Gn; VSAL_I0438.
DR   EnsemblGenomes-Gn; VSAL_I0443.
DR   EnsemblGenomes-Gn; VSAL_I0455.
DR   EnsemblGenomes-Gn; VSAL_I0460.
DR   EnsemblGenomes-Gn; VSAL_I0472.
DR   EnsemblGenomes-Gn; VSAL_I0482.
DR   EnsemblGenomes-Gn; VSAL_I0513.
DR   EnsemblGenomes-Gn; VSAL_I0514.
DR   EnsemblGenomes-Gn; VSAL_I0565.
DR   EnsemblGenomes-Gn; VSAL_I0622.
DR   EnsemblGenomes-Gn; VSAL_I0657.
DR   EnsemblGenomes-Gn; VSAL_I0673.
DR   EnsemblGenomes-Gn; VSAL_I0743.
DR   EnsemblGenomes-Gn; VSAL_I0763.
DR   EnsemblGenomes-Gn; VSAL_I0764.
DR   EnsemblGenomes-Gn; VSAL_I0765.
DR   EnsemblGenomes-Gn; VSAL_I0767.
DR   EnsemblGenomes-Gn; VSAL_I0774.
DR   EnsemblGenomes-Gn; VSAL_I0776.
DR   EnsemblGenomes-Gn; VSAL_I0808.
DR   EnsemblGenomes-Gn; VSAL_I0813.
DR   EnsemblGenomes-Gn; VSAL_I0819.
DR   EnsemblGenomes-Gn; VSAL_I0861.
DR   EnsemblGenomes-Gn; VSAL_I0863.
DR   EnsemblGenomes-Gn; VSAL_I0867.
DR   EnsemblGenomes-Gn; VSAL_I0894.
DR   EnsemblGenomes-Gn; VSAL_I0897.
DR   EnsemblGenomes-Gn; VSAL_I0902.
DR   EnsemblGenomes-Gn; VSAL_I0905.
DR   EnsemblGenomes-Gn; VSAL_I0906.
DR   EnsemblGenomes-Gn; VSAL_I0916.
DR   EnsemblGenomes-Gn; VSAL_I0918.
DR   EnsemblGenomes-Gn; VSAL_I0929.
DR   EnsemblGenomes-Gn; VSAL_I0943.
DR   EnsemblGenomes-Gn; VSAL_I0958.
DR   EnsemblGenomes-Gn; VSAL_I0964.
DR   EnsemblGenomes-Gn; VSAL_I0970.
DR   EnsemblGenomes-Gn; VSAL_I0971.
DR   EnsemblGenomes-Gn; VSAL_I1000.
DR   EnsemblGenomes-Gn; VSAL_I1002.
DR   EnsemblGenomes-Gn; VSAL_I1033.
DR   EnsemblGenomes-Gn; VSAL_I1063.
DR   EnsemblGenomes-Gn; VSAL_I1089.
DR   EnsemblGenomes-Gn; VSAL_I1104.
DR   EnsemblGenomes-Gn; VSAL_I1106.
DR   EnsemblGenomes-Gn; VSAL_I1107.
DR   EnsemblGenomes-Gn; VSAL_I1108.
DR   EnsemblGenomes-Gn; VSAL_I1111.
DR   EnsemblGenomes-Gn; VSAL_I1113.
DR   EnsemblGenomes-Gn; VSAL_I1118.
DR   EnsemblGenomes-Gn; VSAL_I1130.
DR   EnsemblGenomes-Gn; VSAL_I1148.
DR   EnsemblGenomes-Gn; VSAL_I1165.
DR   EnsemblGenomes-Gn; VSAL_I1167.
DR   EnsemblGenomes-Gn; VSAL_I1183.
DR   EnsemblGenomes-Gn; VSAL_I1208.
DR   EnsemblGenomes-Gn; VSAL_I1219.
DR   EnsemblGenomes-Gn; VSAL_I1238.
DR   EnsemblGenomes-Gn; VSAL_I1241.
DR   EnsemblGenomes-Gn; VSAL_I1258.
DR   EnsemblGenomes-Gn; VSAL_I1261.
DR   EnsemblGenomes-Gn; VSAL_I1265.
DR   EnsemblGenomes-Gn; VSAL_I1267.
DR   EnsemblGenomes-Gn; VSAL_I1268.
DR   EnsemblGenomes-Gn; VSAL_I1275.
DR   EnsemblGenomes-Gn; VSAL_I1277.
DR   EnsemblGenomes-Gn; VSAL_I1290.
DR   EnsemblGenomes-Gn; VSAL_I1315.
DR   EnsemblGenomes-Gn; VSAL_I1316.
DR   EnsemblGenomes-Gn; VSAL_I1317.
DR   EnsemblGenomes-Gn; VSAL_I1336.
DR   EnsemblGenomes-Gn; VSAL_I1338.
DR   EnsemblGenomes-Gn; VSAL_I1360.
DR   EnsemblGenomes-Gn; VSAL_I1361.
DR   EnsemblGenomes-Gn; VSAL_I1380.
DR   EnsemblGenomes-Gn; VSAL_I1402.
DR   EnsemblGenomes-Gn; VSAL_I1409.
DR   EnsemblGenomes-Gn; VSAL_I1414.
DR   EnsemblGenomes-Gn; VSAL_I1423.
DR   EnsemblGenomes-Gn; VSAL_I1429.
DR   EnsemblGenomes-Gn; VSAL_I1434.
DR   EnsemblGenomes-Gn; VSAL_I1440.
DR   EnsemblGenomes-Gn; VSAL_I1444.
DR   EnsemblGenomes-Gn; VSAL_I1458.
DR   EnsemblGenomes-Gn; VSAL_I1461.
DR   EnsemblGenomes-Gn; VSAL_I1462.
DR   EnsemblGenomes-Gn; VSAL_I1468.
DR   EnsemblGenomes-Gn; VSAL_I1474.
DR   EnsemblGenomes-Gn; VSAL_I1479.
DR   EnsemblGenomes-Gn; VSAL_I1480.
DR   EnsemblGenomes-Gn; VSAL_I1493.
DR   EnsemblGenomes-Gn; VSAL_I1496.
DR   EnsemblGenomes-Gn; VSAL_I1521.
DR   EnsemblGenomes-Gn; VSAL_I1523.
DR   EnsemblGenomes-Gn; VSAL_I1525.
DR   EnsemblGenomes-Gn; VSAL_I1546.
DR   EnsemblGenomes-Gn; VSAL_I1548.
DR   EnsemblGenomes-Gn; VSAL_I1602.
DR   EnsemblGenomes-Gn; VSAL_I1604.
DR   EnsemblGenomes-Gn; VSAL_I1629.
DR   EnsemblGenomes-Gn; VSAL_I1631.
DR   EnsemblGenomes-Gn; VSAL_I1653.
DR   EnsemblGenomes-Gn; VSAL_I1657.
DR   EnsemblGenomes-Gn; VSAL_I1661.
DR   EnsemblGenomes-Gn; VSAL_I1679.
DR   EnsemblGenomes-Gn; VSAL_I1682.
DR   EnsemblGenomes-Gn; VSAL_I1691.
DR   EnsemblGenomes-Gn; VSAL_I1702.
DR   EnsemblGenomes-Gn; VSAL_I1704.
DR   EnsemblGenomes-Gn; VSAL_I1707.
DR   EnsemblGenomes-Gn; VSAL_I1710.
DR   EnsemblGenomes-Gn; VSAL_I1716.
DR   EnsemblGenomes-Gn; VSAL_I1717.
DR   EnsemblGenomes-Gn; VSAL_I1719.
DR   EnsemblGenomes-Gn; VSAL_I1722.
DR   EnsemblGenomes-Gn; VSAL_I1734.
DR   EnsemblGenomes-Gn; VSAL_I1735.
DR   EnsemblGenomes-Gn; VSAL_I1738.
DR   EnsemblGenomes-Gn; VSAL_I1742.
DR   EnsemblGenomes-Gn; VSAL_I1744.
DR   EnsemblGenomes-Gn; VSAL_I1751.
DR   EnsemblGenomes-Gn; VSAL_I1771.
DR   EnsemblGenomes-Gn; VSAL_I1778.
DR   EnsemblGenomes-Gn; VSAL_I1791.
DR   EnsemblGenomes-Gn; VSAL_I1794.
DR   EnsemblGenomes-Gn; VSAL_I1811.
DR   EnsemblGenomes-Gn; VSAL_I1812.
DR   EnsemblGenomes-Gn; VSAL_I1818.
DR   EnsemblGenomes-Gn; VSAL_I1821.
DR   EnsemblGenomes-Gn; VSAL_I1822.
DR   EnsemblGenomes-Gn; VSAL_I1832.
DR   EnsemblGenomes-Gn; VSAL_I1833.
DR   EnsemblGenomes-Gn; VSAL_I1835.
DR   EnsemblGenomes-Gn; VSAL_I1910.
DR   EnsemblGenomes-Gn; VSAL_I1923.
DR   EnsemblGenomes-Gn; VSAL_I1926.
DR   EnsemblGenomes-Gn; VSAL_I1927.
DR   EnsemblGenomes-Gn; VSAL_I1942.
DR   EnsemblGenomes-Gn; VSAL_I1945.
DR   EnsemblGenomes-Gn; VSAL_I1947.
DR   EnsemblGenomes-Gn; VSAL_I1964.
DR   EnsemblGenomes-Gn; VSAL_I1992.
DR   EnsemblGenomes-Gn; VSAL_I1994.
DR   EnsemblGenomes-Gn; VSAL_I2008.
DR   EnsemblGenomes-Gn; VSAL_I2009.
DR   EnsemblGenomes-Gn; VSAL_I2012.
DR   EnsemblGenomes-Gn; VSAL_I2013.
DR   EnsemblGenomes-Gn; VSAL_I2014.
DR   EnsemblGenomes-Gn; VSAL_I2016.
DR   EnsemblGenomes-Gn; VSAL_I2021.
DR   EnsemblGenomes-Gn; VSAL_I2036.
DR   EnsemblGenomes-Gn; VSAL_I2045.
DR   EnsemblGenomes-Gn; VSAL_I2052.
DR   EnsemblGenomes-Gn; VSAL_I2069.
DR   EnsemblGenomes-Gn; VSAL_I2086.
DR   EnsemblGenomes-Gn; VSAL_I2089.
DR   EnsemblGenomes-Gn; VSAL_I2117.
DR   EnsemblGenomes-Gn; VSAL_I2122.
DR   EnsemblGenomes-Gn; VSAL_I2123.
DR   EnsemblGenomes-Gn; VSAL_I2160.
DR   EnsemblGenomes-Gn; VSAL_I2164.
DR   EnsemblGenomes-Gn; VSAL_I2177.
DR   EnsemblGenomes-Gn; VSAL_I2185.
DR   EnsemblGenomes-Gn; VSAL_I2256.
DR   EnsemblGenomes-Gn; VSAL_I2263.
DR   EnsemblGenomes-Gn; VSAL_I2265.
DR   EnsemblGenomes-Gn; VSAL_I2308.
DR   EnsemblGenomes-Gn; VSAL_I2316.
DR   EnsemblGenomes-Gn; VSAL_I2320.
DR   EnsemblGenomes-Gn; VSAL_I2321.
DR   EnsemblGenomes-Gn; VSAL_I2322.
DR   EnsemblGenomes-Gn; VSAL_I2352.
DR   EnsemblGenomes-Gn; VSAL_I2366.
DR   EnsemblGenomes-Gn; VSAL_I2403.
DR   EnsemblGenomes-Gn; VSAL_I2447.
DR   EnsemblGenomes-Gn; VSAL_I2459.
DR   EnsemblGenomes-Gn; VSAL_I2462.
DR   EnsemblGenomes-Gn; VSAL_I2468.
DR   EnsemblGenomes-Gn; VSAL_I2483.
DR   EnsemblGenomes-Gn; VSAL_I2487.
DR   EnsemblGenomes-Gn; VSAL_I2561.
DR   EnsemblGenomes-Gn; VSAL_I2576.
DR   EnsemblGenomes-Gn; VSAL_I2596.
DR   EnsemblGenomes-Gn; VSAL_I2601.
DR   EnsemblGenomes-Gn; VSAL_I2606.
DR   EnsemblGenomes-Gn; VSAL_I2612.
DR   EnsemblGenomes-Gn; VSAL_I2620.
DR   EnsemblGenomes-Gn; VSAL_I2621.
DR   EnsemblGenomes-Gn; VSAL_I2624.
DR   EnsemblGenomes-Gn; VSAL_I2631.
DR   EnsemblGenomes-Gn; VSAL_I2698.
DR   EnsemblGenomes-Gn; VSAL_I2720.
DR   EnsemblGenomes-Gn; VSAL_I2809.
DR   EnsemblGenomes-Gn; VSAL_I2810.
DR   EnsemblGenomes-Gn; VSAL_I2852.
DR   EnsemblGenomes-Gn; VSAL_I2855.
DR   EnsemblGenomes-Gn; VSAL_I2859.
DR   EnsemblGenomes-Gn; VSAL_I2862.
DR   EnsemblGenomes-Gn; VSAL_I2906.
DR   EnsemblGenomes-Gn; VSAL_I2933.
DR   EnsemblGenomes-Gn; VSAL_I2950.
DR   EnsemblGenomes-Gn; VSAL_I2957.
DR   EnsemblGenomes-Gn; VSAL_I2958.
DR   EnsemblGenomes-Gn; VSAL_I3007.
DR   EnsemblGenomes-Gn; VSAL_I3017.
DR   EnsemblGenomes-Gn; VSAL_I3022.
DR   EnsemblGenomes-Gn; VSAL_I3023.
DR   EnsemblGenomes-Gn; VSAL_I3034.
DR   EnsemblGenomes-Gn; VSAL_I3036.
DR   EnsemblGenomes-Gn; VSAL_I3037.
DR   EnsemblGenomes-Gn; VSAL_I3042.
DR   EnsemblGenomes-Gn; VSAL_I3052.
DR   EnsemblGenomes-Gn; VSAL_I3053.
DR   EnsemblGenomes-Gn; VSAL_I3071r.
DR   EnsemblGenomes-Gn; VSAL_I3072r.
DR   EnsemblGenomes-Gn; VSAL_I3073r.
DR   EnsemblGenomes-Gn; VSAL_I3074r.
DR   EnsemblGenomes-Gn; VSAL_I3075t.
DR   EnsemblGenomes-Gn; VSAL_I3076t.
DR   EnsemblGenomes-Gn; VSAL_I3077r.
DR   EnsemblGenomes-Gn; VSAL_I3078r.
DR   EnsemblGenomes-Gn; VSAL_I3079r.
DR   EnsemblGenomes-Gn; VSAL_I3080t.
DR   EnsemblGenomes-Gn; VSAL_I3081t.
DR   EnsemblGenomes-Gn; VSAL_I3082t.
DR   EnsemblGenomes-Gn; VSAL_I3083r.
DR   EnsemblGenomes-Gn; VSAL_I3084r.
DR   EnsemblGenomes-Gn; VSAL_I3085r.
DR   EnsemblGenomes-Gn; VSAL_I3086t.
DR   EnsemblGenomes-Gn; VSAL_I3087t.
DR   EnsemblGenomes-Gn; VSAL_I3088t.
DR   EnsemblGenomes-Gn; VSAL_I3089t.
DR   EnsemblGenomes-Gn; VSAL_I3090r.
DR   EnsemblGenomes-Gn; VSAL_I3091r.
DR   EnsemblGenomes-Gn; VSAL_I3092r.
DR   EnsemblGenomes-Gn; VSAL_I3093r.
DR   EnsemblGenomes-Gn; VSAL_I3094r.
DR   EnsemblGenomes-Gn; VSAL_I3095t.
DR   EnsemblGenomes-Gn; VSAL_I3096r.
DR   EnsemblGenomes-Gn; VSAL_I3097t.
DR   EnsemblGenomes-Gn; VSAL_I3098t.
DR   EnsemblGenomes-Gn; VSAL_I3099t.
DR   EnsemblGenomes-Gn; VSAL_I3100t.
DR   EnsemblGenomes-Gn; VSAL_I3101t.
DR   EnsemblGenomes-Gn; VSAL_I3107r.
DR   EnsemblGenomes-Gn; VSAL_I3108r.
DR   EnsemblGenomes-Gn; VSAL_I3109r.
DR   EnsemblGenomes-Gn; VSAL_I3110r.
DR   EnsemblGenomes-Gn; VSAL_I3111t.
DR   EnsemblGenomes-Gn; VSAL_I3112t.
DR   EnsemblGenomes-Gn; VSAL_I3113r.
DR   EnsemblGenomes-Gn; VSAL_I3114r.
DR   EnsemblGenomes-Gn; VSAL_I3115t.
DR   EnsemblGenomes-Gn; VSAL_I3117t.
DR   EnsemblGenomes-Gn; VSAL_I3118t.
DR   EnsemblGenomes-Gn; VSAL_I3119t.
DR   EnsemblGenomes-Gn; VSAL_I3120t.
DR   EnsemblGenomes-Gn; VSAL_I3121t.
DR   EnsemblGenomes-Gn; VSAL_I3122t.
DR   EnsemblGenomes-Gn; VSAL_I3123t.
DR   EnsemblGenomes-Gn; VSAL_I3124t.
DR   EnsemblGenomes-Gn; VSAL_I3125t.
DR   EnsemblGenomes-Gn; VSAL_I3126t.
DR   EnsemblGenomes-Gn; VSAL_I3128t.
DR   EnsemblGenomes-Gn; VSAL_I3129t.
DR   EnsemblGenomes-Gn; VSAL_I3130t.
DR   EnsemblGenomes-Gn; VSAL_I3131t.
DR   EnsemblGenomes-Gn; VSAL_I3132t.
DR   EnsemblGenomes-Gn; VSAL_I3133t.
DR   EnsemblGenomes-Gn; VSAL_I3134t.
DR   EnsemblGenomes-Gn; VSAL_I3135t.
DR   EnsemblGenomes-Gn; VSAL_I3136r.
DR   EnsemblGenomes-Gn; VSAL_I3137t.
DR   EnsemblGenomes-Gn; VSAL_I3138r.
DR   EnsemblGenomes-Gn; VSAL_I3139r.
DR   EnsemblGenomes-Gn; VSAL_I3140t.
DR   EnsemblGenomes-Gn; VSAL_I3141t.
DR   EnsemblGenomes-Gn; VSAL_I3143t.
DR   EnsemblGenomes-Gn; VSAL_I3144t.
DR   EnsemblGenomes-Gn; VSAL_I3145t.
DR   EnsemblGenomes-Gn; VSAL_I3146t.
DR   EnsemblGenomes-Gn; VSAL_I3147t.
DR   EnsemblGenomes-Gn; VSAL_I3148t.
DR   EnsemblGenomes-Gn; VSAL_I3149t.
DR   EnsemblGenomes-Gn; VSAL_I3150t.
DR   EnsemblGenomes-Gn; VSAL_I3151t.
DR   EnsemblGenomes-Gn; VSAL_I3152t.
DR   EnsemblGenomes-Gn; VSAL_I3153t.
DR   EnsemblGenomes-Gn; VSAL_I3154t.
DR   EnsemblGenomes-Gn; VSAL_I3155t.
DR   EnsemblGenomes-Gn; VSAL_I3157t.
DR   EnsemblGenomes-Gn; VSAL_I3158t.
DR   EnsemblGenomes-Gn; VSAL_I3159t.
DR   EnsemblGenomes-Gn; VSAL_I3161t.
DR   EnsemblGenomes-Gn; VSAL_I3164t.
DR   EnsemblGenomes-Gn; VSAL_I3166t.
DR   EnsemblGenomes-Gn; VSAL_I3167t.
DR   EnsemblGenomes-Gn; VSAL_I3168t.
DR   EnsemblGenomes-Gn; VSAL_I3169t.
DR   EnsemblGenomes-Gn; VSAL_I3170t.
DR   EnsemblGenomes-Gn; VSAL_I3171t.
DR   EnsemblGenomes-Gn; VSAL_I3173t.
DR   EnsemblGenomes-Gn; VSAL_I3174t.
DR   EnsemblGenomes-Gn; VSAL_I3175t.
DR   EnsemblGenomes-Gn; VSAL_I3176t.
DR   EnsemblGenomes-Gn; VSAL_I3177t.
DR   EnsemblGenomes-Gn; VSAL_I3181t.
DR   EnsemblGenomes-Gn; VSAL_I3182r.
DR   EnsemblGenomes-Gn; VSAL_I3183r.
DR   EnsemblGenomes-Gn; VSAL_I3184r.
DR   EnsemblGenomes-Gn; VSAL_I3185t.
DR   EnsemblGenomes-Gn; VSAL_I3186r.
DR   EnsemblGenomes-Gn; VSAL_I3187r.
DR   EnsemblGenomes-Gn; VSAL_I3188t.
DR   EnsemblGenomes-Gn; VSAL_I3189t.
DR   EnsemblGenomes-Gn; VSAL_I3190t.
DR   EnsemblGenomes-Gn; VSAL_I3191r.
DR   EnsemblGenomes-Gn; VSAL_I3192t.
DR   EnsemblGenomes-Gn; VSAL_I3193t.
DR   EnsemblGenomes-Gn; VSAL_I3194t.
DR   EnsemblGenomes-Gn; VSAL_I3195t.
DR   EnsemblGenomes-Gn; VSAL_I3196t.
DR   EnsemblGenomes-Gn; VSAL_I3197t.
DR   EnsemblGenomes-Gn; VSAL_I3198t.
DR   EnsemblGenomes-Gn; VSAL_I3199t.
DR   EnsemblGenomes-Gn; VSAL_I3200t.
DR   EnsemblGenomes-Gn; VSAL_I3201t.
DR   EnsemblGenomes-Gn; VSAL_I3202t.
DR   EnsemblGenomes-Gn; VSAL_I3203t.
DR   EnsemblGenomes-Gn; VSAL_I3204t.
DR   EnsemblGenomes-Gn; VSAL_I3205t.
DR   EnsemblGenomes-Gn; VSAL_I3206t.
DR   EnsemblGenomes-Gn; VSAL_I3207t.
DR   EnsemblGenomes-Gn; VSAL_I3208t.
DR   EnsemblGenomes-Gn; VSAL_I3209t.
DR   EnsemblGenomes-Gn; VSAL_I3210r.
DR   EnsemblGenomes-Gn; VSAL_I3211r.
DR   EnsemblGenomes-Gn; VSAL_I3212r.
DR   EnsemblGenomes-Gn; VSAL_I3214t.
DR   EnsemblGenomes-Tr; EBT00001783690.
DR   EnsemblGenomes-Tr; EBT00001783691.
DR   EnsemblGenomes-Tr; EBT00001783692.
DR   EnsemblGenomes-Tr; EBT00001783693.
DR   EnsemblGenomes-Tr; EBT00001783694.
DR   EnsemblGenomes-Tr; EBT00001783695.
DR   EnsemblGenomes-Tr; EBT00001783696.
DR   EnsemblGenomes-Tr; EBT00001783697.
DR   EnsemblGenomes-Tr; EBT00001783698.
DR   EnsemblGenomes-Tr; EBT00001783699.
DR   EnsemblGenomes-Tr; EBT00001783700.
DR   EnsemblGenomes-Tr; EBT00001783701.
DR   EnsemblGenomes-Tr; EBT00001783702.
DR   EnsemblGenomes-Tr; EBT00001783703.
DR   EnsemblGenomes-Tr; EBT00001783704.
DR   EnsemblGenomes-Tr; EBT00001783705.
DR   EnsemblGenomes-Tr; EBT00001783706.
DR   EnsemblGenomes-Tr; EBT00001783707.
DR   EnsemblGenomes-Tr; EBT00001783708.
DR   EnsemblGenomes-Tr; EBT00001783709.
DR   EnsemblGenomes-Tr; EBT00001783710.
DR   EnsemblGenomes-Tr; EBT00001783711.
DR   EnsemblGenomes-Tr; EBT00001783712.
DR   EnsemblGenomes-Tr; EBT00001783713.
DR   EnsemblGenomes-Tr; EBT00001783714.
DR   EnsemblGenomes-Tr; EBT00001783715.
DR   EnsemblGenomes-Tr; EBT00001783716.
DR   EnsemblGenomes-Tr; EBT00001783717.
DR   EnsemblGenomes-Tr; EBT00001783718.
DR   EnsemblGenomes-Tr; EBT00001783719.
DR   EnsemblGenomes-Tr; EBT00001783720.
DR   EnsemblGenomes-Tr; EBT00001783721.
DR   EnsemblGenomes-Tr; EBT00001783722.
DR   EnsemblGenomes-Tr; EBT00001783723.
DR   EnsemblGenomes-Tr; EBT00001783724.
DR   EnsemblGenomes-Tr; EBT00001783725.
DR   EnsemblGenomes-Tr; EBT00001783726.
DR   EnsemblGenomes-Tr; EBT00001783727.
DR   EnsemblGenomes-Tr; EBT00001783728.
DR   EnsemblGenomes-Tr; EBT00001783729.
DR   EnsemblGenomes-Tr; EBT00001783730.
DR   EnsemblGenomes-Tr; EBT00001783731.
DR   EnsemblGenomes-Tr; EBT00001783732.
DR   EnsemblGenomes-Tr; EBT00001783733.
DR   EnsemblGenomes-Tr; EBT00001783734.
DR   EnsemblGenomes-Tr; EBT00001783735.
DR   EnsemblGenomes-Tr; EBT00001783736.
DR   EnsemblGenomes-Tr; EBT00001783737.
DR   EnsemblGenomes-Tr; EBT00001783738.
DR   EnsemblGenomes-Tr; EBT00001783739.
DR   EnsemblGenomes-Tr; EBT00001783740.
DR   EnsemblGenomes-Tr; EBT00001783741.
DR   EnsemblGenomes-Tr; EBT00001783742.
DR   EnsemblGenomes-Tr; EBT00001783743.
DR   EnsemblGenomes-Tr; EBT00001783744.
DR   EnsemblGenomes-Tr; EBT00001783745.
DR   EnsemblGenomes-Tr; EBT00001783746.
DR   EnsemblGenomes-Tr; EBT00001783747.
DR   EnsemblGenomes-Tr; EBT00001783748.
DR   EnsemblGenomes-Tr; EBT00001783749.
DR   EnsemblGenomes-Tr; EBT00001783750.
DR   EnsemblGenomes-Tr; EBT00001783751.
DR   EnsemblGenomes-Tr; EBT00001783752.
DR   EnsemblGenomes-Tr; EBT00001783753.
DR   EnsemblGenomes-Tr; EBT00001783754.
DR   EnsemblGenomes-Tr; EBT00001783755.
DR   EnsemblGenomes-Tr; EBT00001783756.
DR   EnsemblGenomes-Tr; EBT00001783757.
DR   EnsemblGenomes-Tr; EBT00001783758.
DR   EnsemblGenomes-Tr; EBT00001783759.
DR   EnsemblGenomes-Tr; EBT00001783760.
DR   EnsemblGenomes-Tr; EBT00001783761.
DR   EnsemblGenomes-Tr; EBT00001783762.
DR   EnsemblGenomes-Tr; EBT00001783763.
DR   EnsemblGenomes-Tr; EBT00001783764.
DR   EnsemblGenomes-Tr; EBT00001783765.
DR   EnsemblGenomes-Tr; EBT00001783766.
DR   EnsemblGenomes-Tr; EBT00001783767.
DR   EnsemblGenomes-Tr; EBT00001783768.
DR   EnsemblGenomes-Tr; EBT00001783769.
DR   EnsemblGenomes-Tr; EBT00001783770.
DR   EnsemblGenomes-Tr; EBT00001783771.
DR   EnsemblGenomes-Tr; EBT00001783772.
DR   EnsemblGenomes-Tr; EBT00001783773.
DR   EnsemblGenomes-Tr; EBT00001783774.
DR   EnsemblGenomes-Tr; EBT00001783775.
DR   EnsemblGenomes-Tr; EBT00001783776.
DR   EnsemblGenomes-Tr; EBT00001783777.
DR   EnsemblGenomes-Tr; EBT00001783778.
DR   EnsemblGenomes-Tr; EBT00001783779.
DR   EnsemblGenomes-Tr; EBT00001783780.
DR   EnsemblGenomes-Tr; EBT00001783781.
DR   EnsemblGenomes-Tr; EBT00001783782.
DR   EnsemblGenomes-Tr; EBT00001783783.
DR   EnsemblGenomes-Tr; EBT00001783784.
DR   EnsemblGenomes-Tr; EBT00001783785.
DR   EnsemblGenomes-Tr; EBT00001783786.
DR   EnsemblGenomes-Tr; EBT00001783787.
DR   EnsemblGenomes-Tr; EBT00001783788.
DR   EnsemblGenomes-Tr; EBT00001783789.
DR   EnsemblGenomes-Tr; EBT00001783790.
DR   EnsemblGenomes-Tr; EBT00001783791.
DR   EnsemblGenomes-Tr; EBT00001783792.
DR   EnsemblGenomes-Tr; EBT00001783793.
DR   EnsemblGenomes-Tr; EBT00001783794.
DR   EnsemblGenomes-Tr; EBT00001783795.
DR   EnsemblGenomes-Tr; EBT00001783796.
DR   EnsemblGenomes-Tr; EBT00001783797.
DR   EnsemblGenomes-Tr; EBT00001783798.
DR   EnsemblGenomes-Tr; EBT00001783799.
DR   EnsemblGenomes-Tr; EBT00001783800.
DR   EnsemblGenomes-Tr; EBT00001783801.
DR   EnsemblGenomes-Tr; EBT00001783802.
DR   EnsemblGenomes-Tr; EBT00001783803.
DR   EnsemblGenomes-Tr; EBT00001783804.
DR   EnsemblGenomes-Tr; EBT00001783805.
DR   EnsemblGenomes-Tr; EBT00001783806.
DR   EnsemblGenomes-Tr; EBT00001783807.
DR   EnsemblGenomes-Tr; EBT00001783808.
DR   EnsemblGenomes-Tr; EBT00001783809.
DR   EnsemblGenomes-Tr; EBT00001783810.
DR   EnsemblGenomes-Tr; EBT00001783811.
DR   EnsemblGenomes-Tr; EBT00001783812.
DR   EnsemblGenomes-Tr; EBT00001783813.
DR   EnsemblGenomes-Tr; EBT00001783814.
DR   EnsemblGenomes-Tr; EBT00001783815.
DR   EnsemblGenomes-Tr; EBT00001783816.
DR   EnsemblGenomes-Tr; EBT00001783817.
DR   EnsemblGenomes-Tr; EBT00001783818.
DR   EnsemblGenomes-Tr; EBT00001783819.
DR   EnsemblGenomes-Tr; EBT00001783820.
DR   EnsemblGenomes-Tr; EBT00001783821.
DR   EnsemblGenomes-Tr; EBT00001783822.
DR   EnsemblGenomes-Tr; EBT00001783823.
DR   EnsemblGenomes-Tr; EBT00001783824.
DR   EnsemblGenomes-Tr; EBT00001783825.
DR   EnsemblGenomes-Tr; EBT00001783826.
DR   EnsemblGenomes-Tr; EBT00001783827.
DR   EnsemblGenomes-Tr; EBT00001783828.
DR   EnsemblGenomes-Tr; EBT00001783829.
DR   EnsemblGenomes-Tr; EBT00001783830.
DR   EnsemblGenomes-Tr; EBT00001783831.
DR   EnsemblGenomes-Tr; EBT00001783832.
DR   EnsemblGenomes-Tr; EBT00001783833.
DR   EnsemblGenomes-Tr; EBT00001783834.
DR   EnsemblGenomes-Tr; EBT00001783835.
DR   EnsemblGenomes-Tr; EBT00001783836.
DR   EnsemblGenomes-Tr; EBT00001783837.
DR   EnsemblGenomes-Tr; EBT00001783838.
DR   EnsemblGenomes-Tr; EBT00001783839.
DR   EnsemblGenomes-Tr; EBT00001783840.
DR   EnsemblGenomes-Tr; EBT00001783841.
DR   EnsemblGenomes-Tr; EBT00001783842.
DR   EnsemblGenomes-Tr; EBT00001783843.
DR   EnsemblGenomes-Tr; EBT00001783844.
DR   EnsemblGenomes-Tr; EBT00001783845.
DR   EnsemblGenomes-Tr; EBT00001783846.
DR   EnsemblGenomes-Tr; EBT00001783847.
DR   EnsemblGenomes-Tr; EBT00001783848.
DR   EnsemblGenomes-Tr; EBT00001783849.
DR   EnsemblGenomes-Tr; EBT00001783850.
DR   EnsemblGenomes-Tr; EBT00001783851.
DR   EnsemblGenomes-Tr; EBT00001783852.
DR   EnsemblGenomes-Tr; EBT00001783853.
DR   EnsemblGenomes-Tr; EBT00001783854.
DR   EnsemblGenomes-Tr; VSAL_I0013.
DR   EnsemblGenomes-Tr; VSAL_I0036.
DR   EnsemblGenomes-Tr; VSAL_I0037.
DR   EnsemblGenomes-Tr; VSAL_I0041.
DR   EnsemblGenomes-Tr; VSAL_I0055.
DR   EnsemblGenomes-Tr; VSAL_I0063.
DR   EnsemblGenomes-Tr; VSAL_I0064.
DR   EnsemblGenomes-Tr; VSAL_I0067.
DR   EnsemblGenomes-Tr; VSAL_I0068.
DR   EnsemblGenomes-Tr; VSAL_I0071.
DR   EnsemblGenomes-Tr; VSAL_I0094.
DR   EnsemblGenomes-Tr; VSAL_I0130.
DR   EnsemblGenomes-Tr; VSAL_I0145.
DR   EnsemblGenomes-Tr; VSAL_I0153.
DR   EnsemblGenomes-Tr; VSAL_I0154.
DR   EnsemblGenomes-Tr; VSAL_I0156.
DR   EnsemblGenomes-Tr; VSAL_I0166.
DR   EnsemblGenomes-Tr; VSAL_I0175.
DR   EnsemblGenomes-Tr; VSAL_I0178.
DR   EnsemblGenomes-Tr; VSAL_I0200.
DR   EnsemblGenomes-Tr; VSAL_I0202.
DR   EnsemblGenomes-Tr; VSAL_I0213.
DR   EnsemblGenomes-Tr; VSAL_I0237.
DR   EnsemblGenomes-Tr; VSAL_I0245.
DR   EnsemblGenomes-Tr; VSAL_I0248.
DR   EnsemblGenomes-Tr; VSAL_I0257.
DR   EnsemblGenomes-Tr; VSAL_I0281.
DR   EnsemblGenomes-Tr; VSAL_I0285.
DR   EnsemblGenomes-Tr; VSAL_I0314.
DR   EnsemblGenomes-Tr; VSAL_I0318.
DR   EnsemblGenomes-Tr; VSAL_I0357.
DR   EnsemblGenomes-Tr; VSAL_I0378.
DR   EnsemblGenomes-Tr; VSAL_I0395.
DR   EnsemblGenomes-Tr; VSAL_I0438.
DR   EnsemblGenomes-Tr; VSAL_I0443.
DR   EnsemblGenomes-Tr; VSAL_I0455.
DR   EnsemblGenomes-Tr; VSAL_I0460.
DR   EnsemblGenomes-Tr; VSAL_I0472.
DR   EnsemblGenomes-Tr; VSAL_I0482.
DR   EnsemblGenomes-Tr; VSAL_I0513.
DR   EnsemblGenomes-Tr; VSAL_I0514.
DR   EnsemblGenomes-Tr; VSAL_I0565.
DR   EnsemblGenomes-Tr; VSAL_I0622.
DR   EnsemblGenomes-Tr; VSAL_I0657.
DR   EnsemblGenomes-Tr; VSAL_I0673.
DR   EnsemblGenomes-Tr; VSAL_I0743.
DR   EnsemblGenomes-Tr; VSAL_I0763.
DR   EnsemblGenomes-Tr; VSAL_I0764.
DR   EnsemblGenomes-Tr; VSAL_I0765.
DR   EnsemblGenomes-Tr; VSAL_I0767.
DR   EnsemblGenomes-Tr; VSAL_I0774.
DR   EnsemblGenomes-Tr; VSAL_I0776.
DR   EnsemblGenomes-Tr; VSAL_I0808.
DR   EnsemblGenomes-Tr; VSAL_I0813.
DR   EnsemblGenomes-Tr; VSAL_I0819.
DR   EnsemblGenomes-Tr; VSAL_I0861.
DR   EnsemblGenomes-Tr; VSAL_I0863.
DR   EnsemblGenomes-Tr; VSAL_I0867.
DR   EnsemblGenomes-Tr; VSAL_I0894.
DR   EnsemblGenomes-Tr; VSAL_I0897.
DR   EnsemblGenomes-Tr; VSAL_I0902.
DR   EnsemblGenomes-Tr; VSAL_I0905.
DR   EnsemblGenomes-Tr; VSAL_I0906.
DR   EnsemblGenomes-Tr; VSAL_I0916.
DR   EnsemblGenomes-Tr; VSAL_I0918.
DR   EnsemblGenomes-Tr; VSAL_I0929.
DR   EnsemblGenomes-Tr; VSAL_I0943.
DR   EnsemblGenomes-Tr; VSAL_I0958.
DR   EnsemblGenomes-Tr; VSAL_I0964.
DR   EnsemblGenomes-Tr; VSAL_I0970.
DR   EnsemblGenomes-Tr; VSAL_I0971.
DR   EnsemblGenomes-Tr; VSAL_I1000.
DR   EnsemblGenomes-Tr; VSAL_I1002.
DR   EnsemblGenomes-Tr; VSAL_I1033.
DR   EnsemblGenomes-Tr; VSAL_I1063.
DR   EnsemblGenomes-Tr; VSAL_I1089.
DR   EnsemblGenomes-Tr; VSAL_I1104.
DR   EnsemblGenomes-Tr; VSAL_I1106.
DR   EnsemblGenomes-Tr; VSAL_I1107.
DR   EnsemblGenomes-Tr; VSAL_I1108.
DR   EnsemblGenomes-Tr; VSAL_I1111.
DR   EnsemblGenomes-Tr; VSAL_I1113.
DR   EnsemblGenomes-Tr; VSAL_I1118.
DR   EnsemblGenomes-Tr; VSAL_I1130.
DR   EnsemblGenomes-Tr; VSAL_I1148.
DR   EnsemblGenomes-Tr; VSAL_I1165.
DR   EnsemblGenomes-Tr; VSAL_I1167.
DR   EnsemblGenomes-Tr; VSAL_I1183.
DR   EnsemblGenomes-Tr; VSAL_I1208.
DR   EnsemblGenomes-Tr; VSAL_I1219.
DR   EnsemblGenomes-Tr; VSAL_I1238.
DR   EnsemblGenomes-Tr; VSAL_I1241.
DR   EnsemblGenomes-Tr; VSAL_I1258.
DR   EnsemblGenomes-Tr; VSAL_I1261.
DR   EnsemblGenomes-Tr; VSAL_I1265.
DR   EnsemblGenomes-Tr; VSAL_I1267.
DR   EnsemblGenomes-Tr; VSAL_I1268.
DR   EnsemblGenomes-Tr; VSAL_I1275.
DR   EnsemblGenomes-Tr; VSAL_I1277.
DR   EnsemblGenomes-Tr; VSAL_I1290.
DR   EnsemblGenomes-Tr; VSAL_I1315.
DR   EnsemblGenomes-Tr; VSAL_I1316.
DR   EnsemblGenomes-Tr; VSAL_I1317.
DR   EnsemblGenomes-Tr; VSAL_I1336.
DR   EnsemblGenomes-Tr; VSAL_I1338.
DR   EnsemblGenomes-Tr; VSAL_I1360.
DR   EnsemblGenomes-Tr; VSAL_I1361.
DR   EnsemblGenomes-Tr; VSAL_I1380.
DR   EnsemblGenomes-Tr; VSAL_I1402.
DR   EnsemblGenomes-Tr; VSAL_I1409.
DR   EnsemblGenomes-Tr; VSAL_I1414.
DR   EnsemblGenomes-Tr; VSAL_I1423.
DR   EnsemblGenomes-Tr; VSAL_I1429.
DR   EnsemblGenomes-Tr; VSAL_I1434.
DR   EnsemblGenomes-Tr; VSAL_I1440.
DR   EnsemblGenomes-Tr; VSAL_I1444.
DR   EnsemblGenomes-Tr; VSAL_I1458.
DR   EnsemblGenomes-Tr; VSAL_I1461.
DR   EnsemblGenomes-Tr; VSAL_I1462.
DR   EnsemblGenomes-Tr; VSAL_I1468.
DR   EnsemblGenomes-Tr; VSAL_I1474.
DR   EnsemblGenomes-Tr; VSAL_I1479.
DR   EnsemblGenomes-Tr; VSAL_I1480.
DR   EnsemblGenomes-Tr; VSAL_I1493.
DR   EnsemblGenomes-Tr; VSAL_I1496.
DR   EnsemblGenomes-Tr; VSAL_I1521.
DR   EnsemblGenomes-Tr; VSAL_I1523.
DR   EnsemblGenomes-Tr; VSAL_I1525.
DR   EnsemblGenomes-Tr; VSAL_I1546.
DR   EnsemblGenomes-Tr; VSAL_I1548.
DR   EnsemblGenomes-Tr; VSAL_I1602.
DR   EnsemblGenomes-Tr; VSAL_I1604.
DR   EnsemblGenomes-Tr; VSAL_I1629.
DR   EnsemblGenomes-Tr; VSAL_I1631.
DR   EnsemblGenomes-Tr; VSAL_I1653.
DR   EnsemblGenomes-Tr; VSAL_I1657.
DR   EnsemblGenomes-Tr; VSAL_I1661.
DR   EnsemblGenomes-Tr; VSAL_I1679.
DR   EnsemblGenomes-Tr; VSAL_I1682.
DR   EnsemblGenomes-Tr; VSAL_I1691.
DR   EnsemblGenomes-Tr; VSAL_I1702.
DR   EnsemblGenomes-Tr; VSAL_I1704.
DR   EnsemblGenomes-Tr; VSAL_I1707.
DR   EnsemblGenomes-Tr; VSAL_I1710.
DR   EnsemblGenomes-Tr; VSAL_I1716.
DR   EnsemblGenomes-Tr; VSAL_I1717.
DR   EnsemblGenomes-Tr; VSAL_I1719.
DR   EnsemblGenomes-Tr; VSAL_I1722.
DR   EnsemblGenomes-Tr; VSAL_I1734.
DR   EnsemblGenomes-Tr; VSAL_I1735.
DR   EnsemblGenomes-Tr; VSAL_I1738.
DR   EnsemblGenomes-Tr; VSAL_I1742.
DR   EnsemblGenomes-Tr; VSAL_I1744.
DR   EnsemblGenomes-Tr; VSAL_I1751.
DR   EnsemblGenomes-Tr; VSAL_I1771.
DR   EnsemblGenomes-Tr; VSAL_I1778.
DR   EnsemblGenomes-Tr; VSAL_I1791.
DR   EnsemblGenomes-Tr; VSAL_I1794.
DR   EnsemblGenomes-Tr; VSAL_I1811.
DR   EnsemblGenomes-Tr; VSAL_I1812.
DR   EnsemblGenomes-Tr; VSAL_I1818.
DR   EnsemblGenomes-Tr; VSAL_I1821.
DR   EnsemblGenomes-Tr; VSAL_I1822.
DR   EnsemblGenomes-Tr; VSAL_I1832.
DR   EnsemblGenomes-Tr; VSAL_I1833.
DR   EnsemblGenomes-Tr; VSAL_I1835.
DR   EnsemblGenomes-Tr; VSAL_I1910.
DR   EnsemblGenomes-Tr; VSAL_I1923.
DR   EnsemblGenomes-Tr; VSAL_I1926.
DR   EnsemblGenomes-Tr; VSAL_I1927.
DR   EnsemblGenomes-Tr; VSAL_I1942.
DR   EnsemblGenomes-Tr; VSAL_I1945.
DR   EnsemblGenomes-Tr; VSAL_I1947.
DR   EnsemblGenomes-Tr; VSAL_I1964.
DR   EnsemblGenomes-Tr; VSAL_I1992.
DR   EnsemblGenomes-Tr; VSAL_I1994.
DR   EnsemblGenomes-Tr; VSAL_I2008.
DR   EnsemblGenomes-Tr; VSAL_I2009.
DR   EnsemblGenomes-Tr; VSAL_I2012.
DR   EnsemblGenomes-Tr; VSAL_I2013.
DR   EnsemblGenomes-Tr; VSAL_I2014.
DR   EnsemblGenomes-Tr; VSAL_I2016.
DR   EnsemblGenomes-Tr; VSAL_I2021.
DR   EnsemblGenomes-Tr; VSAL_I2036.
DR   EnsemblGenomes-Tr; VSAL_I2045.
DR   EnsemblGenomes-Tr; VSAL_I2052.
DR   EnsemblGenomes-Tr; VSAL_I2069.
DR   EnsemblGenomes-Tr; VSAL_I2086.
DR   EnsemblGenomes-Tr; VSAL_I2089.
DR   EnsemblGenomes-Tr; VSAL_I2117.
DR   EnsemblGenomes-Tr; VSAL_I2122.
DR   EnsemblGenomes-Tr; VSAL_I2123.
DR   EnsemblGenomes-Tr; VSAL_I2160.
DR   EnsemblGenomes-Tr; VSAL_I2164.
DR   EnsemblGenomes-Tr; VSAL_I2177.
DR   EnsemblGenomes-Tr; VSAL_I2185.
DR   EnsemblGenomes-Tr; VSAL_I2256.
DR   EnsemblGenomes-Tr; VSAL_I2263.
DR   EnsemblGenomes-Tr; VSAL_I2265.
DR   EnsemblGenomes-Tr; VSAL_I2308.
DR   EnsemblGenomes-Tr; VSAL_I2316.
DR   EnsemblGenomes-Tr; VSAL_I2320.
DR   EnsemblGenomes-Tr; VSAL_I2321.
DR   EnsemblGenomes-Tr; VSAL_I2322.
DR   EnsemblGenomes-Tr; VSAL_I2352.
DR   EnsemblGenomes-Tr; VSAL_I2366.
DR   EnsemblGenomes-Tr; VSAL_I2403.
DR   EnsemblGenomes-Tr; VSAL_I2447.
DR   EnsemblGenomes-Tr; VSAL_I2459.
DR   EnsemblGenomes-Tr; VSAL_I2462.
DR   EnsemblGenomes-Tr; VSAL_I2468.
DR   EnsemblGenomes-Tr; VSAL_I2483.
DR   EnsemblGenomes-Tr; VSAL_I2487.
DR   EnsemblGenomes-Tr; VSAL_I2561.
DR   EnsemblGenomes-Tr; VSAL_I2576.
DR   EnsemblGenomes-Tr; VSAL_I2596.
DR   EnsemblGenomes-Tr; VSAL_I2601.
DR   EnsemblGenomes-Tr; VSAL_I2606.
DR   EnsemblGenomes-Tr; VSAL_I2612.
DR   EnsemblGenomes-Tr; VSAL_I2620.
DR   EnsemblGenomes-Tr; VSAL_I2621.
DR   EnsemblGenomes-Tr; VSAL_I2624.
DR   EnsemblGenomes-Tr; VSAL_I2631.
DR   EnsemblGenomes-Tr; VSAL_I2698.
DR   EnsemblGenomes-Tr; VSAL_I2720.
DR   EnsemblGenomes-Tr; VSAL_I2809.
DR   EnsemblGenomes-Tr; VSAL_I2810.
DR   EnsemblGenomes-Tr; VSAL_I2852.
DR   EnsemblGenomes-Tr; VSAL_I2855.
DR   EnsemblGenomes-Tr; VSAL_I2859.
DR   EnsemblGenomes-Tr; VSAL_I2862.
DR   EnsemblGenomes-Tr; VSAL_I2906.
DR   EnsemblGenomes-Tr; VSAL_I2933.
DR   EnsemblGenomes-Tr; VSAL_I2950.
DR   EnsemblGenomes-Tr; VSAL_I2957.
DR   EnsemblGenomes-Tr; VSAL_I2958.
DR   EnsemblGenomes-Tr; VSAL_I3007.
DR   EnsemblGenomes-Tr; VSAL_I3017.
DR   EnsemblGenomes-Tr; VSAL_I3022.
DR   EnsemblGenomes-Tr; VSAL_I3023.
DR   EnsemblGenomes-Tr; VSAL_I3034.
DR   EnsemblGenomes-Tr; VSAL_I3036.
DR   EnsemblGenomes-Tr; VSAL_I3037.
DR   EnsemblGenomes-Tr; VSAL_I3042.
DR   EnsemblGenomes-Tr; VSAL_I3052.
DR   EnsemblGenomes-Tr; VSAL_I3053.
DR   EnsemblGenomes-Tr; VSAL_I3071r-1.
DR   EnsemblGenomes-Tr; VSAL_I3072r-1.
DR   EnsemblGenomes-Tr; VSAL_I3073r-1.
DR   EnsemblGenomes-Tr; VSAL_I3074r-1.
DR   EnsemblGenomes-Tr; VSAL_I3075t-1.
DR   EnsemblGenomes-Tr; VSAL_I3076t-1.
DR   EnsemblGenomes-Tr; VSAL_I3077r-1.
DR   EnsemblGenomes-Tr; VSAL_I3078r-1.
DR   EnsemblGenomes-Tr; VSAL_I3079r-1.
DR   EnsemblGenomes-Tr; VSAL_I3080t-1.
DR   EnsemblGenomes-Tr; VSAL_I3081t-1.
DR   EnsemblGenomes-Tr; VSAL_I3082t-1.
DR   EnsemblGenomes-Tr; VSAL_I3083r-1.
DR   EnsemblGenomes-Tr; VSAL_I3084r-1.
DR   EnsemblGenomes-Tr; VSAL_I3085r-1.
DR   EnsemblGenomes-Tr; VSAL_I3086t-1.
DR   EnsemblGenomes-Tr; VSAL_I3087t-1.
DR   EnsemblGenomes-Tr; VSAL_I3088t-1.
DR   EnsemblGenomes-Tr; VSAL_I3089t-1.
DR   EnsemblGenomes-Tr; VSAL_I3090r-1.
DR   EnsemblGenomes-Tr; VSAL_I3091r-1.
DR   EnsemblGenomes-Tr; VSAL_I3092r-1.
DR   EnsemblGenomes-Tr; VSAL_I3093r-1.
DR   EnsemblGenomes-Tr; VSAL_I3094r-1.
DR   EnsemblGenomes-Tr; VSAL_I3095t-1.
DR   EnsemblGenomes-Tr; VSAL_I3096r-1.
DR   EnsemblGenomes-Tr; VSAL_I3097t-1.
DR   EnsemblGenomes-Tr; VSAL_I3098t-1.
DR   EnsemblGenomes-Tr; VSAL_I3099t-1.
DR   EnsemblGenomes-Tr; VSAL_I3100t-1.
DR   EnsemblGenomes-Tr; VSAL_I3101t-1.
DR   EnsemblGenomes-Tr; VSAL_I3107r-1.
DR   EnsemblGenomes-Tr; VSAL_I3108r-1.
DR   EnsemblGenomes-Tr; VSAL_I3109r-1.
DR   EnsemblGenomes-Tr; VSAL_I3110r-1.
DR   EnsemblGenomes-Tr; VSAL_I3111t-1.
DR   EnsemblGenomes-Tr; VSAL_I3112t-1.
DR   EnsemblGenomes-Tr; VSAL_I3113r-1.
DR   EnsemblGenomes-Tr; VSAL_I3114r-1.
DR   EnsemblGenomes-Tr; VSAL_I3115t-1.
DR   EnsemblGenomes-Tr; VSAL_I3117t-1.
DR   EnsemblGenomes-Tr; VSAL_I3118t-1.
DR   EnsemblGenomes-Tr; VSAL_I3119t-1.
DR   EnsemblGenomes-Tr; VSAL_I3120t-1.
DR   EnsemblGenomes-Tr; VSAL_I3121t-1.
DR   EnsemblGenomes-Tr; VSAL_I3122t-1.
DR   EnsemblGenomes-Tr; VSAL_I3123t-1.
DR   EnsemblGenomes-Tr; VSAL_I3124t-1.
DR   EnsemblGenomes-Tr; VSAL_I3125t-1.
DR   EnsemblGenomes-Tr; VSAL_I3126t-1.
DR   EnsemblGenomes-Tr; VSAL_I3128t-1.
DR   EnsemblGenomes-Tr; VSAL_I3129t-1.
DR   EnsemblGenomes-Tr; VSAL_I3130t-1.
DR   EnsemblGenomes-Tr; VSAL_I3131t-1.
DR   EnsemblGenomes-Tr; VSAL_I3132t-1.
DR   EnsemblGenomes-Tr; VSAL_I3133t-1.
DR   EnsemblGenomes-Tr; VSAL_I3134t-1.
DR   EnsemblGenomes-Tr; VSAL_I3135t-1.
DR   EnsemblGenomes-Tr; VSAL_I3136r-1.
DR   EnsemblGenomes-Tr; VSAL_I3137t-1.
DR   EnsemblGenomes-Tr; VSAL_I3138r-1.
DR   EnsemblGenomes-Tr; VSAL_I3139r-1.
DR   EnsemblGenomes-Tr; VSAL_I3140t-1.
DR   EnsemblGenomes-Tr; VSAL_I3141t-1.
DR   EnsemblGenomes-Tr; VSAL_I3143t-1.
DR   EnsemblGenomes-Tr; VSAL_I3144t-1.
DR   EnsemblGenomes-Tr; VSAL_I3145t-1.
DR   EnsemblGenomes-Tr; VSAL_I3146t-1.
DR   EnsemblGenomes-Tr; VSAL_I3147t-1.
DR   EnsemblGenomes-Tr; VSAL_I3148t-1.
DR   EnsemblGenomes-Tr; VSAL_I3149t-1.
DR   EnsemblGenomes-Tr; VSAL_I3150t-1.
DR   EnsemblGenomes-Tr; VSAL_I3151t-1.
DR   EnsemblGenomes-Tr; VSAL_I3152t-1.
DR   EnsemblGenomes-Tr; VSAL_I3153t-1.
DR   EnsemblGenomes-Tr; VSAL_I3154t-1.
DR   EnsemblGenomes-Tr; VSAL_I3155t-1.
DR   EnsemblGenomes-Tr; VSAL_I3157t-1.
DR   EnsemblGenomes-Tr; VSAL_I3158t-1.
DR   EnsemblGenomes-Tr; VSAL_I3159t-1.
DR   EnsemblGenomes-Tr; VSAL_I3161t-1.
DR   EnsemblGenomes-Tr; VSAL_I3164t-1.
DR   EnsemblGenomes-Tr; VSAL_I3166t-1.
DR   EnsemblGenomes-Tr; VSAL_I3167t-1.
DR   EnsemblGenomes-Tr; VSAL_I3168t-1.
DR   EnsemblGenomes-Tr; VSAL_I3169t-1.
DR   EnsemblGenomes-Tr; VSAL_I3170t-1.
DR   EnsemblGenomes-Tr; VSAL_I3171t-1.
DR   EnsemblGenomes-Tr; VSAL_I3173t-1.
DR   EnsemblGenomes-Tr; VSAL_I3174t-1.
DR   EnsemblGenomes-Tr; VSAL_I3175t-1.
DR   EnsemblGenomes-Tr; VSAL_I3176t-1.
DR   EnsemblGenomes-Tr; VSAL_I3177t-1.
DR   EnsemblGenomes-Tr; VSAL_I3181t-1.
DR   EnsemblGenomes-Tr; VSAL_I3182r-1.
DR   EnsemblGenomes-Tr; VSAL_I3183r-1.
DR   EnsemblGenomes-Tr; VSAL_I3184r-1.
DR   EnsemblGenomes-Tr; VSAL_I3185t-1.
DR   EnsemblGenomes-Tr; VSAL_I3186r-1.
DR   EnsemblGenomes-Tr; VSAL_I3187r-1.
DR   EnsemblGenomes-Tr; VSAL_I3188t-1.
DR   EnsemblGenomes-Tr; VSAL_I3189t-1.
DR   EnsemblGenomes-Tr; VSAL_I3190t-1.
DR   EnsemblGenomes-Tr; VSAL_I3191r-1.
DR   EnsemblGenomes-Tr; VSAL_I3192t-1.
DR   EnsemblGenomes-Tr; VSAL_I3193t-1.
DR   EnsemblGenomes-Tr; VSAL_I3194t-1.
DR   EnsemblGenomes-Tr; VSAL_I3195t-1.
DR   EnsemblGenomes-Tr; VSAL_I3196t-1.
DR   EnsemblGenomes-Tr; VSAL_I3197t-1.
DR   EnsemblGenomes-Tr; VSAL_I3198t-1.
DR   EnsemblGenomes-Tr; VSAL_I3199t-1.
DR   EnsemblGenomes-Tr; VSAL_I3200t-1.
DR   EnsemblGenomes-Tr; VSAL_I3201t-1.
DR   EnsemblGenomes-Tr; VSAL_I3202t-1.
DR   EnsemblGenomes-Tr; VSAL_I3203t-1.
DR   EnsemblGenomes-Tr; VSAL_I3204t-1.
DR   EnsemblGenomes-Tr; VSAL_I3205t-1.
DR   EnsemblGenomes-Tr; VSAL_I3206t-1.
DR   EnsemblGenomes-Tr; VSAL_I3207t-1.
DR   EnsemblGenomes-Tr; VSAL_I3208t-1.
DR   EnsemblGenomes-Tr; VSAL_I3209t-1.
DR   EnsemblGenomes-Tr; VSAL_I3210r-1.
DR   EnsemblGenomes-Tr; VSAL_I3211r-1.
DR   EnsemblGenomes-Tr; VSAL_I3212r-1.
DR   EnsemblGenomes-Tr; VSAL_I3214t-1.
DR   EuropePMC; PMC2627896; 19099551.
DR   EuropePMC; PMC2777879; 19860885.
DR   EuropePMC; PMC2807590; 19830476.
DR   EuropePMC; PMC3033894; 21326607.
DR   EuropePMC; PMC3937223; 24586205.
DR   EuropePMC; PMC4324432; 25649684.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00378; Qrr.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02100; tfoR.
DR   RFAM; RF02268; MtlS.
DR   SILVA-LSU; FM178379.
DR   SILVA-SSU; FM178379.
DR   StrainInfo; 379913; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3325165
FT                   /organism="Aliivibrio salmonicida LFI1238"
FT                   /chromosome="1"
FT                   /strain="LFI1238"
FT                   /mol_type="genomic DNA"
FT                   /country="Norway:Hammerfest"
FT                   /isolation_source="Atlantic cod"
FT                   /db_xref="taxon:316275"
FT   CDS_pept        complement(312..746)
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="VSAL_I0001"
FT                   /old_locus_tag="TVS3117"
FT                   /product="MioC protein"
FT                   /note="Similar to Escherichia coli Protein MioC
FT                   UniProt:P03817 (146 aa) fasta scores: E()=2.7e-20, 45.985%
FT                   id in 137 aa. Shown to be important for the modulation of
FT                   initiation at oriC in a minichromosome model (its true role
FT                   in chromosome replication in E. coli is equivocal)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77686"
FT                   /db_xref="GOA:B6EP38"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP38"
FT                   /inference="similar to sequence:UniProt:P03817"
FT                   /protein_id="CAQ77686.1"
FT                   /translation="MKNASIITGSTLGAAEYVGDHIADLLEEMDFATDIHNQPILSEID
FT                   TKGLWILVVSTHGAGDYPDNIKPFIQELEEGSQDLSDVEFAIIAIGDSNYDTFCAAGKS
FT                   LQKVLHNRNVKEIFPLLEIDVTQNPIPEEPAELWLKQHIC"
FT   misc_feature    complement(333..731)
FT                   /gene="mioC"
FT                   /locus_tag="VSAL_I0001"
FT                   /note="HMMPfam hit to PF00258, Flavodoxin, score 1.8e-24"
FT                   /inference="protein motif:HMMPfam:PF00258"
FT   CDS_pept        complement(811..2178)
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="VSAL_I0002"
FT                   /old_locus_tag="TVS3118"
FT                   /product="probable tRNA modification GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77687"
FT                   /db_xref="GOA:B6EP39"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP39"
FT                   /protein_id="CAQ77687.1"
FT                   /translation="MTLHTDTIVAQATAPGRGGVGIIRVSGPKAQQVALEVVGKTLKPR
FT                   YAEYTPFKDDNGLELDQGIALYFPNPHSFTGEDVLELQGHGGPVVMDMLIKRILKIEGI
FT                   RTARPGEFSERAFLNDKMDLAQAEAIADLIDASSEEAAKSALNSLQGVFSRKINTLVES
FT                   LIYLRIYVEAAIDFPEEEIDFLADGKVSGDLQGIIDNLNAVRQEANQGAIMREGMKVVI
FT                   AGRPNAGKSSLLNALSGKDSAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREASDE
FT                   VERIGIERAWQEIAQADRVLFMVDGTTTDATDPKVIWPEFLDRLPKNMGMTVIRNKADQ
FT                   TGENLGICHVNDPTLIRLSAKTGEGVDALRLHLKECMGFSGNQEGGFMARRRHLEALEK
FT                   ASEHLDIGQQQLEGYMAGEILAEELRIAQQHLSEITGEFSSDDLLGRIFTSFCIGK"
FT   misc_feature    complement(1162..1527)
FT                   /gene="trmE"
FT                   /locus_tag="VSAL_I0002"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown
FT                   function,score 6.3e-41"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    complement(1486..1509)
FT                   /gene="trmE"
FT                   /locus_tag="VSAL_I0002"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(2056..2079)
FT                   /gene="trmE"
FT                   /locus_tag="VSAL_I0002"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(2277..3902)
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="VSAL_I0003"
FT                   /old_locus_tag="TVS3119"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77688"
FT                   /db_xref="GOA:B6EP40"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP40"
FT                   /protein_id="CAQ77688.1"
FT                   /translation="MDTQRNILLLALALVSFLLFQQWQVETNPQQPATVSTVQQTHKNG
FT                   DVPTSSTANSDAPVDSAQSDKLITITTDVLTLKVDTLGGDIIESVLNKYDAELDSKAKF
FT                   VLLKNDADHSYIAQSGLIGPQGIDSNTGRAQFTAKKTDYVLADGQNELRIPLTLEKNGI
FT                   TYTKTLIVKRDSYAIDVEYTVNNQSSAPATVEMYANLKQNLLDDGGSLTMPTYRGGAYS
FT                   TEDTRYKKYSFDDMEDKNLSIDMTNGQGWAGMLQHYFASAWIPRNVNDATLTTRVAGDY
FT                   GYIGVRMPSVTIPAGQEDTLTATLWTGPKLQPQMAATAKYLDLSVDYGWLWFIASPLHK
FT                   LLSFIQSIVGNWGLAIMILTFIVRGAMYPLTKAQYTSMAKMRMLQPKLAAMRERIGDDR
FT                   QRMSQEMMELYKKEKVNPLGGCLPIVLQMPIFISLYWALMESVELRHAPFFGWITDLSA
FT                   QDPYYILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFIPVMFTVFFLWFPAGLVLYWLV
FT                   SNVVTLIQQTLIYRALEKKGLHSK"
FT   misc_feature    complement(2301..2855)
FT                   /gene="oxaA"
FT                   /locus_tag="VSAL_I0003"
FT                   /note="HMMPfam hit to PF02096, 60Kd inner membrane protein,
FT                   score 8.2e-121"
FT                   /inference="protein motif:HMMPfam:PF02096"
FT   misc_feature    complement(order(2352..2420,2478..2531,2589..2657,
FT                   2814..2882,3828..3884))
FT                   /gene="oxaA"
FT                   /locus_tag="VSAL_I0003"
FT   sig_peptide     complement(3840..3902)
FT                   /gene="oxaA"
FT                   /locus_tag="VSAL_I0003"
FT   CDS_pept        complement(4129..4482)
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="VSAL_I0004"
FT                   /old_locus_tag="TVS3120"
FT                   /product="ribonuclease P protein component (RNase P
FT                   protein)"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77689"
FT                   /db_xref="GOA:B6EP41"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP41"
FT                   /protein_id="CAQ77689.1"
FT                   /translation="MNYDFSRELRLLTPEDYKSVFKQAHRAGSPHFTILARENSLSHPR
FT                   LGLAVPKKQIKTAVGRNKFKRITRESFRNKQHSLPAKDFVVIAKKSAQELSNEDFNKLL
FT                   DKLWHRLSRPSRG"
FT   misc_feature    complement(4147..4470)
FT                   /gene="rnpA"
FT                   /locus_tag="VSAL_I0004"
FT                   /note="HMMPfam hit to PF00825, Ribonuclease P, score
FT                   6.8e-40"
FT                   /inference="protein motif:HMMPfam:PF00825"
FT   misc_feature    complement(4276..4320)
FT                   /gene="rnpA"
FT                   /locus_tag="VSAL_I0004"
FT                   /note="PS00648 Bacterial ribonuclease P protein component
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00648"
FT   CDS_pept        complement(4499..4633)
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="VSAL_I0005"
FT                   /old_locus_tag="TVS3121"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77690"
FT                   /db_xref="GOA:B6EP42"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP42"
FT                   /protein_id="CAQ77690.1"
FT                   /translation="MKRTFQPSVLKRKRSHGFRARMATKNGRNTINARRAKGRKRLSK"
FT   misc_feature    complement(4502..4633)
FT                   /gene="rpmH"
FT                   /locus_tag="VSAL_I0005"
FT                   /note="HMMPfam hit to PF00468, Ribosomal protein L34,score
FT                   9.9e-19"
FT                   /inference="protein motif:HMMPfam:PF00468"
FT   misc_feature    complement(4571..4630)
FT                   /gene="rpmH"
FT                   /locus_tag="VSAL_I0005"
FT                   /note="PS00784 Ribosomal protein L34 signature."
FT                   /inference="protein motif:ProSite:PS00784"
FT   CDS_pept        complement(4820..5557)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0006"
FT                   /old_locus_tag="TVS3122"
FT                   /product="putative amino-acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77691"
FT                   /db_xref="GOA:B6EP43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP43"
FT                   /protein_id="CAQ77691.1"
FT                   /translation="MIKITNLHKSFGTTEVLSGIDLTINKGEIIAIIGSSGTGKSTLLR
FT                   CINFLETADQGTITIDDVSVNTEKYTKTEVLALRRKTGFIFQNYALFAHLTARQNIAEG
FT                   LITVHKWNKADALKRSQQILDDIGLGDKGDSYPAALSGGQQQRVGIGRAMALETELLLF
FT                   DEPTSALDPEWVNEVLTLMKKLATQHQTMLVVTHEMQFAKEVADRVIYMADGKIVEQGT
FT                   PEQIFGYPQDLKLKKFLNQVGIA"
FT   misc_feature    complement(4913..5479)
FT                   /locus_tag="VSAL_I0006"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.5e-62"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(5097..5140)
FT                   /locus_tag="VSAL_I0006"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(5435..5458)
FT                   /locus_tag="VSAL_I0006"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(5554..6225)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0007"
FT                   /old_locus_tag="TVS3123"
FT                   /product="putative amino-acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77692"
FT                   /db_xref="GOA:B6EP44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP44"
FT                   /protein_id="CAQ77692.1"
FT                   /translation="MGFDFAYMIELLPILFKYLGTTLEMAVWGLFFALALALVLANLRV
FT                   FKVPVLDQLSQLYISFFRGTPLLVQLFLLYYGLPQVFPIFVGLDAFSAAVIGLTLHFAA
FT                   YMAESIRAAIIGVDRSQMEASLSIGMTTSQAMRRIILPQATRIALPSLMNYFIDMIKST
FT                   SLAFTLGVSEIMAKAQMEASSSFKFFEAFLAVALIYWGVVIILTQVQTWAEKKLNKAYV
FT                   R"
FT   misc_feature    complement(5569..6183)
FT                   /locus_tag="VSAL_I0007"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 5.5e-19"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(order(5596..5664,5914..5982,5992..6051,
FT                   6088..6156))
FT                   /locus_tag="VSAL_I0007"
FT   misc_feature    complement(5800..5886)
FT                   /locus_tag="VSAL_I0007"
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:ProSite:PS00402"
FT   CDS_pept        complement(6380..7132)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0008"
FT                   /old_locus_tag="TVS3124"
FT                   /product="putative amino acid ABC
FT                   transporter,substrate-binding protein"
FT                   /note="Similar to Escherichia coli Cystine-binding
FT                   periplasmic protein precursor FliY UniProt:P0AEM9 (266 aa)
FT                   fasta scores: E()=6.8e-24, 40.969% id in 227 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77693"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP45"
FT                   /inference="similar to sequence:UniProt:P0AEM9"
FT                   /protein_id="CAQ77693.1"
FT                   /translation="MKWTKQILTGLALTLAATQFAQAATEVKVGMSGRYFPFTFVKLDK
FT                   LQGFEVDLWDEIGRRNDYKIEYVTASFSGLFGLLETGRIDTISNQITKTEAREAKYLFA
FT                   DPYVVDGAQITVRKGNESIKGIEDLAGKTVAVDLGSNFEKLLRDNDKSNQIDIKTYDTG
FT                   IEHDVALGRSDAFVMDRLSAAQLIKKSGLPLQLAGEPFETIENAWPFVKNEKGQKLQQE
FT                   VNKALSEMRTDGTLAEISQKWFDADVTK"
FT   misc_feature    complement(6395..7054)
FT                   /locus_tag="VSAL_I0008"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding prot, score 1.6e-75"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    complement(6950..6991)
FT                   /locus_tag="VSAL_I0008"
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT                   /inference="protein motif:ProSite:PS01039"
FT   sig_peptide     complement(7064..7132)
FT                   /locus_tag="VSAL_I0008"
FT   CDS_pept        7427..8833
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="VSAL_I0009"
FT                   /old_locus_tag="TVS3125"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77694"
FT                   /db_xref="GOA:B6EP46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP46"
FT                   /protein_id="CAQ77694.1"
FT                   /translation="MSSSLWLQCLQRLQEELPSAEFSMWVRPLQAELNDNTLTLFAPNR
FT                   FVLDWVRDKYLNSINSLLNEFCGGDIPTLRFEVGSKPISAPPRPQRTAADVAAATSAPA
FT                   QMQARQSLHKPWESRGPEPVDDLNHRSNVNPKHKFTNFVEGKSNQLGLAAARQVSDNPG
FT                   TAYNPLFLYGGTGLGKTHLLQAVGNAILERKPNAKVVYMHSERFVQDMVKALQNNAIEE
FT                   FKCYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVED
FT                   RLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIHLADEVAFFIAKRLRSNVRELEGA
FT                   LNRVVANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADLLSKR
FT                   RSRSVARPRQLAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKED
FT                   YSNLIRTLSS"
FT   misc_feature    7823..8479
FT                   /gene="dnaA"
FT                   /locus_tag="VSAL_I0009"
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,score
FT                   1.4e-145"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    7943..7966
FT                   /gene="dnaA"
FT                   /locus_tag="VSAL_I0009"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    8552..8761
FT                   /gene="dnaA"
FT                   /locus_tag="VSAL_I0009"
FT                   /note="HMMPfam hit to PF08299, Bacterial dnaA protein
FT                   helix-turn-helix, score 2.9e-48"
FT                   /inference="protein motif:HMMPfam:PF08299"
FT   misc_feature    8702..8761
FT                   /gene="dnaA"
FT                   /locus_tag="VSAL_I0009"
FT                   /note="PS01008 DnaA protein signature."
FT                   /inference="protein motif:ProSite:PS01008"
FT   CDS_pept        8866..9975
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="VSAL_I0010"
FT                   /old_locus_tag="TVS3126"
FT                   /product="DNA polymerase III subunit beta-subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Escherichia coli DNA polymerase III
FT                   subunit beta-subunit DnaN UniProt:P0A988 (366 aa) fasta
FT                   scores: E()=8.7e-95, 65.854% id in 369 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77695"
FT                   /db_xref="GOA:B6EP47"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP47"
FT                   /inference="similar to sequence:UniProt:P0A988"
FT                   /protein_id="CAQ77695.1"
FT                   /translation="MKFSIERSHLLKPLQQVSGALGGRPSLPIFGNILLQVENGQLSMT
FT                   ATDLEVELISNILLEGDFEAGAITVPSRKFLDICRGLPDGANITIVLEGDRVLVRSGRS
FT                   RFTLATLPAQDFPNIEGWQSEVEITLSQAQLRKLIESTQFSMANQDVRYYLNGMMFETQ
FT                   GTIFRSVATDGHRMAVCNMPVESELPEQQVIMPRKGIQELVRLLDSPEQSVTLQFGNSN
FT                   VRAEVNNFIFTSKLVDGRFPDYRRVMPQSSNKTLEADCDELRQAFARAAILSNEKFRGV
FT                   RVNLANNQMRITANNPEQEEAEEILDVDFQGEDIEIGFNVSYVLDVLDVLNTLKCERVR
FT                   ISMTTANASALVEDCANDEAQYVVMPIRL"
FT   misc_feature    8866..9225
FT                   /gene="dnaN"
FT                   /locus_tag="VSAL_I0010"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 4e-57"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    8875..9219
FT                   /gene="dnaN"
FT                   /locus_tag="VSAL_I0010"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 0.00024"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    order(9250..9348,9349..9594)
FT                   /gene="dnaN"
FT                   /locus_tag="VSAL_I0010"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 3.3e-54"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    9597..9968
FT                   /gene="dnaN"
FT                   /locus_tag="VSAL_I0010"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 1.2e-52"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   CDS_pept        9989..11068
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="VSAL_I0011"
FT                   /old_locus_tag="TVS3128"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77696"
FT                   /db_xref="GOA:B6EP48"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP48"
FT                   /protein_id="CAQ77696.1"
FT                   /translation="MPLSRLIINDFRNIETCDIQLSTGFNFVIGPNGSGKTSVLEAIYL
FT                   LGHGRSFKSSLTGRIIRNSCDELFIHGRFTTPEQFELPIGINKQRDGTTEVKIGGESGQ
FT                   KLAQLAKVLPLQLIHPEGFELVTDGPKFRRAFIDWGVFHVEPAFYEAWSRVKRLTKQRN
FT                   ALLKTAQSYRELSYWDLELANLAEKIDQWRVDYINHISEATQQICQAFLPEYDIKLSYY
FT                   RGWERETPYAELLKRNFERDKQLGYTVGGPNKADLRIKVAGTPVEDVLSRGQLKLMVCA
FT                   LRLAQGQHLTEATGKQCIYLIDDFASELDSHRRQLLAQYLKQTKAQVFISSITAEQIAD
FT                   MHDEESKMFEIEHGKIAQG"
FT   misc_feature    9992..11059
FT                   /gene="recF"
FT                   /locus_tag="VSAL_I0011"
FT                   /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
FT                   domain, score 1.3e-38"
FT                   /inference="protein motif:HMMPfam:PF02463"
FT   misc_feature    10076..10099
FT                   /gene="recF"
FT                   /locus_tag="VSAL_I0011"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    10886..10939
FT                   /gene="recF"
FT                   /locus_tag="VSAL_I0011"
FT                   /note="PS00618 RecF protein signature 2."
FT                   /inference="protein motif:ProSite:PS00618"
FT   CDS_pept        11086..13503
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="VSAL_I0012"
FT                   /old_locus_tag="TVS3129"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77697"
FT                   /db_xref="GOA:B6EP49"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP49"
FT                   /protein_id="CAQ77697.1"
FT                   /translation="MSENYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEALAGHCSDIIVTIHEDDSVSVSDDGRGIPTEIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKVELTINRRGEIFQQIYCHGVPQAPLAVIGTTDTT
FT                   GTKIRFWPSDQTFANIEFVYDILAKRLRELSFLNSGVSIRLQDMREEDKSDHFMFEGGI
FT                   KAFVTHLNRNKTPVHQKIFYFDSERKEDGIVVEVAMQWNDSYQENIFCYTNNIPQRDGG
FT                   AHLSGFRSALTRTLNSFMDKEGFSKKAKSSASGDDAREGLTAVVSVKVPDPKFSSQTKD
FT                   KLVSSEVKSAVESAMNEKLAEFLAENPGEAKMVCSKIIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPAQSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKA
FT                   RFDKMISSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFY
FT                   RQMPELIERGYIYIAQPPLYKVKKGKQEQYIKDEEAMAEYQITQALDNASLFVNPHESI
FT                   FGQELENLIRKFNSVMKLLDRMSRRYPLPLLNRLVYTSRLTQDECENEATVQAWTEALV
FT                   IALNEHETGASQYTAALQFNEELNIHQPKLVVRTHGVQHEYVLSADLLNSKEYGRIAEL
FT                   SESLNGLIEEGAYVQRGERKLATETLDEAIAWLIKDSRRGVYLQRYKGLGEMNPEQLWE
FT                   TTMDPDSRRMMQVTINDAVSADELFTTLMGDHVEPRRNFIEENALRVANLDV"
FT   misc_feature    11176..11607
FT                   /gene="gyrB"
FT                   /locus_tag="VSAL_I0012"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and H, score 6.7e-31"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    11746..12264
FT                   /gene="gyrB"
FT                   /locus_tag="VSAL_I0012"
FT                   /note="HMMPfam hit to PF00204, DNA gyrase B, score 2.4e-92"
FT                   /inference="protein motif:HMMPfam:PF00204"
FT   misc_feature    12343..12681
FT                   /gene="gyrB"
FT                   /locus_tag="VSAL_I0012"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   2.1e-06"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   misc_feature    12355..12381
FT                   /gene="gyrB"
FT                   /locus_tag="VSAL_I0012"
FT                   /note="PS00177 DNA topoisomerase II signature."
FT                   /inference="protein motif:ProSite:PS00177"
FT   misc_feature    13270..13467
FT                   /gene="gyrB"
FT                   /locus_tag="VSAL_I0012"
FT                   /note="HMMPfam hit to PF00986, DNA gyrase B
FT                   subunit,carboxyl terminus, score 4.7e-45"
FT                   /inference="protein motif:HMMPfam:PF00986"
FT   repeat_region   complement(order(13718..13882,15328..17034))
FT                   /note="VSa2"
FT   repeat_region   complement(13718..13741)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(join(13734..13880,15330..16223))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0013"
FT                   /old_locus_tag="TVS3133"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella sp. (strain W3-18-1)
FT                   transposase is66. UniProt:A1RLT8 (EMBL:CP000503) (500 aa)
FT                   fasta scores: E()=2.3e-66, 54.1% id in 296 aa. CDS is
FT                   disrupted by the insertion of an IS element"
FT                   /db_xref="PSEUDO:CAQ77698.1"
FT                   /inference="similar to sequence:UniProt:A1RLT8"
FT   repeat_region   complement(13883..15327)
FT                   /note="VSa9"
FT   CDS_pept        complement(14049..15239)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0014"
FT                   /old_locus_tag="TVS3131"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77699"
FT                   /db_xref="GOA:B6EHE4"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EHE4"
FT                   /protein_id="CAQ77699.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHLS
FT                   VTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYYELDLSSEECPYIRNKTDWS
FT                   RFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLDH
FT                   RTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIEA
FT                   EPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   misc_feature    complement(order(15269..15413,15409..15899))
FT                   /locus_tag="VSAL_I0013"
FT                   /note="HMMPfam hit to PF03050, Transposase IS66
FT                   family,score 1.4e-30"
FT                   /inference="protein motif:HMMPfam:PF03050"
FT   CDS_pept        complement(16295..16642)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0015"
FT                   /old_locus_tag="TVSb0112"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77700"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77700.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        complement(16639..16953)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0016"
FT                   /old_locus_tag="TVS3135"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77701"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77701.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   repeat_region   complement(17011..17034)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(17172..18809)
FT                   /transl_table=11
FT                   /gene="groL1"
FT                   /locus_tag="VSAL_I0017"
FT                   /old_locus_tag="TVS3136"
FT                   /product="60 kda chaperonin 1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77702"
FT                   /db_xref="GOA:B6ENX0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX0"
FT                   /experiment="The expressed protein is found to be
FT                   associated with the outer membrane in Aliivibrio
FT                   salmonicida"
FT                   /protein_id="CAQ77702.1"
FT                   /translation="MAAKDVKFGNDARIKMLEGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQAIIAEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEALKDLSVPCADTKAIAQVGTISANSDYTVGNLIA
FT                   EAMEKVGRDGVITVEEGQSLQDELDVVEGMQFDRGYLSPYFVNNQEAGSVDLDSPFILL
FT                   VDKKVSNIRELLPTLEAVAKASRPLLIIAEDIEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAALTAGSVISEEIGLELEKVVLEDLGQAKRVTITKETTTIIDGAGDET
FT                   IISGRVSQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAASKVVNLEGDNEEQTVGIRLALRAMEAPLRQIVKNA
FT                   GEEDSVVANNVRAGEDNYGYNAATGVYGDMIEMGILDPTKVTRSALQFAASVAGLMITT
FT                   EAMITDKPQDSSSSMPDMGGMGGMGGMM"
FT   misc_feature    complement(17235..18743)
FT                   /gene="groL1"
FT                   /locus_tag="VSAL_I0017"
FT                   /note="HMMPfam hit to PF00118, TCP-1/cpn60 chaperonin
FT                   family, score 9.5e-194"
FT                   /inference="protein motif:HMMPfam:PF00118"
FT   misc_feature    complement(17562..17597)
FT                   /gene="groL1"
FT                   /locus_tag="VSAL_I0017"
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT                   /inference="protein motif:ProSite:PS00296"
FT   misc_feature    complement(18141..18173)
FT                   /gene="groL1"
FT                   /locus_tag="VSAL_I0017"
FT                   /note="PS00284 Serpins signature."
FT                   /inference="protein motif:ProSite:PS00284"
FT   CDS_pept        complement(18902..19189)
FT                   /transl_table=11
FT                   /gene="groS1"
FT                   /locus_tag="VSAL_I0018"
FT                   /old_locus_tag="TVS3137"
FT                   /product="10 kDa chaperonin 1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77703"
FT                   /db_xref="GOA:B6ENX1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ENX1"
FT                   /protein_id="CAQ77703.1"
FT                   /translation="MNIRPLHDRVIVERQESESKSAGGIVLTGSAAEKSTRGIILAVGN
FT                   GRILENGSVQPLDVKVGDSVIFAEGNIKAEKIDGKEVLIMSEYNILAIVE"
FT   misc_feature    complement(18908..19186)
FT                   /gene="groS1"
FT                   /locus_tag="VSAL_I0018"
FT                   /note="HMMPfam hit to PF00166, Chaperonin 10 Kd
FT                   subunit,score 3e-36"
FT                   /inference="protein motif:HMMPfam:PF00166"
FT   misc_feature    complement(19109..19183)
FT                   /gene="groS1"
FT                   /locus_tag="VSAL_I0018"
FT                   /note="PS00681 Chaperonins cpn10 signature."
FT                   /inference="protein motif:ProSite:PS00681"
FT   repeat_region   complement(19550..20988)
FT                   /note="VSa9"
FT   CDS_pept        complement(19716..20909)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0019"
FT                   /old_locus_tag="TVS3138"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77704"
FT                   /db_xref="GOA:B6ENX2"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX2"
FT                   /protein_id="CAQ77704.1"
FT                   /translation="MHAYKPLKQLFNSQNNGLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHL
FT                   SVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYYELDLSSEECPYIRNKTDW
FT                   SRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLD
FT                   HRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIE
FT                   AEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        21269..21523
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0020"
FT                   /old_locus_tag="TVS3139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77705"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX3"
FT                   /protein_id="CAQ77705.1"
FT                   /translation="MKFSRVKEGEFKRLVETKTITTLIAQESNNEHNKFSLFGIDEKNQ
FT                   LGYAVRHGRVDELRTWRLDILSAFVKSLGFKSIEVYFSK"
FT   CDS_pept        22530..23489
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0021"
FT                   /old_locus_tag="TVS3141"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77706"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX4"
FT                   /protein_id="CAQ77706.1"
FT                   /translation="MTYSTTINSTITKETEATKARAGYPKNEMVKKRKTTKKRAVVKVS
FT                   KDIYQMVTDRIIAALESGVKPWACPWDRTNECSMLPMNFKTKANYSGVNILLLWSETVM
FT                   KGFTSPYWLTYNQAVELGGNVIKGQKGTPIIYYKNWEKENDDGKTEIIPMLKTFTVFNL
FT                   DQVEGIEKPAVTVAEVREKNEFVTLDHVVEAINATGIKINHCGIRAFYSSAHDEITLPM
FT                   VDRFNSSYDYYATTWHELVHATGHKTRLDRNLKNSFGSKDYAFEELIAELGAEFCCADL
FT                   GIVGEVQHESYIASWLERLNGDKKFIFKAASQARRING"
FT   misc_feature    22662..23012
FT                   /locus_tag="VSAL_I0021"
FT                   /note="HMMPfam hit to PF08401, Domain of unknown function
FT                   (DUF1738), score 2.3e-68"
FT                   /inference="protein motif:HMMPfam:PF08401"
FT   repeat_region   complement(23773..25188)
FT                   /note="VSa9"
FT   CDS_pept        complement(23916..25109)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0022"
FT                   /old_locus_tag="TVS3142"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77707"
FT                   /db_xref="GOA:B6EGT7"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGT7"
FT                   /protein_id="CAQ77707.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHL
FT                   SVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYDELDLSSEECPYIRNKTDW
FT                   SRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLD
FT                   HRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIE
FT                   AEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        25189..26034
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0023"
FT                   /old_locus_tag="TVS3143"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77708"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX6"
FT                   /protein_id="CAQ77708.1"
FT                   /translation="MILTSLIDNTRLNNRTDLAIERGLSIHASTMGKSILFDAGSSEAF
FT                   CDNATLLNVDISNVDAAVISHRHHDHCNGVTHFLDRNSKAPVYFRECEETNYLFKTFGF
FT                   KNNVGINKQLLVKGASRLTFVNQMTEISPNIFIITDLSNKYAKSKGNQYLFTESDGCCK
FT                   PDSFDHELLLVVKENDGLIVFTGCAHSGVLNMIDTAISHFPNTKIKAVVGGFHLVGLPL
FT                   FNSIGGTKKQIEEIGESILNYPIDKLYTGHCTGMKAYHILKGVLGDRLEYFPTGRSITI
FT                   "
FT   misc_feature    25252..25944
FT                   /locus_tag="VSAL_I0023"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 3.8e-05"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        26437..26988
FT                   /transl_table=11
FT                   /gene="cyaB"
FT                   /locus_tag="VSAL_I0024"
FT                   /old_locus_tag="TVS3144"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77709"
FT                   /db_xref="GOA:B6ENX7"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX7"
FT                   /protein_id="CAQ77709.1"
FT                   /translation="MSEHFEGKFEVELKYRLKSKSQFLTILNSMMYEVMLEDNLESDCY
FT                   FDTPEQVLLAENKSLCIREMEPSGIKLWIVKGPEADHCEATNITDTNKAKSMLNTMGYH
FT                   VVLAMKKTRSIYFVGKFHITIDNLNGLGDFAEFAIMTDDESLLESYRSELIVLASKFGL
FT                   SSTDLEHRSYRKMYSESLTV"
FT   misc_feature    26458..26973
FT                   /gene="cyaB"
FT                   /locus_tag="VSAL_I0024"
FT                   /note="HMMPfam hit to PF01928, CYTH domain, score 3.1e-26"
FT                   /inference="protein motif:HMMPfam:PF01928"
FT   CDS_pept        27382..27747
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0025"
FT                   /old_locus_tag="TVS3145"
FT                   /product="putative exported protein"
FT                   /note="Expression may be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77710"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX8"
FT                   /protein_id="CAQ77710.1"
FT                   /translation="MKFISKVIFITCSIAFGCVANESIEPTSILLTYDSSFVLAAIQQD
FT                   RKFLAVENNDEGSLELSGLVTKQYSDYLVDVVVAQERKYNQSSREIKTTILVREDQIGK
FT                   PIVLGSVNNEKFTFTLK"
FT   sig_peptide     27382..27441
FT                   /locus_tag="VSAL_I0025"
FT   misc_feature    27472..27504
FT                   /locus_tag="VSAL_I0025"
FT                   /note="PS00284 Serpins signature."
FT                   /inference="protein motif:ProSite:PS00284"
FT   CDS_pept        27776..28180
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0026"
FT                   /old_locus_tag="TVS3146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77711"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENX9"
FT                   /protein_id="CAQ77711.1"
FT                   /translation="MEVLARFSFPHEAHIAKASLEAAGIGSVIADEHTVNAQWLYSNAV
FT                   GGVRLMVNEADVEMALSIINTDFSEAVINSPETEIIKNCCPNCGSEDLVLFTKGKKPAF
FT                   VVFILLGFPLFFFKHGYKCQGCNEFIQKVE"
FT   CDS_pept        28436..29215
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0027"
FT                   /old_locus_tag="TVS3147"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Escherichia coli o157:h- Plasmid pSFO157
FT                   Wb0013. UniProt:Q8VU43 (262 aa) fasta scores:
FT                   E()=2.3e-08,24.254% id in 268 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77712"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY0"
FT                   /inference="similar to sequence:UniProt:Q8VU43"
FT                   /protein_id="CAQ77712.1"
FT                   /translation="MLLWHYTSVEVLSSILGQAKPTLRATHINYLNDSVELKHGLDAIK
FT                   NILIKTHDPSVNDIVEDINELLDDNYDPHIFSFSLSEAKDSLYQWLAYCPSNGGVSLGF
FT                   EFSDTMVMEDVICVKNAFELPLPNYPSSQIPQYRKCNYFLSEIDIKTDWYRPQNGKTTK
FT                   ANLLTNAMFLKHSAFHFEQEHRLFFHPMPNSQFYVPAKFQGSKPYVDFHFDPKILKYVC
FT                   VSPRGNKDIGVKIVKKILSTYGFNHVEVIVSSIPFRE"
FT   CDS_pept        29602..30555
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0028"
FT                   /old_locus_tag="TVS3148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77713"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY1"
FT                   /protein_id="CAQ77713.1"
FT                   /translation="MRTRIYIDGYNFYYGCLKGTPYKWLDLVKLFEEHIIPRSDVYNAT
FT                   LHDNVGIKYFTAEITNKAAADPNSVNDQRSYHHALYLHSENLLKTIKGSYAVDKVEYPK
FT                   VEYYEAGIEKEPKDCARVKVWKLEEKQSDVNIAIEAVYDAVMDHTLEQIIFVTNDTDIV
FT                   PALEKIREHNQKSLRSPIKIGLVIPSKENNEYRKPNKSLSNLADWTVKYIKNSELSESQ
FT                   LPCRIAGRKSSAIKPTSWFKYNQKVEEILEILAASDVLKTIPRAWRWLSEPKPEVKDLP
FT                   ILTSTPDQLLDCEKDIEDVLEHVKAFALYMREKNKS"
FT   repeat_region   complement(30791..31828)
FT                   /note="VSa17"
FT   CDS_pept        complement(30807..31769)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0029"
FT                   /old_locus_tag="TVS3149"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77714"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY2"
FT                   /protein_id="CAQ77714.1"
FT                   /translation="MSKKNTTTPHDGLFKAFLTTPDTAKDMLEIHLPTHLKTLCDLSTL
FT                   KLESGSFLEDDLRPYYSDVLYSMKTECGDGYIYALIEHQSSPDEHMAFRMFRYAIAAMQ
FT                   KHLDAGNKDLPLVVPLLFYHGKTSPYPYSMNWLDCFTKPEMAKALYNNDFPLVDVTVMD
FT                   DSEIMQHKRIALLELVQKHIYQKDINDILESLAILLLNDYHTDSQVRTLIEYLVTVGET
FT                   QNVNTLLEELAQQVPKHEGTLMTIAEQLILQGEQKGLQQGLQQGRQEGEQKGRQEGRQE
FT                   GRQDTLKEMARNLLLSGVDKDAIMKATGFSSRELELISH"
FT   misc_feature    complement(30876..31766)
FT                   /locus_tag="VSAL_I0029"
FT                   /note="HMMPfam hit to PF04754, Putative
FT                   transposase,YhgA-like, score 1.2e-176"
FT                   /inference="protein motif:HMMPfam:PF04754"
FT   repeat_region   complement(31802..31828)
FT                   /note="IR of VSa17"
FT   CDS_pept        32166..32456
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0030"
FT                   /old_locus_tag="TVS3150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77715"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY3"
FT                   /protein_id="CAQ77715.1"
FT                   /translation="MRLTMGTTINSKNLSEQIFNFLRENKKASIRELIELTGESRQRVQ
FT                   STISGLRVKSENSDYKILSRNENIGEVTYEYTPQEKNQFQRCEQLLKSIFC"
FT   CDS_pept        33193..35412
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0031"
FT                   /old_locus_tag="TVS3151"
FT                   /product="putative cell wall degradation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77716"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031922"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY4"
FT                   /protein_id="CAQ77716.1"
FT                   /translation="MKVDDRKFVNAYYPWNEELAREAKADTPHHEPIKEKLVETAAFEY
FT                   SIEIACTLDELNTYQVGAFFLGKTKEEESISLWTKSQTDKGFSLLTASVKVNEPKSLTR
FT                   EFFISSGYSLTFNDVSPVKKGSGTHAESFVLIKPSIQIYNRLAWPKVGFFYHFINDELE
FT                   NEYPLSGGDKWSFKVTYSKGKTLSSDLLSEHEYAFILLPWKIDNTVISRQHLLYTKEKM
FT                   TQEQLSEINDQWLDESACLINPDEVVTARSDKIVLREKEDNGRITYTVQSGDTLGLIAK
FT                   KQGITYDGLLALNPQITNPDLIQVDDVVTIKDTPPEQESIQFHVCKIKSETGQRETWGE
FT                   IAEQHGMGAKELYDLNADNPMHKDGALALDNELRVKNTAQSEALDVVYRNAQSPEDVSG
FT                   DKWVFSFANVWSVIEKPFSDVAHMFVQDDTALNKNTCVIKVNSIRLHSKILSGSDGLEA
FT                   IAQEKKGAIKKGDKDAPKSNEIKTIQEALLALNFDLGKYGADGDFGSGTEQAVIDFQRE
FT                   FVPTHEVHPEYEMKKSDGVVGNQTLLALDEAVTIEWKYIRKCKLMIDHHFIQLLEGTKK
FT                   EGYVPMPDKSQSGVTIGSGFDLGARNVNDLISMGLPESLVEKFTPYLGLKKYEAVNKLK
FT                   ALPLSLTEADLSVVEATVKKSETDKIIKLFNSSSKVKFECLPANAQTVVASVAYQYGYL
FT                   PRRAEKFWEQAINQDWNGMYDNLMAFGDDFEVRRHKEAKLIKEIL"
FT   misc_feature    33376..33399
FT                   /locus_tag="VSAL_I0031"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    33994..34128
FT                   /locus_tag="VSAL_I0031"
FT                   /note="HMMPfam hit to PF01476, LysM domain, score 1.9e-14"
FT                   /inference="protein motif:HMMPfam:PF01476"
FT   misc_feature    34618..34839
FT                   /locus_tag="VSAL_I0031"
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain, score 6.9e-08"
FT                   /inference="protein motif:HMMPfam:PF01471"
FT   CDS_pept        35412..35801
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0032"
FT                   /old_locus_tag="TVS3152"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77717"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY5"
FT                   /protein_id="CAQ77717.1"
FT                   /translation="MKKLLLLMYVFSCSVSAFPMKDIYNNLDITSFNSSLMPLRKGEER
FT                   TFKDFNKKLPTPIFSEKNILLDDDYWTYSLTVIKASSDNDYYVCFKDKAKMGTYDSQKP
FT                   MIIRKYERYYVAISSSSNVCDDYAK"
FT   sig_peptide     35412..35462
FT                   /locus_tag="VSAL_I0032"
FT   CDS_pept        complement(35944..36303)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0033"
FT                   /old_locus_tag="TVS3153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77718"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY6"
FT                   /protein_id="CAQ77718.1"
FT                   /translation="MDKLFKVVSNGIYEIVDNACNHNTIATPLSQKAFSPLAYMSEMMV
FT                   PNDMPMKMHDFAARCINLIGLSCQIMNTHQSNFKTTDTYLICKSFISNVCDELEMPSNS
FT                   YQRQYWLEQIDNKLL"
FT   CDS_pept        complement(36382..37035)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0034"
FT                   /old_locus_tag="TVS3154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77719"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENY7"
FT                   /protein_id="CAQ77719.1"
FT                   /translation="MPSNYWVAFPNTHIGIEEVKFLEEIATPSEVPAYIYPLNSNMIKI
FT                   MNNRLLSSGLAEMSFSEKQWVVVSTATLLPLESFTELSEAKDFVFKQFPQTKSIRSDCL
FT                   GILSSEPDYTQLPVLTIYDEKIWEDYLLELENKHGFLFSEEYLLGDLLQKLIVEHQAPK
FT                   EIYQEFNDFNAIEKAIDFIKKNQLIGYQCAISVITQFSEKLSRIDSQRSMLEID"
FT   repeat_region   complement(37110..38545)
FT                   /note="VSa9"
FT   CDS_pept        complement(37276..38466)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0035"
FT                   /old_locus_tag="TVS3156"
FT                   /old_locus_tag="TVS3155"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77720"
FT                   /db_xref="GOA:B6EMK7"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMK7"
FT                   /protein_id="CAQ77720.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHLS
FT                   VTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYDELDLSSEECPYIRNKTDWS
FT                   RFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLDH
FT                   RTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIEA
FT                   EPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        38547..39242
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0036"
FT                   /old_locus_tag="TVS3157"
FT                   /product="toxin coregulated pilus biosynthesis protein I
FT                   (Tcp pilus biosynthesis protein TcpI) (fragment)"
FT                   /note="Similar to C-terminal part of Vibrio cholerae Toxin
FT                   coregulated pilus biosynthesis protein I TcpI
FT                   UniProt:P29486 (620 aa) fasta scores: E()=1.4e-24, 46.552%
FT                   id in 232 aa. CDS is truncated by the insertion of the
FT                   upstream IS element and subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:P29486"
FT   misc_feature    38547..39239
FT                   /locus_tag="VSAL_I0036"
FT                   /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
FT                   protein (MCP) s, score 1.4e-40"
FT                   /inference="protein motif:HMMPfam:PF00015"
FT   CDS_pept        39505..40020
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0037"
FT                   /old_locus_tag="TVS3158"
FT                   /product="putative exported protein (fragment)"
FT                   /note="Similar to Shewanella frigidimarina ncimb 400
FT                   Hypothetical protein precursor UniProt:Q3NML9 (287 aa)
FT                   fasta scores: E()=2.8e-36, 56.614% id in 189 aa. CDS is
FT                   truncated by the insertion of the downstream IS element and
FT                   subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:Q3NML9"
FT   sig_peptide     39505..39570
FT                   /locus_tag="VSAL_I0037"
FT   repeat_region   40023..41027
FT                   /note="VSa6"
FT   repeat_region   40023..40041
FT                   /note="IR of VSa6"
FT   CDS_pept        40119..41000
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0038"
FT                   /old_locus_tag="TVS3159"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77723"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B6EH02"
FT                   /protein_id="CAQ77723.1"
FT                   /translation="MNKLVDIFCDVDDFCYQFLSQWEKYLVEASERKRKRQSVMSTSEC
FT                   MTIVIAFHQSNHRDFKNFYIGLVHQYWKGYFPNLLSYTRFVSKMPSLIAPMCAYFQSIK
FT                   GKPTGIAFVDSTSLKVCHNIRIPRHKVFDGVAKRGKGTMGWFFGFKLHLLINHLGEIIS
FT                   LKITAGNVNDRTPVPDLCKELSGKLYADKGYIGKKLSESLKNSDVDLVTTSRKNMKAKE
FT                   ISAFDKAMLSKRYIIETINDQLKNISQIEHSRHRSVTGFMLNVISGVVAYCLKKQKPRI
FT                   KLSECEFELILA"
FT   misc_feature    40446..40940
FT                   /locus_tag="VSAL_I0038"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   9.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   41009..41027
FT                   /note="IR of VSa6"
FT   repeat_region   41228..42253
FT                   /note="VSa17"
FT   CDS_pept        41289..42239
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0039"
FT                   /old_locus_tag="TVS3161"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77724"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ0"
FT                   /protein_id="CAQ77724.1"
FT                   /translation="MNKKNTSTPHDGLFKAFLSKPDTAKDMLETHLPAHLQTLCDLSTL
FT                   KLESGTFLEDDLRPYYSDVLYSMKTECGDGYIYALIEHQSSPDEHMAFRMFRYAIAAMQ
FT                   KHLDAGNKELPLVVPLLFYHGKTSPYPYSMNWLDCFTNPDMAKILYSNNFPLVDVTVMD
FT                   DSEIMQHKRIALLELVQKHIYQKDIIEIIKPLAILLSNDYHTDSQIRTLIEYLVTVGES
FT                   QNVSTLLEELAQQVPKHEGVLMTIAEQLIQQGEQKGLLRGEQTGLKKGLEKGLEKGRQD
FT                   TLNEMARNLLQSGVDKDVIMKATGFSSRELELLSH"
FT   misc_feature    41292..42170
FT                   /locus_tag="VSAL_I0039"
FT                   /note="HMMPfam hit to PF04754, Putative
FT                   transposase,YhgA-like, score 3.7e-173"
FT                   /inference="protein motif:HMMPfam:PF04754"
FT   repeat_region   42661..44099
FT                   /note="VSa9"
FT   CDS_pept        42740..43933
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0040"
FT                   /old_locus_tag="TVS3162"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77725"
FT                   /db_xref="GOA:B6ENZ1"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ1"
FT                   /protein_id="CAQ77725.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDVGIFYALHTYGRKLNWNTHLHL
FT                   SVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYYELDLSSEECPYIRNKTDW
FT                   SRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLD
FT                   HRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIE
FT                   AEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        complement(44102..44461)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0041"
FT                   /old_locus_tag="TVS3163"
FT                   /product="acetolactate synthase isozyme II large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli Acetolactate synthase
FT                   isozyme II large subunit IlvG UniProt:P00892 (548 aa) fasta
FT                   scores: E()=9.5e-32, 77.500% id in 120 aa. CDS is truncated
FT                   by the insertion of the downstream IS element and
FT                   subsequent recombination events (fragment)"
FT                   /inference="similar to sequence:UniProt:P00892"
FT   misc_feature    complement(44102..44461)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0041"
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-termina, score 8.9e-44"
FT                   /inference="protein motif:HMMPfam:PF02776"
FT   misc_feature    complement(44192..44284)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0041"
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00044"
FT   misc_feature    complement(44261..44326)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0041"
FT                   /note="Predicted helix-turn-helix motif with score 987.000,
FT                   SD 2.55 at aa 46-67, sequence HEQGAAMAAIGMARSTKSVAVC"
FT   CDS_pept        44867..46393
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0042"
FT                   /old_locus_tag="TVS3164"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77727"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ2"
FT                   /protein_id="CAQ77727.1"
FT                   /translation="MGLAIIHSRACVGVEAPEVTVEVHISNGMPGFNLVGLPETTVKEA
FT                   KDRVRSAIINSNFEFPSKKITVNLAPADLPKEGGRFDLPIALGILAASDQIPNHKLKDH
FT                   EFVGELALSGELRRVKGVLPAALASLKANRSLIVPDENGDQAALVGANVHKSAPHLLSV
FT                   CGFLCGQQQLGLFTSPVIEHIDLPLERDLQDIIGQQQGKRALEIAAAGGHNLLYLGPPG
FT                   TGKTMLASRMSDLLPEMTNDEALETAAVASLTHQHINESNWRTRPFRSPHHSSSMAALV
FT                   GGGSIPRPGEISLAHNGILFLDEMPEFERKVLDSLREPLESGEIIISRVASKMRFPARF
FT                   QLVGALNPSPTGYYEGNNTRTNPQLILRYLNRISGPLLDRFDMSLEIPLLPKGTLTEGG
FT                   DRGESSLQVKERVRLARVKMLERSGKINALLSSREVETYCPLEKEDAVFLEDTLYRLGL
FT                   SIRAYHRIIKVARTIADLSGSENIQRIHLGEAVGYRAMDRLLKQLSAQAV"
FT   misc_feature    45437..46051
FT                   /locus_tag="VSAL_I0042"
FT                   /note="HMMPfam hit to PF01078, Magnesium chelatase,subunit
FT                   ChlI, score 2.1e-138"
FT                   /inference="protein motif:HMMPfam:PF01078"
FT   misc_feature    45506..46033
FT                   /locus_tag="VSAL_I0042"
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various ce, score 3.9e-05"
FT                   /inference="protein motif:HMMPfam:PF07728"
FT   misc_feature    45521..45544
FT                   /locus_tag="VSAL_I0042"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    45734..45781
FT                   /locus_tag="VSAL_I0042"
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT                   /inference="protein motif:ProSite:PS00676"
FT   CDS_pept        46481..47350
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0043"
FT                   /old_locus_tag="TVS3165"
FT                   /product="putative acyltransferase"
FT                   /note="Similar to Escherichia coli Probable acyltransferase
FT                   YihG UniProt:P32129 (310 aa) fasta scores: E()=5.3e-48,
FT                   42.612% id in 291 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77728"
FT                   /db_xref="GOA:B6ENZ3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ3"
FT                   /inference="similar to sequence:UniProt:P32129"
FT                   /protein_id="CAQ77728.1"
FT                   /translation="MKIFMFANIRLVISTLLVILNTALTSFIISFFAVIKFILPFPFVK
FT                   KLMVSMANKTLWCWATLNLWMLNINNTIDWVVDGGETLSQEKWYLLLSNHVSWADIVIL
FT                   SSVMKDKVPMTKFFLKYELLYVPFVGLACWGADMPFMRRNPERKDDDFKAIQKSCENFR
FT                   SVPTTVVNFVEGTRATPDKLKEARTPYQHLFKPKIGGVAFTLSAMGELFDGIVDVTLAY
FT                   PENQDSPFIDMLQGKLTKVVVRIKLHANDEKVNGDYFEDKVFRRGFHQWINELWKEKDE
FT                   YLQRILKR"
FT   sig_peptide     46481..46636
FT                   /locus_tag="VSAL_I0043"
FT   misc_feature    46517..46585
FT                   /locus_tag="VSAL_I0043"
FT   misc_feature    46700..47107
FT                   /locus_tag="VSAL_I0043"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   7.9e-18"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   CDS_pept        complement(47417..48040)
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="VSAL_I0044"
FT                   /old_locus_tag="TVS3166"
FT                   /product="thiol/disulfide interchange protein DsbA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77729"
FT                   /db_xref="GOA:B6ENZ4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ4"
FT                   /experiment="The expressed protein is found to be exported
FT                   (extracellular) by Aliivibrio salmonicida"
FT                   /protein_id="CAQ77729.1"
FT                   /translation="MDWRKLNMMKTMMALFGALVLSFSVNAANFTEGDYYKVLNLPESK
FT                   TPTVNEFFSFYCPHCNSFEPLIQGLKKTLPENATFKKTHVSFMGGKMGLSMSKAYATMV
FT                   SLGIEDKMVPVMFNRIHSMQKPPRNDKELRQIFLDEGVNADEFDGTYNSFAINSMVNRF
FT                   DKSFQDSGLTGVPALMVNNKYLVETSKIKSTEEYYELVNWLLKK"
FT   misc_feature    complement(47444..47899)
FT                   /gene="dsbA"
FT                   /locus_tag="VSAL_I0044"
FT                   /note="HMMPfam hit to PF01323, DSBA-like thioredoxin
FT                   domain, score 4.6e-30"
FT                   /inference="protein motif:HMMPfam:PF01323"
FT   misc_feature    complement(47948..48007)
FT                   /gene="dsbA"
FT                   /locus_tag="VSAL_I0044"
FT   sig_peptide     complement(47960..48040)
FT                   /gene="dsbA"
FT                   /locus_tag="VSAL_I0044"
FT   CDS_pept        complement(48066..49049)
FT                   /transl_table=11
FT                   /gene="rdoA"
FT                   /locus_tag="VSAL_I0045"
FT                   /old_locus_tag="TVS3167"
FT                   /product="putative phosphotransferase"
FT                   /note="Similar to Escherichia coli Protein RdoA
FT                   UniProt:P0C0K3 (328 aa) fasta scores: E()=1.9e-82, 56.707%
FT                   id in 328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77730"
FT                   /db_xref="GOA:B6ENZ5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ5"
FT                   /inference="similar to sequence:UniProt:P0C0K3"
FT                   /protein_id="CAQ77730.1"
FT                   /translation="MSEHAFNFSTLTPDLLWYALADIGVRAESGFLALNSYENRVYQFS
FT                   DEHKRRFVVKFYRPQRWSEAQILEEHLFAKQLVQQDIPVAAPLEINGKTLHFAKGYWFA
FT                   LFDSLGGRTFEVDNFDQLEWVGRFLGRIHKVGEAELFTHRPTVGLDEYLYQPRKLLENS
FT                   SFIPSYLENSFFSDLDLLISRIEQHWQPSKAIRLHGDCHPSNILWRDGPLFVDLDDARN
FT                   GPAAQDMWMLLNGDRQDKLVQLDILVEAYSEYCDFDHNQLKLIEPLRGLRMVHYMAWLA
FT                   KRWQDPAFPIAFPWFSDAKYWESQVLGFKEQIAALNEAPLELMPQW"
FT   misc_feature    complement(48255..48962)
FT                   /gene="rdoA"
FT                   /locus_tag="VSAL_I0045"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 5.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01636"
FT   CDS_pept        complement(49108..50526)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0046"
FT                   /old_locus_tag="TVS3168"
FT                   /product="putative ferredoxin"
FT                   /note="Expression may be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77731"
FT                   /db_xref="GOA:B6ENZ6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ6"
FT                   /protein_id="CAQ77731.1"
FT                   /translation="MSQDKIDIKDVTPKQFNPKTHKSSGDRFNPSTGIYVRQSKGTFQQ
FT                   LRRYGGWFLLALFVLTPWISFGDRQAILLDIGSQQFNFFGTTLFPQDLTLLALLFVIAA
FT                   FGLFFITTFLGRVWCGYLCPQTVWTFMYIWFEEKLEGSANKRRKQDQLPMTSSLLLRKT
FT                   LKHCAWIAIAIATGITFIGYFVPVKELVIDFFTLNIDFLPAFWILFFAACTYGNAGWMR
FT                   SIVCLHMCPYARFQSAMFDKDTYIVGYDPKRGESRGPRSRKKDHKALGLGDCIDCNLCV
FT                   QVCPTGIDIRDGLQYECINCGACIDACNETMDKMGYEKNLISYTTEHKLAGHKTHVMRP
FT                   KLIGYGIVMILMIGLFLAQIATVDPMGLDILRDRNQLSRMNNSGLIENTYTLKIINKTQ
FT                   QPQHYQLSVSGIENTTWYGPQNVNVKPGEVLSLPMSLGASSENLTKTITTIVFEIKNDD
FT                   EQVIKTESRFFKPL"
FT   misc_feature    complement(order(49438..49503,49855..49923,49966..50025,
FT                   50182..50250,50329..50382))
FT                   /locus_tag="VSAL_I0046"
FT   misc_feature    complement(49657..49728)
FT                   /locus_tag="VSAL_I0046"
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain,score
FT                   0.0013"
FT                   /inference="protein motif:HMMPfam:PF00037"
FT   misc_feature    complement(49672..49707)
FT                   /locus_tag="VSAL_I0046"
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00198"
FT   CDS_pept        complement(50752..51015)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0047"
FT                   /old_locus_tag="TVS3169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77732"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ7"
FT                   /protein_id="CAQ77732.1"
FT                   /translation="MKCHRVNELIELIHPEWKKEPELNLMQFIVKLAEETKYEGKIEDL
FT                   TDDILIYHLKMRNSKKTDMIPGLAKDHETDFKTAILKARGLL"
FT   misc_feature    complement(50755..51015)
FT                   /locus_tag="VSAL_I0047"
FT                   /note="HMMPfam hit to PF06288, Protein of unknown function
FT                   (DUF1040), score 1.3e-47"
FT                   /inference="protein motif:HMMPfam:PF06288"
FT   CDS_pept        51533..52318
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0048"
FT                   /old_locus_tag="TVS3170"
FT                   /product="putative sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77733"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ8"
FT                   /protein_id="CAQ77733.1"
FT                   /translation="MSFLKKTLASLGIGSANVDTIIHHEALIPGQKIKITIDITGGATA
FT                   QSIDNIELKLCCQYKKEVERQGENNSREAIIKQTYVLADWSLPYAFTIKPKQQRQFDID
FT                   LDLPLNTPITIGETKVWVETGLDISLGLDPTDKDPITVRPDELFEGVLSALEGEGLRIR
FT                   QVECEAASGFELPFVQEFEFVPFDGPYHGRWRELEIIAYRDNDKLQLWFEVDRQQKGLS
FT                   GLLSTFIGSNELKRYLEIPSDTPPDIAGQQVIDFLNQTT"
FT   sig_peptide     51533..51586
FT                   /locus_tag="VSAL_I0048"
FT   misc_feature    51542..52213
FT                   /locus_tag="VSAL_I0048"
FT                   /note="HMMPfam hit to PF07070, SpoOM protein, score
FT                   5.7e-113"
FT                   /inference="protein motif:HMMPfam:PF07070"
FT   CDS_pept        52420..53067
FT                   /transl_table=11
FT                   /gene="hlyIII"
FT                   /locus_tag="VSAL_I0049"
FT                   /old_locus_tag="TVS3171"
FT                   /product="hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77734"
FT                   /db_xref="GOA:B6ENZ9"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENZ9"
FT                   /protein_id="CAQ77734.1"
FT                   /translation="MSTTTPYSKKEELANSLSHGLGLVFGVVALILLLVKANAVDADWL
FT                   TIASMSVYGASIILLFLASTLYHSIATPKAKRLLKTLDHCAIFLLIAGSYTPYLLVSLR
FT                   TPLAYWLMAVIWAIALIGIIGKIVFVYRFKKLSLITYLIMGWLSVIAVYQLVIHIDING
FT                   VILLGLGGVIYSLGVIFYVSKKIPYNHAIWHLFVLGGCVTQFLSIYYYVQPV"
FT   sig_peptide     52420..52536
FT                   /gene="hlyIII"
FT                   /locus_tag="VSAL_I0049"
FT   misc_feature    52438..53034
FT                   /gene="hlyIII"
FT                   /locus_tag="VSAL_I0049"
FT                   /note="HMMPfam hit to PF03006, Haemolysin-III related,score
FT                   5.2e-58"
FT                   /inference="protein motif:HMMPfam:PF03006"
FT   misc_feature    order(52456..52524,52567..52635,52672..52731,52744..52812,
FT                   52831..52890,52900..52968,52987..53055)
FT                   /gene="hlyIII"
FT                   /locus_tag="VSAL_I0049"
FT   repeat_region   53172..53195
FT                   /note="IR of VSa2"
FT   repeat_region   complement(53198..54636)
FT                   /note="VSa9"
FT   CDS_pept        complement(53364..54557)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0050"
FT                   /old_locus_tag="TVS3175"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77735"
FT                   /db_xref="GOA:B6EIP3"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EIP3"
FT                   /protein_id="CAQ77735.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHL
FT                   SVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYYELDLSSEECPYIRNKTDW
FT                   SRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLD
FT                   HRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIE
FT                   AEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        complement(54711..54920)
FT                   /transl_table=11
FT                   /gene="cspV"
FT                   /locus_tag="VSAL_I0051"
FT                   /old_locus_tag="TVS3176"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77736"
FT                   /db_xref="GOA:B6EP01"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP01"
FT                   /protein_id="CAQ77736.1"
FT                   /translation="MSKTTGIVKWFNEEKGFGFITQDNGGADVFVHFRAIASEGFKTLK
FT                   EGQKVSFEVEQGQKGPQASNVVGE"
FT   misc_feature    complement(54714..54914)
FT                   /gene="cspV"
FT                   /locus_tag="VSAL_I0051"
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain, score 8.9e-40"
FT                   /inference="protein motif:HMMPfam:PF00313"
FT   misc_feature    complement(54813..54872)
FT                   /gene="cspV"
FT                   /locus_tag="VSAL_I0051"
FT                   /note="PS00352 'Cold-shock' DNA-binding domain signature."
FT                   /inference="protein motif:ProSite:PS00352"
FT   CDS_pept        complement(55198..56730)
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="VSAL_I0052"
FT                   /old_locus_tag="TVS3177"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77737"
FT                   /db_xref="GOA:B6EP02"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP02"
FT                   /protein_id="CAQ77737.1"
FT                   /translation="MTTPSYQTGAEYLRQILRAPVYDVATVTQLQDMPRLSERIQNRVQ
FT                   LKREDRQPVHSFKLRGAYNMVSSLTEEQQKAGVIAASAGNHAQGMALSGTKLGIQTTIV
FT                   MPRTTPDIKVEAVKGFGGHVILHGRNFDEAKAEAERLATLHGYTFVPPFDHPLVIAGQG
FT                   TIGMEMLQQNGHLDYIFVPVGGGGLAAGVAVLIKQLMPEIKVIAVEPEDSACLKAALDA
FT                   GEPVVLDQVSMFADGVAVKRIGDETFRLCQQYIDGHITVSSDEICSAVKDIFEDTRAIA
FT                   EPSGALALAGLKKFADQHQLKDKQLSTVLSGANTNFHGLRYVSERCELGEKREGLLAVT
FT                   IPERQGAFFEFCNLIGGRAVTEFNYRYHDDKKANIFVGVRLQDGQEELNNIIHDLQQGD
FT                   YPVVDLSDDEMAKLHIRYMIGGKPLKPLKERLYSFEFPEYPGALVKFLSTLGTHWNISL
FT                   FNYRNHGADYGRVLCGFELRDSDLIDFSKHLEELGYQCKDETNNPAYQFFLS"
FT   misc_feature    complement(55204..55473)
FT                   /gene="ilvA"
FT                   /locus_tag="VSAL_I0052"
FT                   /note="HMMPfam hit to PF00585, C-terminal regulatory domain
FT                   of Threon, score 2.8e-38"
FT                   /inference="protein motif:HMMPfam:PF00585"
FT   misc_feature    complement(55486..55758)
FT                   /gene="ilvA"
FT                   /locus_tag="VSAL_I0052"
FT                   /note="HMMPfam hit to PF00585, C-terminal regulatory domain
FT                   of Threon, score 4.6e-39"
FT                   /inference="protein motif:HMMPfam:PF00585"
FT   misc_feature    complement(55792..56670)
FT                   /gene="ilvA"
FT                   /locus_tag="VSAL_I0052"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 4.8e-101"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    complement(56545..56586)
FT                   /gene="ilvA"
FT                   /locus_tag="VSAL_I0052"
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00165"
FT   CDS_pept        complement(56735..58207)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="VSAL_I0053"
FT                   /old_locus_tag="TVS3178"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="The CDS appears to have a deletion of 130 amino acid
FT                   residues after codon 297 in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77738"
FT                   /db_xref="GOA:B6EP03"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP03"
FT                   /protein_id="CAQ77738.1"
FT                   /translation="MSTTPKNRYRSATTTHGRNMAGARALWRATGVKEEDFGKPIIAVV
FT                   NSFTQFVPGHVHLKDMGQLVAGEIEKAGGIAKEFNTIAVDDGIAMGHGGMLYSLPSREL
FT                   IADSVEYMVNAHCADAMVCISNCDKITPGMMMAAMRLNIPVIFVSGGPMEAGKTKLSDQ
FT                   IIKLDLVDAMIQGADPTVSDAQSEQIERSACPTCGSCSGMFTANSMNCLTEALGLSQPG
FT                   NGSMLATHADREELFINAGKRIVTLTKRYYEQGDDSALPRNIANKAAFENAMALDIAMG
FT                   GSSNTVLHLIASAQEGGLAVLSGNIAVDGCIVKTAGVDEDNLKFQGPAIVFESQDTAVE
FT                   NILAGEVKAGNVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALLTDGRFSGGTSG
FT                   LSIGHASPEAASGGTIGLVKTGDIITIDIPNRSITLDVPEAELSERRAEQDKLGWKPVN
FT                   RQREVSFALKAYAMMATSADKGAVRDRSKLEG"
FT   misc_feature    complement(56756..58093)
FT                   /gene="ilvD"
FT                   /locus_tag="VSAL_I0053"
FT                   /note="HMMPfam hit to PF00920, Dehydratase family, score
FT                   4.3e-259"
FT                   /inference="protein motif:HMMPfam:PF00920"
FT   misc_feature    complement(57017..57052)
FT                   /gene="ilvD"
FT                   /locus_tag="VSAL_I0053"
FT                   /note="PS00887 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 2."
FT                   /inference="protein motif:ProSite:PS00887"
FT   misc_feature    complement(57734..57757)
FT                   /gene="ilvD"
FT                   /locus_tag="VSAL_I0053"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(57797..57829)
FT                   /gene="ilvD"
FT                   /locus_tag="VSAL_I0053"
FT                   /note="PS00886 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 1."
FT                   /inference="protein motif:ProSite:PS00886"
FT   CDS_pept        complement(58234..58482)
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="VSAL_I0054"
FT                   /old_locus_tag="TVS3179"
FT                   /product="putative acetolactate synthase small regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77739"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP04"
FT                   /protein_id="CAQ77739.1"
FT                   /translation="MQQRYILEIKATDKPVLLERVLRVIRHRGFAIKQVLATQNQSDGV
FT                   AAIEIIVESDRPISLLTNQIEKLWDITTVNVATLHRT"
FT   misc_feature    complement(58246..58470)
FT                   /gene="ilvM"
FT                   /locus_tag="VSAL_I0054"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 0.0058"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        complement(58486..59766)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0055"
FT                   /old_locus_tag="TVS3180"
FT                   /product="acetolactate synthase isozyme II large subunit
FT                   (fragment)"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli Acetolactate synthase
FT                   isozyme II large subunit IlvG UniProt:P00892 (548 aa) fasta
FT                   scores: E()=1.5e-100, 62.383% id in 428 aa. CDS is
FT                   truncated by the insertion of the downstream IS element and
FT                   subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:P00892"
FT   misc_feature    complement(58561..59007)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0055"
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-termina, score 2.8e-68"
FT                   /inference="protein motif:HMMPfam:PF02775"
FT   misc_feature    complement(58636..58659)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0055"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(58837..58896)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0055"
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT                   /inference="protein motif:ProSite:PS00187"
FT   misc_feature    complement(59125..59574)
FT                   /gene="ilvG"
FT                   /locus_tag="VSAL_I0055"
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central d, score 8.8e-49"
FT                   /inference="protein motif:HMMPfam:PF00205"
FT   repeat_region   59768..61206
FT                   /note="VSa9"
FT   CDS_pept        59847..61040
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0056"
FT                   /old_locus_tag="TVS3182"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77741"
FT                   /db_xref="GOA:B6EIP3"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EIP3"
FT                   /protein_id="CAQ77741.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRWLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHL
FT                   SVTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYYELDLSSEECPYIRNKTDW
FT                   SRFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLD
FT                   HRTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIE
FT                   AEPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        61632..62159
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0057"
FT                   /old_locus_tag="TVS3183"
FT                   /product="putative exported protein"
FT                   /note="Expression may be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77742"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP06"
FT                   /protein_id="CAQ77742.1"
FT                   /translation="MKKNILKISLITIISGCSHSHTIDIYTWVPENQSPKITTEKDINY
FT                   WNKKGYYDGACGWTLSTKISILPPPNSPDYIYGTEQIFEYDLSGKIITQWAAPANSYPI
FT                   AIQDDLMFIDSGLAISTDGQLKQMTFNKQKVVYSSCPENLDIDNSDYLRCAIFSDTLFV
FT                   KDRNIAYQAPCT"
FT   sig_peptide     61632..61691
FT                   /locus_tag="VSAL_I0057"
FT   CDS_pept        62442..63239
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0058"
FT                   /old_locus_tag="TVS3184"
FT                   /product="putative ParA chromosome partitioning protein"
FT                   /note="Similar to Bacillus subtilis Sporulation initiation
FT                   inhibitor protein Soj UniProt:P37522 (253 aa) fasta scores:
FT                   E()=1.6e-13, 32.389% id in 247 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77743"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP07"
FT                   /inference="similar to sequence:UniProt:P37522"
FT                   /protein_id="CAQ77743.1"
FT                   /translation="MGKIIAIGNEKGGVGKTTSVVNLAYYFSHMRNKKVLVVDMDPQCN
FT                   LTDKYFDQNDESKAKPASITRKVGEANVISFFDEEFYGKPVELNPNLHIFGATFNISSL
FT                   NNCTNDEIGFFADNLNTLAEQYDYVFIDTAPSVGNLQYSALIACDGLWIPTTAEEDSFQ
FT                   GVSKILKSVARIKSTYGLDVSVLGMYLNMVKKIPTQLQDHFATKLSEDYGDLVFNTQVI
FT                   HTTRVSEASAFKKSILEYDAKKAKYINIDALMQEFELKSEALS"
FT   misc_feature    62454..63128
FT                   /locus_tag="VSAL_I0058"
FT                   /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
FT                   nucleotide binding domai, score 1.2e-27"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   CDS_pept        63236..64210
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0059"
FT                   /old_locus_tag="TVS3185"
FT                   /product="putative chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77744"
FT                   /db_xref="GOA:B6EP08"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP08"
FT                   /protein_id="CAQ77744.1"
FT                   /translation="MSKKKDFKSLMNNKSKSLLDEEINEVKPGESVVLIPKEDIYSSEQ
FT                   IRKFFDEEYILELSKNMDDIGQIQPIVVTHNDIRGYKIQVGECRWRAANLSDKITHVEC
FT                   LVRDAGTVLAQLSENLHRNDLTPFETGRALELLMEEQGIVENKDLANVVSLSEPRISAF
FT                   RKAAQCPPYIELAYHNGIIRDVDTVNSLRIAGELSEVETKKLLESPVSRKEAKDLVKSL
FT                   KASQKELKSAQVDEEQSSLEHQEVANENPSNKADQTKVSGVIPTSQNNGIRISFEGNQG
FT                   FIDLNGQAESGKIVIVLDASSGKLTVPACEVSVIGYHSLEHVH"
FT   misc_feature    63332..63595
FT                   /locus_tag="VSAL_I0059"
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease
FT                   domain,score 1.9e-05"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   CDS_pept        64200..64604
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0060"
FT                   /old_locus_tag="TVS3186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77745"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP09"
FT                   /protein_id="CAQ77745.1"
FT                   /translation="MSTNKKKLSRVVNTNRASLIKLYSLHFEDSATQAIEQITIRAINR
FT                   TYVAYRPPPPGEVMKAWVIENRAPQWACRATFDLLIELDWLPNTDIEKAIAARFLFLND
FT                   YPITESWKALLGEWLELAKQAQNENSDEYE"
FT   CDS_pept        64789..65160
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0061"
FT                   /old_locus_tag="TVS3187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77746"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP10"
FT                   /protein_id="CAQ77746.1"
FT                   /translation="MNFSYEQRIKHLHELSQLPRQSLCFQLLMIMNLCHHDLDSGKVER
FT                   LKSDDETYFYEANSLKEQLLDVPSLSNSHKVLYLLLDAGFIERRVLDKDGQVVIGDSYQ
FT                   RNTAKIYWRISDKGLSVFG"
FT   CDS_pept        complement(65851..66444)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0062"
FT                   /old_locus_tag="TVS3189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77747"
FT                   /db_xref="InterPro:IPR021316"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP11"
FT                   /protein_id="CAQ77747.1"
FT                   /translation="MPHKEYDKLLLETVDNALLHLYMAVAKATQFMPKKTRNERVVKWL
FT                   KPKLTHSKYKLIKKEIKSFIQIGRHAKGDLERRLIELKSLSERVHHEMDDVSRIYDLLN
FT                   CLYDKHGIHSYLIDDHDTKKNETLYLSKQDIIECFSDDNKQIAPLSAFIVTLKVDEIAK
FT                   MINDTGLMKASIKEFNDETMIAHFQLNTIHCPEA"
FT   CDS_pept        complement(join(67138..67530,67532..68629))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0063"
FT                   /old_locus_tag="TVS3190"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /note="Similar to Photobacterium profundum Hypothetical
FT                   protein SA0089 UniProt:Q6LUB5 (478 aa) fasta scores:
FT                   E()=4.6e-147, 78.319% id in 452 aa. CDS contains a
FT                   frameshift after codon 366. The sequence has been checked
FT                   and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77748.1"
FT                   /inference="similar to sequence:UniProt:Q6LUB5"
FT   misc_feature    complement(68519..68572)
FT                   /locus_tag="VSAL_I0063"
FT   CDS_pept        68814..69041
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0064"
FT                   /old_locus_tag="TVS3192"
FT                   /product="hypothetical protein (fragment)"
FT                   /note="No significant database matches. CDS is probably
FT                   truncated by the insertion of the downstream IS element and
FT                   subsequent recombination events"
FT   repeat_region   69042..69804
FT                   /note="VSa18"
FT   CDS_pept        69062..69418
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0065"
FT                   /old_locus_tag="TVS3193"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77750"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP13"
FT                   /protein_id="CAQ77750.1"
FT                   /translation="MKMFVDISMIYLHKAPVDFRKGINGLSMIVEQQMVISPFSDALFV
FT                   FCNRQNDKIKVLYWDRNGFCLWQKRLEEDKFTWPKKMTGATVSLTEEQWHWLLNGLDID
FT                   KMQPHKSIHYQSLN"
FT   misc_feature    69077..69406
FT                   /locus_tag="VSAL_I0065"
FT                   /note="HMMPfam hit to PF05717, IS66 Orf2 like protein,score
FT                   7.1e-42"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   CDS_pept        69494..69790
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0066"
FT                   /old_locus_tag="TVS3194"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77751"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP14"
FT                   /protein_id="CAQ77751.1"
FT                   /translation="MNKKLSHKSNELVLLRALFAEKEAQNNELQLTVDKLNDALKESEA
FT                   RYQSLLEKMQLARHRQFGASSESLPKEDCVFNEAEEVSSDTLLMRILLSIKEH"
FT   CDS_pept        69805..71031
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0067"
FT                   /old_locus_tag="TVS3195"
FT                   /product="putative hemolysin/hemagglutinin-like protein
FT                   (fragment)"
FT                   /note="Similar to central part of Erwinia chrysanthemi
FT                   Hemolysin/hemagglutinin-like protein HecA UniProt:P94772
FT                   (3848 aa) fasta scores: E()=3.9e-08, 28.864% id in 440 aa.
FT                   CDS is truncated by the insertion of the upstream and
FT                   downstream IS elements and subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:P94772"
FT   misc_feature    69847..70014
FT                   /locus_tag="VSAL_I0067"
FT                   /note="HMMPfam hit to PF05594, Haemagluttinin repeat,score
FT                   0.36"
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    70021..70191
FT                   /locus_tag="VSAL_I0067"
FT                   /note="HMMPfam hit to PF05594, Haemagluttinin repeat,score
FT                   0.68"
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    70255..70914
FT                   /locus_tag="VSAL_I0067"
FT                   /note="HMMPfam hit to PF05594, Haemagluttinin repeat,score
FT                   3.5"
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   repeat_region   complement(71139..73455)
FT                   /note="VSa2"
FT   repeat_region   complement(71139..71162)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(join(71155..72354,72354..72644))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0068"
FT                   /old_locus_tag="TVSb0114"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella sp. (strain W3-18-1)
FT                   transposase is66. UniProt:A1RLT8 (EMBL:CP000503) (500 aa)
FT                   fasta scores: E()=2.2e-119, 56.7% id in 494 aa. CDS
FT                   contains a frameshift after codon 97"
FT                   /db_xref="PSEUDO:CAQ77753.1"
FT                   /inference="similar to sequence:UniProt:A1RLT8"
FT   CDS_pept        complement(72716..73063)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0069"
FT                   /old_locus_tag="TVSb0115"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77754"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77754.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        complement(73060..73374)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0070"
FT                   /old_locus_tag="TVS3199"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77755"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77755.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   repeat_region   complement(73432..73455)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(73457..74899)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="VSAL_I0071"
FT                   /old_locus_tag="TVS3200"
FT                   /product="Trk system potassium uptake protein (fragment)"
FT                   /note="The insertion of the downstream IS element truncates
FT                   the original translational stop codon of the CDS. There is
FT                   an inframe translational stop codon 8 amino acid residues
FT                   further downstream within the IS element. The extended CDS
FT                   may therefore be expressed and functional"
FT   misc_feature    complement(73463..74449)
FT                   /gene="trkH"
FT                   /locus_tag="VSAL_I0071"
FT                   /note="HMMPfam hit to PF02386, Cation transport
FT                   protein,score 1.6e-85"
FT                   /inference="protein motif:HMMPfam:PF02386"
FT   misc_feature    complement(order(73472..73540,73670..73738,73871..73939,
FT                   74027..74095,74132..74200,74303..74371,74432..74500,
FT                   74624..74692,74729..74797,74813..74881))
FT                   /gene="trkH"
FT                   /locus_tag="VSAL_I0071"
FT   misc_feature    complement(73814..73891)
FT                   /gene="trkH"
FT                   /locus_tag="VSAL_I0071"
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT                   /inference="protein motif:ProSite:PS00217"
FT   sig_peptide     complement(74771..74899)
FT                   /gene="trkH"
FT                   /locus_tag="VSAL_I0071"
FT   CDS_pept        complement(74902..76278)
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="VSAL_I0072"
FT                   /old_locus_tag="TVS3201"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77757"
FT                   /db_xref="GOA:B6EP18"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP18"
FT                   /protein_id="CAQ77757.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDKSSERLRELQDKYDL
FT                   RVVQGFASHPDTLREAGAQDADMLVAVTNSDETNMIACQIAFTLFNTPNRIARIRSPEY
FT                   LKEKERLFQSDAIPVDHLIAPEELVTGYIERLIEYPGALQVASFAEKKVSLVAVKAYYG
FT                   GPLVGNALSALRDHMPHIDTRVAAIFRQGRPIRPQGTTVIEADDEVFFVAASNHIRSVM
FT                   SELQRLERPYKRIMIVGGGNIGAGLAKRLEQNYSVKLIERNLKRAEQLSELLEESIVFC
FT                   GDAADQELLSEEHIDQVDVFIAVTNEDEANIMSAMLAKRMGAKKVMVLIQRSAYVDLVQ
FT                   GGVIDVAISPQQATISALLTHVRRADIVNVSSLRRGAAEAIEAIAHGDETTSKVVGKEV
FT                   QNIKLPPGTTIGAIVRGEEVLIAHDKTVIEQDDHVVMFLVDKKYVQDVERLFQPSPFFL
FT                   "
FT   misc_feature    complement(74923..75132)
FT                   /gene="trkA"
FT                   /locus_tag="VSAL_I0072"
FT                   /note="HMMPfam hit to PF02080, TrkA-C domain, score
FT                   7.3e-10"
FT                   /inference="protein motif:HMMPfam:PF02080"
FT   misc_feature    complement(75007..75579)
FT                   /gene="trkA"
FT                   /locus_tag="VSAL_I0072"
FT                   /note="HMMPfam hit to PF03807, NADP oxidoreductase coenzyme
FT                   F420-depen, score 0.0038"
FT                   /inference="protein motif:HMMPfam:PF03807"
FT   misc_feature    complement(75229..75576)
FT                   /gene="trkA"
FT                   /locus_tag="VSAL_I0072"
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   5.2e-34"
FT                   /inference="protein motif:HMMPfam:PF02254"
FT   misc_feature    complement(75601..75816)
FT                   /gene="trkA"
FT                   /locus_tag="VSAL_I0072"
FT                   /note="HMMPfam hit to PF02080, TrkA-C domain, score
FT                   4.2e-10"
FT                   /inference="protein motif:HMMPfam:PF02080"
FT   misc_feature    complement(75904..76272)
FT                   /gene="trkA"
FT                   /locus_tag="VSAL_I0072"
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   3.6e-36"
FT                   /inference="protein motif:HMMPfam:PF02254"
FT   CDS_pept        complement(76303..77637)
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="VSAL_I0073"
FT                   /old_locus_tag="TVS3202"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="Possible alternative translational start site after
FT                   codon 18"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77758"
FT                   /db_xref="GOA:B6EP19"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP19"
FT                   /protein_id="CAQ77758.1"
FT                   /translation="MANIVFAILFCQSYLGDDMNVRAAAAKVIYQVVDQGHSLSSALPK
FT                   AQSEIKPRDQALLQEICYGVLRFLPRLESVAQSLMDKPLKGKQRVFHHLILVGIYQLSF
FT                   MRIPAHAAVGETVEGTKNLKGPKLRGLINGVLRSYQRSQEELDAKSISHDSGKYGHPGW
FT                   LLKMLKEAYPTQWESIVEANNSKAPMWLRVNSQHHTRDEYIALLEKEEIAVTPHSQATD
FT                   ALLLDKARDVFTLPGFEKGWVSVQDAAAQLSVEYLQPQDGELILDCCAAPGGKTAHILE
FT                   RTKNTNVVAIDCDETRLTRVYENLERLNLEAKVICGDARHPEEWWQGEQFDRILLDAPC
FT                   SATGVIRRHPDIKWLRRSEDIKALAELQSEIFDAMWLQLKSGGTMVYATCSITPQENGD
FT                   QVKAFLERTENASLVDNTDPAKPGRQILPGEENMDGFYYAVLQKA"
FT   misc_feature    complement(76312..77103)
FT                   /gene="rsmB"
FT                   /locus_tag="VSAL_I0073"
FT                   /note="HMMPfam hit to PF01189, NOL1/NOP2/sun family, score
FT                   9.2e-104"
FT                   /inference="protein motif:HMMPfam:PF01189"
FT   misc_feature    complement(76612..76647)
FT                   /gene="rsmB"
FT                   /locus_tag="VSAL_I0073"
FT                   /note="PS01153 NOL1/NOP2/sun family signature."
FT                   /inference="protein motif:ProSite:PS01153"
FT   misc_feature    complement(77209..77583)
FT                   /gene="rsmB"
FT                   /locus_tag="VSAL_I0073"
FT                   /note="HMMPfam hit to PF01029, NusB family, score 1.7e-44"
FT                   /inference="protein motif:HMMPfam:PF01029"
FT   misc_feature    complement(77590..77625)
FT                   /gene="rsmB"
FT                   /locus_tag="VSAL_I0073"
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT                   /inference="protein motif:ProSite:PS00962"
FT   CDS_pept        complement(77686..78651)
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="VSAL_I0074"
FT                   /old_locus_tag="TVS3203"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="Possible alternative translational start site after
FT                   codon 6"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77759"
FT                   /db_xref="GOA:B6EP20"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP20"
FT                   /protein_id="CAQ77759.1"
FT                   /translation="MMTEVNLNKPLRIIFAGTPDFAARHLAALLDSHHEIIGVYTQPDR
FT                   PAGRGKKLTASPVKELALKHAIPVFQPENFKSDDAKQELADQNADLMVVVAYGLLLPQA
FT                   VLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLNITTL
FT                   PIEATDTSASMYNKLAELGPIALVNCLSDIANGNALAEKQNDEKANYAKKLSKEEAKID
FT                   WTMDAETIERCVRAFNPWPMSHFSVDDKAIKVWQSRVETYEGDATPGTIIQADKTGIYV
FT                   ATSSNAIVFEQLQVPGKKAMGVQDILNSRKEWFEVGNTLN"
FT   misc_feature    complement(77719..78009)
FT                   /gene="fmt"
FT                   /locus_tag="VSAL_I0074"
FT                   /note="HMMPfam hit to PF02911, Formyl
FT                   transferase,C-terminal domain, score 2.4e-38"
FT                   /inference="protein motif:HMMPfam:PF02911"
FT   misc_feature    complement(78082..78627)
FT                   /gene="fmt"
FT                   /locus_tag="VSAL_I0074"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   1.5e-63"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   CDS_pept        complement(78654..79163)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="VSAL_I0075"
FT                   /old_locus_tag="TVS3204"
FT                   /product="peptide deformylase (polypeptide deformylase)"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77760"
FT                   /db_xref="GOA:B6EP21"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP21"
FT                   /protein_id="CAQ77760.1"
FT                   /translation="MAVLEVLTFPDDRLRTVAKPVKTVTPEIQTFIDDMIETMYDEEGI
FT                   GLAATQVDFHQRIVVIDVSETRDEPMVLINPVITQKSGDDGIEEGCLSVPGAKGMVPRS
FT                   AEVSVTALDRDGNEFSFDADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIKEKLEKIK
FT                   KFNEKN"
FT   misc_feature    complement(78705..79157)
FT                   /gene="def"
FT                   /locus_tag="VSAL_I0075"
FT                   /note="HMMPfam hit to PF01327, Polypeptide
FT                   deformylase,score 2.9e-74"
FT                   /inference="protein motif:HMMPfam:PF01327"
FT   CDS_pept        79281..80342
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0076"
FT                   /old_locus_tag="TVS3205"
FT                   /product="putative cell wall degradation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77761"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP22"
FT                   /protein_id="CAQ77761.1"
FT                   /translation="MFKKMLILTSLFTTITLSPLSFSNEDKLMLKKDYPDTYTVEKGDT
FT                   LWDISALFLDNPWFWPKLWKINPDINNPHLIYPGDKLSLSWHNGNPVLSLKPLQKLSPK
FT                   TRIIEKEAVPTLAPSLVVPYLKSDRLIDDVNYRAAYRVLGTSDGRKFLSSNERVYVDGE
FT                   LSHKEWGIYRVINEFKRRDNKEKAYALKSIGTAELVDSTEEFSGLRVLKQQQEITINDI
FT                   VLPLDGKSNLSLTTTFYPLPAPTNSKASLLGSIDGGDYLAVNQVAVIDKGTNDGLQQGS
FT                   MFALKEKGYAVKGDKGEYHYDDENNKKSIQLPETVVGELIVIRPYESFSLALITRSETP
FT                   IHKRMIVTSPQTK"
FT   sig_peptide     79281..79349
FT                   /locus_tag="VSAL_I0076"
FT   misc_feature    79392..79535
FT                   /locus_tag="VSAL_I0076"
FT                   /note="HMMPfam hit to PF01476, LysM domain, score 7.1e-11"
FT                   /inference="protein motif:HMMPfam:PF01476"
FT   CDS_pept        80351..81460
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="VSAL_I0077"
FT                   /old_locus_tag="TVS3206"
FT                   /product="Smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77762"
FT                   /db_xref="GOA:B6EP23"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP23"
FT                   /protein_id="CAQ77762.1"
FT                   /translation="MFNSDKHLSAWLTLCFCPRIGGKVMSRLLAIDSVENIVKYDKDKL
FT                   QSIGLSCAQIAYIQAVNHEEVDKCLLWEDGDSLNTILTLSDPRYPKLLSEISAPPPVLF
FT                   VKGDVLALSEPQVAIVGSRNASLEGLECAKQFAASIVQHNYVVTSGLALGVDGYAHHGA
FT                   IEAKGQTIAVLGSGLNKVYPAKHRTLADRVIHNGALVSEFRPDSPPRADNFPRRNRIIS
FT                   GLSTGVLVVEAAERSGSLITARYANEQGREVFALPGSIHNPTAQGSNSLIKAGAKLVSS
FT                   PEDIFEEIGALTYCAISHQPSLFEQEVVTEQLPFPKVFATVGIEATPVDIIAERCQTPV
FT                   HEIMMQLLELELQGFITAVPGGYIKKRRG"
FT   misc_feature    80558..81190
FT                   /gene="smf"
FT                   /locus_tag="VSAL_I0077"
FT                   /note="HMMPfam hit to PF02481, SMF family, score 9.5e-93"
FT                   /inference="protein motif:HMMPfam:PF02481"
FT   CDS_pept        81463..81936
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0078"
FT                   /old_locus_tag="TVS3207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77763"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP24"
FT                   /protein_id="CAQ77763.1"
FT                   /translation="MMDVLMYLFETYIHSDIELTVDQEKLEDELLKAGFHQEAIYKALD
FT                   WLEDLAHLQETDSHEHIAKSTSTAMRIYTQQEIDGIDTVCRGFLLFLEQIKVLTCETRE
FT                   MVIEQVMTLETEDLSLDDLKWVILMVLFNVPGQESAYTQMEELLYTSDTGMTH"
FT   misc_feature    81463..81933
FT                   /locus_tag="VSAL_I0078"
FT                   /note="HMMPfam hit to PF04361, Protein of unknown function
FT                   (DUF494), score 4.5e-94"
FT                   /inference="protein motif:HMMPfam:PF04361"
FT   CDS_pept        81946..82515
FT                   /transl_table=11
FT                   /gene="yrdD"
FT                   /locus_tag="VSAL_I0079"
FT                   /old_locus_tag="TVS3208"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="Similar to Bacillus subtilis DNA topoisomerase 1
FT                   TopA UniProt:P39814 (691 aa) fasta scores:
FT                   E()=2e-10,32.258% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77764"
FT                   /db_xref="GOA:B6EP25"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP25"
FT                   /inference="similar to sequence:UniProt:P39814"
FT                   /protein_id="CAQ77764.1"
FT                   /translation="MSGKINKQLFQAHEHALDHESCPQCSGELAIRYGKRGPFLGCGNY
FT                   PECDYIRPLKSNDGHVVKELGIPCPECDSELVLRQGRYGMFIGCSSYPECSHIESLEQK
FT                   KEEPKELLACPSCHSGSLHEKQSRFGKTFYACDAYPVCRFVVNFAPEKGICQQCGFELL
FT                   LRKEIATGLKLVCADKKCSVVQDIKK"
FT   misc_feature    82000..82116
FT                   /gene="yrdD"
FT                   /locus_tag="VSAL_I0079"
FT                   /note="HMMPfam hit to PF01396, Topoisomerase DNA binding C4
FT                   zinc fing, score 3.6e-16"
FT                   /inference="protein motif:HMMPfam:PF01396"
FT   misc_feature    82141..82257
FT                   /gene="yrdD"
FT                   /locus_tag="VSAL_I0079"
FT                   /note="HMMPfam hit to PF01396, Topoisomerase DNA binding C4
FT                   zinc fing, score 4.2e-17"
FT                   /inference="protein motif:HMMPfam:PF01396"
FT   misc_feature    82285..82398
FT                   /gene="yrdD"
FT                   /locus_tag="VSAL_I0079"
FT                   /note="HMMPfam hit to PF01396, Topoisomerase DNA binding C4
FT                   zinc fing, score 3.1e-09"
FT                   /inference="protein motif:HMMPfam:PF01396"
FT   CDS_pept        complement(82555..83673)
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="VSAL_I0080"
FT                   /old_locus_tag="TVS3209"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit PurK"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77765"
FT                   /db_xref="GOA:B6EP26"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP26"
FT                   /protein_id="CAQ77765.1"
FT                   /translation="MMKVLVLGSGQLARMMSLASAPLNIDIIAYDVNNNKIVHPLTQQV
FT                   MDTTLEQTINSVDVITAEFEHIPYDILDICSQSGKFQPNPEAIKAGGDRRIEKTLLDNA
FT                   NVANATHHIITTKQEFLDSISSVGLPMVLKSALGGYDGKGQWRLKEASQIDHIWEEMNE
FT                   LIQSTPNQAIVAEQFIPFNREVSLIGARNKNGDIVTYPLTENVHVNGVLALSTALEGTS
FT                   LLQQQADDMFSAIVNELDYIGVLAIEFFDVDGQLLVNEIAPRVHNSGHWTQQGTDVCQF
FT                   EMHIRAVCNLPLVGAELIRSTAMINILGEDSLPKELLTMPHCHIHWYGKEKRVGRKMGH
FT                   INVCASSPEALEKELMALSELLDKNAFQVLSK"
FT   misc_feature    complement(82846..83397)
FT                   /gene="purK"
FT                   /locus_tag="VSAL_I0080"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   3.9e-65"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   sig_peptide     complement(83617..83673)
FT                   /gene="purK"
FT                   /locus_tag="VSAL_I0080"
FT   CDS_pept        complement(83673..84209)
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="VSAL_I0081"
FT                   /old_locus_tag="TVS3210"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77766"
FT                   /db_xref="GOA:B6EP27"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP27"
FT                   /protein_id="CAQ77766.1"
FT                   /translation="MLPTFYILPLSLSKEFTMKVGIIMGSKSDWPTMKLAAEMLERFNV
FT                   PYETKVVSAHRTPQLLADYATQAKDRGIKVIIAGAGGAAHLPGMAAAFTSIPVLGVPVQ
FT                   SKVLKGIDSLLSIVQMPKGIAVGTLAIGEAGAANAGILAAQIIGTSNEAVMAAVEAFRK
FT                   EQTDTVLANPDPSED"
FT   misc_feature    complement(83682..84158)
FT                   /gene="purE"
FT                   /locus_tag="VSAL_I0081"
FT                   /note="HMMPfam hit to PF00731, AIR carboxylase, score
FT                   4.8e-92"
FT                   /inference="protein motif:HMMPfam:PF00731"
FT   CDS_pept        84360..84917
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0082"
FT                   /old_locus_tag="TVS3211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77767"
FT                   /db_xref="GOA:B6EP28"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP28"
FT                   /protein_id="CAQ77767.1"
FT                   /translation="MKNLDQVVKALNNGGVIAYPTEGVFGVGCDPDNEFALHQLLKVKQ
FT                   RPREKGLILIAASIDQLLPYIDLAQLNNDQINRIKFTWPGPVTWIVPVNKNTLPLVTGQ
FT                   FDSIAVRVSAHPQVKAICSAFGKPITSTSANLSGYEPCRTVLEVEEQLGDLGVVVFQGE
FT                   IGNRTQPTEIRDAKTGETLRQG"
FT   misc_feature    84381..84914
FT                   /locus_tag="VSAL_I0082"
FT                   /note="HMMPfam hit to PF01300, yrdC domain, score 1.7e-55"
FT                   /inference="protein motif:HMMPfam:PF01300"
FT   CDS_pept        84984..85805
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="VSAL_I0083"
FT                   /old_locus_tag="TVS3212"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77768"
FT                   /db_xref="GOA:B6EP29"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP29"
FT                   /protein_id="CAQ77768.1"
FT                   /translation="MDKYAVFGHPIKQSKSPFIHTLFARQTIQPLEYVAIEAPVDGFLN
FT                   SVTHFFSNGGKGCNITVPFKEEAFQFADQLTDRAKLAGAVNTLKKLDDGIILGDNTDGE
FT                   GLVQDLLQYQVPLQDKRILLIGAGGAARGVLLPLLKQNPSSITVVNRTYEKAEALAEIF
FT                   SAYGAVEAVRMSDVTRSFDVIINSTSASLSGELPNISPVIFSKGSISYDMMYGKGKTVF
FT                   NQWALDNDVYQAYDGLGMLVGQAAESFTVWRGLRPSSKQILRELRKNLEGM"
FT   misc_feature    84999..85247
FT                   /gene="aroE"
FT                   /locus_tag="VSAL_I0083"
FT                   /note="HMMPfam hit to PF08501, Shikimate dehydrogenase
FT                   substrate bind, score 3.4e-29"
FT                   /inference="protein motif:HMMPfam:PF08501"
FT   misc_feature    85299..85652
FT                   /gene="aroE"
FT                   /locus_tag="VSAL_I0083"
FT                   /note="HMMPfam hit to PF01488, Shikimate / quinate
FT                   5-dehydrogenase, score 7.2e-27"
FT                   /inference="protein motif:HMMPfam:PF01488"
FT   CDS_pept        85879..86064
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0084"
FT                   /old_locus_tag="TVS3213"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Vibrio fischeri Hypothetical protein
FT                   UniProt:Q5E1R7 (87 aa) fasta scores: E()=7e-11, 65.000% id
FT                   in 60 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77769"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP30"
FT                   /inference="similar to sequence:UniProt:Q5E1R7"
FT                   /protein_id="CAQ77769.1"
FT                   /translation="MGNLIPCLVFVSWLASESGETITNELDALRIFEEYRFDIEEHAEA
FT                   LIEDEEFNASGEVEIK"
FT   CDS_pept        complement(86057..86602)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0085"
FT                   /old_locus_tag="TVS3214"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77770"
FT                   /db_xref="GOA:B6EP31"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP31"
FT                   /protein_id="CAQ77770.1"
FT                   /translation="MNSSLRSYKSTFPTIGLRSYIDSSSILIGDINIGDDCSVWPLVVA
FT                   RGDVNSIVIGQRTNIQDGSILHVTHKNPENPKGAPLLIGDDVTIGHKVMLHGCEIKDRV
FT                   LVGMGSIILDNAIIESDVMIGAGSLIPPNKILKSGYLYIGSPVKQVRSLSTDEIGFLKK
FT                   SAMNYVSFKNSYINEEAI"
FT   misc_feature    complement(86189..86242)
FT                   /locus_tag="VSAL_I0085"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 14"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(86243..86296)
FT                   /locus_tag="VSAL_I0085"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 4"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(86312..86365)
FT                   /locus_tag="VSAL_I0085"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 16"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(86399..86452)
FT                   /locus_tag="VSAL_I0085"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 63"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    complement(86462..86515)
FT                   /locus_tag="VSAL_I0085"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (three rep, score 21"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   rRNA            87125..88661
FT                   /locus_tag="VSAL_I3071r"
FT                   /product="16S ribosomal RNA"
FT   rRNA            88992..91882
FT                   /locus_tag="VSAL_I3072r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            91976..92095
FT                   /locus_tag="VSAL_I3073r"
FT                   /product="5S ribosomal RNA"
FT   rRNA            92502..94038
FT                   /locus_tag="VSAL_I3074r"
FT                   /product="16S ribosomal RNA"
FT   tRNA            94110..94183
FT                   /locus_tag="VSAL_I3075t"
FT                   /product="transfer RNA-Ile"
FT   tRNA            94226..94298
FT                   /locus_tag="VSAL_I3076t"
FT                   /product="transfer RNA-Ala"
FT   rRNA            94571..97458
FT                   /locus_tag="VSAL_I3077r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            97552..97671
FT                   /locus_tag="VSAL_I3078r"
FT                   /product="5S ribosomal RNA"
FT   rRNA            98079..99614
FT                   /locus_tag="VSAL_I3079r"
FT                   /product="16S ribosomal RNA"
FT   tRNA            99711..99783
FT                   /locus_tag="VSAL_I3080t"
FT                   /product="transfer RNA-Glu"
FT   tRNA            99789..99861
FT                   /locus_tag="VSAL_I3081t"
FT                   /product="transfer RNA-Lys"
FT   tRNA            99896..99968
FT                   /locus_tag="VSAL_I3082t"
FT                   /product="transfer RNA-Val"
FT   rRNA            100241..103131
FT                   /locus_tag="VSAL_I3083r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            103225..103344
FT                   /locus_tag="VSAL_I3084r"
FT                   /product="5S ribosomal RNA"
FT   rRNA            103751..105287
FT                   /locus_tag="VSAL_I3085r"
FT                   /product="16S ribosomal RNA"
FT   tRNA            105384..105456
FT                   /locus_tag="VSAL_I3086t"
FT                   /product="transfer RNA-Glu"
FT   tRNA            105462..105534
FT                   /locus_tag="VSAL_I3087t"
FT                   /product="transfer RNA-Lys"
FT   tRNA            105562..105634
FT                   /locus_tag="VSAL_I3088t"
FT                   /product="transfer RNA-Ala"
FT   tRNA            105669..105741
FT                   /locus_tag="VSAL_I3089t"
FT                   /product="transfer RNA-Val"
FT   rRNA            106014..108904
FT                   /locus_tag="VSAL_I3090r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            108998..109117
FT                   /locus_tag="VSAL_I3091r"
FT                   /product="5S ribosomal RNA"
FT   rRNA            109524..111060
FT                   /locus_tag="VSAL_I3092r"
FT                   /product="16S ribosomal RNA"
FT   rRNA            111391..114281
FT                   /locus_tag="VSAL_I3093r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            114375..114494
FT                   /locus_tag="VSAL_I3094r"
FT                   /product="5S ribosomal RNA"
FT   tRNA            114553..114626
FT                   /locus_tag="VSAL_I3095t"
FT                   /product="transfer RNA-Thr"
FT   rRNA            114645..114765
FT                   /locus_tag="VSAL_I3096r"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(114812..115696)
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="VSAL_I0086"
FT                   /old_locus_tag="TVS3308"
FT                   /product="HTH-type transcriptional regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77771"
FT                   /db_xref="GOA:B6EP32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP32"
FT                   /protein_id="CAQ77771.1"
FT                   /translation="MNIKLLQTFLHLCESHSFTNTSKAMHLSLSALSRQIQKLEDEIGH
FT                   PLFVRDNRSVELTSSAKKLMPIALNICSEWSSYKSSSNTVNNSLKGELKLFCSVTASYS
FT                   HLPQLLNNFKVNYPHIEIKLSTGDPAQAIKKVESSEVDIAISAIPEKRSNKLAFEIISE
FT                   IPLSIIAPIGNNTFSGDINKENTNWDTLPFILPKEGTARERANLWFKEQKIKPTIYAQV
FT                   SGHEAIVSMVALGCGIGIAPDVVINNSPVKDKIQRLNTTPIAPFKLGLCCKQSKLNDSV
FT                   IQALWRVAENTFI"
FT   misc_feature    complement(114815..115441)
FT                   /gene="ilvY"
FT                   /locus_tag="VSAL_I0086"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 5e-24"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(115511..115690)
FT                   /gene="ilvY"
FT                   /locus_tag="VSAL_I0086"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 3.6e-17"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(115556..115648)
FT                   /gene="ilvY"
FT                   /locus_tag="VSAL_I0086"
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00044"
FT   misc_feature    complement(115586..115651)
FT                   /gene="ilvY"
FT                   /locus_tag="VSAL_I0086"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1546.000, SD 4.45 at aa 16-37, sequence
FT                   HSFTNTSKAMHLSLSALSRQIQ"
FT   CDS_pept        115825..117309
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="VSAL_I0087"
FT                   /old_locus_tag="TVS3307"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77772"
FT                   /db_xref="GOA:B6EP33"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP33"
FT                   /protein_id="CAQ77772.1"
FT                   /translation="MSNYFDTLNLREQLDQLGRCRFMDREEFSTEADYLKGKRVVIVGC
FT                   GAQGLNQGLNMRDSGLNVAYALRQAAIDEQRQSFKNASENGFEVASYEKLIPQADLVIN
FT                   LTPDKQHTNVVETVMPLMKEGATLGYSHGFNIVEEGMKIRKDLTVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGWDIAKAWAAGTGGHRAGCLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSIVCYEKMIADGIDASYAGKLLQFGWETVTEALKFGGVTHMMDRLSNPA
FT                   KIKAFDLSEELKDLMRPLYNKHMDDIISGHFSSTMMADWANDDVNLLGWREETGETAFE
FT                   NYPDSSLEIPEQEYFDNGILMVAMVRAGVELAFEAMTASGIVDESAYYESLHELPLIAN
FT                   TVARKRLYEMNVVISDTAEYGNYLFANVATPLLREKFMPLVDTDVIGRGLGAISNQVDN
FT                   AKLIEVNETIRNHPVEYIGEELRGYMTDMKTIAVGG"
FT   misc_feature    115924..116436
FT                   /gene="ilvC"
FT                   /locus_tag="VSAL_I0087"
FT                   /note="HMMPfam hit to PF07991, Acetohydroxy acid
FT                   isomeroreductase, catalyti, score 9.4e-87"
FT                   /inference="protein motif:HMMPfam:PF07991"
FT   misc_feature    116452..117288
FT                   /gene="ilvC"
FT                   /locus_tag="VSAL_I0087"
FT                   /note="HMMPfam hit to PF01450, Acetohydroxy acid
FT                   isomeroreductase, catalyti, score 1.2e-117"
FT                   /inference="protein motif:HMMPfam:PF01450"
FT   CDS_pept        complement(117397..117648)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0088"
FT                   /old_locus_tag="TVS3306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77773"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP34"
FT                   /protein_id="CAQ77773.1"
FT                   /translation="MFNPKKLEQVAKQIHDSMPQPVKELGTDVEQKVRQVIQGQLNKLD
FT                   IVAREEFDVQTQVLLRTRKKLTEMEQKLALLEEKLSEK"
FT   misc_feature    complement(117400..117648)
FT                   /locus_tag="VSAL_I0088"
FT                   /note="HMMPfam hit to PF04380, Protein of unknown function
FT                   (DUF526), score 7.9e-41"
FT                   /inference="protein motif:HMMPfam:PF04380"
FT   CDS_pept        complement(117758..120826)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0089"
FT                   /old_locus_tag="TVS3305"
FT                   /product="putative integral membrane component of multidrug
FT                   efflux system"
FT                   /note="Similar to Escherichia coli Acriflavine resistance
FT                   protein F AcrF UniProt:P24181 (1034 aa) blastp scores:
FT                   E()=0e-130"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77774"
FT                   /db_xref="GOA:B6EP35"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP35"
FT                   /inference="similar to sequence:UniProt:P24181"
FT                   /protein_id="CAQ77774.1"
FT                   /translation="MRFTDVFIKRPVLAVSISFLIALLGIQAIFKMQVREYPEMTNTVV
FT                   TVTTSYYGASADLIQGFITQPLEQAVAQADNIDFMTSQSVMGQSTITVTMKLNTDPNAA
FT                   LSDILAKTNSVRSQLPKEAEDPTVTMSTGSTTAVLYIGFTSDELASSQITDYLERVVNP
FT                   QLFTVNGVSKIDLYGGIRYALRIWLEPARMAAVNMTATDVMSVLNANNFQSAAGQATGE
FT                   FVLYNGSANTQVSNVEELERLVIKTDDGEVVRLSDIAKVSLEKSHDIYRASANGKEAVV
FT                   TAINAAPSANPINIAADVLKLLPQLEKNLPTNIKMNIMYDSTIAINESIHEVIKTIVEA
FT                   AVIVLIVITLFLGSFRAVIIPIVTIPLSLVGVAMVMQVMGFSWNLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHVKLGETPFRAAIIGTREIAIPVIAMTLTLGAVYAPIAMMGGITGSL
FT                   FKEFALTLAGSVFVSGIVALTLSPMMCSKMLKANEVPSKFESTVHHFLDGMTNKYERIL
FT                   GSVMQHRPVIIAFAVIVFASLPLLFKFIPSELAPSEDKGVVMLMGTGTSNANLDYLQNT
FT                   MNDVNKILSDQPEIAFAQVFTGVPNSNQAFGIASMVPWSQREASQAEVTDRVGKLVQNV
FT                   PGMAVTAFQMPELPGAGSGLPIQFVITTPNSFESLFQIATEVLTEVKGSPLFVYSDIDL
FT                   NFDSATMKINIDKDKAGAYGVTMQDIGITLSTMMADGYVNRIDLNGRSYEVIPQVERKF
FT                   RLNPESMNNYYVRSASGEAVPLGSLIAIDVIAEPRSLPHFNQLNSATVGAVPSPGVAMG
FT                   DAISWFENIANSKLPSGYNHDYMGEARQYVTEGSALYATFGLALAIIFLVLAIQFESIR
FT                   DPLVIMVSVPLAICGALIALAWGAATMNIYSQVGLITLVGLITKHGILICEVAKEEQLH
FT                   NLKNRVEAVTEAAKVRLRPILMTTAAMIAGLIPLMYATGAGAAQRFSIGIVIVAGLAIG
FT                   TLFTLFVLPVIYSYLASEHKPLPEFEEGKEIQE"
FT   misc_feature    complement(117812..120820)
FT                   /locus_tag="VSAL_I0089"
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family,score
FT                   3.8e-283"
FT                   /inference="protein motif:HMMPfam:PF00873"
FT   misc_feature    complement(order(117824..117892,117911..117979,
FT                   118139..118207,118226..118294,119201..119254,
FT                   119384..119443,119471..119539,119609..119677,
FT                   119690..119758,119762..119821,120737..120793))
FT                   /locus_tag="VSAL_I0089"
FT   CDS_pept        complement(120838..121944)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0090"
FT                   /old_locus_tag="TVS3304"
FT                   /product="putative multidrug transporter, HlyD family"
FT                   /note="Similar to Pseudomonas aeruginosa Multidrug
FT                   transporter, membrane fusion protein MexA (PDB
FT                   1VF7),evalue=3e-21, identity=(80, 326)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77775"
FT                   /db_xref="GOA:B6EP36"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP36"
FT                   /protein_id="CAQ77775.1"
FT                   /translation="MKKWTFFMLLLALLIFGSVIGFNMFKQQKIAEFMANRPEPEFPVT
FT                   IETVKASTWTPTIEAIGFIEPNQGVTLTTESNGVIDKISFDSGSQVKDDQLLISLDSKV
FT                   EKANLRSSQARLPAAEAKYKRYKGLFKKGSISKEAYDEAEANFFSLAADIEGLKATIER
FT                   REIKAPFAGVIGIRNVYLGQYLQPGTDIVRLEDTSIMRLRFTVPQTDISRINIGQDIDI
FT                   YIDSYPTETFKGSISAIEPAVNIQSGLIQVQADIPNNGGKLRSGMFARAEIILPAFENQ
FT                   VVIPQTSITFTLYGDNVYIVSDVDGVKRVKQAVVKVGERTKAVAHILDGVKPGDMVVTS
FT                   GQVRLSNDAKVRVVESDATTPPAETPML"
FT   misc_feature    complement(120928..121743)
FT                   /locus_tag="VSAL_I0090"
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 0.00067"
FT                   /inference="protein motif:HMMPfam:PF00529"
FT   misc_feature    complement(121870..121926)
FT                   /locus_tag="VSAL_I0090"
FT   sig_peptide     complement(121882..121944)
FT                   /locus_tag="VSAL_I0090"
FT   CDS_pept        complement(121963..122562)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0091"
FT                   /old_locus_tag="TVS3303"
FT                   /product="HTH-type transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77776"
FT                   /db_xref="GOA:B6EP37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP37"
FT                   /protein_id="CAQ77776.1"
FT                   /translation="MNVHSFHKDSFMKEKRRLILESAEQLLATDGFRGLSMQKVANQAG
FT                   VAAGTIYRYFDDKEALIQEIKLNILQRVACAIQENVCNTDPLKVRFRTMWLNIWYFAIS
FT                   EKNTFLNRNQYESLPTTDLVKFRELEKEMFAQVNQLFVDGLEQGVFKPFNVEILTGLSL
FT                   ETSVCLARRYAQGTFTLTDDDLDSAIEASWDAIIKH"
FT   misc_feature    complement(122368..122508)
FT                   /locus_tag="VSAL_I0091"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 2.4e-18"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(122380..122472)
FT                   /locus_tag="VSAL_I0091"
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01081"
FT   misc_feature    complement(122395..122460)
FT                   /locus_tag="VSAL_I0091"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1736.000, SD 5.10 at aa 35-56, sequence
FT                   LSMQKVANQAGVAAGTIYRYFD"
FT   CDS_pept        122717..124732
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="VSAL_I0092"
FT                   /old_locus_tag="TVS3302"
FT                   /product="ATP-dependent DNA helicase rep"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77777"
FT                   /db_xref="GOA:B6EP51"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP51"
FT                   /protein_id="CAQ77777.1"
FT                   /translation="MRLNPQQDEAVKFVSGPCLVLAGAGSGKTRVITNKIAYLVQQCGY
FT                   KARNIAAVTFTNKAAREMKERVGQTLNKQESRGLLVSTFHSLGLDIIRREYKILGLKAG
FT                   FSLFDDQDQLALLKELTEKQIDGDKDLLRQLLSCISKWKTDMLTPDQVKGIVRSEQEQL
FT                   FAFCYEMYLTQMKAYNALDFDDLISLPVLLLRNNQDVRERWQMKLRYLLVDEYQDTNTS
FT                   QYELVKLLVGERGRLTVVGDDDQSIYSWRGAKPQNLILLSEDYPNLKVIKLEQNYRSTS
FT                   RILRAANILIANNPHAFEKRLFSEIPDGEQIKILTAKDDAHEAERVVGEIIAHRFLNRT
FT                   DYKDYAVLYRGNHQSRLIEKSLMQNRVPYKISGGTSFFSRSEIKDIMAYLRLLTNPDDD
FT                   NAFLRVVNTPRREIGPVTLEKLGTYANMRGKSLFEACFEMGLEQTLSGRGLESLRRFGH
FT                   WVVSISENAERGNTVEAVRSLVKDIHYEDWLYETSPSAKAAEMRMKNVSDLYSWIVADL
FT                   EGDNYDKEEKTLKEVVLRLTLRDMMERGEDEDGADQVQLMTLHASKGLEFPYVYLIGAE
FT                   EGILPHQTSVDEDNVEEERRLAYVGITRAKKELTFTLCKERRQYGELIRPTPSRFLEEL
FT                   PQDDLDWEMKKPKPTQEERMEKGKSNIAHLRAMLKK"
FT   misc_feature    122723..124171
FT                   /gene="rep"
FT                   /locus_tag="VSAL_I0092"
FT                   /note="HMMPfam hit to PF00580, UvrD/REP helicase, score
FT                   1e-211"
FT                   /inference="protein motif:HMMPfam:PF00580"
FT   misc_feature    122780..122803
FT                   /gene="rep"
FT                   /locus_tag="VSAL_I0092"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(124833..125240)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0093"
FT                   /old_locus_tag="TVS3301"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77778"
FT                   /db_xref="GOA:B6EP52"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP52"
FT                   /protein_id="CAQ77778.1"
FT                   /translation="MDKSIRNTIVAIVAALTFSTASFAANNADDAIAERIKPVGQVYLA
FT                   SDVPVVEEPTGPRTGDQVYNTFCIACHSTGAAGAPKTQNAADWAPRIAKGMDVLKDHAI
FT                   NGFNAMPARGTCMNCSDDELVAAIDHLIKGL"
FT   misc_feature    complement(124836..125072)
FT                   /locus_tag="VSAL_I0093"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.018"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   sig_peptide     complement(125169..125240)
FT                   /locus_tag="VSAL_I0093"
FT   tRNA            125523..125596
FT                   /locus_tag="VSAL_I3097t"
FT                   /product="transfer RNA-Arg"
FT   tRNA            125644..125716
FT                   /locus_tag="VSAL_I3098t"
FT                   /product="transfer RNA-His"
FT   tRNA            125805..125878
FT                   /locus_tag="VSAL_I3099t"
FT                   /product="transfer RNA-Pro"
FT   tRNA            125924..125996
FT                   /locus_tag="VSAL_I3100t"
FT                   /product="transfer RNA-His"
FT   tRNA            126084..126157
FT                   /locus_tag="VSAL_I3101t"
FT                   /product="transfer RNA-Pro"
FT   CDS_pept        join(126692..127534,127536..128423)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0094"
FT                   /old_locus_tag="TVS3296"
FT                   /product="ABC transporter, ATP-binding protein
FT                   (pseudogene)"
FT                   /note="Similar to Vibrio fischeri Dipeptide transport
FT                   ATP-binding protein DppD UniProt:Q5E1T2 (578 aa) fasta
FT                   scores: E()=1e-173, 94.435% id in 575 aa. CDS contains a
FT                   frameshift after codon 290. The sequence has been checked
FT                   and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77779.1"
FT                   /inference="similar to sequence:UniProt:Q5E1T2"
FT   misc_feature    126815..127408
FT                   /locus_tag="VSAL_I0094"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   9.2e-58"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    126836..126859
FT                   /locus_tag="VSAL_I0094"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    127178..127222
FT                   /locus_tag="VSAL_I0094"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    order(127415..127534,127536..127562)
FT                   /locus_tag="VSAL_I0094"
FT                   /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
FT                   transporter, C-termi, score 0.00011"
FT                   /inference="protein motif:HMMPfam:PF08352"
FT   misc_feature    127734..128312
FT                   /locus_tag="VSAL_I0094"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-69"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    127755..127778
FT                   /locus_tag="VSAL_I0094"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    128082..128126
FT                   /locus_tag="VSAL_I0094"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   CDS_pept        128498..130051
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0095"
FT                   /old_locus_tag="TVS3295"
FT                   /product="transport protein, extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77780"
FT                   /db_xref="GOA:B6EP54"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP54"
FT                   /protein_id="CAQ77780.1"
FT                   /translation="MKTIKTKLAIAIMAAGLSFSAAAADITVAYDADPVSLDPHEQLSG
FT                   GTLQLSHMVFDPLVRYTQEFDFEPRLAEKWERVDDKTFRFTLRKGVKFHSGNTMTADDV
FT                   VWTFNRLKDSADFKAIFAPYEKLVKIDDYTVELISKGAYPLVLQTATYLFPMDSKFYSG
FT                   KTEDGKDKDEIVKHGNSFTSTHISGTGPFVVKSREQGVKVVFDRFDGYWDKNSPGNVDE
FT                   LTLVPIKENATRVAALLSGDVDVIAPVAPNDHKRVKNTKGIDLVTLPGTRLISFQMNQT
FT                   SNEALKDVRVRQAIVHAINNEGIVKKIMKGFATAAGQQSPPGYSGYDADLVPRYDLKKA
FT                   KELMKEAGYENGFKLSMMAPNNRYVNDAKIAQAAAAMLSKIGIKVDLKTLPKAQYWPEF
FT                   DVCSADMMMIGWHSDTEDSANLTEFLTMTRNEETGKGQYNCGHYSNPEVDRLIEAANVE
FT                   TDPAKRSEMLKTVEDTLYNDAAFVPLHWQNLAWGAKSNIDIQPIVNSMEYPYFGDLVVK
FT                   "
FT   sig_peptide     128498..128566
FT                   /locus_tag="VSAL_I0095"
FT   misc_feature    128693..129796
FT                   /locus_tag="VSAL_I0095"
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding prot, score 4e-80"
FT                   /inference="protein motif:HMMPfam:PF00496"
FT   misc_feature    128711..128776
FT                   /locus_tag="VSAL_I0095"
FT                   /note="PS01040 Bacterial extracellular solute-binding
FT                   proteins, family 5 signature."
FT                   /inference="protein motif:ProSite:PS01040"
FT   CDS_pept        130188..131165
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0096"
FT                   /old_locus_tag="TVS3294"
FT                   /product="binding-protein-dependent transport system,inner
FT                   membrane component"
FT                   /note="Similar to Bacillus subtilis Oligopeptide transport
FT                   system permease protein AppB UniProt:P42062 (317 aa) fasta
FT                   scores: E()=1e-32, 34.161% id in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77781"
FT                   /db_xref="GOA:B6EP55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP55"
FT                   /inference="similar to sequence:UniProt:P42062"
FT                   /protein_id="CAQ77781.1"
FT                   /translation="MFTFLVKRLFQALIVMFVISLVAFSIQDNLGDPLRELVGQSVSES
FT                   ERQALRDDLGLNDPFVTKYTRFITNAVQGDLGTSYFFKKPAVEVILDKLVATLELVLGS
FT                   ALIIICLSIPLGVYSAIHPKSFFTKAIMAFSSIGISIPVFLTAIMLMYVFSIELNWLPS
FT                   YGRGETYNLLGWESGFFTIDGLAHLVLPCVSLASIMLPLFIRLVRSEMIEVLSSEYIKF
FT                   AKAKGIATNKIYYQHALKNTMLPVLTVGGVQIGTMVAYTILTETVFQWPGTGFLFLEAI
FT                   NRVDTPLITAYVIFVGLIFVVTNTIVDLLYGLINPTVDITGKGA"
FT   sig_peptide     130188..130262
FT                   /locus_tag="VSAL_I0096"
FT   misc_feature    order(130212..130265,130485..130553,130587..130655,
FT                   130740..130808,130911..130979,131061..131129)
FT                   /locus_tag="VSAL_I0096"
FT   misc_feature    130467..131147
FT                   /locus_tag="VSAL_I0096"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 6.1e-46"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        131168..132109
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0097"
FT                   /old_locus_tag="TVS3293"
FT                   /product="binding-protein-dependent transport system,inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77782"
FT                   /db_xref="GOA:B6EP56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP56"
FT                   /protein_id="CAQ77782.1"
FT                   /translation="MNTTTNRVPTRWERFKSSDFLYYFLRDKVAMFSFAVFVVFVLGAL
FT                   LSPVLAPSNPYDLSSIDIMDSELPPSWMEEGDERFLLGTDDQGRDVLSTILYGSRLSLT
FT                   IGFLAVAVQLTLGIVIGLSAGYFGGRIDSFLMRFADVQLSFSTMMVAIIVSAIFKASFG
FT                   TEFFSQYAVIMLVVIIGIAEWPQYARTIRASVLAEKQKEYVEAAKVMGFRSPRIMFRHI
FT                   LPNCLSPILVISTVQIANAIMSEAALSFLGLGLPVDQPSLGSLISIGFNYIFSGSWWIT
FT                   AFPGLVLVALVLVINLLGDWLRDVFNPKIYKG"
FT   sig_peptide     131168..131320
FT                   /locus_tag="VSAL_I0097"
FT   misc_feature    order(131252..131320,131480..131548,131567..131635,
FT                   131663..131722,131831..131899,131996..132064)
FT                   /locus_tag="VSAL_I0097"
FT   misc_feature    131462..132103
FT                   /locus_tag="VSAL_I0097"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.8e-43"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    131753..131839
FT                   /locus_tag="VSAL_I0097"
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:ProSite:PS00402"
FT   CDS_pept        132347..133927
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0098"
FT                   /old_locus_tag="TVS3292"
FT                   /product="transporter, BCCT family"
FT                   /note="Similar to Bacillus subtilis Glycine betaine
FT                   transporter OpuD UniProt:P54417 (512 aa) fasta scores:
FT                   E()=4.2e-65, 41.968% id in 498 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77783"
FT                   /db_xref="GOA:B6EP57"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP57"
FT                   /inference="similar to sequence:UniProt:P54417"
FT                   /protein_id="CAQ77783.1"
FT                   /translation="MSRNKDKYSIDNTDYTVGQDNVQKWGLDIHNTVFGISAGLIALFL
FT                   IAVAVTDPETAKTVLNGLKSQIINAFDGLFMWSANIFVVFCLALIVSPFGKIRLGGDKA
FT                   KPDYSMISWIAMLFAAGMGIGLMFWGVAEPVAYFTGWFGTPLGVEAYTPEARQLALGAT
FT                   MFHWGIHPWAIYGVVALSLAFFSYNKGLPLSMRSIFYPILGDRTWGWPGHIVDILAVLA
FT                   TLFGLATSLGLGAQQAASGFQHVFGIEGGLGLQVAIIFIVTLLAVVSVMRGIDGGVKII
FT                   SNINMIIAIVFVVFVALVTFAVSMGAIPTTIMGYIENIIPLSNPSGRDDEAWMHGWTVT
FT                   YWAWWISWSPFVGMFIARVSRGRTVREFLIAVLVVPTVFTVLWMSTFGGVAIDQVMNNV
FT                   GTLGTDGLTDVSLAMFQMFDALPMGNVLSMIAVVLVLVFFITSSDSGSLVIDSITAGGK
FT                   VDAPIPQRVFWAFMEGAIAVALLWVGGTQAVEALQAGAISTALPFTIILLVMCVSLLMG
FT                   MRTEKHNRS"
FT   misc_feature    order(132431..132499,132563..132631,132668..132736,
FT                   132842..132910,132971..133039,133082..133150,
FT                   133187..133255,133343..133411,133448..133516,
FT                   133598..133666,133745..133813,133826..133894)
FT                   /locus_tag="VSAL_I0098"
FT   misc_feature    132443..133909
FT                   /locus_tag="VSAL_I0098"
FT                   /note="HMMPfam hit to PF02028, BCCT family
FT                   transporter,score 8.4e-173"
FT                   /inference="protein motif:HMMPfam:PF02028"
FT   misc_feature    133352..133381
FT                   /locus_tag="VSAL_I0098"
FT                   /note="PS01303 BCCT family of transporters signature."
FT                   /inference="protein motif:ProSite:PS01303"
FT   CDS_pept        complement(134012..134728)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0099"
FT                   /old_locus_tag="TVS3291"
FT                   /product="putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77784"
FT                   /db_xref="GOA:B6EP58"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP58"
FT                   /protein_id="CAQ77784.1"
FT                   /translation="MISNTHQEILNWTAFFTHKYEASKDQRLKNFYQTGTYEEETPLKE
FT                   IEFVALDFETTGLDANQNSIISIGLVPFTLERIRCRESQHWFVKAQDSLEENSVVIHGI
FT                   THSDLQGAPDLRRILEKVLDALAGKVVVVHYRKIERDFFDINLRNLIGEGIVFPIVDTM
FT                   QIEGDFQQEQAKGLINWIKGKRPESIRLANSRSRYGLPAYAPHHALTDAIATAELFQAQ
FT                   IRYHFSENDPIRKIWQ"
FT   misc_feature    complement(134072..134587)
FT                   /locus_tag="VSAL_I0099"
FT                   /note="HMMPfam hit to PF00929, Exonuclease, score 9.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00929"
FT   CDS_pept        complement(134738..136618)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0100"
FT                   /old_locus_tag="TVS3290"
FT                   /product="putative cyclic nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77785"
FT                   /db_xref="GOA:B6EP59"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP59"
FT                   /protein_id="CAQ77785.1"
FT                   /translation="MEVELLEIQHFLSQYPPFSLLPEEAIKEAAQSVEISYYRAESMVI
FT                   GFGDEIKDLYMVRSGIIEVYRRNGELYNRLDQGSIFGQMGLLMNNKVRFPAKALKDSLL
FT                   YCIPESVFDDYCERYDEFSDFVEVEDATRLKQAVESNHDDANDLTTSKVKTLLTREAVM
FT                   ITKYETIQSAAKTMAEENVSAVLITDPEINTDEEDNDFVGIITDRDLCTKVLACGLDFD
FT                   TPVSEVMSTELISLDHNAYVFEAMLMMLRYNVHHLPVLRNKQPIGVLEVSDIVRYESQN
FT                   SLLFVSSIFQQQTIEDLVILSAQLKDCFVRMVNEDANSHMVGSAMSEIGRSFKQRLLEL
FT                   AEEELGHPPVPYCFLALGSMARDEQLIVTDQDNAIILDNDYNEAEHGDYFKALSAFVCD
FT                   GLAACGYTYCTGDIMATNPEWRKTQSEWEECFADWIDNPDPQALLNSSIFFDLNGVYGR
FT                   TKWAEQLNGFIVRRAKKNNRFLACLARNGLRRTPPLGFFKDFVMEKDGRHNNSINLKRR
FT                   GTAPLADLIRVHALAIGSQAQNSFERLDDIIEAGILPKSKGGDLHHAMELISLVRLRHQ
FT                   ALDVEANIEPDNNIEPENMSDFERRNLKDAFQVLSNAQNFLKFRYSASKF"
FT   misc_feature    complement(134741..135712)
FT                   /locus_tag="VSAL_I0100"
FT                   /note="HMMPfam hit to PF03445, Putative
FT                   nucleotidyltransferase DUF294, score 4e-114"
FT                   /inference="protein motif:HMMPfam:PF03445"
FT   misc_feature    complement(135782..136156)
FT                   /locus_tag="VSAL_I0100"
FT                   /note="HMMPfam hit to PF00571, CBS domain pair, score
FT                   3e-29"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    complement(136256..136516)
FT                   /locus_tag="VSAL_I0100"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 4e-16"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   CDS_pept        136794..137672
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0101"
FT                   /old_locus_tag="TVS3289"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77786"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP60"
FT                   /protein_id="CAQ77786.1"
FT                   /translation="MTKLINKTALSFIVLSNVVVVTSAYANINLTDYLTTKKSALMSVC
FT                   VPKASTAMNELSESCPIGEGLWGNQSAKHDEGDSEFWIQCGLFRKTIDDAVISRLSEAV
FT                   NAPINMKKEGDLNRCLIGPYLDYTIASKSLAALQRDRLFKLATLREVDLSTIPKPEIIP
FT                   EVVAEPEPAPITIRKAVMINQTHFVVPFSHDTTEGFYMEGKMPWLRATEQHAQEICQRI
FT                   DMNLVTKEQWKILADSTIMKKDKWPMQLPYWGANDLGLFKDGSTKKLKNTSMLNVVCTK
FT                   KTEGDVVGNPI"
FT   sig_peptide     136794..136871
FT                   /locus_tag="VSAL_I0101"
FT   misc_feature    136827..136895
FT                   /locus_tag="VSAL_I0101"
FT   CDS_pept        137656..137919
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0102"
FT                   /old_locus_tag="TVS3288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77787"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP61"
FT                   /protein_id="CAQ77787.1"
FT                   /translation="MEIQFKGRWDSKSLAENLQEALETLEEEFGVKALSDITLSICLED
FT                   EHKEELALLSPTGRALELIVINNPRDVNDGEKAPVLEFKPRS"
FT   CDS_pept        complement(137970..139940)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0103"
FT                   /old_locus_tag="TVS3287"
FT                   /product="HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77788"
FT                   /db_xref="GOA:B6EP62"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP62"
FT                   /protein_id="CAQ77788.1"
FT                   /translation="MILLLIRINSLNFGSLMIQLPYPRLNTIFEALRHEPLPQQELAQR
FT                   CDISTRTIRTDISALNDILASYGAQIQHQRGTGYHFDIYDEARFSDIEKQTQKMKTSPR
FT                   NAKDRVVYLIMRLLSQEEECKLDDLANQWFVSRTSLQADMTEIREILEQYNLEIVSKAH
FT                   HGLKLFGEEQAIRACIAHVLFQFKPSDRTFINVCDHFFPEINLPSLKEDLLTLINQNHI
FT                   RLTDEGLHHLLVYCGITLHRVKLNSVIHHVHQPKISNEAQNAALDLSKTIEVLLSAPLP
FT                   QSEIDYLSIQIAARRVTGVTIVDTEKHTEQLELTHFLLDYVNEHYNYDLRNDELLKRDL
FT                   LCHITTMILRVKYQITIPNPLVDHIKRYYPLAYDMTVAAISHWGKHLIPDGEVGYLVMH
FT                   IGVGLERNFALEEQQPPKALLVCDSGTSIMRLLESQLLRSLPQLDIQKIDSVREYESLT
FT                   KVDADFVISTEKVSQKNRPTITISPLPTSFQLEQVNKLILMNRSHPYMLDKFFDQRYFS
FT                   VLSEPTTQAELLKKFTAHFTEDNITPIEFYDSVIERENITSTILGEGIAIPHSLGLLAN
FT                   ETKVYTIISPHGIDWGNGKIAHVIFLFAINKDDYEEAMSLYDLFVTFMNGKAVDTILEC
FT                   LSYEEFQYVAKECWFNRRKDW"
FT   misc_feature    complement(138024..138416)
FT                   /locus_tag="VSAL_I0103"
FT                   /note="HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent
FT                   sugar phosph, score 0.0019"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   misc_feature    complement(138732..138995)
FT                   /locus_tag="VSAL_I0103"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 4.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    complement(139389..139688)
FT                   /locus_tag="VSAL_I0103"
FT                   /note="HMMPfam hit to PF05043, Mga helix-turn-helix domain,
FT                   score 4.2e-06"
FT                   /inference="protein motif:HMMPfam:PF05043"
FT   misc_feature    complement(139440..139616)
FT                   /locus_tag="VSAL_I0103"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.00019"
FT                   /inference="protein motif:HMMPfam:PF08279"
FT   misc_feature    complement(139701..139871)
FT                   /locus_tag="VSAL_I0103"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 4.1e-12"
FT                   /inference="protein motif:HMMPfam:PF08279"
FT   misc_feature    complement(139767..139832)
FT                   /locus_tag="VSAL_I0103"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1735.000, SD 5.10 at aa 37-58, sequence
FT                   LPQQELAQRCDISTRTIRTDIS"
FT   CDS_pept        complement(140087..140827)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0104"
FT                   /old_locus_tag="TVS3286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77789"
FT                   /db_xref="GOA:B6EP63"
FT                   /db_xref="InterPro:IPR010763"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP63"
FT                   /protein_id="CAQ77789.1"
FT                   /translation="MTLKANFYKNRVCLNVLAGSVDNAGEIYNAAEGHVLVGVLSKNYP
FT                   DVDTAVTDMKKYSEVTNNAVSVGLGAGDPNQSMMVSLISQHVQPQHINQVFTGVATSRA
FT                   LVGQDKSIVNGLISPTGTVGMVKISTGPLSSRSEDAIVPVETAIAMLKDMGGSSVKYFP
FT                   MGGLESREEFAYVAKACAEQDFWLEPTGGIDLENYEEIMQIALDAGVSKIIPHIYSSII
FT                   DKATGNSRPTDVTTLLEMTKKLLN"
FT   misc_feature    complement(140153..140806)
FT                   /locus_tag="VSAL_I0104"
FT                   /note="HMMPfam hit to PF07071, Protein of unknown function
FT                   (DUF1341), score 6e-144"
FT                   /inference="protein motif:HMMPfam:PF07071"
FT   CDS_pept        complement(140840..141886)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0105"
FT                   /old_locus_tag="TVS3285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77790"
FT                   /db_xref="GOA:B6EP64"
FT                   /db_xref="InterPro:IPR006337"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP64"
FT                   /protein_id="CAQ77790.1"
FT                   /translation="MTALGVSTPNEDVVNAVTEGLGQYFDMKDLVIKTGEYIANLLNVD
FT                   AAVVVSCASAGIAQSVAAVIVKDSQYRLENLHAHAHDVPSEIVLPKGHNVNFGAPVGTM
FT                   VTLGGGTIKEAGYANECSAEQLEAAITKNTAAILYIKSHHCVQKSILTVEQAVAVAQKH
FT                   DLPLIVDAAAEEDLQGYFAMGADLVIYSGTKAIEGPTSGLVVGKTHYINWVRKQSQGIG
FT                   RAMKVGKEGILGLTHAITDYLTVEKESGQEMVAKMETFISDINSINGVKSRVVWDSAGR
FT                   DIARAEIAFDHDELQTTTTDIVKQLQNGNPAVYCRGYKANEGIIEIDVRSVNSTQLNTI
FT                   FLKINALF"
FT   misc_feature    complement(141029..141802)
FT                   /locus_tag="VSAL_I0105"
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,score
FT                   7.3e-05"
FT                   /inference="protein motif:HMMPfam:PF01212"
FT   CDS_pept        complement(141927..143063)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0106"
FT                   /old_locus_tag="TVS3284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77791"
FT                   /db_xref="GOA:B6EP65"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP65"
FT                   /protein_id="CAQ77791.1"
FT                   /translation="MYDLLIKNGKLVNGGLVDVAILNEKIARVESDINDAAIRTVDLKG
FT                   LHFLSAGWIDSHTHCYPSSPIYNDEPDLIGVTHGVTTVVDAGSVGADDVDDFYRLTQQS
FT                   ATNVYSILNISRIGLLRQDELADMSDISLDAAKTAITKHSDFVVGIKARMSGSVVKNNG
FT                   LAPLIRAKEMQAQNNNLPLMVHVGNNPPNLDDIAELLTKGDIITHCYNGKPNRILTPEG
FT                   ELKESMKKAIKRGVILDVGHGGASFSFDVAEQAIKKGIYPDTISSDIYCKNRISGPVRS
FT                   LSHIMSKFLSIGLPMDRVIDCVTINAANALKMETKGTLEIGQDADITIFNIHHEACTFE
FT                   DSEQGTRQGEESFLPLASIVAGKLITTQHGEQTNVFNS"
FT   misc_feature    complement(142071..142922)
FT                   /locus_tag="VSAL_I0106"
FT                   /note="HMMPfam hit to PF01979, Amidohydrolase family,score
FT                   0.00049"
FT                   /inference="protein motif:HMMPfam:PF01979"
FT   CDS_pept        complement(143122..143772)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0107"
FT                   /old_locus_tag="TVS3283"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77792"
FT                   /db_xref="GOA:B6EP66"
FT                   /db_xref="InterPro:IPR025456"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP66"
FT                   /protein_id="CAQ77792.1"
FT                   /translation="MDDKLKNNFWYADWSFPFFVGLLSSGVFAGTHMYYLYGIGAFNEV
FT                   AFVSMLRAGMDTGVYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALLLG
FT                   AGIVYPLENFIASLIVGFLLGVAIGYIIILARKYTVGQSNSTYGADVMMGAGNSSGRFL
FT                   GPLIVLSAIAASIPIGIGSLIGALAFYQWKKPITGGAIIGAMVFGSLFPVAIG"
FT   misc_feature    complement(order(143128..143187,143206..143274,
FT                   143368..143436,143449..143517,143545..143604,
FT                   143662..143730))
FT                   /locus_tag="VSAL_I0107"
FT   CDS_pept        complement(143787..144566)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0108"
FT                   /old_locus_tag="TVS3282"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77793"
FT                   /db_xref="GOA:B6EP67"
FT                   /db_xref="InterPro:IPR020042"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP67"
FT                   /protein_id="CAQ77793.1"
FT                   /translation="MFLIILMKSLIIGALVGVGVGVGAARMFHAPTVQGMGAFRTLGEL
FT                   NSCEGDPASHFSFGLGFFFNAWASSVAAGAFTQDVDHRIIPHWGAAALMFKNKNVAETM
FT                   HDPKKMGIACGIIGMVVVAFLNSTASAVPESLQITAVKVLVPAANLLVNIAMPVIFWLA
FT                   AIDAGRRSGFWATIFGGLAQMIMGNAVPGLVLGILIGKGVEDGGWNKVTKIMLAAVITL
FT                   FVMSAFFRGFDLELIESFRLTVPTWLESVHTTLSGNQ"
FT   misc_feature    complement(order(143871..143927,143970..144038,
FT                   144072..144140,144168..144236,144336..144404,
FT                   144495..144563))
FT                   /locus_tag="VSAL_I0108"
FT   sig_peptide     complement(144477..144566)
FT                   /locus_tag="VSAL_I0108"
FT   CDS_pept        complement(144627..144923)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0109"
FT                   /old_locus_tag="TVS3281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77794"
FT                   /db_xref="InterPro:IPR020037"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP68"
FT                   /protein_id="CAQ77794.1"
FT                   /translation="MKESITTTVTVSGNGNTKQAAFSSALNNIQKTILKDNEQVILRIE
FT                   PVDVKLINAEKKERIEKFMFFFLPRNKTSYSVTLDVTVNVTIINIDQLDFKSI"
FT   CDS_pept        complement(144926..145288)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0110"
FT                   /old_locus_tag="TVS3280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77795"
FT                   /db_xref="InterPro:IPR020034"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP69"
FT                   /protein_id="CAQ77795.1"
FT                   /translation="MTNIKVVIGDRLGKGQKVGLGVEAAGGSVTVIPGMAADMKLGDVM
FT                   NEEQADFGISFCGSGGAGAITAQNKYGYKAKYGMRSVEEGVTAINEGFNVLGFGFMDKE
FT                   ELGQRLVEAFVKKYRS"
FT   CDS_pept        complement(145290..145637)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0111"
FT                   /old_locus_tag="TVS3279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77796"
FT                   /db_xref="GOA:B6EP70"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR020044"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP70"
FT                   /protein_id="CAQ77796.1"
FT                   /translation="MDSNTLDINEELFTEEVDSTFNKVISILRAENIFPDSVQKQMLFS
FT                   HLKAMVIRSHTHESLPEVEIEMFDEISKSSHKLAEDVVSLFPTLAYEESYLLSVHFEVA
FT                   KENELTEELGA"
FT   repeat_region   145806..146810
FT                   /note="VSa6"
FT   repeat_region   145806..145824
FT                   /note="IR of VSa6"
FT   CDS_pept        145902..146783
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0112"
FT                   /old_locus_tag="TVS3278"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77797"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B6EJM9"
FT                   /protein_id="CAQ77797.1"
FT                   /translation="MNKLVDIFCDVDDFCYQFLSQWEKYLVEASERKRKRQSVMSTSEC
FT                   MTIVIAFHQSNHRDFKNFYIGLVHQYWKGYFPNLLSHTRFVSKMPSLIAPMCAYFQSIK
FT                   GKPTGIAFVDSTSLKVCHNIRIPRHKVFDGVAKRGKGTMGWFFGFKLHLLINHLGEIIS
FT                   LKITAGNVNDRTPVPDLCKELSGKLYADKGYIGKKLSESLKNSDVDLVTTSRKNMKAKE
FT                   ISAFDKAMLSKRYIIETINDQLKNISQIEHSRHRSVTGFMLNVISGVVAYCLKKQKPRI
FT                   KLSECEFELILA"
FT   misc_feature    146229..146723
FT                   /locus_tag="VSAL_I0112"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   9.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   146792..146810
FT                   /note="IR of VSa6"
FT   repeat_region   146823..149137
FT                   /note="VSa2"
FT   repeat_region   146823..146846
FT                   /note="IR of VSa2"
FT   CDS_pept        146904..147218
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0113"
FT                   /old_locus_tag="TVS3277"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77798"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77798.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   CDS_pept        147215..147562
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0114"
FT                   /old_locus_tag="TVSb0156"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77799"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77799.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        147634..149121
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0115"
FT                   /old_locus_tag="TVSb0155"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77800"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGR2"
FT                   /protein_id="CAQ77800.1"
FT                   /translation="MTDKIKPLPDTIDELKALVLQLENKYNRLLEQFRLAQHQRFGKSS
FT                   ESDSTQFDLFNETEEEIIIENDDTQTITYTRQKPKRQRLPEDLPRTVIIHDIKDKTCKC
FT                   CGLEMHAMGKDISEKLEFVPAKVEVIQHVRPKYACRNCEKNNTSVDIKQAPMPASPIPK
FT                   GIATASLLAQIITAKFQYSLPLYRQETLFQQWGIIIGRRTMADWLIKCSVLFTPLNNEL
FT                   HRILLEQPTLHCDETTVNVLDVEKAKCYMWVYCSGYDSPGSGVLPGIVLYDYQSSRHGY
FT                   HPVNFLKGYNGYLHTDGYQGYEQTEAILVGCWAHARRRFIEAQRVQVKGKTGSADWVLS
FT                   KIQKLYRIESLLKEASPEAKYVARQTEARDLLKELRDWLDSAVSRVSPKTKLGEAISYT
FT                   LNQWDKLVRYIDDGLLSIDNNRAERAVKPFVIGRKNWLFSGSTAGADSSAMLYSIVETA
FT                   KANGLIPYDYIRYCLDRLCVGSPDIDSLLPWNVKDKV"
FT   repeat_region   149114..149137
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(149312..151027)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0116"
FT                   /old_locus_tag="TVS3273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77801"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP75"
FT                   /protein_id="CAQ77801.1"
FT                   /translation="MGCGSSDDDSNDPSTNIDTAKTQKPSIAIPTAGKFIDAKVIGLDY
FT                   ISGSLEEKKTDINGTYTIDTNNPEISFYLGGKDGLFIGSISGRHITTPFEAAGTYQRAV
FT                   NLARLLLTVGEGTSTLIKTGQAVLIKEITLPQDLSVAATELKEATLDDEASLLAVATAL
FT                   NPAITALVSQDDATTHMQSSLANIPRGSDVNLSHWSRGSNWTFVSRDSTQRIRNSANQE
FT                   FDLVINVDRTLTDSQGNPRNLFEKTSSMIFTLADNNLIVRKGSNDSSISGHYVADYLTC
FT                   LDNDGIFNTVETDDNEYNTCDGNRITVTDERYNYFYNLDNKYQYSFISPNKEQISDINE
FT                   PWIEISEMGDAFECMNAKNCTEQALSKFEVLERDDSDEQDGSYMLEETISGTYDPITDV
FT                   YINTTSKKYLDNSPYPGRISERISFLYPVEALGQDRYVDFIGTWESRELCANKSIAVAK
FT                   MTFTETGLTMTGEECGTLGFINKTHTYAQLSPKDLWWFGTNDAGDSKATLDQLNSTVRW
FT                   NDKNSTDDPNNIKINRFTYIPAGKNWDQGLLIRDTLNLDGTKKSTITMKKIKSL"
FT   CDS_pept        complement(151287..151856)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0117"
FT                   /old_locus_tag="TVS3272"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77802"
FT                   /db_xref="GOA:B6EP76"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP76"
FT                   /protein_id="CAQ77802.1"
FT                   /translation="MITITKLTRTIQYWQSGDKVAENHVYQFAYLQLHNIAQKERKRNA
FT                   KKYGPDNDMFADSVNNTTSLIHDAYIKLSNSKLTDIKTKRDFFLMITRVMRQILIDNAR
FT                   SLQAKKRQPLAPINRDIDKFEQLITMDKALDNFAIRYPRQSNVLKLKYLMGMKNTEICQ
FT                   LLECSSSLVEKDLKFSRCWLHSYIMK"
FT   misc_feature    complement(151290..151847)
FT                   /locus_tag="VSAL_I0117"
FT                   /note="HMMPfam hit to PF07638, ECF sigma factor, score
FT                   1.3e-12"
FT                   /inference="protein motif:HMMPfam:PF07638"
FT   CDS_pept        complement(151960..153300)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0118"
FT                   /old_locus_tag="TVS3271"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77803"
FT                   /db_xref="GOA:B6EP77"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP77"
FT                   /protein_id="CAQ77803.1"
FT                   /translation="MQLITSPTQIFYDLMDLDNIQKQKVLDALQNSHPNIYQDLIPLLN
FT                   NTTSEPFFDLFGFGAQQTFNTEWDFSHHMVDKYQITKELGRGGMGVVYSAYRANGTFEQ
FT                   ELAIKFIQPDLKNLLNKHALFEEAQLLARLNHPYIAKVFDGGEYEGAVYVVMEKIIGTT
FT                   LNDFLKHNLLSRQQKLQLFSQICQALEHAHQHDVLHADLKPENILIDKRNCPKLIDFNL
FT                   TQQVKKNGHHNTQGLVAYSEHFASPEQKEGNYLTPLSDVYSLGKILLLLFPNLHKKEDI
FT                   TYIQEKTTQETLSKRYCSVEALRKDIECVLASRPITLKQHTPLYTFRCLLKRKPISAFI
FT                   LVLLTLSTLILSSVLIIKNNNLKHDKIVSEKIMFEITHLLFNSKGKDISKASINSMLEL
FT                   TRCKILSNPELPAYIKQKMQLAMMMPIQTKQKSLPEEQRREIKIQFK"
FT   misc_feature    complement(152230..152298)
FT                   /locus_tag="VSAL_I0118"
FT   misc_feature    complement(152353..153069)
FT                   /locus_tag="VSAL_I0118"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain,score
FT                   1e-25"
FT                   /inference="protein motif:HMMPfam:PF00069"
FT   misc_feature    complement(152674..152712)
FT                   /locus_tag="VSAL_I0118"
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00108"
FT   misc_feature    complement(152974..153051)
FT                   /locus_tag="VSAL_I0118"
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00107"
FT   CDS_pept        153609..154199
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0119"
FT                   /old_locus_tag="TVS3270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77804"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP78"
FT                   /protein_id="CAQ77804.1"
FT                   /translation="MTAHHHPHFQVGQTIEDHPFRQGDGAMLEMFRNDLPNILYVGLGN
FT                   ITADEQAVLGQESAQLGMTMTNEGACLTVFSLGELTFEMQFNAAVIPEEYFQSPESGKL
FT                   SFSMLAIDSATNTLQAIREFTLSEELSRQFVEVMQIQRKINDVNVVNRVNEMLLNTLTT
FT                   EELNEKITLEPLQSVVAAPTCGCGHHHNHDHSH"
FT   CDS_pept        complement(154286..155641)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="VSAL_I0120"
FT                   /old_locus_tag="TVS3269"
FT                   /product="glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77805"
FT                   /db_xref="GOA:B6EP79"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP79"
FT                   /protein_id="CAQ77805.1"
FT                   /translation="MATHFDYICIGGGSGGIASANRAAMHGAKVALIEAQELGGTCVNV
FT                   GCVPKKVMWHGAQVAEAINLYAEDYGFDVELKKFNWSKMVENRQAYIGRIHESYDRVLG
FT                   NNKINVIKGFAKFVDANTVEVNGEHYTADHILIAVGGRPTIPNIPGAEHGIDSNGFFDI
FT                   TEQPKRVAIIGAGYIAVEIAGVLHSLGTETHLFVRKESPLRSFDPMIIDTLVEVMNTEG
FT                   PTLHTHSVPKEVVKEADGSLTLHLENGETQNVDTLIWAIGRHPATDAINLEKTGVAIND
FT                   RGYIKVDEYQSTNVKGIYCVGDIMEGGIELTPIAVKAGRLLSERLFNGQTNAKMDYTLV
FT                   PTVVFSHPPIGTIGLTEQEADEQYGKDNVKVYTSGFTAMYTAVTKHRQPCKMKLVCAGE
FT                   NEKVVGLHGIGFTVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR"
FT   misc_feature    complement(154289..154624)
FT                   /gene="gor"
FT                   /locus_tag="VSAL_I0120"
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidored, score 2.6e-52"
FT                   /inference="protein motif:HMMPfam:PF02852"
FT   misc_feature    complement(154715..155626)
FT                   /gene="gor"
FT                   /locus_tag="VSAL_I0120"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidored, score 5.8e-69"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    complement(154856..155137)
FT                   /gene="gor"
FT                   /locus_tag="VSAL_I0120"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidored, score 3.5e-28"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   misc_feature    complement(155495..155527)
FT                   /gene="gor"
FT                   /locus_tag="VSAL_I0120"
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT                   /inference="protein motif:ProSite:PS00076"
FT   CDS_pept        complement(155854..156693)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0121"
FT                   /old_locus_tag="TVS3268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77806"
FT                   /db_xref="GOA:B6EP80"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP80"
FT                   /protein_id="CAQ77806.1"
FT                   /translation="MLSYRHSFHAGNHADVVKHIVQSLILNSLTLKDKPFVYHDTHSGV
FT                   GRYDLTHEWSEKTGEYKQGIERIWDKTDIPEEITSYLDAVKALNEDGELRYYPGSPCVG
FT                   RAHIRCYDRMVLTELHPSDYPLLEQEFHSDRQVSIYKEDGFARLKASLPPPERRGLVLI
FT                   DPPYELAKEYYDVVNAIGQSHKRWATGIYAIWYPVVNRCDIDDMINGLKKLNIRNILQI
FT                   ELGVSPDTNERGMTASGMIVINPPWKLESQMNTILPFLKEAIAPATGHCKVEWIVPE"
FT   misc_feature    complement(155863..156597)
FT                   /locus_tag="VSAL_I0121"
FT                   /note="HMMPfam hit to PF04378, Protein of unknown function
FT                   (DUF519), score 1.4e-155"
FT                   /inference="protein motif:HMMPfam:PF04378"
FT   misc_feature    complement(155953..155973)
FT                   /locus_tag="VSAL_I0121"
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00092"
FT   misc_feature    complement(156193..156213)
FT                   /locus_tag="VSAL_I0121"
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00092"
FT   CDS_pept        156846..158888
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="VSAL_I0122"
FT                   /old_locus_tag="TVS3267"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77807"
FT                   /db_xref="GOA:B6EP81"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP81"
FT                   /protein_id="CAQ77807.1"
FT                   /translation="MSNPLLTFTDLPLFSQIKPEHIQPAVEQAIADCRAKIEDVLASDA
FT                   VPSWNSIIVPLAETDDRLSRIWSPVSHLNSVQNSEALREAYEACLPILSEYGTWVGQNK
FT                   ALYHAYKEIKASADFSALSQAQQKTIIDELRDFELSGIGLPADQQKRYGDISKRTSELS
FT                   SNFSNNVLDATMGWSKHITDEAELSGLPESAMSAAKAAAEAKELDGWLLTLEMPSYIPV
FT                   MTYSDNKPLRREIYEAFVTRASDRGPNAGKWDNTDLISEELNLRHEVSRLLGFSSYSEK
FT                   SLATKMAESPTQVLGFLNDLAAKAKPQGEREVAELKAFVKEEFDIDELDLWDVTYYSEK
FT                   LKQKLYQISDEELRPYFPESKAVSGLFEVLNRVFGMTVVEREGVDVWHESVRFFDIFDS
FT                   TNTLRGSFYLDLYAREHKRGGAWMDECRVRRLTENGELQTPVAYLTCNFSKPVGGKPAL
FT                   FTHDEVVTLFHEFGHGIHHMLTQIDVASVSGINGVPWDAVELPSQFLENWCYEEEALAF
FT                   ISGHYETGEPLPKEMLDKMLAAKNFQSAMFILRQLEFGMFDFTLHTNYDPDLGAKVLET
FT                   LAEVKAKVAVLPSVEWNRFSHSFSHIFAGGYGAGYYSYLWAEVLSADAFSRFEEEGIFN
FT                   TETGQSFLNNILEMGGSEEPMELFKRFRGREPQVDAMLRHAGIGA"
FT   misc_feature    157380..157445
FT                   /gene="prlC"
FT                   /locus_tag="VSAL_I0122"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1024.000, SD 2.67 at aa 181-202, sequence
FT                   KHITDEAELSGLPESAMSAAKA"
FT   misc_feature    157509..158879
FT                   /gene="prlC"
FT                   /locus_tag="VSAL_I0122"
FT                   /note="HMMPfam hit to PF01432, Peptidase family M3, score
FT                   3.3e-219"
FT                   /inference="protein motif:HMMPfam:PF01432"
FT   misc_feature    158241..158270
FT                   /gene="prlC"
FT                   /locus_tag="VSAL_I0122"
FT                   /note="PS00142 Neutral zinc metallopeptidases,zinc-binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00142"
FT   CDS_pept        complement(158962..160401)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0123"
FT                   /old_locus_tag="TVS3266"
FT                   /product="putative exported peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77808"
FT                   /db_xref="GOA:B6EP82"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP82"
FT                   /protein_id="CAQ77808.1"
FT                   /translation="MPMKSISNITKITGMTLISLSISACSISPNYDKSVGEKNSLVIEQ
FT                   QMGIYQNESLDQYVKQVGARLVSHLDSPQFDFKFEIVDDPIPNAFALPGGYIYISRGLL
FT                   TLMNNEDELACVLAHEIIHVTERHSIQQMKRSILPGITQLPGNIVGSVINEDLGNLINT
FT                   PFTFSNDLLMANYSRSHETESDELGVNLAAKSGYNPMAMGVILARINDAIEFKTQTETE
FT                   KSYFDSHPYTPERVKHVDLSASALRVIPQKPIKPNFLYNLNELVVGDNPENGVFSESTF
FT                   IQPTMGFTIIFPKEWQTVNQPQVVAAINETHDGFVALSVSDPQYTAEQTAHRFSQYLEL
FT                   KYHYLAPVNTVELTWGATMYNVQLTDKEGKQDTFITQYWLDLNDITYQVLTLSTAKNKS
FT                   EVSISALSLQPITDAQIAAITQKEIAITTVIKGESVNELTKRNHSDLSAEETAIWNGLE
FT                   ENTPLHQGDEVKIVVTKPYKK"
FT   misc_feature    complement(159570..159589)
FT                   /locus_tag="VSAL_I0123"
FT                   /note="HMMPfam hit to PF02743, Cache domain, score 3.4e-21"
FT                   /inference="protein motif:HMMPfam:PF02743"
FT   misc_feature    complement(159670..160218)
FT                   /locus_tag="VSAL_I0123"
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   2.7e-27"
FT                   /inference="protein motif:HMMPfam:PF01435"
FT   sig_peptide     complement(160324..160401)
FT                   /locus_tag="VSAL_I0123"
FT   CDS_pept        complement(160523..160837)
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="VSAL_I0124"
FT                   /old_locus_tag="TVS3265"
FT                   /product="protein CyaY"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77809"
FT                   /db_xref="GOA:B6EP83"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP83"
FT                   /protein_id="CAQ77809.1"
FT                   /translation="MNNTEFHELVDAKLQLLEDMIDDSGADIEPIITGNVLTLEFENRS
FT                   QIVINKQEPMHEIWLASKSGGFHFAYTDEKWTCSKTGVEFIEMVKEECQKHADEVIQWA
FT                   "
FT   misc_feature    complement(160526..160837)
FT                   /gene="cyaY"
FT                   /locus_tag="VSAL_I0124"
FT                   /note="HMMPfam hit to PF01491, Frataxin-like domain, score
FT                   1.2e-39"
FT                   /inference="protein motif:HMMPfam:PF01491"
FT   CDS_pept        161114..162367
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="VSAL_I0125"
FT                   /old_locus_tag="TVS3264"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77810"
FT                   /db_xref="GOA:B6EP84"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP84"
FT                   /protein_id="CAQ77810.1"
FT                   /translation="MDYFNYKDDGQLWAEERPITQLAEQYGTPLYVYSRATLERHWNAF
FT                   DSSVGEQPHLVCYAVKANSNIGVLNALACLGSGFDIVSQGELERVVAAGGDPTKVVFSG
FT                   VGKTAKEMRRALELNIKCFNVESEPELERLNAVAEEMGVIAPISLRINPDVDAKTHPYI
FT                   STGLRDNKFGIAFDRAPEVYKFAQTLPNLNIQGIDCHIGSQLTDITPFIDATDRLLALI
FT                   DDLKAQGVNIRHLDVGGGLGVVYRDELPPQPSEYATALLSRLTGREDLELIFEPGRAIA
FT                   ANAGILVTKVEFLKHTEHKNFAIIDAAMNDLMRPALYQAWQDIVPVVPREGEAQSYDLV
FT                   GPICETGDFLGKDRDLVLEANDLLAVRSSGAYGFVMSSNYNTRTRAAEIMVDGDQVHLV
FT                   RKREELSSLWELESILPN"
FT   misc_feature    161213..161962
FT                   /gene="lysA"
FT                   /locus_tag="VSAL_I0125"
FT                   /note="HMMPfam hit to PF02784, Pyridoxal-dependent
FT                   decarboxylase, py, score 1.7e-102"
FT                   /inference="protein motif:HMMPfam:PF02784"
FT   misc_feature    161285..161341
FT                   /gene="lysA"
FT                   /locus_tag="VSAL_I0125"
FT                   /note="PS00878 Orn/DAP/Arg decarboxylases family 2
FT                   pyridoxal-P attachment site."
FT                   /inference="protein motif:ProSite:PS00878"
FT   misc_feature    161798..161839
FT                   /gene="lysA"
FT                   /locus_tag="VSAL_I0125"
FT                   /note="PS00879 Orn/DAP/Arg decarboxylases family 2
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00879"
FT   misc_feature    161969..162286
FT                   /gene="lysA"
FT                   /locus_tag="VSAL_I0125"
FT                   /note="HMMPfam hit to PF00278, Pyridoxal-dependent
FT                   decarboxylase, C-, score 8.9e-33"
FT                   /inference="protein motif:HMMPfam:PF00278"
FT   CDS_pept        162449..163279
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="VSAL_I0126"
FT                   /old_locus_tag="TVS3263"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77811"
FT                   /db_xref="GOA:B6EP85"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EP85"
FT                   /protein_id="CAQ77811.1"
FT                   /translation="MHFHFSKMHGLGNDFMVVDCLTQNIFFSPDLIRRLADRNRGIGFD
FT                   QLLVVEAPYDPETDFHYRIFNSDGTEVEQCGNGARCFARFVRMKGLTNRTTILVSTKKG
FT                   KMSLKVEDDDQITVNMGEPQFEPNKIPFKATQAEKTYLLRAEDKTLFCGAVSMGNPHCV
FT                   TVVDDVDNYDVDKYGPLVEGHERFPERVNAGFMEIVSPSEIKLRVYERGAGETQACGSG
FT                   ACAAVAVGIMQELLEEDVKVSLPGGDLRIVWQGPGKPLFMTGPATHVYDGQLSI"
FT   misc_feature    162461..162826
FT                   /gene="dapF"
FT                   /locus_tag="VSAL_I0126"
FT                   /note="HMMPfam hit to PF01678, Diaminopimelate
FT                   epimerase,score 4.3e-50"
FT                   /inference="protein motif:HMMPfam:PF01678"
FT   misc_feature    162905..163255
FT                   /gene="dapF"
FT                   /locus_tag="VSAL_I0126"
FT                   /note="HMMPfam hit to PF01678, Diaminopimelate
FT                   epimerase,score 1.9e-47"
FT                   /inference="protein motif:HMMPfam:PF01678"
FT   CDS_pept        163276..163977
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0127"
FT                   /old_locus_tag="TVS3262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77812"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP86"
FT                   /protein_id="CAQ77812.1"
FT                   /translation="MNEVTPIEPQPTQLTEDVVAQFLMDHPDFFQQHPELLGRIKVDTP
FT                   ERGVVSLVEVQVSKLRNRIGDLEEEITQLMSLAAKNDRLFHDFADVQKQLLMCESFDQA
FT                   AKIIEQKAVVLNLTAYIKIIDHAHPKYNVDKTALDNFMKKFLNGRSAYLGRLRQTERDS
FT                   LLAYGGLNTSSSELGSFSVLPLGQSTPMGIMAFASRDGGHFQPNMDTLFLEQLVSVFHY
FT                   LLTQWSKAHNE"
FT   misc_feature    163297..163962
FT                   /locus_tag="VSAL_I0127"
FT                   /note="HMMPfam hit to PF04340, Protein of unknown function,
FT                   DUF484, score 3.5e-59"
FT                   /inference="protein motif:HMMPfam:PF04340"
FT   CDS_pept        163970..164881
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="VSAL_I0128"
FT                   /old_locus_tag="TVS3261"
FT                   /product="tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77813"
FT                   /db_xref="GOA:B6EP87"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP87"
FT                   /protein_id="CAQ77813.1"
FT                   /translation="MSESLPPQYEKHLTAFYEFLRNEKGLSIYTQRNYKRQLTTIAEQL
FT                   IELGVDSWQDVDAGWVRQITSKGMRSGLKASSLSTRLSSLRSFFDFLVLRNVLQANPAK
FT                   GVSAPRKSRPLPKNIDVDEMGQLLEVNEDDPLSIRDRAMMELMYGAGLRLAELVGIDVR
FT                   DIQLRQGELRVIGKGDKERKVPFSGKAKEWLGHWLQVRNQLANPEEKGLFVSKLGVRIS
FT                   HRNVQKRMAEWGMKQGVNSHISPHKLRHSFATHMLESSGNLRAVQELLGHENISTTQIY
FT                   THLDFQHLAQAYDQAHPRAKKK"
FT   misc_feature    164006..164257
FT                   /gene="xerC"
FT                   /locus_tag="VSAL_I0128"
FT                   /note="HMMPfam hit to PF02899, Phage integrase, N-terminal
FT                   SAM-like, score 3.5e-17"
FT                   /inference="protein motif:HMMPfam:PF02899"
FT   misc_feature    164348..164842
FT                   /gene="xerC"
FT                   /locus_tag="VSAL_I0128"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,score
FT                   4.7e-52"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   repeat_region   164969..165558
FT                   /note="VSa2"
FT   repeat_region   164969..164992
FT                   /note="IR of VSa2"
FT   CDS_pept        165050..165364
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0129"
FT                   /old_locus_tag="TVS3260"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77814"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77814.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   CDS_pept        165361..165558
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0130"
FT                   /old_locus_tag="TVS3259"
FT                   /product="putative transposase (fragment)"
FT                   /note="Similar to Pseudoalteromonas haloplanktis (strain
FT                   TAC 125) putative orphan protein putative transposase (is66
FT                   family element,orf2-like). UniProt:Q3IIG1 (EMBL:CR954246)
FT                   (115 aa) fasta scores: E()=1.1e-17, 65.2% id in 66 aa. CDS
FT                   is truncated by the insertion of the downstream IS element
FT                   and subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:Q3IIG1"
FT   misc_feature    165376..165558
FT                   /locus_tag="VSAL_I0130"
FT                   /note="HMMPfam hit to PF05717, IS66 Orf2 like protein,score
FT                   3.7e-10"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   repeat_region   complement(165559..166994)
FT                   /note="VSa9"
FT   CDS_pept        complement(165725..166915)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0131"
FT                   /old_locus_tag="TVS3258"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77816"
FT                   /db_xref="GOA:B6EP89"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP89"
FT                   /protein_id="CAQ77816.1"
FT                   /translation="MHAYKPLKQLFNSQNNWLKFLHNNKANLRAVVIENVTKMLSCGTA
FT                   AFGSREYHCCNPDCTHIKYIHQTCKSRACSSCGMKATERWIQKQQHVFPECEYQHITFT
FT                   LPNTLWPIFRHNRLLNKLFKCAANILLGWAKDKGIDVGIFCALHTYGRKLNWNTHLHLS
FT                   VTRGGICERTGLWKPIYFQMKTTEPCWRAAIVSLLGKAYDELDLSSEECPYIHNKTDWS
FT                   RFLSSQYNRRWKLHFAKKTNNVKPTMNYLGRYLKRPPISASRLSHYAKGGMITFNYLDH
FT                   RTGTTDSLTLSPEEMIRRIVEHYPDKHFKMIRYYGFLSMRRRGEALPRVYAALGMTIEA
FT                   EPKMPGYAAMLKGYVKVDPYECILCESRLVFTNFRVGNSVNDLVTHAIVQSELRAA"
FT   CDS_pept        167270..167860
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0132"
FT                   /old_locus_tag="TVS3257"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77817"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP90"
FT                   /protein_id="CAQ77817.1"
FT                   /translation="MKKYLFILPLLLVGCDDDDINANNNTDDDVQSVIEKTPELIGLLQ
FT                   SQETINDQFSVLYEQFEPLLDRSDSLTGVDVNNDGIRDDIEAFIEALEVEEPVRNALKQ
FT                   EARYAQENLYYDFTEKTDANINKAMTMGAKYNKVLACKEFRGILIDDNINTGRTIDALT
FT                   YNTKARTMAYLAYNHLQDGAVSTSLNAEAQYCE"
FT   misc_feature    167282..167314
FT                   /locus_tag="VSAL_I0132"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        167877..169328
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0133"
FT                   /old_locus_tag="TVS3256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77818"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP91"
FT                   /protein_id="CAQ77818.1"
FT                   /translation="MIGALLPLNVNANSCKIEGYTIGFFNGVATTKKDAERGRDKIKST
FT                   LDITQYNGEKVEYQLFYNDSYIESNGFNVLADFAETFDQRTQELEQKQFDRWEAFWDIV
FT                   NGKQDSSIIKKISAAFSWFGGFFTDFNSQRSNIIIREFLELLTLSVDSPDTAKTQMQHK
FT                   LINDSNTWQGKKLIYIAHSQGNLWVNKSYNYVVSQLGYDASNIHVVHIAPASPTLSPNS
FT                   DYILSSSDLVINGLNFTGVGSVPPFNTIIAPSSSDIAGHGLIEVYLTHPKSIQKIKSAT
FT                   DKAFASLTKPDMEDVLFSIDYNYTPTFSESHASPEIEFVDNNNNWVKRTDIYSEISYLQ
FT                   RADPNENKYELNPAKDFEPLSFIHNKKDRESQVISIDQCSDIPNNDPFILGEQSNETIR
FT                   YAWDKVPPNTKVSVTVRDRYGVKLQNDEVSINELRPRGHTYQGIFIDLNAINPYTKEEK
FT                   AFIKQQKLETKYELYSDSILFSISS"
FT   CDS_pept        169900..171447
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0134"
FT                   /old_locus_tag="TVS3255"
FT                   /product="L-2,4-diaminobutyrate decarboxylase"
FT                   /note="Similar to Rhizobium meliloti L-2,4-diaminobutyrate
FT                   decarboxylase, UniProt:Q9Z3R1 (495 aa) fasta scores:
FT                   E()=3e-36, 36.034% id in 469 aa. Expression may be
FT                   regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77819"
FT                   /db_xref="GOA:B6EP92"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP92"
FT                   /inference="similar to sequence:UniProt:Q9Z3R1"
FT                   /protein_id="CAQ77819.1"
FT                   /translation="MDTKYFEKNANNDTLFNQSSLLSNVDFFDSSSLDHYKEITELGLN
FT                   TLIKTVKETSHPNSGISPEELKNAFKNIDLDSPLIDINDVVDELDELYLKHAVYFHHKD
FT                   YLAHLNCPVLLTSLLAEQISCAINTAVETWDQSAGGTFIEQKVIDWLAYRIGYLKSADG
FT                   VFTTGGTQSNLMALLLAREQCSTKLDDTKKASLPTNTSKFRILCSEYSHYSIQKAAFVL
FT                   GLGQEAVISVPANAQRQMDPTALSSTLASLVEQGLIPMAVVATAGTTDFGSIDPIEEIA
FT                   SLCQQYQCWLHVDAAYGGVLLISNKFPHLLKSIEQADSVSIDFHKSFFQPLCCSALMVS
FT                   NGQSLSHLTYHADYLNPKHQADNGIPDLANKSLQTSRRFDALKIWLTLRACGPEAIGKL
FT                   FDDLILNTQEVYQRSQHLTDIKFVQEPQLTTLVFRFVDQRLTPTEQDTCNRAIREALSK
FT                   SRRALIAATVVKGRQYLKITMLNPQTPVNSIVAVFEAINTCGHSITEQLLTNVKQSA"
FT   misc_feature    170086..171207
FT                   /locus_tag="VSAL_I0134"
FT                   /note="HMMPfam hit to PF00282, Pyridoxal-dependent
FT                   decarboxylase conse, score 2.2e-42"
FT                   /inference="protein motif:HMMPfam:PF00282"
FT   CDS_pept        171464..172792
FT                   /transl_table=11
FT                   /gene="iucD"
FT                   /locus_tag="VSAL_I0135"
FT                   /old_locus_tag="TVS3254"
FT                   /product="siderophore biosynthetis protein"
FT                   /note="Similar to Escherichia coli L-lysine 6-monooxygenase
FT                   IucD UniProt:P11295 (425 aa) fasta scores: E()=7.3e-46,
FT                   33.021% id in 427 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77820"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP93"
FT                   /inference="similar to sequence:UniProt:P11295"
FT                   /protein_id="CAQ77820.1"
FT                   /translation="MNKNIYDILGVGIGPFNLSLAALSSSVPDCKSIFLDARSHFDWHP
FT                   GMMLEGTRLQTPFMSDLVTMADPTNEYSFLNYAKLNDRLYPFYIRENFFLAREEYNHYC
FT                   QWACNRLSNLTFNSCVTHIDYDENEAIYCVKTQNTLLDREETYYCHHLVLGTGTQPYLP
FT                   DFCSKKEPKVTHSAHYLMNKAELKASTCITVVGSGQSAAEIFYDLLTDIDVEKYRLRWL
FT                   TRSPRFFSLEYTKLTLEMTSPEYIDYFHQLEPEQRRVLIQKQKHLYKGINADLINDIYD
FT                   LLYIKQLSHDFTVEMMTNVSVHSLSSEQSQVTLHCLHTETQHNFELQTQHIVMATGYEY
FT                   QLPQFLDGICAHLRFDSHGELDVQRNYSVDRNNKIFVQNVGLHTHGLTSPDLGMVCYRN
FT                   ATILNQVLGRTHYKVEKSIAFQQFSPPNCESHLYNATTEHSLE"
FT   CDS_pept        172803..175262
FT                   /transl_table=11
FT                   /gene="iucC"
FT                   /locus_tag="VSAL_I0136"
FT                   /old_locus_tag="TVS3253"
FT                   /product="siderophore biosynthesis protein"
FT                   /note="Similar to Vibrio hollisae Aerobactin synthetase
FT                   IucC UniProt:Q4H460 (586 aa) fasta scores:
FT                   E()=3.9e-49,30.100% id in 598 aa. Possible alternative
FT                   translational start site after codon 56"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77821"
FT                   /db_xref="GOA:B6EP94"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP94"
FT                   /inference="similar to sequence:UniProt:Q4H460"
FT                   /protein_id="CAQ77821.1"
FT                   /translation="MTDFTAKAQCSFTDRYAPKKDQLINISEFEFRNYNEDTDFSVINQ
FT                   WLSQSYSSYWGMNELTEDQRNLELKNTAHKFGLVGLKRGKILFYTELYHPAKDEIGEHY
FT                   PVQEGDCGMHLIIAPVDIPEHRLSQNVITAISSLILEHLPFTRLVVEPDIQNEKVHRLN
FT                   HLIGIEYSQIVPLNSKTAKLGFATKSQFLQSQGKVSSMKNSSKNPSLSLATSHLTTEYW
FT                   HKANQHLIAKMITELSHEQIITPIKLDDASNAQAASWCITFNSDTGTSEYLFRARQYQL
FT                   DHLFVEPQSITCTKDDKNQPLDAVSFILSCRHLLEISDALLPTYLEEITSTLYSKAYKL
FT                   MHQNKTSAQLANASYQEIEAAMTEGHPVFIANNGRIGFDMLDHVEFSPESGQSLNLQWI
FT                   AVLREKTSFAVIESLSYDRLIFDELGQSQLNEFNQQLSMQGLEPSHYYLMPIHPWQWRE
FT                   KISRIFAADIANQYVVPLGTTEDKYQAQQSIRTFFNLSSPEKCYVKTALSILNMGFMRG
FT                   LSPYYMSRTPAINTFIANLIETDPYFAKKQFFVLKEVAAIGYHHSYYEQATRTDNPYKK
FT                   MLSSLWRESPYAPDQHGNVLVNKQQKLLTMASLLHVDDQGKSLISALMADSPLSDHNWL
FT                   KQYMDLYLQPLLHSFFAYDLVFMPHGENLILVLEDNSPIKIIMKDIGEEVAILNGEKTL
FT                   PNDMNCLAVDLEDPMKLNYILLDIFDCIFRFIAPLLEQQTQVSESDFWEIVADSVKDYQ
FT                   QEHPQFDAKYQRYDLYCSSFARTCLNRIQLNNNQQMIDLEDREKNLRFAEDIANPLALF
FT                   AKTHRII"
FT   misc_feature    173853..175235
FT                   /gene="iucC"
FT                   /locus_tag="VSAL_I0136"
FT                   /note="HMMPfam hit to PF04183, IucA / IucC family, score
FT                   9.2e-130"
FT                   /inference="protein motif:HMMPfam:PF04183"
FT   CDS_pept        175286..177451
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0137"
FT                   /old_locus_tag="TVS3252"
FT                   /product="TonB-dependent iron-siderophore receptor
FT                   precursor"
FT                   /note="Similar to Pseudomonas aeruginosa Ferripyoverdine
FT                   receptor precursor FpvA UniProt:P48632 (815 aa) fasta
FT                   scores: E()=4.5e-83, 36.483% id in 688 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77822"
FT                   /db_xref="GOA:B6EP95"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP95"
FT                   /inference="similar to sequence:UniProt:P48632"
FT                   /protein_id="CAQ77822.1"
FT                   /translation="MTLNTNMTSPKIPTYSLFYGLSCVLTLPVMAEDNDNEAMEVMTIT
FT                   AHKQEIASYKTGETSTSTGMDLSYLETPQSVTAVNEQAMKDQQLNSVVDVMNSVSSVYA
FT                   RPMDNDRYTVSARGMEVSTILYDGVPITYDTRFNYGDNLMDTAIYDRVEVVRGANGLMI
FT                   GAGEPSASINLIRKRPTHDFNANVSVGTGSWNLKRGVVDISGSVNTDESIRARLVAVHQ
FT                   ERDSYLDRYEQKRSTLYGVIEADLTTDTLLTVGTDYQYNEPKGTMAGGLPLFHSDGTRT
FT                   NYSTSATTAPDWASAETTALNSFVSLEHSFNPDWVIKGTYTYGDNSLDFNYLWPKGFPD
FT                   PNTNEGMVPGSINYIDGNRKINNLNLTLKGHFSLFGQDHQMIAGFNNQKMTFENTYYKG
FT                   LNAQSEVGDFTDPNWSYPEPEWSREKSWESTGETKQQGIYVASHINVTDQWSFVLGGRL
FT                   SDWETDMNDFGTLHKNKISNEFTSYVGTTYAITPIVAVYASYSDIFTPQNVKGKNNTYL
FT                   DPIKGKNYETGIKASLLDDQLNLSLNGFNTLQDNLGIKTGDVDPNTGMPIYRGVDGTET
FT                   KGFEFETNGAITDDWNLTLGYTYFKIEDPQGNRLKTDIPNKQLKLFTTYELGDVLEGLQ
FT                   IGGGARWYSSIYKEVSGIPNVGDTKVKQDSYAIYDVMVRYEVNKKLNVNANVKNLFDKE
FT                   YYSQMGIYNQYHAGEPRNISVNVDYQF"
FT   sig_peptide     175286..175378
FT                   /locus_tag="VSAL_I0137"
FT   misc_feature    175487..175798
FT                   /locus_tag="VSAL_I0137"
FT                   /note="HMMPfam hit to PF07715, TonB-dependent Receptor Plug
FT                   Domain, score 7.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   misc_feature    176726..177448
FT                   /locus_tag="VSAL_I0137"
FT                   /note="HMMPfam hit to PF00593, TonB dependent
FT                   receptor,score 7.6e-24"
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   CDS_pept        177570..178520
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0138"
FT                   /old_locus_tag="TVS3251"
FT                   /product="iron-siderophore ABC transporter, periplasmic
FT                   binding protein"
FT                   /note="Similar to Escherichia coli
FT                   Ferrienterobactin-binding periplasmic protein precursor
FT                   FepB UniProt:P0AEL6 (318 aa) fasta scores:
FT                   E()=4.8e-05,21.908% id in 283 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77823"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP96"
FT                   /inference="similar to sequence:UniProt:P0AEL6"
FT                   /protein_id="CAQ77823.1"
FT                   /translation="MSSHTAAIPLNQISSSPFPVTIKTAHGTAVIPTHPQRVITLGATT
FT                   EDWCLLLGIVPIAIEAHYWGGDSKGYLPWFKQAVLEQEKALPSVLNSYPELDIEHILSL
FT                   KPDLILAPQSGITLETFNQLNSFVPVVAYPDQPWLTPIDKQVTLISTALGKTEEGEALL
FT                   VQLHQYLASLADANPQFKGKKLAYINAGSRFGNLALYVPGDPRIDSLLALGFIQLPEVK
FT                   DIKPTRGHFTANIGLEHSDIFNDADLIISWYESEKSKQAVEKIPLFSHINAVKQGRYLA
FT                   ITDPSIVMATSYGSLLSLEWVMPAFIPKIKEVMGK"
FT   misc_feature    177672..178424
FT                   /locus_tag="VSAL_I0138"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 7e-07"
FT                   /inference="protein motif:HMMPfam:PF01497"
FT   CDS_pept        178517..179617
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="VSAL_I0139"
FT                   /old_locus_tag="TVS3250"
FT                   /product="iron-siderophore ABC transporter, membrane
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77824"
FT                   /db_xref="GOA:B6EP97"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP97"
FT                   /protein_id="CAQ77824.1"
FT                   /translation="MNNADNQLTSTPDLAILPSLISRNKKVTTTLILLIILSFSAIISG
FT                   LLLGTTTLSPFYLLRLFSENNLNHDTLIIQARLPRVLIGLLAGMSLAMAGCVMQALTRN
FT                   PLADPGLLGVNAGANASIITLSLLSFSANWPLFWLAIPGALLTSVMVYLLSRGHNQSPT
FT                   RLILSGAAISAVLGAYVQARVIVNPSLFSDLKYWMSGSLSGLQLSDINTIWPYFIIATV
FT                   ILLLLAPALNLLSIDRNIAISLGANLRWQPQLGWLGATILCAASTATVGSLTFVGLASA
FT                   HLSRFIAPQDFRWQLPISALIGGNLVVIADVIARTLMPPTELITGIVVAMLGAPFLYLA
FT                   VRRDQMKKSSSVTPCKRRLKRNSNEN"
FT   misc_feature    order(178607..178675,178742..178810,178844..178912,
FT                   178922..178990,179009..179077,179150..179218,
FT                   179276..179344,179483..179539)
FT                   /gene="fepD"
FT                   /locus_tag="VSAL_I0139"
FT   misc_feature    178625..179542
FT                   /gene="fepD"
FT                   /locus_tag="VSAL_I0139"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,score
FT                   1.3e-78"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   CDS_pept        179607..180632
FT                   /transl_table=11
FT                   /gene="fecD"
FT                   /locus_tag="VSAL_I0140"
FT                   /old_locus_tag="TVS3249"
FT                   /product="iron-siderophore ABC transporter, membrane
FT                   permease component"
FT                   /note="Similar to Vibrio cholerae Cytoplasmic membrane
FT                   permease (viuG); id 34.328%; ungapped id 35.276%;
FT                   E()=5.4e-27; 335 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77825"
FT                   /db_xref="GOA:B6EP98"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP98"
FT                   /protein_id="CAQ77825.1"
FT                   /translation="MKTNLVSTWQLGSIVILAPSKRTLNAVIMAMILITLSLVFSLMLG
FT                   KNGITPDDFITLFKGEASPYQDWLFWQSRLPRVLCAIGAGAALGISGAVFQTLTKNPLG
FT                   SPDIIGINAGASAGAVLWLWFLPNQPIAIGALLGAVSVLTIMLIALGKSWQLSRQLVLL
FT                   GIAINAFAVATVQLILTLVQREQAQQLFGYLSGSLANRNWQDVSVIFMTLIIFVPLLLL
FT                   LARRLSLLTQGYDSAIVLGSRVDTAQWQALLLASGLALGAVLTVGPVAFVALVAPHLAR
FT                   FGHSRLALLRSAIYGSLLLLVSDTITLTLPGLFRMPVGVLTALIGGLYLVGLLSRQVTN
FT                   K"
FT   misc_feature    order(179673..179741,179823..179891,179928..179984,
FT                   179997..180065,180084..180152,180210..180278,
FT                   180360..180428,180543..180611)
FT                   /gene="fecD"
FT                   /locus_tag="VSAL_I0140"
FT   misc_feature    179703..180614
FT                   /gene="fecD"
FT                   /locus_tag="VSAL_I0140"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,score
FT                   2e-58"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   CDS_pept        180647..181453
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="VSAL_I0141"
FT                   /old_locus_tag="TVS3248"
FT                   /product="iron-siderophore ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Similar to Vibrio cholerae ATPase (viuC);
FT                   length=279; id 49.802%; ungapped id 50.000%; E()=7.2e-40;
FT                   253 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77826"
FT                   /db_xref="GOA:B6EP99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EP99"
FT                   /protein_id="CAQ77826.1"
FT                   /translation="MQNNNEITKTLSAHHVSLSYSEGQIINRMQLAIPAKKLTVILGPN
FT                   GCGKSSLLKMLSRIKHPDEGCILLGEENILKMNSKTLARQLALLVQKPELPEGIEVIEL
FT                   VSRGRYPHQKMWQQWSLDDETAVQEALIATGLTELIHRPVASLSGGQQQQVWLAMVLAQ
FT                   KSNILMLDEPTSFLDIRAQLLVMNFCLSLRDQGKTLVMVLHDINQAFRYADNIIMMHKG
FT                   KIVAEGKPEDLANPDIIHTIYGVNTTIITDPESQTPMIIPKKDPSI"
FT   misc_feature    180752..181312
FT                   /gene="fepC"
FT                   /locus_tag="VSAL_I0141"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   8.8e-50"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    180773..180796
FT                   /gene="fepC"
FT                   /locus_tag="VSAL_I0141"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   repeat_region   181497..183811
FT                   /note="VSa2"
FT   repeat_region   181497..181520
FT                   /note="IR of VSa2"
FT   CDS_pept        181578..181892
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0142"
FT                   /old_locus_tag="TVS3247"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77827"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77827.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   CDS_pept        181889..182236
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0143"
FT                   /old_locus_tag="TVSb0153"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77828"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77828.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        182308..183795
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0144"
FT                   /old_locus_tag="TVS3244"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77829"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGR2"
FT                   /protein_id="CAQ77829.1"
FT                   /translation="MTDKIKPLPDTIDELKALVLQLENKYNRLLEQFRLAQHQRFGKSS
FT                   ESDSTQFDLFNETEEEIIIENDDTQTITYTRQKPKRQRLPEDLPRTVIIHDIKDKTCKC
FT                   CGLEMHAMGKDISEKLEFVPAKVEVIQHVRPKYACRNCEKNNTSVDIKQAPMPASPIPK
FT                   GIATASLLAQIITAKFQYSLPLYRQETLFQQWGIIIGRRTMADWLIKCSVLFTPLNNEL
FT                   HRILLEQPTLHCDETTVNVLDVEKAKCYMWVYCSGYDSPGSGVLPGIVLYDYQSSRHGY
FT                   HPVNFLKGYNGYLHTDGYQGYEQTEAILVGCWAHARRRFIEAQRVQVKGKTGSADWVLS
FT                   KIQKLYRIESLLKEASPEAKYVARQTEARDLLKELRDWLDSAVSRVSPKTKLGEAISYT
FT                   LNQWDKLVRYIDDGLLSIDNNRAERAVKPFVIGRKNWLFSGSTAGADSSAMLYSIVETA
FT                   KANGLIPYDYIRYCLDRLCVGSPDIDSLLPWNVKDKV"
FT   repeat_region   183788..183811
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(join(183831..184646,184645..185283))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="VSAL_I0145"
FT                   /old_locus_tag="TVS3242"
FT                   /product="guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase (pseudogene)"
FT                   /EC_number="3.6.1.40"
FT                   /note="Similar to Escherichia coli
FT                   Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase
FT                   GppA UniProt:P25552 (494 aa) fasta scores:
FT                   E()=6.1e-48,51.935% id in 491 aa. CDS contains a frameshift
FT                   after codon 213. The sequence has been checked and is
FT                   believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77830.1"
FT                   /inference="similar to sequence:UniProt:P25552"
FT   misc_feature    complement(order(184410..184645,184646..185217))
FT                   /gene="gppA"
FT                   /locus_tag="VSAL_I0145"
FT                   /note="HMMPfam hit to PF02541, Ppx/GppA phosphatase family,
FT                   score 1.1e-94"
FT                   /inference="protein motif:HMMPfam:PF02541"
FT   CDS_pept        complement(185316..186620)
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="VSAL_I0146"
FT                   /old_locus_tag="TVS3241"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77831"
FT                   /db_xref="GOA:B6EPA4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPA4"
FT                   /protein_id="CAQ77831.1"
FT                   /translation="MKKTHITEQKFADLGLEPQVLDGLNAKGFINCTPIQAKALPVLLA
FT                   GQDIAGQAQTGTGKTLAFLAATFNHLLTTPAPEGRKITQPRAIIMAPTRELAIQIYNDA
FT                   ESLIASTGLKAALAYGGERYEKQQKVIEAGVDILIGTTGRIIDFYKQGQIDFKAIQVVV
FT                   LDEADRMFDLGFIKDIRFVFRRMPAPAERLNMLFSATLSYRVQELAFEHMQEPEHVVVE
FT                   PDQKTGHLITEELFYPSNDHKMALLQTLIEEEWPDRAIIFANTKHKCELVWGHLAADKH
FT                   RVGLLTGDVPQKKRERILEEFTKGEVDILVATDVAARGLHIPQVTHVFNFDLPNEAEDY
FT                   VHRIGRTGRAGESGNSISFACEEYAINLPAIEEYIEHSIPQSDYDTSALLEDLPAPIRL
FT                   QRRPPQNRRNGSNNGQRQSGNRKHSRPRPPRSPQA"
FT   misc_feature    complement(185568..185798)
FT                   /gene="rhlB"
FT                   /locus_tag="VSAL_I0146"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 8.5e-34"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    complement(185997..186524)
FT                   /gene="rhlB"
FT                   /locus_tag="VSAL_I0146"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   2.3e-63"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    complement(186108..186134)
FT                   /gene="rhlB"
FT                   /locus_tag="VSAL_I0146"
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00039"
FT   misc_feature    complement(186441..186464)
FT                   /gene="rhlB"
FT                   /locus_tag="VSAL_I0146"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        186733..187059
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="VSAL_I0147"
FT                   /old_locus_tag="TVS3240"
FT                   /product="thioredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77832"
FT                   /db_xref="GOA:B6EPA5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPA5"
FT                   /protein_id="CAQ77832.1"
FT                   /translation="MSDKILQLTDDGFEESVINASGPVLVDFWAEWCGPCKMIAPILDE
FT                   IADEYEGKLTIGKLNIDQNAGTPPKFGIRGIPTLLLFKDGGVAATKVGALSKTQLKEFL
FT                   DANL"
FT   misc_feature    186742..187053
FT                   /gene="trxA"
FT                   /locus_tag="VSAL_I0147"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 2.2e-49"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   misc_feature    186805..186861
FT                   /gene="trxA"
FT                   /locus_tag="VSAL_I0147"
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:ProSite:PS00194"
FT   CDS_pept        187298..188557
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /old_locus_tag="TVS3239"
FT                   /product="transcription termination factor rho"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77833"
FT                   /db_xref="GOA:B6EPA6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPA6"
FT                   /protein_id="CAQ77833.1"
FT                   /translation="MNLTELKNRPVSDLVALGESLGLENLARLRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADCSYLAGPDDIYVSPSQIRRFNLRTGDTIGGKIRPP
FT                   KDGERYFALLKVNAVNYDRPDNARNKILFENLTPLHANDRLRMERGNGSTEDITARILD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAHNYPECELMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGIDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLNRKIAEKRIFPAIDFNRSGTRREELLTKTDELQKMWILRKIVHPMGESDAMEFL
FT                   IDKLSMTKTNNEFFDAMRRQ"
FT   misc_feature    187310..187438
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /note="HMMPfam hit to PF07498, Rho termination
FT                   factor,N-terminal domai, score 1.1e-19"
FT                   /inference="protein motif:HMMPfam:PF07498"
FT   misc_feature    187442..187675
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /note="HMMPfam hit to PF07497, Rho termination
FT                   factor,RNA-binding doma, score 5.6e-58"
FT                   /inference="protein motif:HMMPfam:PF07497"
FT   misc_feature    187454..187645
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /note="HMMPfam hit to PF08206, Ribonuclease B OB
FT                   domain,score 0.002"
FT                   /inference="protein motif:HMMPfam:PF08206"
FT   misc_feature    187727..187801
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:ProSite:PS00464"
FT   misc_feature    187766..188392
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleoti, score 6.2e-74"
FT                   /inference="protein motif:HMMPfam:PF00006"
FT   misc_feature    187829..187852
FT                   /gene="rho"
FT                   /locus_tag="VSAL_I0148"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        188701..189723
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0149"
FT                   /old_locus_tag="TVS3238"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77834"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPA7"
FT                   /protein_id="CAQ77834.1"
FT                   /translation="MRQGLLASILLSTSLMVGVVSASEIQPTFAKSLLVDAQLKKKVDE
FT                   LHQYLIDGDIITLNFSLNRLSMPQQEAVRFMLLQQIEQQKLILDPKGTIWLRAQLTKHP
FT                   TYMIKEQGDGYVVTKLAFDYSSIASRVLNQMSKDQQVLDFILAAEEHSLVLSEWLVGEP
FT                   HEVRVRQSIVLAELDSLTPEALAYLSGQIDDGPISVWLPTTEIVVRLAPLSQDPAVYKI
FT                   LWKMRTDQHSISELTRLSRLSRLSRLSRLAPDKFATDQLIAATSNPSLKQSAFASLAQL
FT                   HPLPSDVEQFLLAKLSHIQDGGAVALHLANYGHGSWLESLLNSRNKVRKQHVRFALSQR
FT                   "
FT   sig_peptide     188701..188766
FT                   /locus_tag="VSAL_I0149"
FT   CDS_pept        189820..191661
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="VSAL_I0150"
FT                   /old_locus_tag="TVS3237"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77835"
FT                   /db_xref="GOA:B6EPA8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPA8"
FT                   /protein_id="CAQ77835.1"
FT                   /translation="MQYKDLRGFLDHLEAIGQLKRISHPIDPHYEMTEISDRTLRAGGP
FT                   ALLFENPIGYDIPVLTNLFGTAERVAIGMGRKDVLELREVGKLLAYLKEPEPPKGFKDA
FT                   MDKLPVFKQVLNMPTKNIRKAACQQIVWKGDDVDLDKIPVMSCWAGDVAPLLTWGLTVT
FT                   RGPHKKRQNLGIYRQQKLSKNKVIMRWLAHRGGALDLRDWMETNPGEPFPVSVAFGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSKTEVTKSISNDLEVPASAEIVLEGYIDPSEFAD
FT                   EGPYGDHTGYYNEIEKHHVFTVTHITMRKDPIYHSTYTGRPPDEPAVLGVALNEVFVPI
FT                   LQKQFPEIIDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVLVCD
FT                   EEVNARDWSEVTAAMSQHMDPFRDSLMIENTPIDSLDFASPVVGLGSKMGLDITKKWDA
FT                   ELALSPNIESSSIESAHIEGNLAELTKAFPEIIDIYLQNDNASMVIVSINKQAAHNGKR
FT                   IMEGVWSQFDENKFVIVCDGDVDVSNWNDIIWAVTTRMDPARDTLFLKNEDSHSKVGLD
FT                   ATNKWEEECLREWGTPIKKDPEIVAKIDAIWGELGIF"
FT   misc_feature    189847..191121
FT                   /gene="ubiD"
FT                   /locus_tag="VSAL_I0150"
FT                   /note="HMMPfam hit to
FT                   PF01977,3-octaprenyl-4-hydroxybenzoate carboxy-lyase, score
FT                   2.7e-200"
FT                   /inference="protein motif:HMMPfam:PF01977"
FT   CDS_pept        191658..191921
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0151"
FT                   /old_locus_tag="TVS3236"
FT                   /product="putative ferredoxin"
FT                   /note="Similar to Equisetum telmateia (Giant horsetail)
FT                   Ferredoxin-1 UniProt:P00234 (95 aa) fasta scores:
FT                   E()=2.5e-08, 42.857% id in 84 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77836"
FT                   /db_xref="GOA:B6EPA9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPA9"
FT                   /inference="similar to sequence:UniProt:P00234"
FT                   /protein_id="CAQ77836.1"
FT                   /translation="MKKITLLPQKKEFGIEEGQTILDAALEAGINYPNRCQVGACAMCL
FT                   CKKLEGEIEYDLDPLLTDKEQEEGWVFACQATAKSDLVLLLE"
FT   misc_feature    191667..191897
FT                   /locus_tag="VSAL_I0151"
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain, score 8.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00111"
FT   misc_feature    191763..191789
FT                   /locus_tag="VSAL_I0151"
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00197"
FT   CDS_pept        192020..192730
FT                   /transl_table=11
FT                   /gene="fre"
FT                   /locus_tag="VSAL_I0152"
FT                   /old_locus_tag="TVS3235"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /EC_number="1.6.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77837"
FT                   /db_xref="GOA:B6EPB0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB0"
FT                   /protein_id="CAQ77837.1"
FT                   /translation="MPINCKVKSIEPLACNTFRILLHPEQPIAFKAGQYLMVVMGEKDK
FT                   RPFSIASSPCRHEGEIELHIGAAEQNAYANEVVQSMKAALENGGDIQIDAPHGEAWIRE
FT                   DNTRSMLLIAGGTGFSYVRSILDHCISQNIEKPIYLYWGGRDERQLYAKAELEAIAAAH
FT                   SHITFVPVIEQGEGWTGKTGNVLEAVKEDFNSLAELDIYIAGRFEMAGAAREQFTTEKQ
FT                   AKKEHLFGDAFAFI"
FT   misc_feature    192029..192322
FT                   /gene="fre"
FT                   /locus_tag="VSAL_I0152"
FT                   /note="HMMPfam hit to PF00970, Oxidoreductase FAD-binding
FT                   domain, score 7e-05"
FT                   /inference="protein motif:HMMPfam:PF00970"
FT   misc_feature    192350..192664
FT                   /gene="fre"
FT                   /locus_tag="VSAL_I0152"
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain, score 5.2e-33"
FT                   /inference="protein motif:HMMPfam:PF00175"
FT   misc_feature    192542..192565
FT                   /gene="fre"
FT                   /locus_tag="VSAL_I0152"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   repeat_region   complement(192815..195130)
FT                   /note="VSa2"
FT   repeat_region   complement(192815..192838)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(join(192831..194039,194042..194320))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0153"
FT                   /old_locus_tag="TVSa0221"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella sp. (strain W3-18-1)
FT                   transposase is66. UniProt:A1RLT8 (EMBL:CP000503) (500 aa)
FT                   fasta scores: E()=1.2e-119, 56.998% id in 493 aa. CDS
FT                   contains a frameshift after codon 93"
FT                   /db_xref="PSEUDO:CAQ77838.1"
FT                   /inference="similar to sequence:UniProt:A1RLT8"
FT   CDS_pept        complement(join(194392..194658,194658..194738))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0154"
FT                   /old_locus_tag="TVSa0220"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Pseudoalteromonas haloplanktis (strain
FT                   TAC 125) putative orphan protein putative transposase (is66
FT                   family element,orf2-like). UniProt:Q3IIG1 (EMBL:CR954246)
FT                   (115 aa) fasta scores: E()=3.3e-31,57.391% id in 115 aa.
FT                   CDS contains a frameshift after codon 27"
FT                   /db_xref="PSEUDO:CAQ77839.1"
FT                   /inference="similar to sequence:UniProt:Q3IIG1"
FT   CDS_pept        complement(194735..195049)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0155"
FT                   /old_locus_tag="TVS3231"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77840"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77840.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   repeat_region   complement(195107..195130)
FT                   /note="IR of VSa2"
FT   CDS_pept        195131..195317
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="VSAL_I0156"
FT                   /old_locus_tag="TVS3230"
FT                   /product="phosphopantetheine adenylyltransferase
FT                   (fragment)"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to C-terminal part of Serratia marcescens
FT                   Phosphopantetheine adenylyltransferase CoaD UniProt:Q9X980
FT                   (161 aa) fasta scores: E()=7.7e-10, 61.111% id in 54 aa.
FT                   CDS is truncated by the insertion of the upstream IS
FT                   element and subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:Q9X980"
FT   CDS_pept        complement(195363..197342)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0157"
FT                   /old_locus_tag="TVSa0219"
FT                   /product="membrane associated sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77842"
FT                   /db_xref="GOA:B6EPB4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB4"
FT                   /protein_id="CAQ77842.1"
FT                   /translation="MSFQQNFKQLSRTIWLSVFIATAIMSVGRLVFLANIGDMAELTHR
FT                   GGDLWRALFTGLRFDLKIVVIGFVPLLLIGLVLAIFPKAYRFFVRIIPWYAGLIFFIVT
FT                   GFSIGNYYYYLTYGNYIDVFIFGLADDDTKAVLANAWADYPIFLSFISSVIVAFFSAII
FT                   VRSAVNKMQQWEWKLQHKGIISVSVFVMILTIFFFARGTLGSHPLKRYHAQISDYKVLN
FT                   SITPNGLIALEWAKSDYKKQNKFHSVNKVDLEAQFTKVVGNSTGQFTTPYNAYLAENKP
FT                   HVVMALMEGMGTNVLVEDNYPENDLLGALRPTFESGFVFKRFLAETPATINTLVNMLGQ
FT                   SNVPTISHSSAQKVEVAAAAARPYKAAGYKTIFITATNGMWRNVANYLPSQGFDEILDE
FT                   NAILKAFPEAEAFRGEWGLSDEYAFKLAEKELKEATQPLMIYILTITNHTPYEVPENYD
FT                   VKPLKVSERLLERMGSGEEEATRLLETYQYANNALGEFIMDIKQSPLGESTLIAATGDH
FT                   KLRGFTMQYPDDLAIINAVPFYLYVPEKIQHQVPYIYNEKVVGSHKDIFPTLYAFSLSE
FT                   ATYYSLGGENMLSTTDTNRFGYNPEMTLIEQGIYMNKQPDRLYPWVSEVAITPESISNN
FT                   GKLLDKDYHTLQTLYINSQVKGVH"
FT   CDS_pept        complement(197379..198197)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="VSAL_I0158"
FT                   /old_locus_tag="TVSa0218"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77843"
FT                   /db_xref="GOA:B6EPB5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB5"
FT                   /protein_id="CAQ77843.1"
FT                   /translation="MPELPEVETSRLGITPHLQGQTIKAITVRTEKLRWPIPQELQKLV
FT                   GQRIQSIRRRAKYLMIDTPEGTAIIHLGMSGSLRILDEAIPTAKHDHVDLVLDSGKLLR
FT                   YNDPRKFGAWLYSEVGVSHDVLAKLGPEPLTDVFNVEYLAEKAKNKKIVVKQFIMNNTI
FT                   VVGVGNIYASESLFMAKINPKAPVGTLTLAQIERLVSDIKKVLETAIKQGGTTLKDFNQ
FT                   VDGKPGYFAQELQVYGRAGEACLICQSLIQEQKIGQRNTFWCEKCQPINQ"
FT   misc_feature    complement(197856..198194)
FT                   /gene="mutM"
FT                   /locus_tag="VSAL_I0158"
FT                   /note="HMMPfam hit to PF01149, Formamidopyrimidine-DNA
FT                   glycosylase N-, score 7.9e-47"
FT                   /inference="protein motif:HMMPfam:PF01149"
FT   CDS_pept        198490..199431
FT                   /transl_table=11
FT                   /gene="hldD"
FT                   /locus_tag="VSAL_I0159"
FT                   /old_locus_tag="TVSa0217"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77844"
FT                   /db_xref="GOA:B6EPB6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB6"
FT                   /protein_id="CAQ77844.1"
FT                   /translation="MIIVTGGAGMIGSNIIKSLNDNGFNDILVVDNLKDGKKFKNLVDL
FT                   DITDYMDKEDFITQIMAGDDFGTIDAIFHEGACSATTEWDGKYMMMNNYEYSKEVLHFC
FT                   IEREIPFLYASSAATYGDTDTFIEEREYEGALNVYGYSKQQFDNYVRRLWADAEAHGET
FT                   VSQITGFRYFNVYGPREQHKGSMASVAFHLNNQMNASEDPKLFERSDEFKRDFVYVGDV
FT                   AAVNLWFLENGVSGIFNCGTGRAEPFRAVADAVIKHHGKGEVQSIPFPEHLKGAYQEFT
FT                   QADLTKLRAAGCDVEFKSVADGVAEYMAIVNK"
FT   misc_feature    198493..199212
FT                   /gene="hldD"
FT                   /locus_tag="VSAL_I0159"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 9.3e-45"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   misc_feature    198496..199302
FT                   /gene="hldD"
FT                   /locus_tag="VSAL_I0159"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/isomera, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01073"
FT   CDS_pept        199602..200828
FT                   /transl_table=11
FT                   /gene="waaL"
FT                   /locus_tag="VSAL_I0160"
FT                   /old_locus_tag="TVSa0216"
FT                   /product="O-antigen ligase WaaL"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77845"
FT                   /db_xref="GOA:B6EPB7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB7"
FT                   /protein_id="CAQ77845.1"
FT                   /translation="MKKISLPLIATILCFLFFSTPIIYPDSYVVAPLLLALFGLFLLPK
FT                   TYHAFKNRDVKYISLSMVGYFILTIISFLYSGGETSQLDMPSRTVLASFILCFLVTYKP
FT                   NPAPLFLAAPIGAAIAGFISFYHSFYIGGCAFVGTFGYMPIQIGGIIASLATFSVISFF
FT                   YYRKTEQKNFAVFSFVAANLGYIATLLSGARGAWLLTPFVLLIVLYLNKELINKKIVGY
FT                   ALLAAIIDLSIASAQITSRLDAIQSDLTQYSAEQSASSSGARLEMWKSALYSAQESPLF
FT                   GQGFSGIEAAKQRQLDAGLIDPIALKYSRAHNQYLEDLQTKGIFGLSVLLIMFAVPFAF
FT                   FKRNLKQYINDSDKDTHYFLALMGASHVALVAGYALTQHYLSHHSGILFFAVGIAILSA
FT                   LVINQRKPS"
FT   CDS_pept        200825..201895
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="VSAL_I0161"
FT                   /old_locus_tag="TVSa0215"
FT                   /product="ADP-heptose-LPS heptosyltransferase II"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77846"
FT                   /db_xref="GOA:B6EPB8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB8"
FT                   /protein_id="CAQ77846.1"
FT                   /translation="MKILIIGPSWVGDMVMSQSLYITLKQQNPDAVIDVMAPAWCKPIL
FT                   ERMPEVNQAIEMPLGHGAFDLFGRRRLSKQLSANNYTHAYICPNSAKSALIPWFAGIPI
FT                   RTGWKGEMRYGLLNDLRSNKKSFQYMVERYVALAHPKSEMINSSSLGGLDTLPRPKLAI
FT                   DADTQQAMLTKFSLSADKPVLGLCPGAEFGPAKQWPVEHYAAVANEMINQGYQVWLFGS
FT                   AKDKETTEAIKSLVHSDNQASVFNLAGDTSLIEAVDLLAACKTVVSNDSGLMHVAAAVG
FT                   CHVVGVYGSTSPKYTPPLAEKVDIVSTDIECRPCFKRECEFKHLKCLTDLDPQLVLDKI
FT                   SPKSHSNESVIQVTSC"
FT   CDS_pept        201889..203151
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="VSAL_I0162"
FT                   /old_locus_tag="TVSa0214"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77847"
FT                   /db_xref="GOA:B6EPB9"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB9"
FT                   /protein_id="CAQ77847.1"
FT                   /translation="MLIRLVYTLLLTLLSPVLLFGLYKKKPNKPQFGDRWKEHFGFTPT
FT                   LKKSEQPLWIHAVSVGEAIAATPLIKALKQQSPEQPILVTTTTSTGAEQIAKLGDLVEH
FT                   RYMPIDFPFAVNGFLKTVNPSKLLIIETELWPNTLHSVGKSNIPIYVVNARLSEKSCQG
FT                   YTKIQPVFTELSKHLTKVLCQTQADADRFARLGINKERLCATGSIKFDIQISDEIKQQG
FT                   QELRQLLDNDRPIWIAASTHKGEDEQVLDAHKEVLKEHPNALLILVPRHPERFDTVFEL
FT                   SKNSGFSSIRRTSNKTVTAETQVYLGDTMGEMLVLIGAADVCFMGGSLLGDKVGGHNVL
FT                   EPAALGVPVIIGPSYYNFKEIVDTLRGEQGIVICEPTQLSNHIVKLIDDSTEYQLLQNS
FT                   ASNVVQSNQGALNRTIAISNI"
FT   CDS_pept        203198..204199
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0163"
FT                   /old_locus_tag="TVSa0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77848"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC0"
FT                   /protein_id="CAQ77848.1"
FT                   /translation="MNVFLVTSPFQYICANEARCHYATNDNILLLVKQDMEPAISQMTK
FT                   IVNENDWTHVINIERSQRTFSMPKAIKAVNKIRTNSSIKHFFHGEYNGWRTKFLLRNLK
FT                   PDTEIYFDDGSLTLGEYERFIKTEHTFYRPRFVNDLIIKMQGLKPIGRLPISKKLEIFT
FT                   IFDIKDPTVPVVKNDFSNMRETYNLNDDHQREHSNEYALFLGQGSIDCHGTIKSFYLDA
FT                   IKRFAKTTGKKILYAPHRTETSDIRKEILKIENLTYHDSTLPIELEIAEKQLNINNIGG
FT                   IASTALYTLKIIYPHIKIYSAKQSKEEYHTQVTYTDNELMLELLKSIGIELF"
FT   repeat_region   complement(204351..205404)
FT                   /note="VSa7"
FT   repeat_region   complement(204351..204380)
FT                   /note="IR of VSa7"
FT   CDS_pept        complement(204352..205308)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0164"
FT                   /old_locus_tag="TVSa0212"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77849"
FT                   /db_xref="GOA:B6EKX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6EKX7"
FT                   /protein_id="CAQ77849.1"
FT                   /translation="MGYQYKQLTLGERYQIEAWNTHSISAREIGQKLKRSNGSISKELR
FT                   RCPAGSYSAEQAHKHAFQKRTLSIKHTKCSQKNKKIIHLYLQLGWSPEQISGRMRREKI
FT                   ENTICCSTIYNAIKREQWQRMLARKGKKYKQRKGVEAGARLIPNRIDISQRPAIVDDKS
FT                   EVGHWEGDTVYGQDGYLVTMVERVSKLLVTCKVRNKSKKAVTRGINRMMKPFKELCKTI
FT                   TFDNGGEFAGHAKIAKHLNCDIYFAKPYHSWQRGLNENTNGLLRRFFPKGMAIGELTAK
FT                   EIKQAEFLINSRPRKTLNFLSPSEFLNGKSVSVIVTI"
FT   repeat_region   complement(205375..205404)
FT                   /note="IR of VSa7"
FT   CDS_pept        complement(205561..206664)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0165"
FT                   /old_locus_tag="TVSa0211"
FT                   /product="hypothetical protein, putative pseudaminic acid
FT                   biosynthesis protein"
FT                   /note="Similar to Campylobacter jejuni PseA UniProt:Q939J7
FT                   (378 aa) fasta scores: E()=6.6e-39, 36.216% id in 370 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77850"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC2"
FT                   /inference="similar to sequence:UniProt:Q939J7"
FT                   /protein_id="CAQ77850.1"
FT                   /translation="MKYCSKCVMPDTRPGIAFDENGICTPCLNHEKKKNIDWDSRYKEL
FT                   EKLCEKYRGINGEGQYDCMIAVSGGKDSHYQVYFMKEVMKMNPLLVSVEDNFPMTDAGK
FT                   HNIRNISEEFGCDIISLKPNIKVQKHLMRKTFERYGKPTWFIDRLIYTYPLMMAEKFNT
FT                   ALLVYGENVSFEYGGADAVETYSARNIIDNGVASDIPFEDLIDDNIQDNDLVLCHAPTK
FT                   SQLDRIDPMYLGYFIPWDSFTNYNFATKRGFKDLTHEWDRTHHVENFDQVDSRAYLVHP
FT                   WLKYPKFGHASATDYAARMVRYGMLTRKEAVELVKAKDAKLDPKCIEDFCNFLGYSNRQ
FT                   FWDVVDGLYNTELFNKDNNGEWVLKSI"
FT   CDS_pept        complement(join(206661..207218,207222..207356))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="nnaC"
FT                   /locus_tag="VSAL_I0166"
FT                   /old_locus_tag="TVSa0210"
FT                   /product="putative acylneuraminate cytidylyltransferase
FT                   (pseudogene)"
FT                   /note="Similar to Escherichia coli NnaC UniProt:Q93NQ1 (421
FT                   aa) fasta scores: E()=3.8e-21, 42.130% id in 216 aa. CDS
FT                   contains a nonsense mutation (TAG) after codon 45. The
FT                   sequence has been checked and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77851.1"
FT                   /inference="similar to sequence:UniProt:Q93NQ1"
FT   CDS_pept        complement(207356..208414)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0167"
FT                   /old_locus_tag="TVSa0208"
FT                   /product="nucleotidyl transferase"
FT                   /note="Similar to Campylobacter coli PtmE UniProt:Q7X521
FT                   (220 aa) fasta scores: E()=5.9e-31, 43.439% id in 221 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77852"
FT                   /db_xref="GOA:B6EPC4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC4"
FT                   /inference="similar to sequence:UniProt:Q7X521"
FT                   /protein_id="CAQ77852.1"
FT                   /translation="MSYSWKKVLIKPESTIVDALRVIDNESLRIALVVNDEQQLLGVVT
FT                   DGDIRRSILNNLPLDTLVVDIMSCSPITASVNTAKEQLVKLMESEGILAIPLMEENKVV
FT                   GLETLHHLFEEKTYHNPVFIMAGGFGTRLRPLTDSCPKPMLKIGNKPILETVIRSFIKA
FT                   GFVNFYISTHYMPEQIQQHFGDGSDLGVKISYVHEDFPLGTGGALGLLPDDLPKDLPLI
FT                   MMNGDVLTKVDFERLLDFHTENEADATMCVREYDYQIPYGVINGEGNKITSMVEKPIQR
FT                   FFVNAGIYVVSPRVIQSVPENHHIDMPTLLEQHMNERDNILMFPIHEYWLDIGRMDDFN
FT                   RAQADIHTLGVL"
FT   CDS_pept        complement(208430..209074)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0168"
FT                   /old_locus_tag="TVSa0207"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77853"
FT                   /db_xref="GOA:B6EPC5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC5"
FT                   /protein_id="CAQ77853.1"
FT                   /translation="MSKTELKPLVVIGGGGHASVLVDILRSQQREILAIVSPEDISQRR
FT                   VFSGLTHLKNDDDVLGFSPDSVYLVNGVGMLPKSGLKRKLNEYFISLGYSFETVISDSA
FT                   QVSSFAEIEQGAQIFSGAIIQAGVVIGAHSIINSGVIIEHDCMIGQYNHIAPKAILCGQ
FT                   VTTHQYVYIGANATVIQNITLEQSSIVGAGAIVTKNISSEQICYPSRSVLK"
FT   CDS_pept        complement(209067..210140)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0169"
FT                   /old_locus_tag="TVSa0206"
FT                   /product="N-acetylneuraminic acid synthase"
FT                   /note="Similar to Campylobacter coli PtmC UniProt:Q7X523
FT                   (334 aa) fasta scores: E()=4.5e-31, 52.113% id in 355 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77854"
FT                   /db_xref="GOA:B6EPC6"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC6"
FT                   /inference="similar to sequence:UniProt:Q7X523"
FT                   /protein_id="CAQ77854.1"
FT                   /translation="MTLIIAEAGVNHNGDENLAFQLVDAAYHAGADIVKFQTFKAKNLV
FT                   TEDAVQAEYQVTNTQKQESQLAMLSRLELSYDIHHQLVKHCESLGIEFLSTAFDSESLD
FT                   FLVNDLGLTRLKIPSGEITNAPLVLEHARTGCDLIVSTGMATLSEIEAVLGVIAFGYVA
FT                   DKTEEPSELAFQQAYASEQGQKALKKKVTILHCTTEYPAPMVEINLKAMDTLGRAFELP
FT                   AGYSDHSAGITIPIAAVARGAVLIEKHFTLDQNMEGPDHKASLEPQELTAMVSAIRQVE
FT                   VALGVGVKSPTVSEVKNKAVARKSLVAAKAIQQGDLITEDNLTIKRPGSGMSPYHYWAL
FT                   LNQPASQDYKAGDLIVE"
FT   CDS_pept        complement(210148..211332)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0170"
FT                   /old_locus_tag="TVSa0204"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.-"
FT                   /note="Similar to Campylobacter coli PtmD UniProt:Q7X522
FT                   (391 aa) fasta scores: E()=1.7e-50, 42.010% id in 388 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77855"
FT                   /db_xref="GOA:B6EPC7"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC7"
FT                   /inference="similar to sequence:UniProt:Q7X522"
FT                   /protein_id="CAQ77855.1"
FT                   /translation="MSQLFMNKKVAVFTGTRAEYGLLFWLLKDIQNDPELQLQLLVSGM
FT                   HLSPEFGETYKQIETDGFVIDEKIEILLSSDSAVGTAKSMGLGVLGFADSLSRLQPDVL
FT                   VILGDRFEALAAAQTAMIMRIPIVHLHGGEITEGAYDDAIRHAITKLSYLHGTSTEDYR
FT                   QRVIQLGEDPSRVQNVGAIGLDHLKRATFMTVAELSESLDFTLDKPFFLVTYHPVTLGN
FT                   EAPEESFQALLNALDEYPDHQVILTYPNADDGGRRIIPILEEYARSNPTRVLAIPSLGQ
FT                   VRYLSSVMHATAVIGNSSSGIIEVPAFDVPTVNIGSRQKGRLAAKSVLNVEPNQQSISD
FT                   AIQVAIDRTYKLADEKIHNPYGQGDTSGKVIEMIKSLQFTPSKAFYDITINDVE"
FT   CDS_pept        complement(211370..212515)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0171"
FT                   /old_locus_tag="TVSa0203"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77856"
FT                   /db_xref="GOA:B6EPC8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC8"
FT                   /protein_id="CAQ77856.1"
FT                   /translation="MNKTPLVEFVRDIYQTNDFIPLHAPTFDGNEQKYVLETIQSTFVS
FT                   SVGKFVDEFEQKIESYTGTAKAVATVNGTAALHAALYMAGVQHGDFVITQALTFVATCN
FT                   ALHHMGAEPIFVDVSPVSLGLCPKAMDEYLTQHAQVTETGCIHSQTKRPIRAVVPMHTF
FT                   GHPVELDELIAVCHKWNITLVEDAAESLGSFYKGKHTGTLGDFGAVSFNGNKIITTGGG
FT                   GMVLCKTAELGARTKHVTTTAKVPHPYEFYHDEAGFNYRMPNLNAALGCAQMEVLEPYL
FT                   AQKRVLANRYQDFFAESDFQFVSEPEYAQSNYWLNAVICPSVDARNDILKQTNESGVMT
FT                   RPIWQLMHRLPMFKEAPRGDLTQSEYIEAHLINLPSTPVAL"
FT   CDS_pept        complement(212539..213729)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0172"
FT                   /old_locus_tag="TVSa0202"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77857"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC9"
FT                   /protein_id="CAQ77857.1"
FT                   /translation="MNPILSLIGRTDALFTQDIASHEAELSRIVSQSRFLVLGGAGSIG
FT                   QAVTKEIFKRNPQKLHVVDISENNMVELVRDIRSSFGYINGDFQTFALDIGSIEYDAFI
FT                   KADGQYDYVLNLSALKHVRSEKDPFTLMRMIDVNVFNTDKTIQQSIDAGAKKYFCVSTD
FT                   KAANPVNMMGASKRIMEMFLMRKSEKMAISTARFANVAFSDGSLLHGFNQRIQKNQPIV
FT                   APNDIKRYFVTPQESGELCLMSCIFGENRDIFFPKLSEALHLISFADIAVKYLKQIGYE
FT                   PHLCDSEDEARELAKTLPAQGKWPCLFTSSDTTGEKDFEEFFTDKETLDMARFDNLGII
FT                   KNDPLYQQELLALFEQKIGQMKSDRQWTKEEIVQLFFTMIPDFGHKETGKYLDSKM"
FT   CDS_pept        complement(213847..214968)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0173"
FT                   /old_locus_tag="TVSa0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77858"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD0"
FT                   /protein_id="CAQ77858.1"
FT                   /translation="MIDIKDKHVFFIADNDRFFYLYADALIHRAKISPESLVVIVFPML
FT                   GHMDNLNKIEQVTYAQINPEVIASALDAKTITFMSLHKGNSSYVKQVLELNESIVDKVH
FT                   IFLADDEVDRWGRVFKKHDNIVEDNKALIGRDDIWVLGKINKFIAHKKTFEQKLVTLLK
FT                   RETIEFIDAGVIFDTLPTLESECLRQAYIKNKIVADSEKKILIGTKQKSFDLRTIISII
FT                   KECTAVLGDEYKFLILWHKKQRKERMFLDLHLIYLRHIKRKTVDVSYVTALNPLGYTAL
FT                   VMSCSHIILQGRGGASTARQFIKWAGGIVCIQEDTANNFGFRDALGLDILSFESSKELA
FT                   SKIKEEKISLQLNAERTQDEEKRSIQELFRLYN"
FT   CDS_pept        complement(214965..216107)
FT                   /transl_table=11
FT                   /gene="rffA"
FT                   /locus_tag="VSAL_I0174"
FT                   /old_locus_tag="TVSa0199"
FT                   /product="lipopolysaccharide biosynthesis protein RffA"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77859"
FT                   /db_xref="GOA:B6EPD1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD1"
FT                   /protein_id="CAQ77859.1"
FT                   /translation="MIPFNKPPVTDNEISYIDQAIKSGCLAGDGHFSKKCETWFENATG
FT                   AQKTLLTPSCTHALEMAALLIDIQPGDEVIMPSYTFVSTANAFVLRGAKIIFVDVHPET
FT                   MNINENLIEAAITKKTKAIVPVHYAGVACEMDLIMSLAHKYSLFVIEDAAQGVMSTYKG
FT                   KALGSIGHLGAFSFHETKNYTSGGEGGLLLINDSRFIKRAEILREKGTNRSQFFRGMVD
FT                   KYSWVDVGSSFLPSEIQSAYLWAQLGSADKINKKRLSDWLFYFNKLLPFQHEGLIDLPH
FT                   IPEEVKHNAHMFYIKVENLEVRTQVLNKLKDRGILAVFHYIPLHSSIAGLQFGRFHAED
FT                   KYTTEESERLLRLPMFYNLLESERELVCNELIKILKEIQS"
FT   CDS_pept        join(216190..216645,216649..216903)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="wavS"
FT                   /locus_tag="VSAL_I0175"
FT                   /old_locus_tag="TVSa0198"
FT                   /product="lipopolysaccharide biosynthesis protein WavS
FT                   (pseudogene)"
FT                   /note="Similar to Vibrio cholerae WavS UniProt:Q8RTH0 (222
FT                   aa) fasta scores: E()=3.6e-13, 39.161% id in 143 aa. CDS
FT                   contains a nonsense mutation (TAA) after codon 152. The
FT                   sequence has been checked and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77860.1"
FT                   /inference="similar to sequence:UniProt:Q8RTH0"
FT   CDS_pept        complement(216890..217729)
FT                   /transl_table=11
FT                   /gene="wavT"
FT                   /locus_tag="VSAL_I0176"
FT                   /old_locus_tag="TVSa0197"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77861"
FT                   /db_xref="GOA:B6EPD3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD3"
FT                   /protein_id="CAQ77861.1"
FT                   /translation="MLKPKASLIIAFYNNTVCLELIFKALSTQTESNFEVIIADDGSKQ
FT                   EAIDFINTRKESLPFTVKHVWHEDKGFRKNRILNHAVLKSSSDYLIIIDGDCIPEKHFI
FT                   EDHFNNAEKGRSLSGRRVELPELYTQRVMNSVSPGAFFSENKLEILIRYMLSNGDKQTK
FT                   GRHIEKGLRFAKLWQQSLFKGKKAKAILGCNFSLFKEDLLKINGFDMRYEAPAVGEDSD
FT                   VDYRLNLVGVTNKSLNGLAVQIHLYHPWLDRVSGNWDILRDTMKHERYWADSGINDC"
FT   CDS_pept        complement(217730..218287)
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="VSAL_I0177"
FT                   /old_locus_tag="TVSa0196"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77862"
FT                   /db_xref="GOA:B6EPD4"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD4"
FT                   /protein_id="CAQ77862.1"
FT                   /translation="MNVIDTNIPDVKIFEPTVFGDERGFFMETWSQKKFEELVTGKPTQ
FT                   FVQDNHSKSKKGILRGLHYQTENTQGKLVRVVSGEVFDVVVDIRENSPTFGQWVGTYLS
FT                   AENKHQLWVPEGFAHGFYVTSEDAEFVYKCTDYYNPKSEISIAWDDKAIGIEWPITTPP
FT                   QLSEKDKNAMILSQVTPIKQED"
FT   CDS_pept        complement(join(218298..218987,218997..219197))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /locus_tag="VSAL_I0178"
FT                   /old_locus_tag="TVSa0195"
FT                   /product="dTDP-4-dehydrorhamnose reductase (pseudogene)"
FT                   /note="Similar to Vibrio cholerae
FT                   DTDP-6-deoxy-L-mannose-dehydrogenase rmlD UniProt:Q842N3
FT                   (291 aa) fasta scores: E()=2.3e-59, 58.108% id in 296 aa.
FT                   CDS contains two nonsense mutations (TAA) and (TAA) after
FT                   codon 67. The sequence has been checked and is believed to
FT                   be correct"
FT                   /db_xref="PSEUDO:CAQ77863.1"
FT                   /inference="similar to sequence:UniProt:Q842N3"
FT   CDS_pept        complement(219197..220081)
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="VSAL_I0179"
FT                   /old_locus_tag="TVSa0194"
FT                   /product="glucose-1-phosphate thymidylyltransferase RmlA"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77864"
FT                   /db_xref="GOA:B6EPD6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD6"
FT                   /protein_id="CAQ77864.1"
FT                   /translation="MKGIVLAGGSGTRLYPLTRGVSKQLLPIYDKPMVFYPISTLMLAG
FT                   IKDILIITTPEDNAGFKRLLGDGSDFGINLEYAIQPSPDGLAQAFIIGEEFIGDDPVCL
FT                   VLGDNIFYGQSFSKTLKNAASRDLGATVFGYQVKDPERFGVVEFDEKMKAISIEEKPLK
FT                   PKSNYAVTGLYFYDNRVVEMAKQVKPSHRGELEITTLNEMYLNDGSLNVELLARGFAWL
FT                   DTGTHESLHEASSFVQTIEHIQGLKVACLEEISWRNGWLSDEQILDLATPMMKNEYGQY
FT                   LTRLINDNKQKEL"
FT   CDS_pept        complement(220081..221172)
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="VSAL_I0180"
FT                   /old_locus_tag="TVSa0193"
FT                   /product="dTDP-D-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77865"
FT                   /db_xref="GOA:B6EPD7"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD7"
FT                   /protein_id="CAQ77865.1"
FT                   /translation="MNILVTGGAGFIGSAVIRHIISNTSNSVINVDSLTYAGNLESLSQ
FT                   VEASDRYSFEHVDICNRTELDRIFSEYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGT
FT                   YTLLEATRAYWNLLADDKKQAFRFHHISTDEVYGDLEGTDDLFTETTPYEPSSPYSASK
FT                   ASSDHLVRAWQRTYGLPTVITNCSNNYGPYHFPEKLIPLMILNALEGKYLPVYGNGMQI
FT                   RDWLFVEDHARALYKVVTEGEIGETYNIGGHNEKANIEVVKTICSLLEELVPNKPEGVA
FT                   QYLDLITYVTDRPGHDVRYAIDASKIEHELGWKPEESFESGIRKTVQWYLDNKQWWSRV
FT                   LDGSYAGERLGVSSEQVVHKEIR"
FT   CDS_pept        complement(221194..223047)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0181"
FT                   /old_locus_tag="TVSa0193a"
FT                   /product="membrane associated sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77866"
FT                   /db_xref="GOA:B6EPD8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD8"
FT                   /protein_id="CAQ77866.1"
FT                   /translation="MILNTLTFKQKLHSHGWFILINSLIAMAIATRYFAFLPEIPTDIL
FT                   GFSFITSGTFSQMVLLVGLIGLVALPALAIRPAKIRNGLQALIASICIATLFIDILVFA
FT                   QYRFHINAVVLELVLSGQVVSFPLITWVTVIGGVIALVVGQYLLISWLEKPAAITQHKL
FT                   GRKFALITFFALLATHGIHIWAAANAYQPVTTVKRYLPAFYPATSTSMMKKYGWVNEEA
FT                   IAQQKAMKLNRKSDLNYPLAPLQKEAVEKPINIMILTVDSWRADTFNAENTPNMWEYAQ
FT                   SGVIFNNHIATGNATRTGIFGLFYGIPGTYWHGFLANQKTPALIDRLQELNYDMGIFTA
FT                   AQLEKPEFNQTVFKNIPNLRIKSEGGSPSELDKDLTKDWLEWYSKRDTSKPAFSFLFYD
FT                   APHGYDFPKDYAHRYEPMLDEINYLELSNDSDPTPFFNRYKTSVHFVDSVAKQVLDKLK
FT                   ETGDLENTLVIITGDHGQEMNDNRMNFWGHNSNFTDAQVKVPFAIFGPKINGKALDWTA
FT                   DDLTSHQDVVPTLMKNYLGVTNNIKDYSVGEDLLGKHVDRNWIMTSNYSGYAIIDKESI
FT                   LEVGATGQYQLLDKTNRPMKDAELNYQHLQEALEQISRFSK"
FT   CDS_pept        complement(223080..223784)
FT                   /transl_table=11
FT                   /gene="wavC"
FT                   /locus_tag="VSAL_I0182"
FT                   /old_locus_tag="TVSa0192"
FT                   /product="lipopolysaccharide core oligosaccharide
FT                   biosynthesis protein WavC"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77867"
FT                   /db_xref="GOA:B6EPD9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD9"
FT                   /protein_id="CAQ77867.1"
FT                   /translation="MQKIQTTKQTIWYDDSILSDSPEQCCDPDYWQQQDKVIGSAQGRG
FT                   TTWFVALDTMDAALRHYRRGGLFGKLIKDHYIFTGWEKTRSYQEFQLLNILIEAGVNVP
FT                   KPIAARSIKRTFCYQADLLSEKIPHARDLVAILQEESLSKEIYQKIGAEIGKMHTAQVN
FT                   HTDLNIHNILIDDKENVWIIDFDKCYQQEGSDWKESNLSRLNRSFHKEVNKRQIKWSED
FT                   EWQHLFSGYNTI"
FT   CDS_pept        224160..225230
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0183"
FT                   /old_locus_tag="TVSa0191"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77868"
FT                   /db_xref="GOA:B6EPN4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPN4"
FT                   /protein_id="CAQ77868.1"
FT                   /translation="MALFTSAPNSLCILRLSAIGDVCHAVAAVQAIQKEWPTTKITWIV
FT                   GKIEAQLIHDLPGITVIPFDKKLGLKGMKAIWSQLNNQRFDALIHMQLALRASVLTIGI
FT                   KAKYKVGFNRKRAKEGQWLFTNRKIEDTASAHVLDSFYSFIEYLGVPKSEPTWNIPLSD
FT                   DDFSFVNSHIPAEKPYVVISPAASKDERNWLTERYAQLSDWLTTQGYQVVLCGSPSDRE
FT                   KQLGDSIESLANSPLINLIGKTSLKQLTAVLKKATVVIAPDSGPAHIATTQATPVIGLY
FT                   GHSNPKRTGPYNSLSYVVSVYEQHVTQQQNKPVNELKWSTRVKGEHIMQDITLDMVARS
FT                   FQQLEIILNSTEEGKK"
FT   CDS_pept        225230..226012
FT                   /transl_table=11
FT                   /gene="waaE"
FT                   /locus_tag="VSAL_I0184"
FT                   /old_locus_tag="TVS0057a"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77869"
FT                   /db_xref="GOA:B6EPF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPF5"
FT                   /protein_id="CAQ77869.1"
FT                   /translation="MTTSSPTLAVALIVKNEAKHLKACLDTVADWVDEIVIMDSGSTDS
FT                   TETIAREFTDKFIVNKEWPGFGKQRQLAQQHVTSDYVLWLDADERVTPELKTEILAAVK
FT                   ANKTKTAYKINRSSSAFGKFIKHSGWSPDWVVRLYKTDETQYSDSLVHESVVIPNHIQV
FT                   NALTGRLLHFTYDALQQYNAKNVMYIKSWVDQREGKKKGSLSGAFLHGFFCFIRMYILK
FT                   RGFLDGRHGLLLATLSASVTFNRYADLWLRDYNKANKE"
FT   CDS_pept        226012..227043
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0185"
FT                   /old_locus_tag="TVS0057"
FT                   /product="glycosyl tranferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Rhizobium meliloti lipopolysaccharide
FT                   core biosynthesis glycosyl transferase LpsD UniProt:Q9R9N0
FT                   (343 aa) fasta scores: E()=1e-10, 25.852% id in 352 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77870"
FT                   /db_xref="GOA:B6EPF4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPF4"
FT                   /inference="similar to sequence:UniProt:Q9R9N0"
FT                   /protein_id="CAQ77870.1"
FT                   /translation="MMKIYHVNLARGFSGGEQQTLALIQQHLKEKQNIAVIALTNSPFY
FT                   NAISDLGCEVITVRHYLLGHTISLPKDAVLHVHEGHAIYWAALQHKVSQTPYIITRRLD
FT                   NPIKKKWLTTFAYSNAAAIVGISTCVSEVVRQRLPQQHIMTIPDSPVTYPINHSEVANI
FT                   RERFKDKFLVIQAGNMIPHKGFDVTVNAAMLLKDPRVHICLLGDGKQRCELEKQASGLT
FT                   NISFMGRQHNMGDWFAAADLLIHPSYTEGLGSVILEGMSTGLPAIGSRAGGIPNIIEHE
FT                   KSGLLIEPGNSTELAEHIEKIANNATLKEHLIEGGWEKLTAFMIEHTAALYFKVYQRAL
FT                   QHD"
FT   CDS_pept        227036..227524
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="VSAL_I0186"
FT                   /old_locus_tag="TVS0056"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77871"
FT                   /db_xref="GOA:B6EPN7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPN7"
FT                   /protein_id="CAQ77871.1"
FT                   /translation="MTKLTLYPGTFDPITNGHLDLIKRSAAMFEHIIVAVAASPSKNTL
FT                   FTLDERVQLVQEVTQDLPNVSVEGFSGLMVDFARQKQANLLVRGLRTTMDFEYEFGLTS
FT                   MYRKLMPELESVFLTPSEEYAFLSSTIVREVALHGGSVEAFVPSVVNQALIHKVKSPV"
FT   misc_feature    227051..227440
FT                   /gene="coaD"
FT                   /locus_tag="VSAL_I0186"
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   4e-36"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   misc_feature    227072..227497
FT                   /gene="coaD"
FT                   /locus_tag="VSAL_I0186"
FT                   /note="HMMPfam hit to PF08218, Citrate lyase ligase
FT                   C-terminal domain, score 0.0044"
FT                   /inference="protein motif:HMMPfam:PF08218"
FT   CDS_pept        complement(227568..229547)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0187"
FT                   /old_locus_tag="TVS0055"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77872"
FT                   /db_xref="GOA:B6EPB4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB4"
FT                   /protein_id="CAQ77872.1"
FT                   /translation="MSFQQNFKQLSRTIWLSVFIATAIMSVGRLVFLANIGDMAELTHR
FT                   GGDLWRALFTGLRFDLKIVVIGFVPLLLIGLVLAIFPKAYRFFVRIIPWYAGLIFFIVT
FT                   GFSIGNYYYYLTYGNYIDVFIFGLADDDTKAVLANAWADYPIFLSFISSVIVAFFSAII
FT                   VRSAVNKMQQWEWKLQHKGIISVSVFVMILTIFFFARGTLGSHPLKRYHAQISDYKVLN
FT                   SITPNGLIALEWAKSDYKKQNKFHSVNKVDLEAQFTKVVGNSTGQFTTPYNAYLAENKP
FT                   HVVMALMEGMGTNVLVEDNYPENDLLGALRPTFESGFVFKRFLAETPATINTLVNMLGQ
FT                   SNVPTISHSSAQKVEVAAAAARPYKAAGYKTIFITATNGMWRNVANYLPSQGFDEILDE
FT                   NAILKAFPEAEAFRGEWGLSDEYAFKLAEKELKEATQPLMIYILTITNHTPYEVPENYD
FT                   VKPLKVSERLLERMGSGEEEATRLLETYQYANNALGEFIMDIKQSPLGESTLIAATGDH
FT                   KLRGFTMQYPDDLAIINAVPFYLYVPEKIQHQVPYIYNEKVVGSHKDIFPTLYAFSLSE
FT                   ATYYSLGGENMLSTTDTNRFGYNPEMTLIEQGIYMNKQPDRLYPWVSEVAITPESISNN
FT                   GKLLDKDYHTLQTLYINSQVKGVH"
FT   CDS_pept        complement(229584..230402)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="VSAL_I0188"
FT                   /old_locus_tag="TVS0054"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77873"
FT                   /db_xref="GOA:B6EPB5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB5"
FT                   /protein_id="CAQ77873.1"
FT                   /translation="MPELPEVETSRLGITPHLQGQTIKAITVRTEKLRWPIPQELQKLV
FT                   GQRIQSIRRRAKYLMIDTPEGTAIIHLGMSGSLRILDEAIPTAKHDHVDLVLDSGKLLR
FT                   YNDPRKFGAWLYSEVGVSHDVLAKLGPEPLTDVFNVEYLAEKAKNKKIVVKQFIMNNTI
FT                   VVGVGNIYASESLFMAKINPKAPVGTLTLAQIERLVSDIKKVLETAIKQGGTTLKDFNQ
FT                   VDGKPGYFAQELQVYGRAGEACLICQSLIQEQKIGQRNTFWCEKCQPINQ"
FT   misc_feature    complement(230061..230288)
FT                   /gene="mutM"
FT                   /locus_tag="VSAL_I0188"
FT                   /note="HMMPfam hit to PF01149, Formamidopyrimidine-DNA
FT                   glycosylase N-, score 7.9e-47"
FT                   /inference="protein motif:HMMPfam:PF01149"
FT   CDS_pept        complement(230590..231048)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0189"
FT                   /old_locus_tag="TVS0001c"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77874"
FT                   /db_xref="GOA:B6EPP0"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP0"
FT                   /protein_id="CAQ77874.1"
FT                   /translation="MKKPSRRKYNNILMIAVLVFIGVLQAPQLIKTYLLEPEQQVDTVT
FT                   GVQPLFEGSNTIQKMHFADYDPAPDTSETVSQLIEHWFTLQGTVLNEESVKVLKTKLPA
FT                   PSTVEAWLEKQEEPQRITIYQAPNFWMMQNWQGEWIAVSGEEGYLFRN"
FT   misc_feature    complement(230962..231015)
FT                   /locus_tag="VSAL_I0189"
FT   sig_peptide     complement(230971..231048)
FT                   /locus_tag="VSAL_I0189"
FT   CDS_pept        complement(231313..231480)
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="VSAL_I0190"
FT                   /old_locus_tag="TVS0001b"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77875"
FT                   /db_xref="GOA:B6EPP1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPP1"
FT                   /protein_id="CAQ77875.1"
FT                   /translation="MAKGAREKIKLVSTANTGHFYTTDKNKRNMPGKMEIKKFDPVVRQ
FT                   HVLYKEAKIK"
FT   misc_feature    complement(231361..231420)
FT                   /gene="rpmG"
FT                   /locus_tag="VSAL_I0190"
FT                   /note="PS00582 Ribosomal protein L33 signature."
FT                   /inference="protein motif:ProSite:PS00582"
FT   CDS_pept        complement(231494..231730)
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="VSAL_I0191"
FT                   /old_locus_tag="TVS0001a"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77876"
FT                   /db_xref="GOA:B6EPP2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPP2"
FT                   /protein_id="CAQ77876.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKR
FT                   FVKLRLTAKGMRIIDKKGIDVVLSEMRARGENV"
FT   CDS_pept        complement(231926..232600)
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="VSAL_I0192"
FT                   /old_locus_tag="TVS0001"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77877"
FT                   /db_xref="GOA:B6EPP3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPP3"
FT                   /protein_id="CAQ77877.1"
FT                   /translation="MSLMNLPEESRPREKLLALGPKSLTDAELLAIFLRTGIKGMNAIE
FT                   LADKLLKEFGSLRKLLGSNENEFCSHKGLGTAKFAQLQAVVEMTERYLFEKIEKEDALT
FT                   SPEHTKRYLTRILRDRHREAFYVLFLDNQHRVLKGEVLFEGTIDAAAVYPREVVKRSID
FT                   YNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLDHFVIGDGEIVSFAERG
FT                   WI"
FT   misc_feature    complement(231929..232303)
FT                   /gene="radC"
FT                   /locus_tag="VSAL_I0192"
FT                   /note="HMMPfam hit to PF04002, RadC, DNA repair
FT                   protein,score 1.8e-75"
FT                   /inference="protein motif:HMMPfam:PF04002"
FT   CDS_pept        232816..234036
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="VSAL_I0193"
FT                   /old_locus_tag="TVS0002"
FT                   /product="coenzyme A biosynthesis bifunctional protein
FT                   CoaBC [includes: phosphopantothenoylcysteine decarboxylase;
FT                   phosphopantothenate--cysteine ligase]"
FT                   /EC_number="6.3.2.5"
FT                   /note="Possible alternative upstream translational start
FT                   sites"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77878"
FT                   /db_xref="GOA:B6EPP4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP4"
FT                   /protein_id="CAQ77878.1"
FT                   /translation="MASLSGKRILLGISGGIAAYKCAELTRRLIERGAEVRVVMTTAAK
FT                   EFITPLTMQAVSGHPVADSLLDPAAEASMGHIELAKWADIVLLAPATADLIARMAAGMG
FT                   NDLLSTLVLATDSPIAVSPAMNQQMYANLATQENIATLTRRGMHIWGPAAGQQACGDVG
FT                   MGRMLEPMELVHLCEDFFQPKALEGQSLLITAGPTREALDPVRYISNHSSGKMGFAIAE
FT                   AAAQLGAKVTLISGPVNLATPANVERIDIESAEQMHSAVMSNASSHSLFIACAAVADFR
FT                   PSQVATQKMKKTADNDGMTITMVKNPDIVASVAAMTEQRPFTVGFAAETQEVEKYARGK
FT                   LERKNLDMICANDVSIQGQGFNSDNNALHLYWKGGDKALPLTAKSELGKAIMLEIVERL
FT                   ETIRCAN"
FT   misc_feature    232834..233187
FT                   /gene="coaBC"
FT                   /locus_tag="VSAL_I0193"
FT                   /note="HMMPfam hit to PF02441, Flavoprotein, score 1.9e-43"
FT                   /inference="protein motif:HMMPfam:PF02441"
FT   misc_feature    233371..233913
FT                   /gene="coaBC"
FT                   /locus_tag="VSAL_I0193"
FT                   /note="HMMPfam hit to PF04127, DNA / pantothenate
FT                   metabolism flavoprote, score 8e-44"
FT                   /inference="protein motif:HMMPfam:PF04127"
FT   misc_feature    233605..233637
FT                   /gene="coaBC"
FT                   /locus_tag="VSAL_I0193"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        234260..234850
FT                   /transl_table=11
FT                   /gene="slmA"
FT                   /locus_tag="VSAL_I0194"
FT                   /old_locus_tag="TVS0003"
FT                   /product="HTH-type regulatory protein, TetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77879"
FT                   /db_xref="GOA:B6EPP5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP5"
FT                   /protein_id="CAQ77879.1"
FT                   /translation="MTTTKKINRRDEILQSLAQMLESNEGASRITTAKLAKQVGVSEAA
FT                   LYRHFPSKAKMFEGLIEFIEESLFSRINRIIEDEKDTLKRIELLLKLLLAFAERNPGLT
FT                   RIMTGHALMFENERLRERINQIFERIELQFKQILRERMIREGKAFPVDEGILAAQLVGQ
FT                   VEGSFCRFVRSDFKYQPTANFNEYWALLSAQIQ"
FT   misc_feature    234296..234439
FT                   /gene="slmA"
FT                   /locus_tag="VSAL_I0194"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 8.7e-10"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    234347..234412
FT                   /gene="slmA"
FT                   /locus_tag="VSAL_I0194"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2248.000, SD 6.84 at aa 30-51, sequence
FT                   ITTAKLAKQVGVSEAALYRHFP"
FT   CDS_pept        234906..235847
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="VSAL_I0195"
FT                   /old_locus_tag="TVS0004"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77880"
FT                   /db_xref="GOA:B6EPP6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP6"
FT                   /protein_id="CAQ77880.1"
FT                   /translation="MMSKYQAPTFSYSLLHPKYWGVWFGFGLLFTIVTILPYKATYKLA
FT                   RGLGFLGLKVSTSRAHVARRNLELAFPEMTPSEREAIVIENFKNSGLAIFETAMAWVWP
FT                   DWRIEKHFSYENVQHLLDFEKEKKGVLVVIVHALNLELTCRAMAAVSPGYGVYRPHNNP
FT                   AYDFIQYWGRTSHGNQTIDRKDVKGMIRKLRNGERVCYLPDHDYNRNKSVFVPFFAVPD
FT                   ACTTIGTDILISASQCAVITASGFRTYNNYHLNIDHDISDQLPKNDPTGVATVMNQAVE
FT                   RVILRGIPQWMWLHKRFKTMEDPSIKKGIRYD"
FT   misc_feature    234924..235805
FT                   /gene="htrB"
FT                   /locus_tag="VSAL_I0195"
FT                   /note="HMMPfam hit to PF03279, Bacterial lipid A
FT                   biosynthesis acyltr, score 6.9e-82"
FT                   /inference="protein motif:HMMPfam:PF03279"
FT   misc_feature    234963..235031
FT                   /gene="htrB"
FT                   /locus_tag="VSAL_I0195"
FT   CDS_pept        235883..236350
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="VSAL_I0196"
FT                   /old_locus_tag="TVS0005"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77881"
FT                   /db_xref="GOA:B6EPP7"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP7"
FT                   /protein_id="CAQ77881.1"
FT                   /translation="MKTNLITREGFNKLQDELTFLWKEDRPEVTKKVTWAASLGDRSEN
FT                   ADYQYNKKRLREIDRRVRYLRKRLDQVKVVDYSPQQDGKVFFGAFVVIENEQGDTLSFR
FT                   IVGPDEIFGRHDYISIDSPMARALIKKEVDEEAIVKTPEGDKEWFVNSIKY"
FT   misc_feature    235883..236104
FT                   /gene="greB"
FT                   /locus_tag="VSAL_I0196"
FT                   /note="HMMPfam hit to PF03449, Prokaryotic transcription
FT                   elongation fact, score 1.5e-38"
FT                   /inference="protein motif:HMMPfam:PF03449"
FT   misc_feature    235901..236026
FT                   /gene="greB"
FT                   /locus_tag="VSAL_I0196"
FT                   /note="PS00829 Prokaryotic transcription elongation factors
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00829"
FT   misc_feature    236120..236347
FT                   /gene="greB"
FT                   /locus_tag="VSAL_I0196"
FT                   /note="HMMPfam hit to PF01272, Prokaryotic transcription
FT                   elongation fact, score 6.6e-34"
FT                   /inference="protein motif:HMMPfam:PF01272"
FT   misc_feature    236237..236287
FT                   /gene="greB"
FT                   /locus_tag="VSAL_I0196"
FT                   /note="PS00830 Prokaryotic transcription elongation factors
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00830"
FT   CDS_pept        236541..238877
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0197"
FT                   /old_locus_tag="TVS0006"
FT                   /product="putative RNA binding protein"
FT                   /note="Similar to Escherichia coli S1 RNA binding domain
FT                   (PDB 1SRO), evalue=5e-09 identity=(31, 75). Expression may
FT                   be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77882"
FT                   /db_xref="GOA:B6EPP8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP8"
FT                   /protein_id="CAQ77882.1"
FT                   /translation="MIINIIAKELNVRPQQVAAAVQLIDEGSTIPFIARYRKEVTEGLD
FT                   DTQLRTLDTRLTYLRELDDRRKSILKSIKEQEKLTPELEREILDADSKTRLEDLYLPFK
FT                   RKRRTKGQIAIEAGIEPLADLLWTRPENTPEEAAQSYINADNGFADTKAVLDGARAILM
FT                   ERMAEDANLLEKVRNYLTSNAELSSKMVDGQEHTGEKFKDYFEHNEKLTRVPSHRALAM
FT                   LRGRNEGFLQLSINADPNQEEGVRGSYCEIIIANHYGVTLGSQPADLWRKQVISWTWRI
FT                   KILMHMETELMGALKERSEDEAIDVFATNLKDLLMAAPAGLKTTLGLDPGLRTGTKVAV
FT                   VDATGKVLATDTIYQNQPHNKTAQSAQIIETLIKRHNVDLIAIGNGTASRETDAFVGDL
FT                   LKKSGLSATKIIVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDPLAELVKID
FT                   PKAIGVGQYQHDVSQSQLAKKLDAVIEDCVNAVGVDVNTASSALLTRVAGLSTTIAQNI
FT                   VDYRDENGRFENRITLKKVARLGPKAFEQCAGFLRVMNGKNPLDASAVHPEAYPVVKTI
FT                   AEKNGKAIDAIIGNTEFLRSVSANDYISADFGLPTVTDIISELDKPGRDPRPEFKTATF
FT                   ADGVNTVSDLELGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSDTFVSDPREVVKA
FT                   GDIVKVKVMEVDAQRKRIALTMRLNDQPGEDTRPQRQSNQPQQRNERTQAPRPSSSARQ
FT                   QRSNNDVGNAAMGGAFAAAFAKAKK"
FT   misc_feature    238470..238691
FT                   /locus_tag="VSAL_I0197"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain,score
FT                   5.6e-25"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS_pept        complement(239187..239666)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0198"
FT                   /old_locus_tag="TVS0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77883"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPP9"
FT                   /protein_id="CAQ77883.1"
FT                   /translation="MNFSINSVNVPLIAPSVNLPTEQVARENRIKKPVVPTTKMSETTS
FT                   EKAIKGDDKQHKRDAWEPSDHPGYDVMEEKSKSKPHIGTLYDIDDDLAKLARLLSLDTY
FT                   AQGEGTGYTMRFNLPKELLEKLAEMGRMVRRRSVISFHYDKAVVPNNPSDILAVL"
FT   CDS_pept        complement(239701..240486)
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="VSAL_I0199"
FT                   /old_locus_tag="TVS0008"
FT                   /product="carboxylesterase BioH"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77884"
FT                   /db_xref="GOA:B6EPQ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPQ0"
FT                   /protein_id="CAQ77884.1"
FT                   /translation="MTTSLYWQTEGEGSDLVLIHGWGMNGAVWQPIVEKLSSQYRVHTV
FT                   DLSGYGYSAELGSADFDEMVAQVLAQAPEKSAWLGWSLGGLIATQAALTAPDRVSQLIT
FT                   VASSPRFAAEKGWRGIKSAVLSQFTEQLKEDFTLTVERFMTLQAMGSPNAKQDIKQVKR
FT                   AVLSRPAPNPSALATGLTILADIDLRESLSQLTMPVCRMYGRLDGLVPIKVAHDMDAFI
FT                   PHSTKVVFEQASHAPFISHSDEFITELHRFLQPEDEFLI"
FT   misc_feature    complement(239734..240369)
FT                   /gene="bioH"
FT                   /locus_tag="VSAL_I0199"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase
FT                   fold,score 2.7e-26"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   misc_feature    complement(240049..240078)
FT                   /gene="bioH"
FT                   /locus_tag="VSAL_I0199"
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00339"
FT   CDS_pept        join(240515..240799,241807..242241)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0200"
FT                   /old_locus_tag="TVS0009"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /function="could be involved in gluconate metabolism by
FT                   similarity to E.coli"
FT                   /note="Similar to Escherichia coli Protein GntX
FT                   UniProt:P46846 (227 aa) fasta scores: E()=4.9e-19, 35.398%
FT                   id in 226 aa. CDS is disrupted by the insertion of an IS
FT                   element after codon 95"
FT                   /db_xref="PSEUDO:CAQ77885.1"
FT                   /inference="similar to sequence:UniProt:P46846"
FT   repeat_region   240800..241804
FT                   /note="VSa6"
FT   repeat_region   240800..240818
FT                   /note="IR of VSa6"
FT   CDS_pept        240896..241777
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0201"
FT                   /old_locus_tag="TVS0010"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77886"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B6EH02"
FT                   /protein_id="CAQ77886.1"
FT                   /translation="MNKLVDIFCDVDDFCYQFLSQWEKYLVEASERKRKRQSVMSTSEC
FT                   MTIVIAFHQSNHRDFKNFYIGLVHQYWKGYFPNLLSYTRFVSKMPSLIAPMCAYFQSIK
FT                   GKPTGIAFVDSTSLKVCHNIRIPRHKVFDGVAKRGKGTMGWFFGFKLHLLINHLGEIIS
FT                   LKITAGNVNDRTPVPDLCKELSGKLYADKGYIGKKLSESLKNSDVDLVTTSRKNMKAKE
FT                   ISAFDKAMLSKRYIIETINDQLKNISQIEHSRHRSVTGFMLNVISGVVAYCLKKQKPRI
FT                   KLSECEFELILA"
FT   misc_feature    241223..241717
FT                   /locus_tag="VSAL_I0201"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   9.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   241786..241804
FT                   /note="IR of VSa6"
FT   CDS_pept        join(242708..243046,243048..244100)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0202"
FT                   /old_locus_tag="TVS0013"
FT                   /product="membrane permease (pseudogene)"
FT                   /note="Similar to Vibrio fischeri Xanthine permease
FT                   UniProt:Q5E8N5 (463 aa) fasta scores: E()=1.2e-133,93.043%
FT                   id in 460 aa. CDS contains a framshift after codon 115. The
FT                   sequence has been checked and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77887.1"
FT                   /inference="similar to sequence:UniProt:Q5E8N5"
FT   misc_feature    order(242777..243046,243048..243962)
FT                   /locus_tag="VSAL_I0202"
FT                   /note="HMMPfam hit to PF00860, Permease family, score
FT                   4.1e-130"
FT                   /inference="protein motif:HMMPfam:PF00860"
FT   misc_feature    242807..242875
FT                   /locus_tag="VSAL_I0202"
FT   misc_feature    order(243072..243131,243150..243218,243276..243329,
FT                   243348..243407,243450..243518,243729..243797,
FT                   243810..243878,243897..243950,243993..244052)
FT                   /locus_tag="VSAL_I0202"
FT   misc_feature    243801..243863
FT                   /locus_tag="VSAL_I0202"
FT                   /note="PS01116 Xanthine/uracil permeases family signature."
FT                   /inference="protein motif:ProSite:PS01116"
FT   CDS_pept        complement(244329..245636)
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="VSAL_I0203"
FT                   /old_locus_tag="TVS0015"
FT                   /product="sensor outer membrane protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77888"
FT                   /db_xref="GOA:B6EPQ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPQ4"
FT                   /protein_id="CAQ77888.1"
FT                   /translation="MKSTFARTLLLLASLLIASQIFSYLAVFNYALLPSLQQFNRILAY
FT                   EVRLMLAEDVTLKNGTNIQLGQPLRRQLLEQLGVSIHDEHDPEMREFYQASPVEFLSEE
FT                   MSRELESPTEVRLILGADSYVLWMKTEAMPEFYMRIPLSELQEEDFAPLFRNSLFIALL
FT                   VILGGWAFIRIQNRPLMALQTAARKVGKGEIPEPLPEKGASEIQAVTRAFNQMAKGIQQ
FT                   LEQDRALLMAGVSHDIRTPLTRIRLATEMMSPQDDYLAESMIKDTEECNEIIGQFMDYL
FT                   KPVAKQDFIDVDINTIVNEVILAEGGYEREIKTNLANIPQSVHGNAIAIKRVITNLVVN
FT                   AIRYGGDWIAVSTRVSADHKTAWIIIEDNGPGIDEAQLESVFEPFTRGDTARGSEGTGL
FT                   GLAIVKRIVGQHQGEVSLANRREGGLKVQVKLPLGR"
FT   misc_feature    complement(244335..244664)
FT                   /gene="envZ"
FT                   /locus_tag="VSAL_I0203"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 2.4e-35"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    complement(244779..244961)
FT                   /gene="envZ"
FT                   /locus_tag="VSAL_I0203"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    complement(244971..245180)
FT                   /gene="envZ"
FT                   /locus_tag="VSAL_I0203"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 2.2e-12"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    complement(order(245121..245180,245541..245609))
FT                   /gene="envZ"
FT                   /locus_tag="VSAL_I0203"
FT   sig_peptide     complement(245568..245636)
FT                   /gene="envZ"
FT                   /locus_tag="VSAL_I0203"
FT   CDS_pept        complement(245950..246669)
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="VSAL_I0204"
FT                   /old_locus_tag="TVS0016"
FT                   /product="response regulator homolog OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77889"
FT                   /db_xref="GOA:B6EPQ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPQ5"
FT                   /protein_id="CAQ77889.1"
FT                   /translation="MQENHKILVVDDDARLRSLLERYLSEQGFQVRSVANSEQMDRLLA
FT                   RETFHLMVLDLMLPGEDGLSICRRLRSNNNMLPILMLTAKGDEIDRIVGLEVGADDYLP
FT                   KPFNPRELLARIRAVLRRQVIEAPGAPSAEDKMVEFGEFRLNLGTREMFRNEEPMPLTS
FT                   GEFAVLKSLVTNMREPMSRDKLMNMARGREYSAMERSIDVQISRLRRMIEVDSSRPRYI
FT                   QTVWGLGYVFVPDGAEG"
FT   misc_feature    complement(245974..246204)
FT                   /gene="ompR"
FT                   /locus_tag="VSAL_I0204"
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C te, score 2.7e-14"
FT                   /inference="protein motif:HMMPfam:PF00486"
FT   misc_feature    complement(246319..246657)
FT                   /gene="ompR"
FT                   /locus_tag="VSAL_I0204"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 4.7e-40"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        246879..247619
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0205"
FT                   /old_locus_tag="TVS0018"
FT                   /product="putative partitioning protein ParA"
FT                   /note="Similar to Pseudomonas aeruginosa Partitioning
FT                   protein ParA UniProt:Q4W1V5 (212 aa) fasta scores:
FT                   E()=3.2e-05, 28.571% id in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77890"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPQ6"
FT                   /inference="similar to sequence:UniProt:Q4W1V5"
FT                   /protein_id="CAQ77890.1"
FT                   /translation="MLVGYKRAQCKKVLVINRKGGAGKSTFAIAMASFYAHQNVKTEII
FT                   DLDPQGTSYFWGNKSEGVRTTKFLPSSNVPFSLALRLEADTKITVIDSPSNFSQFEMEK
FT                   YISMVDKIVFPVQPSPIDVHSMLGFIKDLIKSPAFKNNRVELAFVITRCKENKQGTEFI
FT                   HKVLQHMKYPLLGSMSESQAYQNMFSEKNSFLISHPELDKELWQRMKLWLDVDMTPPQT
FT                   LAPETTKVAEPKPTTYRSLLKRRY"
FT   CDS_pept        complement(247781..248290)
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="VSAL_I0206"
FT                   /old_locus_tag="TVS0019"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77891"
FT                   /db_xref="GOA:B6EPQ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPQ7"
FT                   /protein_id="CAQ77891.1"
FT                   /translation="MKAYQREFIEFALEKEVLKFGEFTLKSGRISPYFFNAGLFNTGRD
FT                   LARLGRFYAAALVESGIDYDVLFGPAYKGIPIATTTAVALADHHDTDKPYCFNRKEAKN
FT                   HGEGGNLVGSALEGRIMLVDDVITAGTAIRESMEIIQANGADLAGVLWQSIAKKKAKAN
FT                   YLRFKK"
FT   misc_feature    complement(247782..248185)
FT                   /gene="pyrE"
FT                   /locus_tag="VSAL_I0206"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 4.5e-32"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    complement(247895..247933)
FT                   /gene="pyrE"
FT                   /locus_tag="VSAL_I0206"
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:ProSite:PS00103"
FT   CDS_pept        complement(248525..249241)
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="VSAL_I0207"
FT                   /old_locus_tag="TVS0020"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77892"
FT                   /db_xref="GOA:B6EPI9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPI9"
FT                   /protein_id="CAQ77892.1"
FT                   /translation="MRPSGRTAQQVRPITITRHFTAHAEGSVLVEFGNTKVICTASVEE
FT                   NVPRWLKGKGKGWVTAEYGMLPRATHTRNNREAASGKQGGRTMEIQRLIARSLRAAVDL
FT                   EALGEQMITVDCDVIQADGGTRTASITGASVALADAINHMIASGKLKKNPMKGHVAAVS
FT                   VGIYKGEAICDLEYLEDSAADTDMNVVMMEDGKMIEVQGTAEVAPFSHQELLDMLALAQ
FT                   QGINDIIEKQKAALAE"
FT   misc_feature    complement(248570..248773)
FT                   /gene="rph"
FT                   /locus_tag="VSAL_I0207"
FT                   /note="HMMPfam hit to PF03725, 3' exoribonuclease
FT                   family,domain, score 2.3e-18"
FT                   /inference="protein motif:HMMPfam:PF03725"
FT   misc_feature    complement(248813..249214)
FT                   /gene="rph"
FT                   /locus_tag="VSAL_I0207"
FT                   /note="HMMPfam hit to PF01138, 3' exoribonuclease
FT                   family,domain, score 1.8e-57"
FT                   /inference="protein motif:HMMPfam:PF01138"
FT   misc_feature    complement(248858..248896)
FT                   /gene="rph"
FT                   /locus_tag="VSAL_I0207"
FT                   /note="PS01277 Ribonuclease PH signature."
FT                   /inference="protein motif:ProSite:PS01277"
FT   CDS_pept        249413..250276
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0208"
FT                   /old_locus_tag="TVS0021"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77893"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPJ0"
FT                   /experiment="The expressed protein is found to be
FT                   associated with the outer membrane in Aliivibrio
FT                   salmonicida"
FT                   /protein_id="CAQ77893.1"
FT                   /translation="MIYSMTAYARREVKGDWGTAVWEIRSVNQRYLETYFRMPEQFRGL
FT                   EPVLRERFRKRLARGKVECHLRFESNNAASSELKINEDLARQVIKAAQWVKTESGEGGI
FT                   NPFQVLQWQGVMEAPEQDFDSINKELLAEFELAVNDFVEARASEGENMKALIVQRLDAI
FT                   TTEAAKVRARMPEILEWQRNRLLTKFEDAKIELDSGRVEQELILLAQKSDVAEELDRLD
FT                   SHVKETTNVMKKGGACGRKLDFMMQEFNREANTLASKSISTDVTASGVELKVLIEQMRE
FT                   QIQNIE"
FT   misc_feature    249416..249877
FT                   /locus_tag="VSAL_I0208"
FT                   /note="HMMPfam hit to PF03755, YicC-like family,N-terminal
FT                   region, score 8.1e-75"
FT                   /inference="protein motif:HMMPfam:PF03755"
FT   misc_feature    250010..250273
FT                   /locus_tag="VSAL_I0208"
FT                   /note="HMMPfam hit to PF08340, Domain of unknown function
FT                   (DUF1732), score 4.1e-58"
FT                   /inference="protein motif:HMMPfam:PF08340"
FT   CDS_pept        complement(250359..250787)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0209"
FT                   /old_locus_tag="TVS0022"
FT                   /product="phosphate-starvation-inducible E"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77894"
FT                   /db_xref="GOA:B6EPJ1"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPJ1"
FT                   /protein_id="CAQ77894.1"
FT                   /translation="MPSHLPKSFSKPFLKIFHILEAVLLVAITLATVFAMVNEFVHVFS
FT                   ERQIQLTDILLMFIYLEVLAMVQQFVMNGKIPVRYPIYIAMMAIARYITLGMKELDAVL
FT                   VVWLALAAFILAAATLLIRAGHYYWPYETHESSKKYDE"
FT   misc_feature    complement(250368..250787)
FT                   /locus_tag="VSAL_I0209"
FT                   /note="HMMPfam hit to
FT                   PF06146,Phosphate-starvation-inducible E, score 1.8e-58"
FT                   /inference="protein motif:HMMPfam:PF06146"
FT   misc_feature    complement(order(250416..250484,250503..250562,
FT                   250575..250643,250677..250745))
FT                   /locus_tag="VSAL_I0209"
FT   sig_peptide     complement(250677..250787)
FT                   /locus_tag="VSAL_I0209"
FT   CDS_pept        250943..251566
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="VSAL_I0210"
FT                   /old_locus_tag="TVS0023"
FT                   /product="5'guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77895"
FT                   /db_xref="GOA:B6EPJ2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPJ2"
FT                   /protein_id="CAQ77895.1"
FT                   /translation="MSKGTLYIVSAPSGAGKSSLISALIESNPTYAMKVSVSHTTRGMR
FT                   PGEQDGVHYHFMQKEHFEDLIEKEEFLEYAEVFGNYYGTSRVWIEETLDKGIDVFLDID
FT                   WQGARQIRIQMPLAKSLFILPPSNGELERRLNVRGQDSEAVIAKRMSEAKSEISHYNEY
FT                   DYVIINDDFDTAQMDFKAIIRAERLKQDKQTSKYKGMLSALLAD"
FT   misc_feature    250973..250996
FT                   /gene="gmk"
FT                   /locus_tag="VSAL_I0210"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    251060..251113
FT                   /gene="gmk"
FT                   /locus_tag="VSAL_I0210"
FT                   /note="PS00856 Guanylate kinase signature."
FT                   /inference="protein motif:ProSite:PS00856"
FT   misc_feature    251063..251377
FT                   /gene="gmk"
FT                   /locus_tag="VSAL_I0210"
FT                   /note="HMMPfam hit to PF00625, Guanylate kinase, score
FT                   3.4e-47"
FT                   /inference="protein motif:HMMPfam:PF00625"
FT   CDS_pept        251679..251951
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="VSAL_I0211"
FT                   /old_locus_tag="TVS0024"
FT                   /product="DNA-directed RNA polymerase, omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77896"
FT                   /db_xref="GOA:B6EPJ3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPJ3"
FT                   /protein_id="CAQ77896.1"
FT                   /translation="MARVTVQDTVEKIGNRFDLVLVSSRRARQLQTGGKDALVPEENDK
FT                   PTVIALREIEEGLITKDLLDARERQEQQEQDAAELAAVSSITHNR"
FT   misc_feature    251712..251873
FT                   /gene="rpoZ"
FT                   /locus_tag="VSAL_I0211"
FT                   /note="HMMPfam hit to PF01192, RNA polymerase Rpb6, score
FT                   2.2e-20"
FT                   /inference="protein motif:HMMPfam:PF01192"
FT   CDS_pept        252018..254147
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="VSAL_I0212"
FT                   /old_locus_tag="TVS0025"
FT                   /product="guanosine-3',5'-bisbis(diphosphate)
FT                   3'-pyrophosphydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77897"
FT                   /db_xref="GOA:B6EPJ4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPJ4"
FT                   /protein_id="CAQ77897.1"
FT                   /translation="MDLFDSLKDVAKDYLPEPHIEALRRSYLVAKEAHEGQTRSTGEPY
FT                   IIHPVAVARILAEMRLDHKTLMAALLHDVIEDTQVSKEELAEQFGDTVAELVDGVSKLD
FT                   KLKFRDKKEAQAENFRKMVMAMVQDIRVILIKLADRTHNMRTLGALRPDKRRRIARETL
FT                   EIFSPLAHRLGIHNIKTELEELGFEALYPNRYRVLKEVVKSARGNRKEMIQKIHAEIEG
FT                   RIAEAGIKGRVVGREKNLFAIYHKMKNKEQRFHTIMDIYAFRVITDDVDTCYRALGQVH
FT                   SIYKPRPGRIKDYIAVPKANGYQSLHTSMVGPHGVPVEVQIRTEDMEQMANKGVAAHWS
FT                   YKEGDNSSSTTAQIRAQRWMQSLLELQQSAGSSFEFIENVKSDLFPNEIYVFTPKGRIF
FT                   ELPVGATAVDFAYAVHSDVGNSCVGSRVNRQPYPLSKPLKSGQTVEIISAPGARPNAAW
FT                   LNYVVTSKARTKIRQVLKTMRKEDSVILGRRLLNHALGHNLSLDDVSEENMTHVLSDLK
FT                   LATQDDLLAAIGLGELMSIVVARRLLGDADELTQQNPSNIETSTGKKLPIRGADGILLT
FT                   FANCCRPIPGDHIIAHVSPGRGLVVHMEDCANVRGYQKELDKYMGVEWADEFDQEFATA
FT                   LDIDLQNHQGALANLTNVVASTGSNIRGISTEEKDGRLYTVTIELTAKDRTHLAEIMRR
FT                   IRVMPHALKVRRHKN"
FT   misc_feature    252150..252449
FT                   /gene="spoT"
FT                   /locus_tag="VSAL_I0212"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 5.5e-16"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   misc_feature    252720..253052
FT                   /gene="spoT"
FT                   /locus_tag="VSAL_I0212"
FT                   /note="HMMPfam hit to PF04607, Region found in RelA / SpoT
FT                   proteins, score 1.3e-43"
FT                   /inference="protein motif:HMMPfam:PF04607"
FT   misc_feature    253182..253361
FT                   /gene="spoT"
FT                   /locus_tag="VSAL_I0212"
FT                   /note="HMMPfam hit to PF02824, TGS domain, score 2.3e-26"
FT                   /inference="protein motif:HMMPfam:PF02824"
FT   misc_feature    253917..254138
FT                   /gene="spoT"
FT                   /locus_tag="VSAL_I0212"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 0.00013"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        254408..254977
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="VSAL_I0213"
FT                   /old_locus_tag="TVS0025a"
FT                   /product="tRNA (guanosine-2'-o-)-methyltransferase
FT                   (fragment)"
FT                   /EC_number="2.1.1.34"
FT                   /note="Similar to Escherichia coli tRNA
FT                   guanosine-2'-O-methyltransferase TrmH UniProt:P0AGJ2 (229
FT                   aa) fasta scores: E()=1.1e-45, 68.783% id in 189 aa. CDS is
FT                   truncated by the insertion of the downstream IS element and
FT                   subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:P0AGJ2"
FT   misc_feature    254462..254884
FT                   /gene="trmH"
FT                   /locus_tag="VSAL_I0213"
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase
FT                   family,score 2.6e-53"
FT                   /inference="protein motif:HMMPfam:PF00588"
FT   repeat_region   complement(254976..257290)
FT                   /note="VSa2"
FT   repeat_region   complement(254976..254999)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(254992..256479)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0214"
FT                   /old_locus_tag="TVS0026"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77899"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EHG8"
FT                   /protein_id="CAQ77899.1"
FT                   /translation="MTDKIKPLPDTIDELKALVLQLENKYNRLLEQFRLAQHQRFGKSS
FT                   ESDSTQFDLFNETEEEIIIENDDTQTITYTRQKPKRQRLPEDLPRTVIIHDIKDKTCKC
FT                   CGLEMHAMGKDISEKLEFVPAKVEVIQHVRPKYACRNCEKNNTSVDIKQAPMPASPIPK
FT                   GIATASLLAQIITAKFQYSLPLYRQETLFQQWGIIIGRRTMADWLIKCSVLFTPLNNEL
FT                   HRILLEQPTLHCDETTVNVLDVEKAKCYMWVYCSGYDSPGSGVLPGIVLYDYQSSRHGY
FT                   HPVNFLKGYNGYLHTDGYQGYEQTEAMLVGCWAHARRRFIEAQRVQVKGKTGSADWVLS
FT                   KIQKLYRIESLLKEASPEAKYVARQTEARDLLKELRDWLDSAVSRVSPKTKLGEAISYT
FT                   LNQWDKLVRYIDDGLLSIDNNRAERAVKPFVIGRKNWLFSGSTAGADSSAMLYSIVETA
FT                   KANGLIPYDYIRYCLDRLCVGSPDIDSLLPWNVKDKV"
FT   CDS_pept        complement(256551..256898)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0215"
FT                   /old_locus_tag="TVSb0116"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77900"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77900.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        complement(256895..257209)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0216"
FT                   /old_locus_tag="TVS0028"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77901"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77901.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   repeat_region   complement(257267..257290)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(257294..258475)
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="VSAL_I0217"
FT                   /old_locus_tag="TVS0029"
FT                   /product="protein HemY"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77902"
FT                   /db_xref="GOA:B6EPJ8"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPJ8"
FT                   /protein_id="CAQ77902.1"
FT                   /translation="MIRLLLLAIVLVGGLIVGTTFADQQGYVLISVAEITIEMSLTTLV
FT                   LFIGALIAGLFLLEIVVKRILSVSNFTRGWFSARHLRKARYNTFKGMIKLHEGEWKEAE
FT                   RLITKGGRHNDFPLLNYLAAAEAAQGRQHIEQRDAYLKLASEQPGSHLAVALTSAKLQM
FT                   REEQYEFALATLQSVNVDYPHNPVLLDLLKDCYLALNEWQALKNIIHPLTKGNLITEQQ
FT                   ALELEEKVECGILALIATNKGTTGLLDHWQSLPKKLKKHIPILVCLIRQLHNRKADSEA
FT                   YILLRDNLKKRNDDRLIELLPTLNLPDYHPATVLLEDLARYDIRNPIIQSTLAQLYMRT
FT                   QKWQPAREHFEAALAIREDMSDYAYLARVLDKQNRKQAAADISRKALTMVDDI"
FT   misc_feature    complement(257396..257497)
FT                   /gene="hemY"
FT                   /locus_tag="VSAL_I0217"
FT                   /note="HMMPfam hit to PF07719, Tetratricopeptide
FT                   repeat,score 0.00091"
FT                   /inference="protein motif:HMMPfam:PF07719"
FT   misc_feature    complement(258077..258475)
FT                   /gene="hemY"
FT                   /locus_tag="VSAL_I0217"
FT                   /note="HMMPfam hit to PF07219, HemY protein
FT                   N-terminus,score 1.6e-41"
FT                   /inference="protein motif:HMMPfam:PF07219"
FT   misc_feature    complement(order(258302..258370,258413..258472))
FT                   /gene="hemY"
FT                   /locus_tag="VSAL_I0217"
FT   sig_peptide     complement(258410..258475)
FT                   /gene="hemY"
FT                   /locus_tag="VSAL_I0217"
FT   CDS_pept        complement(258472..259686)
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="VSAL_I0218"
FT                   /old_locus_tag="TVS0030"
FT                   /product="putative uroporphyrin-III C-methyltransferase
FT                   HemX"
FT                   /note="Similar to Escherichia coli Putative
FT                   uroporphyrin-III C-methyltransferase HemX UniProt:P09127
FT                   (393 aa) fasta scores: E()=1.5e-36, 32.718% id in 379 aa.
FT                   Possible alternative translational start site after codon
FT                   25"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77903"
FT                   /db_xref="GOA:B6EPJ9"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPJ9"
FT                   /inference="similar to sequence:UniProt:P09127"
FT                   /protein_id="CAQ77903.1"
FT                   /translation="MTKDNNKPQSAEEKSSNSATAPSSQIPKKETEKHVQPTTSKAPSN
FT                   KEEPIVDKKSRRLGTVAIIISILLSGGAFLASQQQVTQQQLKIAQLQQQLKNADSTFNE
FT                   KLVTAEQRITDKADDIVRKATVLIQQQDKSIASLQLAIADVKGRRPNDWLLAEADYLVK
FT                   MAGRKLWLEHDVVSATRLMENADQRISALNDPSLMPLRRAMASDISTLKAIPLIDRDGL
FT                   VLKLNSLEQQINTLPLASAILPEAGVVEQKEVSTNINDWQSNLMQSLDDFAGHFITYRV
FT                   REGNVIPLLSPEQHFYLKENIKGKLLLASKALYREQSEVYVTSLESAKLWSSQYFQQDD
FT                   PAVKSFMAQLDSLTKFKVDVRYPQKMKTQALLSDFISERLRRNIQAVGTTTPETKTATI
FT                   EGGKS"
FT   misc_feature    complement(258475..258498)
FT                   /gene="hemX"
FT                   /locus_tag="VSAL_I0218"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(258508..259626)
FT                   /gene="hemX"
FT                   /locus_tag="VSAL_I0218"
FT                   /note="HMMPfam hit to PF04375, HemX, score 7.3e-104"
FT                   /inference="protein motif:HMMPfam:PF04375"
FT   misc_feature    complement(259456..259515)
FT                   /gene="hemX"
FT                   /locus_tag="VSAL_I0218"
FT   CDS_pept        complement(259699..260445)
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="VSAL_I0219"
FT                   /old_locus_tag="TVS0031"
FT                   /product="uroporphyrinogen III synthase HemD"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77904"
FT                   /db_xref="GOA:B6EPK0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK0"
FT                   /protein_id="CAQ77904.1"
FT                   /translation="MTILVTRPEQESQALCDALHQAGHLAISHPLLTIHPGRELSQLPS
FT                   LFSSLSDGDFIIAVSQHAVEHAQNSLQMQQTEWKKGVNYIAVGQKSAQHLKKYVVDTVH
FT                   FPTHSDSEHLLALPVLKNTKGKKALILRGNGGRDLIFQALDNSGVEVSYCETYQRKNTP
FT                   FNGALKAAEWQKEHVDTIIVTSGEQLSFFTEQFTLIHLHWVLHCRLLVPSERINQLAQQ
FT                   LGYQHIETVGGASNSDVLHYLSEHHA"
FT   misc_feature    complement(259723..260418)
FT                   /gene="hemD"
FT                   /locus_tag="VSAL_I0219"
FT                   /note="HMMPfam hit to PF02602, Uroporphyrinogen-III
FT                   synthase HemD, score 5.5e-21"
FT                   /inference="protein motif:HMMPfam:PF02602"
FT   CDS_pept        complement(260447..261382)
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="VSAL_I0220"
FT                   /old_locus_tag="TVS0032"
FT                   /product="porphobilinogen deaminase HemC"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77905"
FT                   /db_xref="GOA:B6EPK1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPK1"
FT                   /protein_id="CAQ77905.1"
FT                   /translation="MSQQLPVRIATRKSPLALWQAHFVKDALQAAHPGLEVELVTMVTK
FT                   GDIILDTPLAKIGGKGLFVKELEVAMLEGRADLAVHSMKDVPVEFPEGLGLVTICERGD
FT                   PRDAFVSNTYNNIDELPQGATVGTCSLRRQCQLKEYRPDLIIKELRGNVGTRLQKLDDG
FT                   NYDAIILACAGLIRLGLEDRIKSSIEPEQSLPAVGQGAVGIETRLNDDRIRALLAPLNH
FT                   PETAHRVLCERAMNNRLEGGCQVPIGSYSLIDGDQIWLRALVGEPDGSIMVRGETTGPV
FT                   SDAEELGTKLAEQLLNDGAKDILDRLYADA"
FT   misc_feature    complement(260486..260707)
FT                   /gene="hemC"
FT                   /locus_tag="VSAL_I0220"
FT                   /note="HMMPfam hit to PF03900, Porphobilinogen
FT                   deaminase,C-terminal, score 6.6e-30"
FT                   /inference="protein motif:HMMPfam:PF03900"
FT   misc_feature    complement(260639..260689)
FT                   /gene="hemC"
FT                   /locus_tag="VSAL_I0220"
FT                   /note="PS00533 Porphobilinogen deaminase cofactor-binding
FT                   site."
FT                   /inference="protein motif:ProSite:PS00533"
FT   misc_feature    complement(260729..261367)
FT                   /gene="hemC"
FT                   /locus_tag="VSAL_I0220"
FT                   /note="HMMPfam hit to PF01379, Porphobilinogen
FT                   deaminase,dipyrometh, score 8.5e-140"
FT                   /inference="protein motif:HMMPfam:PF01379"
FT   CDS_pept        261640..264150
FT                   /transl_table=11
FT                   /gene="cya"
FT                   /locus_tag="VSAL_I0221"
FT                   /old_locus_tag="TVS0033"
FT                   /product="adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77906"
FT                   /db_xref="GOA:B6EPK2"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK2"
FT                   /protein_id="CAQ77906.1"
FT                   /translation="MHTYIETLIARQKRLTEQRVERALALMKPLAQEIFHQLPLLLHFN
FT                   HSELPGFIEGAPSGIKKFHANQKQREWMAELTLRYPLSTSNQENILGLYSMGSTSSIGQ
FT                   TVASDLDIWVCIPEHLTPEKKALLQQKCDAITEWALQFYIEANFFLMEQNRFRDAYSEE
FT                   MTGDNCGSSQHLLLLDEFYRTAVCLGGQQLLWQIIPPEMEESYDEYVAQLCESGVIKRD
FT                   EWVDFGRLNHIPAEEYFGSSLWQLYKSIDSPFKSVLKAILLEAYSWEYPHTQLLSIDSK
FT                   RRFFADEPDLYGMDAYYLMLEKVTRYLERTNDLSRLELVRRSFYLKTHEKLSRRQVQDS
FT                   VEWRRKALTELTTQWGWSQSTIVELDSRRTWKVEQVKKAHNDLLEALMQSYRNLIRFAR
FT                   NNDITSSISPEDISILARKLYAAFEELPGKVTLLNPQISPDLHESDLSFIEVPENGVNK
FT                   PGWYVYKQPLIAKELMGAKHLEHNKYLSKLVAWAFFNGLLTESTRLDAVVRNADLNIDK
FT                   FYQMVSDLRNTFSVHSPRPTKEELASPCEVRQLSIFINLESDPTEELTIKAERATQSDA
FT                   DIFSCGKEQHNLVGSVDLVYRNSWHEVRTLNFSGETAILDALKTVLCKMHQDAERPESV
FT                   DVFCYSKQMRGIIRNNIYQLLAECLELRLKPVENSEKRRRFKGIKIGSTMYGLFFERRG
FT                   VSIQKLEDSVQFYSSISTNKAIGSTSVPLDRRGILIPDVVDSFASEGLIQFFFDDIEKG
FT                   FNIYVLDEENNVEIYHDCYGSKDDMVNSINHYYTSSRNNVDLESPDKVNFNLPQFYDLA
FT                   YCENREASIVPYRSGQQQSKVKQA"
FT   misc_feature    261640..264132
FT                   /gene="cya"
FT                   /locus_tag="VSAL_I0221"
FT                   /note="HMMPfam hit to PF01295, Adenylate cyclase,
FT                   class-I,score 0"
FT                   /inference="protein motif:HMMPfam:PF01295"
FT   misc_feature    262348..262383
FT                   /gene="cya"
FT                   /locus_tag="VSAL_I0221"
FT                   /note="PS01092 Adenylate cyclases class-I signature 1."
FT                   /inference="protein motif:ProSite:PS01092"
FT   CDS_pept        264252..266456
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="VSAL_I0222"
FT                   /old_locus_tag="TVS0034"
FT                   /product="DNA helicase II UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77907"
FT                   /db_xref="GOA:B6EPK3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK3"
FT                   /protein_id="CAQ77907.1"
FT                   /translation="MDVSFLLDGLNDKQREAVAAPLENMLVLAGAGSGKTRVLVHRIAW
FT                   LMQIEQASPFSIMSVTFTNKAAAEMRGRIEELMHGSAGGMWNGTFHGICHRILRAHYLD
FT                   AKLPEGFQIIDSDDQQRLLKRLIKAQNLDDKNWPARQAAWFINGKKDEGLRPHQINSFN
FT                   DPIAETWLKVYRAYQEACDRSGLVDFAEILLRAHELLRDHQYICEHYQARFKHILVDEF
FT                   QDTNNIQYAWLRMMAGSDCKVMIVGDDDQSIYGWRGAQIENIQRFLNEFVGAKTILLEQ
FT                   NYRSTANILNAANELISNNTERMGKELWTEDADGELISIYSAYNEMDEARFAVGKIKEW
FT                   RDNGGALEDTAFLYRNNAQSRVLEEALIQAGLPYRIYGGMRFFERQEIKDALSYLRLMN
FT                   NRNDDAAFERVVNTPTRGLGDKTLETVRLAARERGATMWQASIALIEEQVLPGRAAGAL
FT                   GRFVELINALEDDTRDCRLHEQTDQVIKSSGLFTMYEQEKGEKSKARIENLEELVTATR
FT                   QFDKPEEAEEMTDLTAFLTHAALEAGDGQADEFEDAVQLMTLHSAKGLEFPLVFMVGVE
FT                   EGMFPSQMSAEEAGRLEEERRLCYVGMTRAMEKLYILYAETRRVYGQEKFHKPSRFIKE
FT                   ISAKFVEEVRMKAKVSRTSLYGSYGSQSESSQERFGQTAMSNSFNETGYNLGQRVKHPK
FT                   FGEGTIINFEGAGPQGRVQVAFNGEGIKWLVTQYAKLESV"
FT   misc_feature    264279..265721
FT                   /gene="uvrD"
FT                   /locus_tag="VSAL_I0222"
FT                   /note="HMMPfam hit to PF00580, UvrD/REP helicase, score
FT                   1.8e-207"
FT                   /inference="protein motif:HMMPfam:PF00580"
FT   misc_feature    264336..264359
FT                   /gene="uvrD"
FT                   /locus_tag="VSAL_I0222"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(267419..268336)
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="VSAL_I0223"
FT                   /old_locus_tag="TVS0035"
FT                   /product="chloramphenicol-sensitive protein RarD"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77908"
FT                   /db_xref="GOA:B6EPK4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK4"
FT                   /protein_id="CAQ77908.1"
FT                   /translation="MPTTELEQQRTRQGILLAIAAYTMWGIAPIYFKTINSVSPLEILS
FT                   HRAIWSFFFLAGLLCVSKGWKTVLNTLKDKRKMTYLVTTGLLVGTNWLIFIWAVNNNHM
FT                   LDASLGYYINPLLNVVLGMIFLGERLRKLQWVAVACAAIGVIVQLITFGSIPIVALALA
FT                   CSFGFYGLLRKKVAMDAQSGLFIETLVMLPMAAIYLLFIADSATSSFTNNAMSLNLLLI
FT                   AAGIITTIPLLCFTGAATRLKLSTLGFFQYIGPSLMFLLAVGLYGEEFSTDKAITFAFI
FT                   WSALILFTGDALLYKKRNQKINTK"
FT   misc_feature    complement(order(267452..267511,267539..267607,
FT                   267620..267688,267731..267787,267821..267874,
FT                   267887..267940,267959..268012,268040..268105,
FT                   268142..268198,268241..268300))
FT                   /gene="rarD"
FT                   /locus_tag="VSAL_I0223"
FT   misc_feature    complement(267845..267877)
FT                   /gene="rarD"
FT                   /locus_tag="VSAL_I0223"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    complement(267887..268270)
FT                   /gene="rarD"
FT                   /locus_tag="VSAL_I0223"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 9.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   CDS_pept        268514..270349
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="VSAL_I0224"
FT                   /old_locus_tag="TVS0036"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77909"
FT                   /db_xref="GOA:B6EPK5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK5"
FT                   /protein_id="CAQ77909.1"
FT                   /translation="MSSITVEQPMEQVSQSQTVLRDVFGYQEFRVGQEEVINAVLEGKD
FT                   SLVIMPTGGGKSLCYQIPALVFEGLTLVISPLISLMKDQVDQLKADGVQAECLNSTIDR
FT                   DAQVSIWNRVNSGQIKMLYVSPERVMMRDFMDRLASLNLCMIAVDEAHCISQWGHDFRP
FT                   EYASLGQIKQRFPNVPIMALTATADEATRKDILSRLSLPNPHEYLGSFDRPNIRYTVLE
FT                   KHKPVSQIVRYLATQKNQCGVIYCGSRKKVEMLTEKLCNNHIRAASYHAGLDLDERNYV
FT                   QEAFQRDDIQIVVATVAFGMGINKSNVRFVAHFDIPKNIESYYQETGRAGRDGLPAEAV
FT                   MLYDPADIVWLRKLVEEKPEGPQKLVESHKLNAMTAFAEAQTCRRQVLLNYFGEYNPKP
FT                   CGNCDVCLDPPKQFDGTEAAQKALSCVYRVNQSFGVGYVVEVLRGLKIARIREHGHDKL
FT                   STYGIGKDNSHEYWVSIIRQLIHKGLLTQNITRNSTLQLTEEARPILKGQEPLELAVPR
FT                   LDTAAKTAKSEKLNNRQYDKQLFAKLRKLRKSIADRDDLPPYVVFSDATLMDMADITPT
FT                   SYGEMLAVNGVGQKKLEKYADPFLDLIEMHITGQG"
FT   misc_feature    268601..269098
FT                   /gene="recQ"
FT                   /locus_tag="VSAL_I0224"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   9.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    269285..269515
FT                   /gene="recQ"
FT                   /locus_tag="VSAL_I0224"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 6.5e-28"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    270110..270346
FT                   /gene="recQ"
FT                   /locus_tag="VSAL_I0224"
FT                   /note="HMMPfam hit to PF00570, HRDC domain, score 5e-25"
FT                   /inference="protein motif:HMMPfam:PF00570"
FT   CDS_pept        270353..270643
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0225"
FT                   /old_locus_tag="TVS0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77910"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK6"
FT                   /protein_id="CAQ77910.1"
FT                   /translation="MSLFSVIEFDNNEGRIIFGIPPFDFDSFDVIGQQLVFAMDASIVE
FT                   KQMDADLHSWLIDFEGCQFMLRAEHYSNSVWLEALARKEHQDELSFIAGLF"
FT   CDS_pept        270782..271447
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0226"
FT                   /old_locus_tag="TVS0038"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77911"
FT                   /db_xref="GOA:B6EPK7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK7"
FT                   /protein_id="CAQ77911.1"
FT                   /translation="MSTFTPAQQRNALSFLVLFHLVIIASSNYLVQIPFTLFWFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAKMARSIIFFVMLPALAVSYVLSVVFFEGQYQGLLHLSEF
FT                   NLFVARIAVASFMAYLLGQILDVYVFNRLRQLKQWWIAPTCSTLFGNALDTLAFFAIAF
FT                   YQSPDAFMAEHWTEIALVDYSIKLVISLGLFVPMYGVLLNYLIRKLTSEGHQLATQAS"
FT   misc_feature    order(270818..270886,270914..270973,270992..271060,
FT                   271103..271171,271205..271273,271331..271399)
FT                   /locus_tag="VSAL_I0226"
FT   misc_feature    270890..271342
FT                   /locus_tag="VSAL_I0226"
FT                   /note="HMMPfam hit to PF02592, Uncharacterized ACR, YhhQ
FT                   family COG1738, score 4.8e-71"
FT                   /inference="protein motif:HMMPfam:PF02592"
FT   misc_RNA        271600..271779
FT                   /gene="ryhB"
FT                   /locus_tag="VSAL_I3102s"
FT                   /old_locus_tag="VSsrna22"
FT                   /product="small RNA RyhB"
FT                   /note="small RNA RyhB"
FT                   /experiment="Northern blot and 5`RACE"
FT   CDS_pept        272158..274962
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="VSAL_I0227"
FT                   /old_locus_tag="TVS0039"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77912"
FT                   /db_xref="GOA:B6EPK8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK8"
FT                   /protein_id="CAQ77912.1"
FT                   /translation="MARIPDNPFILVDGSSYLFRAYHAAPNFTNGNGEPTGAVYGVINM
FT                   LRSLLKQFETNRIAVIFDAKGKTFRNDMYPEYKANRPPMPDELRCQIEPLHKLIKAMGL
FT                   PLISISGVEADDVIGTLASQASKAGIPVLISTGDKDMAQLVDENVTLINTMTNVIMGPE
FT                   GVVEKFGVPPELIIDYLALMGDASDNIPGVPGIGDKTARALLQGVGGLDTLYANLDDIA
FT                   PLGFRGSKGMAKKLEENKEGAYLSYKLATIKLDVELEQQPEELVKQEPNVDELIQMFGQ
FT                   MNFKRWLTEMLDGSDGKIVSHETSAHRTTSSSSDEGDSAEEETIVAAQVDRSKYETIFT
FT                   KEAFSAWLEKVNNAEVTAFDTETDSLDYMVANLIGLSFSVEEGEAAYVPVAHDYLDAPE
FT                   QLDRDWVLAQLKPYLEDETKAKVGQNLKYDASVLARYDIEMKGIKFDTMLESYVYNSVA
FT                   GKHNMDSLALRYLQHNTISFEEIAGKGKKQLTFNQIALEEAAPYAAEDADITLRLHNVL
FT                   HAKLVTDEKLNAVFTDIELPLISVLSRMERKGVYIDDMLLSAQSLEIGQRLDELETASF
FT                   EVAGQEFNMNSPKQLQTILFEKMELPVIKKTPSGAASTNEEVLQELALEYELPKLILEY
FT                   RGLAKLKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNIPIRNKEGRRI
FT                   RQAFVAPHGWKILAVDYSQIELRIMAHLSQDRALLEAFSAGKDIHAATAAEVKGVSIEE
FT                   VTSEDRRRAKAINFGLIYGMSAFGLAKQIGISRGEAQDYMNVYFERYPGVMQYMEETRL
FT                   LATEQGYVETLYGRRLYLPEINARNAIRRKAAERAAINAPMQGTAADIIKKAMILVDNW
FT                   IEAEGTGRVNLLMQVHDELVFEVKEDELEAITKQVTALMEAAVSLDVPLIAESGFGDNW
FT                   DEAH"
FT   misc_feature    272176..272664
FT                   /gene="polA"
FT                   /locus_tag="VSAL_I0227"
FT                   /note="HMMPfam hit to PF02739, 5'-3' exonuclease,N-terminal
FT                   resolvase-, score 1.5e-87"
FT                   /inference="protein motif:HMMPfam:PF02739"
FT   misc_feature    272668..272988
FT                   /gene="polA"
FT                   /locus_tag="VSAL_I0227"
FT                   /note="HMMPfam hit to PF01367, 5'-3' exonuclease,C-terminal
FT                   SAM fold, score 4.2e-48"
FT                   /inference="protein motif:HMMPfam:PF01367"
FT   misc_feature    273160..273723
FT                   /gene="polA"
FT                   /locus_tag="VSAL_I0227"
FT                   /note="HMMPfam hit to PF01612, 3'-5' exonuclease, score
FT                   7.1e-55"
FT                   /inference="protein motif:HMMPfam:PF01612"
FT   misc_feature    273811..274956
FT                   /gene="polA"
FT                   /locus_tag="VSAL_I0227"
FT                   /note="HMMPfam hit to PF00476, DNA polymerase family
FT                   A,score 3.2e-201"
FT                   /inference="protein motif:HMMPfam:PF00476"
FT   misc_feature    274432..274491
FT                   /gene="polA"
FT                   /locus_tag="VSAL_I0227"
FT                   /note="PS00447 DNA polymerase family A signature."
FT                   /inference="protein motif:ProSite:PS00447"
FT   misc_RNA        275173..275291
FT                   /gene="spot 42"
FT                   /locus_tag="VSAL_I3103s"
FT                   /old_locus_tag="VSsrna23"
FT                   /product="small RNA Spot 42"
FT                   /note="small RNA Spot 42 (RF00021) predicted by Rfam,score
FT                   81.85"
FT                   /experiment="Northern blot and 5`RACE"
FT   misc_RNA        275570..275630
FT                   /gene="sRNA2"
FT                   /locus_tag="VSAL_I3104s"
FT                   /old_locus_tag="VSsrna24"
FT                   /product="small RNA sRNA2"
FT                   /note="small RNA sRNA2"
FT                   /experiment="Northern blot and 5`RACE"
FT   CDS_pept        complement(275687..276361)
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="VSAL_I0228"
FT                   /old_locus_tag="TVS0040"
FT                   /product="probable gtp-binding protein EngB"
FT                   /function="necessary for normal cell division and for the
FT                   maintenance of normal septation"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77913"
FT                   /db_xref="GOA:B6EPK9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPK9"
FT                   /protein_id="CAQ77913.1"
FT                   /translation="MVSLETELTVSKIIHYQKTHFITSAPDIRHLPEDEGIEVAFAGRS
FT                   NAGKSSALNRLTNQRSLAKTSKTPGRTQLINLFKVDENCHIVDLPGYGFAQVPIELKKK
FT                   WQKSLGEYLQKRECLKGLVVLMDIRHPMKDLDQQLIYWAVDQAIPVQVLLTKADKLKSG
FT                   ARQTQVLKIREASLEFGGEVAVDAFSSLKGIGVDLLRAKLDTWFAPAFEFDEEFIENID
FT                   AE"
FT   misc_feature    complement(275888..276253)
FT                   /gene="engB"
FT                   /locus_tag="VSAL_I0228"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown
FT                   function,score 3.2e-29"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    complement(276212..276235)
FT                   /gene="engB"
FT                   /locus_tag="VSAL_I0228"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        276622..277239
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0229"
FT                   /old_locus_tag="TVS0041"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77914"
FT                   /db_xref="GOA:B6EPL0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL0"
FT                   /protein_id="CAQ77914.1"
FT                   /translation="MKKLALILTLLASCSTWAQGDIEAGKQKSVTCTACHGQEGNSTLT
FT                   QYPNLAGQHAGYLEKQINEFKLGMQTQGKQGRMDPVMGAMAMAVSEEDAKDIAAYYASL
FT                   PMADNTTPEDSIPAGKALYLAGDMERGITACVACHGPRGNGTSLSGFPKISGQHSDYVK
FT                   AQLEKFRSADRANDMNGMMRDIAKKLTDDDIATLSQYVGGLH"
FT   sig_peptide     276622..276675
FT                   /locus_tag="VSAL_I0229"
FT   misc_feature    276631..276663
FT                   /locus_tag="VSAL_I0229"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    276685..276936
FT                   /locus_tag="VSAL_I0229"
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 1e-12"
FT                   /inference="protein motif:HMMPfam:PF00034"
FT   CDS_pept        277381..278025
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0230"
FT                   /old_locus_tag="TVS0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77915"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL1"
FT                   /protein_id="CAQ77915.1"
FT                   /translation="MMQFCPLCQHSQADNFHQDKHRRYYRCQQCYLIYVDEADRFDAEA
FT                   EKAHYDCHENNLDDEGYKTFLSRFSEPLLQRVGKTPQQGLDFGCGPGPLLAHMMREAGH
FT                   HIELYDIYYTPDKSVLTKQYDFVSCTEAIEHFYQPQNELELLLSLIKPGGWLGIMTKLA
FT                   RDESAFATWHYKSDLTHVSFFSKDTFEFVAKRYQLDMEFVGEDVILLRKTQ"
FT   CDS_pept        278025..278573
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0231"
FT                   /old_locus_tag="TVS0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77916"
FT                   /db_xref="GOA:B6EPL2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL2"
FT                   /protein_id="CAQ77916.1"
FT                   /translation="MSRTKKARTPGMASEPVVVTRNRTDRDVDSREIKRKKKRKGLKPG
FT                   ARNVESDSEKARRFSQNKDPRIGSKKPIQLVVEEKKKSSKQERRLTNEQELAQLENDAQ
FT                   LMVLLDRIDNGENLGMGLQKYVDEKLARIEHLMGRLGLLEDEETEEEIAEFPEFAAPKT
FT                   KSDDDLLAEFDNFNMDDFK"
FT   misc_feature    278046..278570
FT                   /locus_tag="VSAL_I0231"
FT                   /note="HMMPfam hit to PF04220, Protein of unknown function,
FT                   DUF414, score 1.7e-47"
FT                   /inference="protein motif:HMMPfam:PF04220"
FT   CDS_pept        278576..279067
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0232"
FT                   /old_locus_tag="TVS0044"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77917"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL3"
FT                   /protein_id="CAQ77917.1"
FT                   /translation="MTTVTLLALLGGAIILALAGYASSLLMKLKKQKELQERHRKLAIQ
FT                   KRNANIFDNVVLLCQASLQEQCDYSEMSIRLYCIMDYLQDDDRIDVEKEYPALSELYHV
FT                   VKDMPRGDKRQALAKQDRMKDNLIRTKAEARLQDAVKIEIQQLHDRIKPLNQKIDIKMI
FT                   "
FT   sig_peptide     278576..278641
FT                   /locus_tag="VSAL_I0232"
FT   misc_feature    278585..278653
FT                   /locus_tag="VSAL_I0232"
FT   CDS_pept        279179..280552
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="VSAL_I0233"
FT                   /old_locus_tag="TVS0046"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77918"
FT                   /db_xref="GOA:B6EPL4"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL4"
FT                   /protein_id="CAQ77918.1"
FT                   /translation="MSNQQIVWDQAIIEKYNYSGPRYTSYPTALEFHEAYTPAEFDMAC
FT                   TQYPERPLSLYIHIPFCHKLCYFCGCNKVITRHHHKADIYLDSLELEIRQRAALFTDRK
FT                   VTQLHFGGGTPTFLTKIQFTRLMNLLRGEFHFEAGAEISIEVDPREIELDMLDHLRDEG
FT                   FNRLSIGVQDFNKEVQLLVNRDQDEDFIISMVQRAKELGFRSTNLDLIYGLPKQSAESL
FT                   AITIKRVLEMEPGRLSVFNYAHMPTLFAAQRKIKDADLPAPAEKLVMLQDTIETLTGAG
FT                   YQFIGMDHFALPDDELAVAQRDGILHRNFQGYTTQGECDLLGMGVSAISMIGDSYAQNK
FT                   KDLKEYYAQVDDKRHALWRGVALDQDDLIRREVIKQLICNFTLDTKAIEVEFNLDFATY
FT                   FAEDFKLLQTFVDDELVSLHEGRIDVELRGRLLIRNICMCFDKYLRDRARQQQFSRVI"
FT   misc_feature    279344..279865
FT                   /gene="hemN"
FT                   /locus_tag="VSAL_I0233"
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 1.5e-25"
FT                   /inference="protein motif:HMMPfam:PF04055"
FT   misc_feature    280109..280471
FT                   /gene="hemN"
FT                   /locus_tag="VSAL_I0233"
FT                   /note="HMMPfam hit to PF06969, HemN C-terminal region,score
FT                   9.2e-49"
FT                   /inference="protein motif:HMMPfam:PF06969"
FT   repeat_region   280688..283002
FT                   /note="VSa2"
FT   repeat_region   280688..280711
FT                   /note="IR of VSa2"
FT   CDS_pept        280769..281083
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0234"
FT                   /old_locus_tag="TVS0047"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77919"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77919.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   CDS_pept        281080..281427
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0235"
FT                   /old_locus_tag="TVSb0117"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77920"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77920.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        281499..282986
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0236"
FT                   /old_locus_tag="TVS0050"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77921"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EHG8"
FT                   /protein_id="CAQ77921.1"
FT                   /translation="MTDKIKPLPDTIDELKALVLQLENKYNRLLEQFRLAQHQRFGKSS
FT                   ESDSTQFDLFNETEEEIIIENDDTQTITYTRQKPKRQRLPEDLPRTVIIHDIKDKTCKC
FT                   CGLEMHAMGKDISEKLEFVPAKVEVIQHVRPKYACRNCEKNNTSVDIKQAPMPASPIPK
FT                   GIATASLLAQIITAKFQYSLPLYRQETLFQQWGIIIGRRTMADWLIKCSVLFTPLNNEL
FT                   HRILLEQPTLHCDETTVNVLDVEKAKCYMWVYCSGYDSPGSGVLPGIVLYDYQSSRHGY
FT                   HPVNFLKGYNGYLHTDGYQGYEQTEAMLVGCWAHARRRFIEAQRVQVKGKTGSADWVLS
FT                   KIQKLYRIESLLKEASPEAKYVARQTEARDLLKELRDWLDSAVSRVSPKTKLGEAISYT
FT                   LNQWDKLVRYIDDGLLSIDNNRAERAVKPFVIGRKNWLFSGSTAGADSSAMLYSIVETA
FT                   KANGLIPYDYIRYCLDRLCVGSPDIDSLLPWNVKDKV"
FT   repeat_region   282979..283002
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(283005..283310)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="VSAL_I0237"
FT                   /old_locus_tag="TVS0051"
FT                   /product="phosphopantetheine adenylyltransferase
FT                   (fragment)"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to Escherichia coli coad phosphopantetheine
FT                   adenylyltransferase (ec 2.7.7.3 ) (pantetheine phosphate
FT                   adenylyltransferase) (ppat) (dephospho-co
FT                   pyrophosphorylase). UniProt:P0A6I6 (EMBL:ECKDTA) (159 aa)
FT                   fasta scores: E()=3.2e-20, 58.824% id in 102 aa. CDS is
FT                   truncated by the insertion of the downstream IS element and
FT                   subsequent recombination events"
FT                   /inference="similar to sequence:UniProt:P0A6I6"
FT   misc_feature    complement(283008..283295)
FT                   /gene="coaD"
FT                   /locus_tag="VSAL_I0237"
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   3.3e-12"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   CDS_pept        complement(283303..284334)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0238"
FT                   /old_locus_tag="TVS0057b"
FT                   /product="glycosyl tranferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="Similar to Rhizobium meliloti lipopolysaccharide
FT                   core biosynthesis glycosyl transferase LpsD UniProt:Q9R9N0
FT                   (EMBL:AF193023) (343 aa) fasta scores: E()=1e-10, 25.852%
FT                   id in 352 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77923"
FT                   /db_xref="GOA:B6EPF4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPF4"
FT                   /inference="similar to sequence:UniProt:Q9R9N0"
FT                   /protein_id="CAQ77923.1"
FT                   /translation="MMKIYHVNLARGFSGGEQQTLALIQQHLKEKQNIAVIALTNSPFY
FT                   NAISDLGCEVITVRHYLLGHTISLPKDAVLHVHEGHAIYWAALQHKVSQTPYIITRRLD
FT                   NPIKKKWLTTFAYSNAAAIVGISTCVSEVVRQRLPQQHIMTIPDSPVTYPINHSEVANI
FT                   RERFKDKFLVIQAGNMIPHKGFDVTVNAAMLLKDPRVHICLLGDGKQRCELEKQASGLT
FT                   NISFMGRQHNMGDWFAAADLLIHPSYTEGLGSVILEGMSTGLPAIGSRAGGIPNIIEHE
FT                   KSGLLIEPGNSTELAEHIEKIANNATLKEHLIEGGWEKLTAFMIEHTAALYFKVYQRAL
FT                   QHD"
FT   CDS_pept        complement(284334..285116)
FT                   /transl_table=11
FT                   /gene="waaE"
FT                   /locus_tag="VSAL_I0239"
FT                   /old_locus_tag="TVS0058"
FT                   /product="glucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77924"
FT                   /db_xref="GOA:B6EPF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPF5"
FT                   /protein_id="CAQ77924.1"
FT                   /translation="MTTSSPTLAVALIVKNEAKHLKACLDTVADWVDEIVIMDSGSTDS
FT                   TETIAREFTDKFIVNKEWPGFGKQRQLAQQHVTSDYVLWLDADERVTPELKTEILAAVK
FT                   ANKTKTAYKINRSSSAFGKFIKHSGWSPDWVVRLYKTDETQYSDSLVHESVVIPNHIQV
FT                   NALTGRLLHFTYDALQQYNAKNVMYIKSWVDQREGKKKGSLSGAFLHGFFCFIRMYILK
FT                   RGFLDGRHGLLLATLSASVTFNRYADLWLRDYNKANKE"
FT   CDS_pept        complement(285116..286237)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0240"
FT                   /old_locus_tag="TVS0059"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77925"
FT                   /db_xref="GOA:B6EPF6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPF6"
FT                   /protein_id="CAQ77925.1"
FT                   /translation="MNVNSIILPHSFWVNIFMALFTSAPNSLCILRLSAIGDVCHAVAA
FT                   VQAIQKEWPTTKITWIVGKIEAQLIHDLPGITVIPFDKKLGLKGMKAIWSQLNNQRFDA
FT                   LIHMQLALRASVLTIGIKAKYKVGFNRKRAKEGQWLFTNRKIEDTASAHVLDSFYSFIE
FT                   YLGVPKSEPTWNIPLSDDDFSFVNSHIPAEKPYVVISPAASKDERNWLTERYAQLSDWL
FT                   TTQGYQVVLCGSPSDREKQLGDSIESLANSPLINLIGKTSLKQLTAVLKKATVVIAPDS
FT                   GPAHIATTQATPVIGLYGHSNPKRTGPYNSLSYVVSVYEQHVTQQQNKPVNELKWSTRV
FT                   KGEHIMQDITLDMVARSFQQLEIILNSTEEGKK"
FT   CDS_pept        286562..287266
FT                   /transl_table=11
FT                   /gene="wavC"
FT                   /locus_tag="VSAL_I0241"
FT                   /old_locus_tag="TVS0061"
FT                   /product="lipopolysaccharide core oligosaccharide
FT                   biosynthesis protein WavC"
FT                   /note="Similar to Vibrio cholerae WavC UniProt:Q8RJM8 (252
FT                   aa) fasta scores: E()=4e-62, 65.665% id in 233 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77926"
FT                   /db_xref="GOA:B6EPD9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD9"
FT                   /inference="similar to sequence:UniProt:Q8RJM8"
FT                   /protein_id="CAQ77926.1"
FT                   /translation="MQKIQTTKQTIWYDDSILSDSPEQCCDPDYWQQQDKVIGSAQGRG
FT                   TTWFVALDTMDAALRHYRRGGLFGKLIKDHYIFTGWEKTRSYQEFQLLNILIEAGVNVP
FT                   KPIAARSIKRTFCYQADLLSEKIPHARDLVAILQEESLSKEIYQKIGAEIGKMHTAQVN
FT                   HTDLNIHNILIDDKENVWIIDFDKCYQQEGSDWKESNLSRLNRSFHKEVNKRQIKWSED
FT                   EWQHLFSGYNTI"
FT   CDS_pept        287299..289152
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0242"
FT                   /old_locus_tag="TVS0062"
FT                   /product="membrane associated sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77927"
FT                   /db_xref="GOA:B6EPD8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD8"
FT                   /protein_id="CAQ77927.1"
FT                   /translation="MILNTLTFKQKLHSHGWFILINSLIAMAIATRYFAFLPEIPTDIL
FT                   GFSFITSGTFSQMVLLVGLIGLVALPALAIRPAKIRNGLQALIASICIATLFIDILVFA
FT                   QYRFHINAVVLELVLSGQVVSFPLITWVTVIGGVIALVVGQYLLISWLEKPAAITQHKL
FT                   GRKFALITFFALLATHGIHIWAAANAYQPVTTVKRYLPAFYPATSTSMMKKYGWVNEEA
FT                   IAQQKAMKLNRKSDLNYPLAPLQKEAVEKPINIMILTVDSWRADTFNAENTPNMWEYAQ
FT                   SGVIFNNHIATGNATRTGIFGLFYGIPGTYWHGFLANQKTPALIDRLQELNYDMGIFTA
FT                   AQLEKPEFNQTVFKNIPNLRIKSEGGSPSELDKDLTKDWLEWYSKRDTSKPAFSFLFYD
FT                   APHGYDFPKDYAHRYEPMLDEINYLELSNDSDPTPFFNRYKTSVHFVDSVAKQVLDKLK
FT                   ETGDLENTLVIITGDHGQEMNDNRMNFWGHNSNFTDAQVKVPFAIFGPKINGKALDWTA
FT                   DDLTSHQDVVPTLMKNYLGVTNNIKDYSVGEDLLGKHVDRNWIMTSNYSGYAIIDKESI
FT                   LEVGATGQYQLLDKTNRPMKDAELNYQHLQEALEQISRFSK"
FT   CDS_pept        289174..290265
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="VSAL_I0243"
FT                   /old_locus_tag="TVS0063"
FT                   /product="dTDP-D-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77928"
FT                   /db_xref="GOA:B6EPD7"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD7"
FT                   /protein_id="CAQ77928.1"
FT                   /translation="MNILVTGGAGFIGSAVIRHIISNTSNSVINVDSLTYAGNLESLSQ
FT                   VEASDRYSFEHVDICNRTELDRIFSEYQPDAVMHLAAESHVDRSIDGPAAFIETNIVGT
FT                   YTLLEATRAYWNLLADDKKQAFRFHHISTDEVYGDLEGTDDLFTETTPYEPSSPYSASK
FT                   ASSDHLVRAWQRTYGLPTVITNCSNNYGPYHFPEKLIPLMILNALEGKYLPVYGNGMQI
FT                   RDWLFVEDHARALYKVVTEGEIGETYNIGGHNEKANIEVVKTICSLLEELVPNKPEGVA
FT                   QYLDLITYVTDRPGHDVRYAIDASKIEHELGWKPEESFESGIRKTVQWYLDNKQWWSRV
FT                   LDGSYAGERLGVSSEQVVHKEIR"
FT   CDS_pept        290265..291149
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="VSAL_I0244"
FT                   /old_locus_tag="TVS0064"
FT                   /product="glucose-1-phosphate thymidylyltransferase RmlA"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77929"
FT                   /db_xref="GOA:B6EPD6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD6"
FT                   /protein_id="CAQ77929.1"
FT                   /translation="MKGIVLAGGSGTRLYPLTRGVSKQLLPIYDKPMVFYPISTLMLAG
FT                   IKDILIITTPEDNAGFKRLLGDGSDFGINLEYAIQPSPDGLAQAFIIGEEFIGDDPVCL
FT                   VLGDNIFYGQSFSKTLKNAASRDLGATVFGYQVKDPERFGVVEFDEKMKAISIEEKPLK
FT                   PKSNYAVTGLYFYDNRVVEMAKQVKPSHRGELEITTLNEMYLNDGSLNVELLARGFAWL
FT                   DTGTHESLHEASSFVQTIEHIQGLKVACLEEISWRNGWLSDEQILDLATPMMKNEYGQY
FT                   LTRLINDNKQKEL"
FT   CDS_pept        join(291149..291349,291359..292048)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /locus_tag="VSAL_I0245"
FT                   /old_locus_tag="TVS0065"
FT                   /product="dTDP-4-dehydrorhamnose reductase (pseudogene)"
FT                   /note="Similar to Vibrio cholerae
FT                   DTDP-6-deoxy-L-mannose-dehydrogenase rmlD UniProt:Q842N3
FT                   (291 aa) fasta scores: E()=2.3e-59, 58.108% id in 296 aa.
FT                   CDS contains two nonsense mutations (TAA) and (TAA) after
FT                   codon 67. The sequence has been checked and is believed to
FT                   be correct"
FT                   /db_xref="PSEUDO:CAQ77930.1"
FT                   /inference="similar to sequence:UniProt:Q842N3"
FT   CDS_pept        292059..292616
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="VSAL_I0246"
FT                   /old_locus_tag="TVS0067"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77931"
FT                   /db_xref="GOA:B6EPD4"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD4"
FT                   /protein_id="CAQ77931.1"
FT                   /translation="MNVIDTNIPDVKIFEPTVFGDERGFFMETWSQKKFEELVTGKPTQ
FT                   FVQDNHSKSKKGILRGLHYQTENTQGKLVRVVSGEVFDVVVDIRENSPTFGQWVGTYLS
FT                   AENKHQLWVPEGFAHGFYVTSEDAEFVYKCTDYYNPKSEISIAWDDKAIGIEWPITTPP
FT                   QLSEKDKNAMILSQVTPIKQED"
FT   CDS_pept        292617..293456
FT                   /transl_table=11
FT                   /gene="wavT"
FT                   /locus_tag="VSAL_I0247"
FT                   /old_locus_tag="TVS0068"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77932"
FT                   /db_xref="GOA:B6EPD3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD3"
FT                   /protein_id="CAQ77932.1"
FT                   /translation="MLKPKASLIIAFYNNTVCLELIFKALSTQTESNFEVIIADDGSKQ
FT                   EAIDFINTRKESLPFTVKHVWHEDKGFRKNRILNHAVLKSSSDYLIIIDGDCIPEKHFI
FT                   EDHFNNAEKGRSLSGRRVELPELYTQRVMNSVSPGAFFSENKLEILIRYMLSNGDKQTK
FT                   GRHIEKGLRFAKLWQQSLFKGKKAKAILGCNFSLFKEDLLKINGFDMRYEAPAVGEDSD
FT                   VDYRLNLVGVTNKSLNGLAVQIHLYHPWLDRVSGNWDILRDTMKHERYWADSGINDC"
FT   CDS_pept        complement(join(293443..293697,293701..294162))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="wavS"
FT                   /locus_tag="VSAL_I0248"
FT                   /old_locus_tag="TVS0069"
FT                   /product="lipopolysaccharide biosynthesis protein WavS
FT                   (pseudogene)"
FT                   /note="Similar to Vibrio cholerae WavS UniProt:Q8RTH0 (222
FT                   aa) fasta scores: E()=3.6e-13, 39.161% id in 143 aa. CDS
FT                   contains a nonsense mutation (TAA) after codon 152. The
FT                   sequence has been checked and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77933.1"
FT                   /inference="similar to sequence:UniProt:Q8RTH0"
FT   CDS_pept        294239..295381
FT                   /transl_table=11
FT                   /gene="rffA"
FT                   /locus_tag="VSAL_I0249"
FT                   /old_locus_tag="TVS0070"
FT                   /product="lipopolysaccharide biosynthesis protein RffA"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77934"
FT                   /db_xref="GOA:B6EPD1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD1"
FT                   /protein_id="CAQ77934.1"
FT                   /translation="MIPFNKPPVTDNEISYIDQAIKSGCLAGDGHFSKKCETWFENATG
FT                   AQKTLLTPSCTHALEMAALLIDIQPGDEVIMPSYTFVSTANAFVLRGAKIIFVDVHPET
FT                   MNINENLIEAAITKKTKAIVPVHYAGVACEMDLIMSLAHKYSLFVIEDAAQGVMSTYKG
FT                   KALGSIGHLGAFSFHETKNYTSGGEGGLLLINDSRFIKRAEILREKGTNRSQFFRGMVD
FT                   KYSWVDVGSSFLPSEIQSAYLWAQLGSADKINKKRLSDWLFYFNKLLPFQHEGLIDLPH
FT                   IPEEVKHNAHMFYIKVENLEVRTQVLNKLKDRGILAVFHYIPLHSSIAGLQFGRFHAED
FT                   KYTTEESERLLRLPMFYNLLESERELVCNELIKILKEIQS"
FT   CDS_pept        295378..296499
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0250"
FT                   /old_locus_tag="TVS0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77935"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPD0"
FT                   /protein_id="CAQ77935.1"
FT                   /translation="MIDIKDKHVFFIADNDRFFYLYADALIHRAKISPESLVVIVFPML
FT                   GHMDNLNKIEQVTYAQINPEVIASALDAKTITFMSLHKGNSSYVKQVLELNESIVDKVH
FT                   IFLADDEVDRWGRVFKKHDNIVEDNKALIGRDDIWVLGKINKFIAHKKTFEQKLVTLLK
FT                   RETIEFIDAGVIFDTLPTLESECLRQAYIKNKIVADSEKKILIGTKQKSFDLRTIISII
FT                   KECTAVLGDEYKFLILWHKKQRKERMFLDLHLIYLRHIKRKTVDVSYVTALNPLGYTAL
FT                   VMSCSHIILQGRGGASTARQFIKWAGGIVCIQEDTANNFGFRDALGLDILSFESSKELA
FT                   SKIKEEKISLQLNAERTQDEEKRSIQELFRLYN"
FT   CDS_pept        296617..297807
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0251"
FT                   /old_locus_tag="TVS0072"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77936"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC9"
FT                   /experiment="The expressed protein is found to be exported
FT                   (extracellular) by Aliivibrio salmonicida"
FT                   /protein_id="CAQ77936.1"
FT                   /translation="MNPILSLIGRTDALFTQDIASHEAELSRIVSQSRFLVLGGAGSIG
FT                   QAVTKEIFKRNPQKLHVVDISENNMVELVRDIRSSFGYINGDFQTFALDIGSIEYDAFI
FT                   KADGQYDYVLNLSALKHVRSEKDPFTLMRMIDVNVFNTDKTIQQSIDAGAKKYFCVSTD
FT                   KAANPVNMMGASKRIMEMFLMRKSEKMAISTARFANVAFSDGSLLHGFNQRIQKNQPIV
FT                   APNDIKRYFVTPQESGELCLMSCIFGENRDIFFPKLSEALHLISFADIAVKYLKQIGYE
FT                   PHLCDSEDEARELAKTLPAQGKWPCLFTSSDTTGEKDFEEFFTDKETLDMARFDNLGII
FT                   KNDPLYQQELLALFEQKIGQMKSDRQWTKEEIVQLFFTMIPDFGHKETGKYLDSKM"
FT   CDS_pept        297831..298976
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0252"
FT                   /old_locus_tag="TVS0073"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77937"
FT                   /db_xref="GOA:B6EPC8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC8"
FT                   /protein_id="CAQ77937.1"
FT                   /translation="MNKTPLVEFVRDIYQTNDFIPLHAPTFDGNEQKYVLETIQSTFVS
FT                   SVGKFVDEFEQKIESYTGTAKAVATVNGTAALHAALYMAGVQHGDFVITQALTFVATCN
FT                   ALHHMGAEPIFVDVSPVSLGLCPKAMDEYLTQHAQVTETGCIHSQTKRPIRAVVPMHTF
FT                   GHPVELDELIAVCHKWNITLVEDAAESLGSFYKGKHTGTLGDFGAVSFNGNKIITTGGG
FT                   GMVLCKTAELGARTKHVTTTAKVPHPYEFYHDEAGFNYRMPNLNAALGCAQMEVLEPYL
FT                   AQKRVLANRYQDFFAESDFQFVSEPEYAQSNYWLNAVICPSVDARNDILKQTNESGVMT
FT                   RPIWQLMHRLPMFKEAPRGDLTQSEYIEAHLINLPSTPVAL"
FT   CDS_pept        299014..300198
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0253"
FT                   /old_locus_tag="TVS0074"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.-"
FT                   /note="Similar to Campylobacter coli PtmD UniProt:Q7X522
FT                   (391 aa) fasta scores: E()=1.7e-50, 42.010% id in 388 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77938"
FT                   /db_xref="GOA:B6EPC7"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC7"
FT                   /inference="similar to sequence:UniProt:Q7X522"
FT                   /protein_id="CAQ77938.1"
FT                   /translation="MSQLFMNKKVAVFTGTRAEYGLLFWLLKDIQNDPELQLQLLVSGM
FT                   HLSPEFGETYKQIETDGFVIDEKIEILLSSDSAVGTAKSMGLGVLGFADSLSRLQPDVL
FT                   VILGDRFEALAAAQTAMIMRIPIVHLHGGEITEGAYDDAIRHAITKLSYLHGTSTEDYR
FT                   QRVIQLGEDPSRVQNVGAIGLDHLKRATFMTVAELSESLDFTLDKPFFLVTYHPVTLGN
FT                   EAPEESFQALLNALDEYPDHQVILTYPNADDGGRRIIPILEEYARSNPTRVLAIPSLGQ
FT                   VRYLSSVMHATAVIGNSSSGIIEVPAFDVPTVNIGSRQKGRLAAKSVLNVEPNQQSISD
FT                   AIQVAIDRTYKLADEKIHNPYGQGDTSGKVIEMIKSLQFTPSKAFYDITINDVE"
FT   CDS_pept        300206..301279
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0254"
FT                   /old_locus_tag="TVS0075"
FT                   /product="N-acetylneuraminic acid synthase"
FT                   /note="Similar to Campylobacter coli PtmC UniProt:Q7X523
FT                   (334 aa) fasta scores: E()=4.5e-31, 52.113% id in 355 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77939"
FT                   /db_xref="GOA:B6EPC6"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC6"
FT                   /inference="similar to sequence:UniProt:Q7X523"
FT                   /protein_id="CAQ77939.1"
FT                   /translation="MTLIIAEAGVNHNGDENLAFQLVDAAYHAGADIVKFQTFKAKNLV
FT                   TEDAVQAEYQVTNTQKQESQLAMLSRLELSYDIHHQLVKHCESLGIEFLSTAFDSESLD
FT                   FLVNDLGLTRLKIPSGEITNAPLVLEHARTGCDLIVSTGMATLSEIEAVLGVIAFGYVA
FT                   DKTEEPSELAFQQAYASEQGQKALKKKVTILHCTTEYPAPMVEINLKAMDTLGRAFELP
FT                   AGYSDHSAGITIPIAAVARGAVLIEKHFTLDQNMEGPDHKASLEPQELTAMVSAIRQVE
FT                   VALGVGVKSPTVSEVKNKAVARKSLVAAKAIQQGDLITEDNLTIKRPGSGMSPYHYWAL
FT                   LNQPASQDYKAGDLIVE"
FT   CDS_pept        301272..301916
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0255"
FT                   /old_locus_tag="TVS0076"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77940"
FT                   /db_xref="GOA:B6EPC5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC5"
FT                   /protein_id="CAQ77940.1"
FT                   /translation="MSKTELKPLVVIGGGGHASVLVDILRSQQREILAIVSPEDISQRR
FT                   VFSGLTHLKNDDDVLGFSPDSVYLVNGVGMLPKSGLKRKLNEYFISLGYSFETVISDSA
FT                   QVSSFAEIEQGAQIFSGAIIQAGVVIGAHSIINSGVIIEHDCMIGQYNHIAPKAILCGQ
FT                   VTTHQYVYIGANATVIQNITLEQSSIVGAGAIVTKNISSEQICYPSRSVLK"
FT   CDS_pept        301932..302990
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0256"
FT                   /old_locus_tag="TVS0077"
FT                   /product="nucleotidyl transferase"
FT                   /note="Similar to Campylobacter coli PtmE UniProt:Q7X521
FT                   (220 aa) fasta scores: E()=5.9e-31, 43.439% id in 221 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77941"
FT                   /db_xref="GOA:B6EPC4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC4"
FT                   /inference="similar to sequence:UniProt:Q7X521"
FT                   /protein_id="CAQ77941.1"
FT                   /translation="MSYSWKKVLIKPESTIVDALRVIDNESLRIALVVNDEQQLLGVVT
FT                   DGDIRRSILNNLPLDTLVVDIMSCSPITASVNTAKEQLVKLMESEGILAIPLMEENKVV
FT                   GLETLHHLFEEKTYHNPVFIMAGGFGTRLRPLTDSCPKPMLKIGNKPILETVIRSFIKA
FT                   GFVNFYISTHYMPEQIQQHFGDGSDLGVKISYVHEDFPLGTGGALGLLPDDLPKDLPLI
FT                   MMNGDVLTKVDFERLLDFHTENEADATMCVREYDYQIPYGVINGEGNKITSMVEKPIQR
FT                   FFVNAGIYVVSPRVIQSVPENHHIDMPTLLEQHMNERDNILMFPIHEYWLDIGRMDDFN
FT                   RAQADIHTLGVL"
FT   CDS_pept        join(302990..303124,303128..303685)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0257"
FT                   /old_locus_tag="TVS0078"
FT                   /product="putative acylneuraminate cytidylyltransferase
FT                   (pseudogene)"
FT                   /note="Similar to Escherichia coli NnaC UniProt:Q93NQ1 (421
FT                   aa) fasta scores: E()=3.8e-21, 42.130% id in 216 aa. CDS
FT                   contains a nonsense mutation (TAG) after codon 45. The
FT                   sequence has been checked and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ77942.1"
FT                   /inference="similar to sequence:UniProt:Q93NQ1"
FT   CDS_pept        303682..304785
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0258"
FT                   /old_locus_tag="TVS0080"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Campylobacter jejuni PseA UniProt:Q939J7
FT                   (378 aa) fasta scores: E()=3.7e-39, 36.216% id in 370 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77943"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC2"
FT                   /inference="similar to sequence:UniProt:Q939J7"
FT                   /experiment="The expressed protein is found to be
FT                   associated with the outer membrane in Aliivibrio
FT                   salmonicida"
FT                   /protein_id="CAQ77943.1"
FT                   /translation="MKYCSKCVMPDTRPGIAFDENGICTPCLNHEKKKNIDWDSRYKEL
FT                   EKLCEKYRGINGEGQYDCMIAVSGGKDSHYQVYFMKEVMKMNPLLVSVEDNFPMTDAGK
FT                   HNIRNISEEFGCDIISLKPNIKVQKHLMRKTFERYGKPTWFIDRLIYTYPLMMAEKFNT
FT                   ALLVYGENVSFEYGGADAVETYSARNIIDNGVASDIPFEDLIDDNIQDNDLVLCHAPTK
FT                   SQLDRIDPMYLGYFIPWDSFTNYNFATKRGFKDLTHEWDRTHHVENFDQVDSRAYLVHP
FT                   WLKYPKFGHASATDYAARMVRYGMLTRKEAVELVKAKDAKLDPKCIEDFCNFLGYSNRQ
FT                   FWDVVDGLYNTELFNKDNNGEWVLKSI"
FT   repeat_region   304942..305995
FT                   /note="VSa7"
FT   repeat_region   304942..304971
FT                   /note="IR of VSa7"
FT   CDS_pept        305038..305994
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0259"
FT                   /old_locus_tag="TVSa0178"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77944"
FT                   /db_xref="GOA:B6EKX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B6EKX7"
FT                   /protein_id="CAQ77944.1"
FT                   /translation="MGYQYKQLTLGERYQIEAWNTHSISAREIGQKLKRSNGSISKELR
FT                   RCPAGSYSAEQAHKHAFQKRTLSIKHTKCSQKNKKIIHLYLQLGWSPEQISGRMRREKI
FT                   ENTICCSTIYNAIKREQWQRMLARKGKKYKQRKGVEAGARLIPNRIDISQRPAIVDDKS
FT                   EVGHWEGDTVYGQDGYLVTMVERVSKLLVTCKVRNKSKKAVTRGINRMMKPFKELCKTI
FT                   TFDNGGEFAGHAKIAKHLNCDIYFAKPYHSWQRGLNENTNGLLRRFFPKGMAIGELTAK
FT                   EIKQAEFLINSRPRKTLNFLSPSEFLNGKSVSVIVTI"
FT   repeat_region   305966..305995
FT                   /note="IR of VSa7"
FT   CDS_pept        complement(306147..307148)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0260"
FT                   /old_locus_tag="TVS0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77945"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPC0"
FT                   /protein_id="CAQ77945.1"
FT                   /translation="MNVFLVTSPFQYICANEARCHYATNDNILLLVKQDMEPAISQMTK
FT                   IVNENDWTHVINIERSQRTFSMPKAIKAVNKIRTNSSIKHFFHGEYNGWRTKFLLRNLK
FT                   PDTEIYFDDGSLTLGEYERFIKTEHTFYRPRFVNDLIIKMQGLKPIGRLPISKKLEIFT
FT                   IFDIKDPTVPVVKNDFSNMRETYNLNDDHQREHSNEYALFLGQGSIDCHGTIKSFYLDA
FT                   IKRFAKTTGKKILYAPHRTETSDIRKEILKIENLTYHDSTLPIELEIAEKQLNINNIGG
FT                   IASTALYTLKIIYPHIKIYSAKQSKEEYHTQVTYTDNELMLELLKSIGIELF"
FT   CDS_pept        complement(307195..308457)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0261"
FT                   /old_locus_tag="TVS0083"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77946"
FT                   /db_xref="GOA:B6EPB9"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB9"
FT                   /protein_id="CAQ77946.1"
FT                   /translation="MLIRLVYTLLLTLLSPVLLFGLYKKKPNKPQFGDRWKEHFGFTPT
FT                   LKKSEQPLWIHAVSVGEAIAATPLIKALKQQSPEQPILVTTTTSTGAEQIAKLGDLVEH
FT                   RYMPIDFPFAVNGFLKTVNPSKLLIIETELWPNTLHSVGKSNIPIYVVNARLSEKSCQG
FT                   YTKIQPVFTELSKHLTKVLCQTQADADRFARLGINKERLCATGSIKFDIQISDEIKQQG
FT                   QELRQLLDNDRPIWIAASTHKGEDEQVLDAHKEVLKEHPNALLILVPRHPERFDTVFEL
FT                   SKNSGFSSIRRTSNKTVTAETQVYLGDTMGEMLVLIGAADVCFMGGSLLGDKVGGHNVL
FT                   EPAALGVPVIIGPSYYNFKEIVDTLRGEQGIVICEPTQLSNHIVKLIDDSTEYQLLQNS
FT                   ASNVVQSNQGALNRTIAISNI"
FT   CDS_pept        complement(308451..309521)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0262"
FT                   /old_locus_tag="TVS0084"
FT                   /product="ADP-heptose-LPS heptosyltransferase II"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77947"
FT                   /db_xref="GOA:B6EPB8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB8"
FT                   /protein_id="CAQ77947.1"
FT                   /translation="MKILIIGPSWVGDMVMSQSLYITLKQQNPDAVIDVMAPAWCKPIL
FT                   ERMPEVNQAIEMPLGHGAFDLFGRRRLSKQLSANNYTHAYICPNSAKSALIPWFAGIPI
FT                   RTGWKGEMRYGLLNDLRSNKKSFQYMVERYVALAHPKSEMINSSSLGGLDTLPRPKLAI
FT                   DADTQQAMLTKFSLSADKPVLGLCPGAEFGPAKQWPVEHYAAVANEMINQGYQVWLFGS
FT                   AKDKETTEAIKSLVHSDNQASVFNLAGDTSLIEAVDLLAACKTVVSNDSGLMHVAAAVG
FT                   CHVVGVYGSTSPKYTPPLAEKVDIVSTDIECRPCFKRECEFKHLKCLTDLDPQLVLDKI
FT                   SPKSHSNESVIQVTSC"
FT   CDS_pept        complement(309518..310744)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0263"
FT                   /old_locus_tag="TVSa0182"
FT                   /product="O-antigen ligase WaaL"
FT                   /note="Similar to Vibrio cholerae Putative O-antigen ligase
FT                   WaaL UniProt:Q8RJ54 (399 aa) fasta scores: E()=7e-14,
FT                   27.094% id in 406 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77948"
FT                   /db_xref="GOA:B6EPB7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB7"
FT                   /inference="similar to sequence:UniProt:Q8RJ54"
FT                   /protein_id="CAQ77948.1"
FT                   /translation="MKKISLPLIATILCFLFFSTPIIYPDSYVVAPLLLALFGLFLLPK
FT                   TYHAFKNRDVKYISLSMVGYFILTIISFLYSGGETSQLDMPSRTVLASFILCFLVTYKP
FT                   NPAPLFLAAPIGAAIAGFISFYHSFYIGGCAFVGTFGYMPIQIGGIIASLATFSVISFF
FT                   YYRKTEQKNFAVFSFVAANLGYIATLLSGARGAWLLTPFVLLIVLYLNKELINKKIVGY
FT                   ALLAAIIDLSIASAQITSRLDAIQSDLTQYSAEQSASSSGARLEMWKSALYSAQESPLF
FT                   GQGFSGIEAAKQRQLDAGLIDPIALKYSRAHNQYLEDLQTKGIFGLSVLLIMFAVPFAF
FT                   FKRNLKQYINDSDKDTHYFLALMGASHVALVAGYALTQHYLSHHSGILFFAVGIAILSA
FT                   LVINQRKPS"
FT   CDS_pept        complement(310915..311856)
FT                   /transl_table=11
FT                   /gene="hldD"
FT                   /locus_tag="VSAL_I0264"
FT                   /old_locus_tag="TVS0086"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77949"
FT                   /db_xref="GOA:B6EPB6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPB6"
FT                   /protein_id="CAQ77949.1"
FT                   /translation="MIIVTGGAGMIGSNIIKSLNDNGFNDILVVDNLKDGKKFKNLVDL
FT                   DITDYMDKEDFITQIMAGDDFGTIDAIFHEGACSATTEWDGKYMMMNNYEYSKEVLHFC
FT                   IEREIPFLYASSAATYGDTDTFIEEREYEGALNVYGYSKQQFDNYVRRLWADAEAHGET
FT                   VSQITGFRYFNVYGPREQHKGSMASVAFHLNNQMNASEDPKLFERSDEFKRDFVYVGDV
FT                   AAVNLWFLENGVSGIFNCGTGRAEPFRAVADAVIKHHGKGEVQSIPFPEHLKGAYQEFT
FT                   QADLTKLRAAGCDVEFKSVADGVAEYMAIVNK"
FT   misc_feature    complement(311044..311850)
FT                   /gene="hldD"
FT                   /locus_tag="VSAL_I0264"
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/isomera, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01073"
FT   misc_feature    complement(311134..311853)
FT                   /gene="hldD"
FT                   /locus_tag="VSAL_I0264"
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family, score 9.3e-45"
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   CDS_pept        312237..313691
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0265"
FT                   /old_locus_tag="TVS0087"
FT                   /product="putative metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77950"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH0"
FT                   /protein_id="CAQ77950.1"
FT                   /translation="MPTPQKHSTQSTNFEINLKHHGGKLGVTGSCHELCINSNGNKHGI
FT                   LIDCGLFQGKDAKDKHGNDKKLDIEFPISHLKALILTHTHIDHIGRLPWLLTKGFKQPI
FT                   YCTPATAELVPLMLDDGLKLQLGLNKGQRERVLELIRKQIKPIPYNQWHRIKLTSTMVP
FT                   SHSKSSCSSLKAKRPESLNLLLRFQPAGHILGSAYVEIKLPNDEIVVFSGDLGPSNTPL
FT                   LPDPISPKRADLLVIESTYGNKLHDSVETRAKRLQEIIERSLQDGGAIIIPAFSVGRTQ
FT                   ELLFDIEHLIHHNKIDSKIPIILDSPLANKVTKQYRRFKKLWSKEAKTKLNNQRHPLNF
FT                   EQCITIESHKEHMQIVNRLKSTAKPCIIVAASGMCAGGRVMNYLEALLPDKRTDIILAG
FT                   YQAHGTLGRDLQNQRSTVWIDNQPVDVNAQIHTMSGYSAHADQADLIKFVDGIEEGRKE
FT                   VVVVHGEDNVREEFERVLEARNYTLR"
FT   misc_feature    312318..313061
FT                   /locus_tag="VSAL_I0265"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 1.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   misc_feature    313500..313637
FT                   /locus_tag="VSAL_I0265"
FT                   /note="HMMPfam hit to PF07521, RNA-metabolising
FT                   metallo-beta-lactamase, score 8.6e-15"
FT                   /inference="protein motif:HMMPfam:PF07521"
FT   CDS_pept        313868..314215
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0266"
FT                   /old_locus_tag="TVS0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77951"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH1"
FT                   /protein_id="CAQ77951.1"
FT                   /translation="MLFEKLKIWQRSARLACDVIELFEGNRNFALKDQILRSSLSVPSN
FT                   ISEGEERETLKEKIRFYYYAKGSCGELLTQLLIAIETSSVPKEPALILVKETREIAKVI
FT                   ATIIQKDKRKK"
FT   CDS_pept        314332..314976
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0267"
FT                   /old_locus_tag="TVS0089"
FT                   /product="HTH-type transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77952"
FT                   /db_xref="GOA:B6EPH2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH2"
FT                   /protein_id="CAQ77952.1"
FT                   /translation="MKTKDRIILGALTLFNQNGERNITTNHISAHLEISPGNLYYHFGN
FT                   KEAIINSIFDNYANELKTRFKPMAEEDQSTMPSVQIMLSYLDSIFELMWNYRFFYANLP
FT                   DILSRDTELKEKYTKAQESLNDNLISIMKGFRTSGLIALEDDELLALTKTLHLVSSCWI
FT                   SYQTAQLSDKEITEAVVYQGMLQMLNVVRPIATEQGRAQILELEAHYQSRL"
FT   misc_feature    314350..314490
FT                   /locus_tag="VSAL_I0267"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 2e-13"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    314398..314463
FT                   /locus_tag="VSAL_I0267"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1148.000, SD 3.10 at aa 23-44, sequence
FT                   ITTNHISAHLEISPGNLYYHFG"
FT   misc_feature    314593..314622
FT                   /locus_tag="VSAL_I0267"
FT                   /note="PS00904 Protein prenyltransferases alpha subunit
FT                   repeat signature."
FT                   /inference="protein motif:ProSite:PS00904"
FT   CDS_pept        315135..316286
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0268"
FT                   /old_locus_tag="TVS0090"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77953"
FT                   /db_xref="GOA:B6EPH3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH3"
FT                   /protein_id="CAQ77953.1"
FT                   /translation="MKRIILSTILFISNPLTAAIEPLFDTPKDMEPTWVDNLLDVFGAD
FT                   GGFDESKVIDMSYLPTAYYTPEKKFGVGLLMVGLYKTENAAVEEQPSSLVVNSFVSMNK
FT                   SYGVSVENMSFFNQGKQRLLLELELHNEAAVYYGKGIEQGNKDSNYHEFDEQVYSFKPR
FT                   WMTEVANNYFIGIGADLTYAKAENLELVTTGRSYQSDRYLPDNLSSGVIITSVYDSRDY
FT                   RLNAKKGWLLQFDAGLYHNDKADSFSTYDLEVANYIDLNGLPGLIAWQIQGHFTQGEAP
FT                   WNIMPDLGGSSAMRGYIKGRYRDDQMMMGQVEYRLPIFQRYGMVFWGAVGSVAPSVSEL
FT                   SDELMTSYGTGFRFKVKDNINLRADVGIGQNETNFYLNVNEVF"
FT   sig_peptide     315135..315188
FT                   /locus_tag="VSAL_I0268"
FT   CDS_pept        316286..317005
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0269"
FT                   /old_locus_tag="TVS0091"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77954"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH4"
FT                   /protein_id="CAQ77954.1"
FT                   /translation="MGFRLICLTLAMSASVQSVMANEQVREASCSVASSYGIYLSGIHT
FT                   GEMKRVEAWQGTRAIITSNSKASILGIGTAYSQSAEVSWSELENEWVTDKFHQKVSGFR
FT                   SRDMKVTFTDGGHQSDVDIDGKESTYFSKEIPLRDVDTLSIQIRENLLQGKQTFRLNRQ
FT                   ASDGIEPYQYQVHEKQIKTFEKWGELEVIPVEQTGAEHVTFLFAPELEYQLIEARYHGF
FT                   ILRGLLTLEGYESTCGG"
FT   sig_peptide     316286..316348
FT                   /locus_tag="VSAL_I0269"
FT   CDS_pept        317174..317698
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0270"
FT                   /old_locus_tag="TVS0092"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77955"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH5"
FT                   /protein_id="CAQ77955.1"
FT                   /translation="MNKMIPIGLFSTLLLTACGGSDSGGGSGGGTPAPTKYTWQFVQMK
FT                   ANTQKNMLSSCAGKAPTEFYVDTNDIDESKWVYTFAVQAPNITDILVYDANSVLYTDTN
FT                   LSKFDINPTTATLTFSENDIPDGGYVTIVDSIKDGSKHLLTVQKELLSDALIKVNVEQG
FT                   TQKCYAENKFS"
FT   sig_peptide     317174..317248
FT                   /locus_tag="VSAL_I0270"
FT   misc_feature    317195..317227
FT                   /locus_tag="VSAL_I0270"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        317676..318617
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0271"
FT                   /old_locus_tag="TVS0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77956"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH6"
FT                   /protein_id="CAQ77956.1"
FT                   /translation="MQRINLVKNSKNKKVIIGTFDGVAESSVEGFLTGQSQKGSGTTKT
FT                   EIETLNNEYVLLSGFNADNQITGFNYQASSALSDMTSTSTASHALDALTSFINIDLRDS
FT                   SDFSFLDMTIFSNYKGQVFTWNSWATKPSIFTSYAKLGDEFNYSATYKGTLNSWKITVN
FT                   STASATGDISIVLDSLDMQTIPAPAFECGGSTCYVNVKTLTSLDVDTIKLEYTAGVTRH
FT                   TIYTNDRDMFIPEIPSYIEDVTYPDSLTPVNVSFLMGDNITNEARSGFMSYSNIKENPP
FT                   RDGYIDMLIAPGLEMKHQLGVKQSNFISVVSP"
FT   CDS_pept        complement(318954..321161)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0272"
FT                   /old_locus_tag="TVS0094"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77957"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH7"
FT                   /experiment="The expressed protein is found to be
FT                   associated with the outer membrane in Aliivibrio
FT                   salmonicida"
FT                   /protein_id="CAQ77957.1"
FT                   /translation="MPYPKFALSLIASAITATFSTFSLAAESSEYIEPITFTPSQTDFG
FT                   GVGLMQMPSGRNAEEGTFSFNTSFNNEYHFYNLSLQLMPWLETTIRYTLTQDMKYSSDP
FT                   SFSGDTTHADKGIDFKVRLLEESDWLPETSIGVRDFGGTGLFDGEFVAATKRFGNLDVT
FT                   VGMGWGYLGQSGNITNPFCKASDKYCSRESDFKGNGGSVDFERWFKGSASLYGGLEYQT
FT                   PFQPLRLKLEYDGNDYSQDYPVKGGVADMTQHTPWNFGVLYGLGDWGDMRLSYERGDTL
FT                   TFGFTLTTNFNTMKANWRDTPETVYQAPSVNHVDEINWNYIEQELDNNAGYSNSKFYVK
FT                   GNELTIVTGQEKYRNKDIAHQEAAAILASNTPEYIQTYRIIEENNSLLTTETVIDAERY
FT                   KDAAQFNYVGAKITDATVTQDISETDSINDDNLKHDSFDRWDVNISPSLRQSIGGAEGF
FT                   YLYEIGIKAGSSYWLTDNLQASGSLYLNLIDNYDKFNYIAPPDATEVPRVRTMFRAYAT
FT                   ESALRLERLQLTWFDEYAEGLYGQTYGGYLESMFGGVGTEILYRPINSRWAVGLDYTYI
FT                   QQRSPDNWFDFYQDDRQYSEADGRYYNVRSQGTTGHLTGYYMPQWSFLKSTLLKVSYGE
FT                   FLAGDKGYRVDFSKQFDSGVIVGAYASMTDLSAEEFGEGSYTKGFYLSIPYDIMTVKPS
FT                   KNRAYFDWQPLTRDGGQMLSKENTLFGLTDARQPWYTKKGL"
FT   misc_feature    complement(318969..321143)
FT                   /locus_tag="VSAL_I0272"
FT                   /note="HMMPfam hit to PF06082, Bacterial putative
FT                   lipoprotein (DUF940), score 0"
FT                   /inference="protein motif:HMMPfam:PF06082"
FT   sig_peptide     complement(321087..321161)
FT                   /locus_tag="VSAL_I0272"
FT   CDS_pept        complement(321164..321928)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0273"
FT                   /old_locus_tag="TVS0095"
FT                   /product="exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77958"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH8"
FT                   /protein_id="CAQ77958.1"
FT                   /translation="MTMRIFGFLFLSLCSFFSYASDSALSITLVKNSVILSFPQATRLD
FT                   SALLESLNYSNIYAYPLGLILSDDEKKNTVIQQQEKLSQQLSKLGEYSPFLSWTESTYQ
FT                   LNSSLLINQLAQLSFVSRLFIPLDIDEIRIKKENNPLLSGQFSLFVPERPTTITVLGLT
FT                   LSPKPQTLSYIENGSVKDYLHNVDVSSQANTSQVYVIQPDGVVQIASNNQWQKNTVSIA
FT                   PGATIFIGFNELPDSLSSIHQDIIQLLRNKVN"
FT   misc_feature    complement(321170..321916)
FT                   /locus_tag="VSAL_I0273"
FT                   /note="HMMPfam hit to PF06251, Protein of unknown function
FT                   (DUF1017), score 4.9e-33"
FT                   /inference="protein motif:HMMPfam:PF06251"
FT   misc_feature    complement(321401..321466)
FT                   /locus_tag="VSAL_I0273"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1038.000, SD 2.72 at aa 155-176, sequence
FT                   TTITVLGLTLSPKPQTLSYIEN"
FT   sig_peptide     complement(321869..321928)
FT                   /locus_tag="VSAL_I0273"
FT   CDS_pept        complement(321935..322600)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0274"
FT                   /old_locus_tag="TVS0096"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77959"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPH9"
FT                   /protein_id="CAQ77959.1"
FT                   /translation="MKNITLYLLTFGCFLLTGCSQKIQDVQSTFNEAVFGMSDVELSAE
FT                   HINELPYASAFVKINDSHNIFMVLALAESNPTTGVTQLKWLSSDNVMIVTENGRIIKTL
FT                   ALPNYNLIALNSVALPKLSQQLTAPQQWQAVYDWMPDYRYHYQASIHALPGEKSTLTSL
FT                   VWTKEVTAIQELVSFSALDLTFTNQYWLDNTGEVVKTRQFIGPNMATIEMTFLKPFRS"
FT   sig_peptide     complement(322529..322600)
FT                   /locus_tag="VSAL_I0274"
FT   misc_feature    complement(322562..322594)
FT                   /locus_tag="VSAL_I0274"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        complement(322685..322942)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0275"
FT                   /old_locus_tag="TVS0097"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77960"
FT                   /db_xref="GOA:B6EPI0"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPI0"
FT                   /protein_id="CAQ77960.1"
FT                   /translation="MKKTAIALMLAMTAGSAFAAAEATTAAASTGSAAGTAAGTARATT
FT                   AAVGVAGTTAIAVGAVVAVAVAVADSGSDTATSTSTSVTQ"
FT   misc_feature    complement(order(322736..322804,322862..322930))
FT                   /locus_tag="VSAL_I0275"
FT   sig_peptide     complement(322886..322942)
FT                   /locus_tag="VSAL_I0275"
FT   CDS_pept        323139..324506
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0276"
FT                   /old_locus_tag="TVS0098"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77961"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPI1"
FT                   /protein_id="CAQ77961.1"
FT                   /translation="MILKNRFGKYLIMHTVMANYTNKKRSLTPIAAALACCYSAITFMA
FT                   TPAMASPWLEANDPFLRSSLQVLSDSGVISSPTNQYPLRWSLFGDDIINNDTSHDLSVT
FT                   LAQREVRYSMNSAKLNRGQSSAKFVASNEEAPSTGFGQFSKDKWGASASYEYLDTSYAF
FT                   RVTTSYSNYQGEEEIRWDDSYLSLNLGAWLFSIGTVDRWWGQGWQHNLILGSYAKADPD
FT                   ISASYIGKNRVLGVWNIETVVAKPDDAEFNYHSATRLVSKPFSFFEYGLTYQVWFDSNN
FT                   SSDSDDSIKQAAVDAKLTLPSINVSNDSAEEQTHVYHSVYAELASTENTTELGALLLGW
FT                   SGSVNIEGQTVRLVLESQQSTSENEASFNANSSYAVDNSYSVALYVQMSNDHNVSLSYQ
FT                   QSEWDDTQSSQSKTTQANYRLPAASGMVHLGLGYTQMKTTTDDDQINASLGYEFRF"
FT   sig_peptide     323139..323288
FT                   /locus_tag="VSAL_I0276"
FT   misc_feature    323217..323285
FT                   /locus_tag="VSAL_I0276"
FT   CDS_pept        324575..327184
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0277"
FT                   /old_locus_tag="TVS0099"
FT                   /product="periplasmic protein involved in polysaccharide
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77962"
FT                   /db_xref="GOA:B6EPI2"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPI2"
FT                   /protein_id="CAQ77962.1"
FT                   /translation="MMMKRTLTASLFAMISTSTMAFTPSAEQMAQFQKLPKSQQEQLAR
FT                   QYGVDVSVLTGSASPVHRAKGKTEQQPVRASAPIVPSVADKSERFSAFGYDMFLGKVKT
FT                   LTSVDNLPVPNDYVMAPGDEVAIQIYGKSSEELNLVIDRQGRLNFPEFGPVAVSGQTFA
FT                   DMQKHLTGIIKQKMLGVDVLVSMGAMRTMQVYVVGEATQPGAYNVNGLTTVTQALIASG
FT                   GIKESGSLRYVELKRKGRVVERFDVYDLLLKGDSRSDVRLLSGDTLYIPTKNSSVELHG
FT                   AVKRPAIYELKGKTTLSRLLSFGGGLQPNAFLSKINITRMGSNGYEQFTVDMSTSKGKN
FT                   FIIKNGDKVVISKAAESLNNAVALRGEVARQGAYNFKQGMKVSDIVSSVRTDLKQNADL
FT                   NYALIVREINKQRDIEVLQFNLGEAIANPSSKENLSLKESDQIFVFNSGLDLDYWFKSY
FT                   ADAEVKVKHSEQKKNVERVDVETGAIIETQSVTTLKTEDIDTVSRGEQQIQKSREKLLT
FT                   PIIDRLKSQATLDNPARLIEVSGAVKYPGVYPLSRIGTIKQIILAAGGLTEEAYLDSAE
FT                   WTVRDVNGSELIIEQKKISLRDALSVEGEKNFTLTGQDRLIVKTKPNWQEGYTIELQGE
FT                   VMFPGAYSFTRGETLQEVIERAGGLTEYAYADGSVFSRERLKRLEEERLKILNMQLKQE
FT                   IGNLALRRQNSSAQYTTPPGDAMLIADELAKTEAMGRMVISIPRAIEGDEIANLMLEKG
FT                   DKLYIPARNPVISIMGEVQFASNQLFEPNMTVEEYIEVAGGTKKQADTDRIYVVRADGS
FT                   VMVPNNSYWFSRSDKPLAPGDTIIVPLDTDYLDGLSTLTSATQILYQIGVAWSAIKD"
FT   sig_peptide     324575..324637
FT                   /locus_tag="VSAL_I0277"
FT   misc_feature    324890..325249
FT                   /locus_tag="VSAL_I0277"
FT                   /note="HMMPfam hit to PF02563, Polysaccharide
FT                   biosynthesis/export protei, score 3.8e-20"
FT                   /inference="protein motif:HMMPfam:PF02563"
FT   misc_feature    324950..324973
FT                   /locus_tag="VSAL_I0277"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        327417..328394
FT                   /transl_table=11
FT                   /gene="wzz"
FT                   /locus_tag="VSAL_I0278"
FT                   /old_locus_tag="TVS0100"
FT                   /product="O-antigen length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77963"
FT                   /db_xref="GOA:B6EPI3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPI3"
FT                   /protein_id="CAQ77963.1"
FT                   /translation="MNEKQQLPHSQHLAFPPAMPADDEIDLRELFGALWKGKWIIIATT
FT                   FIFAVGGVLFALSQPNTYKAEVVLAPAGESGGGLAVMAGELGGLASLAGINIGGGGTDS
FT                   KGMSLAVLQSRQFINAFITKHDLVVPLFAGTEWNKQSGELIIDPEVYNTETKEWVREVK
FT                   PDESPVPTDWQAHKAFKGFLSTADAKDTGLVTLSVTHISPIIAQQWVEWLVADLNLWMK
FT                   DKSLTETKRNIGYLEQQLQKTDISDMRSVFYQLIEDQTKNLMLAEVEAEFAFKTIDPAV
FT                   IPEEKAGPKRALICVLSVLLGGMLGVAVVLVRFAFRKEELETRN"
FT   misc_feature    327483..328064
FT                   /gene="wzz"
FT                   /locus_tag="VSAL_I0278"
FT                   /note="HMMPfam hit to PF02706, Chain length determinant
FT                   protein, score 1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF02706"
FT   misc_feature    order(327531..327590,328296..328364)
FT                   /gene="wzz"
FT                   /locus_tag="VSAL_I0278"
FT   repeat_region   328703..330982
FT                   /note="VSa2"
FT   repeat_region   328703..328726
FT                   /note="IR of VSa2"
FT   CDS_pept        328784..329098
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0279"
FT                   /old_locus_tag="TVS0101"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77964"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77964.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   CDS_pept        329095..329442
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0280"
FT                   /old_locus_tag="TVSb0146"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77965"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ77965.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        join(329514..329732,329731..330966)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0281"
FT                   /old_locus_tag="TVS0104"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella sp. (strain W3-18-1)
FT                   transposase is66. UniProt:A1RLT8 (EMBL:CP000503) (500 aa)
FT                   fasta scores: E()=1.2e-119, 56.998% id in 493 aa. Contains
FT                   a 31 nucleotide deletion after codon 73"
FT                   /db_xref="PSEUDO:CAQ77966.1"
FT                   /inference="similar to sequence:UniProt:A1RLT8"
FT   CDS_pept        complement(331420..331788)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0282"
FT                   /old_locus_tag="TVS0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77967"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPI7"
FT                   /protein_id="CAQ77967.1"
FT                   /translation="MTLIYNKSKHKTLRQKLRSEVPTAERVLWNKLRRNQLNVKFRRQY
FT                   GIGRYVCDFYNAEYKLVIELDGDSHFTPEAENYDAIRNEYMRNLGMSVLRFTNQDIMNN
FT                   INGVIEFILIHIDQLKSE"
FT   misc_feature    complement(331438..331767)
FT                   /locus_tag="VSAL_I0282"
FT                   /note="HMMPfam hit to PF04480, Protein of unknown function
FT                   (DUF559), score 1.2e-35"
FT                   /inference="protein motif:HMMPfam:PF04480"
FT   CDS_pept        complement(332081..332851)
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="VSAL_I0283"
FT                   /old_locus_tag="TVS0106"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77968"
FT                   /db_xref="GOA:B6EPI8"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPI8"
FT                   /protein_id="CAQ77968.1"
FT                   /translation="MRHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPAL
FT                   FIDLAERTLTEAGSAIILGAQNSDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYH
FT                   NESDEFVAKKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEG
FT                   AIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPENAEA
FT                   YFAQPDIDGALVGGAALDAKSFAAIAKAAAKAKA"
FT   misc_feature    complement(332108..332842)
FT                   /gene="tpiA"
FT                   /locus_tag="VSAL_I0283"
FT                   /note="HMMPfam hit to PF00121, Triosephosphate
FT                   isomerase,score 1e-122"
FT                   /inference="protein motif:HMMPfam:PF00121"
FT   misc_feature    complement(332321..332353)
FT                   /gene="tpiA"
FT                   /locus_tag="VSAL_I0283"
FT                   /note="PS00171 Triosephosphate isomerase active site."
FT                   /inference="protein motif:ProSite:PS00171"
FT   CDS_pept        333134..333484
FT                   /transl_table=11
FT                   /gene="hpcD"
FT                   /locus_tag="VSAL_I0284"
FT                   /old_locus_tag="TVS0107"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77969"
FT                   /db_xref="GOA:B6EPL5"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL5"
FT                   /protein_id="CAQ77969.1"
FT                   /translation="MMPHLVMEYSNSADERLNMQGLLEDLHQVAIESELFSVDDVKSRA
FT                   IRVHSWLVGDKGNSVDFIHITIELLSGRTTEQKRELSRALMDVLAEQASHIDSLTINVR
FT                   DMEKESFQKVGQ"
FT   misc_feature    333140..333466
FT                   /gene="hpcD"
FT                   /locus_tag="VSAL_I0284"
FT                   /note="HMMPfam hit to
FT                   PF02962,5-carboxymethyl-2-hydroxymuconate isomerase, score
FT                   2.4e-05"
FT                   /inference="protein motif:HMMPfam:PF02962"
FT   CDS_pept        complement(join(333518..333592,334600..334866))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0285"
FT                   /old_locus_tag="TVS0109"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /note="Similar to Vibrio fischeri Hypothetical protein
FT                   UniProt:Q5E8E3 (117 aa) fasta scores: E()=1.4e-26, 83.333%
FT                   id in 90 aa. CDS is disrupted by the insertion of an IS
FT                   element after codon 107"
FT                   /db_xref="PSEUDO:CAQ77970.1"
FT                   /inference="similar to sequence:UniProt:Q5E8E3"
FT   repeat_region   333593..334597
FT                   /note="VSa6"
FT   repeat_region   333593..333611
FT                   /note="IR of VSa6"
FT   CDS_pept        333689..334570
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0286"
FT                   /old_locus_tag="TVS0108"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77971"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B6EH02"
FT                   /protein_id="CAQ77971.1"
FT                   /translation="MNKLVDIFCDVDDFCYQFLSQWEKYLVEASERKRKRQSVMSTSEC
FT                   MTIVIAFHQSNHRDFKNFYIGLVHQYWKGYFPNLLSYTRFVSKMPSLIAPMCAYFQSIK
FT                   GKPTGIAFVDSTSLKVCHNIRIPRHKVFDGVAKRGKGTMGWFFGFKLHLLINHLGEIIS
FT                   LKITAGNVNDRTPVPDLCKELSGKLYADKGYIGKKLSESLKNSDVDLVTTSRKNMKAKE
FT                   ISAFDKAMLSKRYIIETINDQLKNISQIEHSRHRSVTGFMLNVISGVVAYCLKKQKPRI
FT                   KLSECEFELILA"
FT   misc_feature    334016..334510
FT                   /locus_tag="VSAL_I0286"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   9.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   334579..334597
FT                   /note="IR of VSa6"
FT   CDS_pept        complement(335317..336324)
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="VSAL_I0287"
FT                   /old_locus_tag="TVS0110"
FT                   /product="fructose-1,6-bisphosphatase class II GlpX"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77972"
FT                   /db_xref="GOA:B6EPL8"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPL8"
FT                   /protein_id="CAQ77972.1"
FT                   /translation="MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRTLLN
FT                   KTDISGEIVIGEGEIDDAPMLYIGETVGTGGDAVDIAVDPIEGTRMTAMGQSNALAVLA
FT                   AGEKGSFLKAPDMYMEKLVVGPGAKGAIDLNLSLEENLENVAKALGKTLDTLVVTTLAK
FT                   PRHDVMIAKMQKMGVRVFAVPDGDVAASILTCMPDSEVDVMYCIGGAPEGVISAAAIRA
FT                   LDGDMQARLLPRHEVKGDTEENRAYGEEELKRCKEMGVEANVILKMTDMARSDDVVFAA
FT                   TGITKGDLLEGITRQGNIATTETLLIRGRCRTIRRIKSIHYLERKDAEVRDFIL"
FT   misc_feature    complement(335362..336321)
FT                   /gene="glpX"
FT                   /locus_tag="VSAL_I0287"
FT                   /note="HMMPfam hit to PF03320, Bacterial
FT                   fructose-1,6-bisphosphatase, gl, score 3.2e-213"
FT                   /inference="protein motif:HMMPfam:PF03320"
FT   CDS_pept        336692..336934
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0288"
FT                   /old_locus_tag="TVS0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77973"
FT                   /db_xref="GOA:B6EPL9"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPL9"
FT                   /protein_id="CAQ77973.1"
FT                   /translation="MSLEILEQLEAKVQMAVDTIALLQMEVEELKETNAELTQNLEQAN
FT                   NGRSEVEQEAQKARDEQASFEARIRGLLGKMEEVE"
FT   misc_feature    336692..336928
FT                   /locus_tag="VSAL_I0288"
FT                   /note="HMMPfam hit to PF06005, Protein of unknown function
FT                   (DUF904), score 4.4e-28"
FT                   /inference="protein motif:HMMPfam:PF06005"
FT   repeat_region   337139..339453
FT                   /note="VSa2"
FT   repeat_region   337139..337162
FT                   /note="IR of VSa2"
FT   CDS_pept        337220..337534
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0289"
FT                   /old_locus_tag="TVS0112"
FT                   /product="putative transposase?"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77974"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN3"
FT                   /protein_id="CAQ77974.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS
FT                   "
FT   CDS_pept        337531..337878
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0290"
FT                   /old_locus_tag="TVSb0147"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77975"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGS1"
FT                   /protein_id="CAQ77975.1"
FT                   /translation="MNVFTDISTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        337950..339437
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0291"
FT                   /old_locus_tag="TVS0115"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77976"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGR2"
FT                   /protein_id="CAQ77976.1"
FT                   /translation="MTDKIKPLPDTIDELKALVLQLENKYNRLLEQFRLAQHQRFGKSS
FT                   ESDSTQFDLFNETEEEIIIENDDTQTITYTRQKPKRQRLPEDLPRTVIIHDIKDKTCKC
FT                   CGLEMHAMGKDISEKLEFVPAKVEVIQHVRPKYACRNCEKNNTSVDIKQAPMPASPIPK
FT                   GIATASLLAQIITAKFQYSLPLYRQETLFQQWGIIIGRRTMADWLIKCSVLFTPLNNEL
FT                   HRILLEQPTLHCDETTVNVLDVEKAKCYMWVYCSGYDSPGSGVLPGIVLYDYQSSRHGY
FT                   HPVNFLKGYNGYLHTDGYQGYEQTEAILVGCWAHARRRFIEAQRVQVKGKTGSADWVLS
FT                   KIQKLYRIESLLKEASPEAKYVARQTEARDLLKELRDWLDSAVSRVSPKTKLGEAISYT
FT                   LNQWDKLVRYIDDGLLSIDNNRAERAVKPFVIGRKNWLFSGSTAGADSSAMLYSIVETA
FT                   KANGLIPYDYIRYCLDRLCVGSPDIDSLLPWNVKDKV"
FT   repeat_region   339430..339453
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(339695..340192)
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="VSAL_I0292"
FT                   /old_locus_tag="TVS0116"
FT                   /product="regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77977"
FT                   /db_xref="GOA:B6EPM3"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPM3"
FT                   /protein_id="CAQ77977.1"
FT                   /translation="MEYNTSALCDIYLDQVDVVEPMFSHFGAKSSFSGQITTIKCFEDN
FT                   GLISQLLDEKGEGRILLIDGGGSLRRALIDADLAAKAAHNGWEGLIVYGCVREVDYLEE
FT                   IELGIQALASIPVGAAKKNVGEIDVAVNFGSVTFLPEDYLYADSTGIIISQEPLEEMGE
FT                   EE"
FT   misc_feature    complement(339734..340192)
FT                   /gene="rraA"
FT                   /locus_tag="VSAL_I0292"
FT                   /note="HMMPfam hit to PF03737, Demethylmenaquinone
FT                   methyltransferase, score 1.7e-77"
FT                   /inference="protein motif:HMMPfam:PF03737"
FT   CDS_pept        complement(340286..341194)
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="VSAL_I0293"
FT                   /old_locus_tag="TVS0117"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77978"
FT                   /db_xref="GOA:B6EPM4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPM4"
FT                   /protein_id="CAQ77978.1"
FT                   /translation="MKTSPFAIWLSAARPKTLPLALASIMTGSALAYWNNHASATITIM
FT                   AFVTATLLQILSNLANDYGDAVKGTDNDERLGPQRAMQSGLVTQATMKKAIGINIVLTI
FT                   ISGLILVFSSLHQTMDIIGFIILGLLAIGAAIAYTMGDKPYGYRGLGDISVFIFFGLLG
FT                   VAGTYYLQTGHLSSSLLLPAIACGLLAVAVLNINNLRDIDNDAACGKMTLAVRMGPNWG
FT                   RKYHAIIIAISFTCLALFSATQIHSLAGWLFLIPAPFVLNHVISVMRAPDGEAIRPMMG
FT                   TVVQCALFTNIFFSLGLYLSI"
FT   misc_feature    complement(340289..341143)
FT                   /gene="menA"
FT                   /locus_tag="VSAL_I0293"
FT                   /note="HMMPfam hit to PF01040, UbiA prenyltransferase
FT                   family, score 1.2e-30"
FT                   /inference="protein motif:HMMPfam:PF01040"
FT   misc_feature    complement(order(340295..340363,340391..340450,
FT                   340469..340522,340607..340666,340685..340738,
FT                   340781..340834,340853..340912,341030..341098))
FT                   /gene="menA"
FT                   /locus_tag="VSAL_I0293"
FT   sig_peptide     complement(341099..341194)
FT                   /gene="menA"
FT                   /locus_tag="VSAL_I0293"
FT   CDS_pept        complement(341282..342151)
FT                   /transl_table=11
FT                   /gene="cfxP"
FT                   /locus_tag="VSAL_I0294"
FT                   /old_locus_tag="TVS0118"
FT                   /product="phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77979"
FT                   /db_xref="GOA:B6EPM5"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPM5"
FT                   /protein_id="CAQ77979.1"
FT                   /translation="MSAKHPIIAVTGSSGAGTTTTSEAFRKMFNMMDIKASWLEGDSFH
FT                   RFTRPEMDVEIRKAKEQGKHISYFGPQANDFPALEQFFHQYGIDGSGQYRRYLHTFDEA
FT                   VPFNQMPGTFTPWQELPDNTDVLFYEGLHGGVVDGDINVSQHVDLLIGMVPIVNLEWIQ
FT                   KFVRDTRDRGHSREAVMDSIVRSMDDYLNYITPQFSRTHINFQRVPTVDTSNPLNAKGI
FT                   PSLDESFVVIRFRGIANVDFPYLLAMIDGSFMSRHNTLVVPGGKMSFAMELIIRPLLQQ
FT                   LIETGKIG"
FT   misc_feature    complement(341510..342133)
FT                   /gene="cfxP"
FT                   /locus_tag="VSAL_I0294"
FT                   /note="HMMPfam hit to PF00485, Phosphoribulokinase /
FT                   Uridine kinase family, score 1.2e-101"
FT                   /inference="protein motif:HMMPfam:PF00485"
FT   CDS_pept        complement(342253..342495)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0295"
FT                   /old_locus_tag="TVS0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77980"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPM6"
FT                   /protein_id="CAQ77980.1"
FT                   /translation="MIIPWQDIAPDTLENLISEFVLREGTDYGEMECSHQDKIEQVKLL
FT                   LKNGDAMVVFSELHETVDIQTKARFNPNMTNHDFE"
FT   misc_feature    complement(342286..342495)
FT                   /locus_tag="VSAL_I0295"
FT                   /note="HMMPfam hit to PF06794, Uncharacterised protein
FT                   family (UPF0270), score 1.8e-38"
FT                   /inference="protein motif:HMMPfam:PF06794"
FT   CDS_pept        complement(342530..343498)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0296"
FT                   /old_locus_tag="TVS0120"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77981"
FT                   /db_xref="GOA:B6EPM7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPM7"
FT                   /protein_id="CAQ77981.1"
FT                   /translation="MMDQFTPITGLSNAHIQTLLPRLLRRHPLFNAYWQRLELPDGDFV
FT                   DLAWSENPNTAGNKPLFILFHGLEGSFESPYANGLLSSAKEQGWLGVMMHFRGCSDVPN
FT                   RLEKAYHSGETEDARFFLETIHDRFPNRVKVATGVSLGGNMLVNYLAKYNSNTLLNAAT
FT                   IISAPLDLSACSERIQQGFSRVYQGYLLRSLKTNSIKKLNSTRKHIVGLDKDMIAAIPD
FT                   LLQFDNLITAPLNDYADAQDYYQQCSGLQFLNDINIPTRIIHAKDDPFMTTAVIPTHPL
FT                   PNCVHYQLTEHGGHVGFINGSMTKPNFWLEDTVNRWFQTVV"
FT   misc_feature    complement(342554..343234)
FT                   /locus_tag="VSAL_I0296"
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase
FT                   fold,score 1.5e-07"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        complement(343518..344000)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0297"
FT                   /old_locus_tag="TVS0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77982"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPM8"
FT                   /protein_id="CAQ77982.1"
FT                   /translation="MKPAHNGILTPTQQAQLTTDAFWAFSLSHYKKEGVQQACLTLQDQ
FT                   YSGNVNLVLLFIWLDSLAISISKTQRHQLQDALFYTDPLLISYRSLRKNIKLTESKTLY
FT                   QQALNFELQLEKQQQHDLLHTLHRIDLNQTQLTHSTLLSLYCVSLNAQSLLNTLHP"
FT   CDS_pept        complement(343984..345915)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0298"
FT                   /old_locus_tag="TVS0122"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77983"
FT                   /db_xref="GOA:B6EPM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPM9"
FT                   /protein_id="CAQ77983.1"
FT                   /translation="MITFSDIQLLRGGKPLLEQASATIHPGDKVGLVGKNGCGKSTLFA
FT                   LIKGELSVDGGSNRVPHHWELAWVAQETPALERKALDYVIDGDREYRNLEAQLIEAEEA
FT                   DNGTLVAELHSKIDIVGGYTINSRAAELLNGLGFSQQQMDWNLTQFSGGWRMRLNLAQA
FT                   LLCHSDLLLLDEPTNHLDLDAVMWLERWLQNYPGTLMLISHDRDFLDPVINRIVHVENQ
FT                   QLNEYTGNYSSFEIQRSEKLVLQQAKYQKQQKNMSHMQSYIDRFRYKASKARQAQSRIK
FT                   ALEKMEKVLPAQLDNPFTFNFREPDALPNPILMMDEVSAGYENNTILEQIRLNLVPGSR
FT                   IGLLGRNGAGKSTLIKILSGELAPQSGIFTYSQGVKIGYFAQHQLETLQVEETPLQHLM
FT                   QVAPNHTEQQLRDYLGSFGFKGEKALDKVGPFSGGEKARLVLALVVWQKPNMLLLDEPT
FT                   NHLDLDMRQALTMALQTFEGAMVIVSHDRYLLRATTDDLYLVHDRQVMPFDGDLNDYYK
FT                   WLTEQNKSERKEQLQQDKQDSPSASTSLSAAEKKEQKRKEAEFRKQIAPLRKEVTKLEK
FT                   KMDALNNTISKAEEELGDVSLYEAENKKRLTEVLATQASAKSELEDVEMEWMDLQEQIE
FT                   EKENEARS"
FT   misc_feature    complement(344407..344904)
FT                   /locus_tag="VSAL_I0298"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(344581..344625)
FT                   /locus_tag="VSAL_I0298"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(344860..344883)
FT                   /locus_tag="VSAL_I0298"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(345250..345837)
FT                   /locus_tag="VSAL_I0298"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.3e-43"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(345424..345468)
FT                   /locus_tag="VSAL_I0298"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(345793..345816)
FT                   /locus_tag="VSAL_I0298"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        346064..346636
FT                   /transl_table=11
FT                   /gene="kefG"
FT                   /locus_tag="VSAL_I0299"
FT                   /old_locus_tag="TVS0123"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein KefG"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77984"
FT                   /db_xref="GOA:B6EPN0"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPN0"
FT                   /protein_id="CAQ77984.1"
FT                   /translation="MTQSNDVLLTSTPLPKILVILAHPDPEHSIANKAILAAYQQLPHV
FT                   TVHDLYATYPEFFIDVVYEHELLAQHDIIVFQHPLYLYSCPSLLKEWMDCVLGKGFAYG
FT                   EGNALKGKQWRSVITAGGIEEAFSETGYNQHSMDDILIPFKITAALCQMEWITPSVQYW
FT                   ARKITIEKRQSYINDYRNWLLNPKGEL"
FT   misc_feature    346106..346627
FT                   /gene="kefG"
FT                   /locus_tag="VSAL_I0299"
FT                   /note="HMMPfam hit to PF02525, Flavodoxin-like fold, score
FT                   5.8e-56"
FT                   /inference="protein motif:HMMPfam:PF02525"
FT   CDS_pept        346636..348426
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="VSAL_I0300"
FT                   /old_locus_tag="TVS0124"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefB (K(+)/H(+) antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77985"
FT                   /db_xref="GOA:B6EPN1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPN1"
FT                   /protein_id="CAQ77985.1"
FT                   /translation="MAGDWLHTSAIFLAAAVVTVPLAQRFGLGAVLGYLLAGIAIGPWG
FT                   LQLISDVDAILHFSEFGVVLLLFLIGLELNPNKLWKMRKPIIGLGGSQVVVTSCVITAA
FT                   MMFYGLAWQVSVVIGMGLALSSTAIALRVIEERKLSDSESGQSGFAVLLFQDIAVIPML
FT                   AVLPVLAGGASGNWLDGLWVLAGVIGIFTLGHFLLRPLFSYVVKSGARELFTVAALLLV
FT                   IGVSAAMKELGLSMALGAFLAGVLLAESEFRHELEVAIEPFKGLLLGLFFIAVGMSVNL
FT                   GLLLQYPVEIVIAVTLLVASKGFLLYGLARTFGTQAKARSQMAMILSQGGEFAFVLFTA
FT                   AQMEGLLSKELTAFLLVVVSLSMMTTPLLLIAQDKWFARTLNHEEEMPLSDFTHATQPK
FT                   VIIAGFGRFGQIVGRLLFANKIKLTILEGDPSQIRLLRKFGYKVYYGDATQVELLRAAG
FT                   AEKAEAIVICKTDPQKVMEIVALCKQHFPHLKILARARSRVEAYELLNEGVDHFSRETF
FT                   YGALDLGRQTLTSLGMHPYQAKRAESHFKKLDVAMLKELLPLHSDDKILASKAKAARIE
FT                   LEEIFGLEMESERSNQAHWD"
FT   misc_feature    order(346648..346701,346714..346782,346795..346854,
FT                   346891..346959,346972..347040,347077..347145,
FT                   347173..347241,347260..347319,347332..347391,
FT                   347428..347496,347506..347565,347602..347655,
FT                   347683..347751)
FT                   /gene="kefB"
FT                   /locus_tag="VSAL_I0300"
FT   misc_feature    346663..347748
FT                   /gene="kefB"
FT                   /locus_tag="VSAL_I0300"
FT                   /note="HMMPfam hit to PF00999, Sodium/hydrogen exchanger
FT                   family, score 4.8e-74"
FT                   /inference="protein motif:HMMPfam:PF00999"
FT   misc_feature    347833..348180
FT                   /gene="kefB"
FT                   /locus_tag="VSAL_I0300"
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   8.8e-28"
FT                   /inference="protein motif:HMMPfam:PF02254"
FT   CDS_pept        348447..348641
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0301"
FT                   /old_locus_tag="TVS0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77986"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPN2"
FT                   /protein_id="CAQ77986.1"
FT                   /translation="MKKRFIAGAVCPSCKVSDTLRWWQESNIEHVECVECGHMDRRTPK
FT                   SIETSKHAQDDVIGVFKPE"
FT   CDS_pept        348699..349289
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="VSAL_I0302"
FT                   /old_locus_tag="TVS0126"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   SlyD"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77987"
FT                   /db_xref="GOA:B6EPN3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPN3"
FT                   /protein_id="CAQ77987.1"
FT                   /translation="MKIEKNVVVSLAYQVKTEEGVVVDQSTAEAPLDYLHGHDNLIVGL
FT                   EKALEGKVAGDKFSITVAPEEAYGEHMDEMIQRVPADVFQGVEQIEVGMRFLADTDQGP
FT                   IPVEVTEVDGDEVVVDGNHMLAGQTLGFEVEVIAVRAATEEEATHGHVHQEGGCGHDHG
FT                   HDHDHEGGCCGGEGHSHEHKEDHECCGSGNCSK"
FT   misc_feature    348699..349109
FT                   /gene="slyD"
FT                   /locus_tag="VSAL_I0302"
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomeras, score 8.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    348699..348893
FT                   /locus_tag="VSAL_I0301"
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS00430"
FT   misc_feature    348729..348776
FT                   /locus_tag="VSAL_I0301"
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:ProSite:PS00453"
FT   misc_feature    348819..348905
FT                   /locus_tag="VSAL_I0301"
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00454"
FT   CDS_pept        complement(349477..349701)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0303"
FT                   /old_locus_tag="TVS0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli Protein SlyX
FT                   UniProt:P0A8R4 (72 aa) fasta scores: E()=1.4e-06, 37.313%
FT                   id in 67 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77988"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPQ8"
FT                   /inference="similar to sequence:UniProt:P0A8R4"
FT                   /protein_id="CAQ77988.1"
FT                   /translation="MTTDIKQLELKISDLECQMAFQEQTIDELNDALSQQQLLITNMQV
FT                   QMKFVVGKMKTMDTSSMADASEETPPPHY"
FT   misc_feature    complement(349480..349683)
FT                   /locus_tag="VSAL_I0303"
FT                   /note="HMMPfam hit to PF04102, SlyX, score 6.6e-31"
FT                   /inference="protein motif:HMMPfam:PF04102"
FT   CDS_pept        complement(349698..350714)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0304"
FT                   /old_locus_tag="TVS0128"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77989"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPQ9"
FT                   /protein_id="CAQ77989.1"
FT                   /translation="MRVISQYLAIFVITLTLAGCFFNNSDVQRWEMAPEGTTSFALSRD
FT                   ARFALFYVKPHPKDKNPQLNKKSGLHFWDLIENKELTYFGEQDQLKSVVSHIKISDNSR
FT                   FAITATQTNFAVWDLGMGVSEGLWSISDGIIRDVDISSNGQQVLLGLSNGKAIYIDLAT
FT                   GRRLEFLAHREKINSVALSANGKFALSGGNDHFAYFWDTTTGQIIYTFEHDKRVSRIAL
FT                   QRDGKFALTADGGNEGFIWDLKTGQKISTLSTFSRQQVFSTARFSDDGNYLVTGSPAGT
FT                   IKLWNIPSGKKQEQWRAEPLKDARPPTAVVYDVAIDKKQRVISATSAGIAQAWLIEE"
FT   misc_feature    complement(350109..350153)
FT                   /locus_tag="VSAL_I0304"
FT                   /note="PS00678 Trp-Asp (WD) repeats signature."
FT                   /inference="protein motif:ProSite:PS00678"
FT   misc_feature    complement(350112..350225)
FT                   /locus_tag="VSAL_I0304"
FT                   /note="HMMPfam hit to PF00400, WD domain, G-beta
FT                   repeat,score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF00400"
FT   sig_peptide     complement(350640..350714)
FT                   /locus_tag="VSAL_I0304"
FT   misc_feature    complement(350655..350687)
FT                   /locus_tag="VSAL_I0304"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        350844..351638
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT                   /old_locus_tag="TVS0129"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   FkpA precursor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77990"
FT                   /db_xref="GOA:B6EPR0"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPR0"
FT                   /experiment="FkpA probably acts in the folding of
FT                   extracytoplasmic proteins. The expressed protein is found
FT                   to be associated with the outer membrane of Aliivibrio
FT                   salmonicida"
FT                   /protein_id="CAQ77990.1"
FT                   /translation="MKSIFKVSLLAATVAFVVGCQKEEAPKTEATTLPAKIEASAEGAT
FT                   ASTFASEDEKAGYAIGASLAKYLNSNLEKQTELGLDLKKADVLAGVTDVFNGKERLTDE
FT                   QIQGALQALDQRVAEIGKKKAAAESEANIKAGADYRAKFAKEDGVIKTESGLLYKVLTP
FT                   ADGPKPKDTDTVVVHYTGTLIDGTKFDSSYDRKQPATFPLNAVIPGWTEGVQLMNVGSK
FT                   YKFVVPAELGYGAQGNQAIPANSTLVFDVELLEIKDAAKPAK"
FT   sig_peptide     350844..350909
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT   misc_feature    350871..350903
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    350937..351323
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT                   /note="HMMPfam hit to PF01346, Domain amino terminal to
FT                   FKBP-type peptidyl-, score 7.6e-28"
FT                   /inference="protein motif:HMMPfam:PF01346"
FT   misc_feature    351333..351605
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomeras, score 1e-47"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    351372..351419
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:ProSite:PS00453"
FT   misc_feature    351459..351545
FT                   /gene="fkpA"
FT                   /locus_tag="VSAL_I0305"
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00454"
FT   CDS_pept        351827..352540
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0306"
FT                   /old_locus_tag="TVS0130"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77991"
FT                   /db_xref="GOA:B6EPR1"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPR1"
FT                   /protein_id="CAQ77991.1"
FT                   /translation="MVNMNIETAIEERLSEMKPFTEFDHHILQSYEAVVDGIASLIGNY
FT                   CEIVLHSLEDINKSAVKIANGENTGRKVGSPITDLALQMLKDIQRSKRNFSRSYFTRAK
FT                   GGVLMKSITIAIRNGDQRIIGLLCININLDAPFSQVLQSFMPSEEANEAASSVNFASDV
FT                   DELVDQTVKRTIDEINADKEVGNNAKNKQIVIDLYDKGIFDIKDAINRVADQLNISKHT
FT                   VYLYIRQRKIEDGEK"
FT   misc_feature    351905..352255
FT                   /locus_tag="VSAL_I0306"
FT                   /note="HMMPfam hit to PF08348, YheO-like protein, score
FT                   6.3e-62"
FT                   /inference="protein motif:HMMPfam:PF08348"
FT   misc_feature    352445..352510
FT                   /locus_tag="VSAL_I0306"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1246.000, SD 3.43 at aa 207-228, sequence
FT                   DAINRVADQLNISKHTVYLYIR"
FT   CDS_pept        352537..352929
FT                   /transl_table=11
FT                   /gene="dsrE"
FT                   /locus_tag="VSAL_I0307"
FT                   /old_locus_tag="TVS0131"
FT                   /product="intracellular sulfur oxidation protein DsrE"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77992"
FT                   /db_xref="GOA:B6EPR2"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPR2"
FT                   /protein_id="CAQ77992.1"
FT                   /translation="MSLTYGIVVNGSAYGTQASRQAYQFSKALIEQGHTLKKVFFYQDG
FT                   VLNASALILPANDEVNITQAWQQLASEHSIELETCVAAALRRGVIGEEEANQHKLSQHN
FT                   LASGFQQAGLGGLATALLRYDRVIQF"
FT   misc_feature    352543..352926
FT                   /gene="dsrE"
FT                   /locus_tag="VSAL_I0307"
FT                   /note="HMMPfam hit to PF02635, DsrE/DsrF-like family,score
FT                   2.9e-46"
FT                   /inference="protein motif:HMMPfam:PF02635"
FT   CDS_pept        352959..353315
FT                   /transl_table=11
FT                   /gene="dsrF"
FT                   /locus_tag="VSAL_I0308"
FT                   /old_locus_tag="TVS0132"
FT                   /product="intracellular sulfur oxidation protein DsrF"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77993"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPR3"
FT                   /protein_id="CAQ77993.1"
FT                   /translation="MNRLGFVFQSSPHSTTQGREGLDAILAASAYSDDIRIFFVGDGIL
FT                   QLLKSQKPEMILSRDYIAGFKMLELYDLDDIFVDKAALANRGITESHLLIDAHLISIEY
FT                   LNEKLSQCDQVMVF"
FT   misc_feature    352962..353312
FT                   /gene="dsrF"
FT                   /locus_tag="VSAL_I0308"
FT                   /note="HMMPfam hit to PF02635, DsrE/DsrF-like family,score
FT                   1.6e-31"
FT                   /inference="protein motif:HMMPfam:PF02635"
FT   CDS_pept        353325..353612
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0309"
FT                   /old_locus_tag="TVS0133"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77994"
FT                   /db_xref="GOA:B6EPR4"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPR4"
FT                   /protein_id="CAQ77994.1"
FT                   /translation="MLHILTKVENLQTVRMNELPINKESDRVLLTKDCVYAGINDHKDH
FT                   SVILSFKQCYILQEDAEARGVLSLINNKIQLVNYSSFVVLTQEHSPTVTW"
FT   CDS_pept        353778..354152
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="VSAL_I0310"
FT                   /old_locus_tag="TVS0135"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77995"
FT                   /db_xref="GOA:B6EPR5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPR5"
FT                   /protein_id="CAQ77995.1"
FT                   /translation="MATINQLVRQPRAKQVVKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVNDRKKGRSKYGVKRPKS"
FT   misc_feature    353781..354146
FT                   /gene="rpsL"
FT                   /locus_tag="VSAL_I0310"
FT                   /note="HMMPfam hit to PF00164, Ribosomal protein S12,score
FT                   1.3e-74"
FT                   /inference="protein motif:HMMPfam:PF00164"
FT   misc_feature    353904..353927
FT                   /gene="rpsL"
FT                   /locus_tag="VSAL_I0310"
FT                   /note="PS00055 Ribosomal protein S12 signature."
FT                   /inference="protein motif:ProSite:PS00055"
FT   CDS_pept        354263..354733
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="VSAL_I0311"
FT                   /old_locus_tag="TVS0136"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77996"
FT                   /db_xref="GOA:B6EPR6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPR6"
FT                   /protein_id="CAQ77996.1"
FT                   /translation="MPRRRVIGQRKILPDPKFKSELLAKFVNIVMVDGKKSTAEKIVYG
FT                   ALELMAEKSGKDHLAVFEEALENIRPSVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMAQRLANEMLDASENKGTSVKKREDVHRMADANKAFAHYRW"
FT   misc_feature    354266..354709
FT                   /gene="rpsG"
FT                   /locus_tag="VSAL_I0311"
FT                   /note="HMMPfam hit to PF00177, Ribosomal protein
FT                   S7p/S5e,score 7.5e-85"
FT                   /inference="protein motif:HMMPfam:PF00177"
FT   misc_feature    354320..354400
FT                   /gene="rpsG"
FT                   /locus_tag="VSAL_I0311"
FT                   /note="PS00052 Ribosomal protein S7 signature."
FT                   /inference="protein motif:ProSite:PS00052"
FT   CDS_pept        354867..356954
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="VSAL_I0312"
FT                   /old_locus_tag="TVS0138"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77997"
FT                   /db_xref="GOA:B6EPR7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPR7"
FT                   /protein_id="CAQ77997.1"
FT                   /translation="MARNTPIERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWRGMDAQFQDHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCASSGVEPQSETVWRQADKYGVPRIVFVNKMDRAGADFLRVIEQIKNRLG
FT                   ANPVPIQLNIGAEEDFGGVIDLIKMKTINWNEADQGMTFSYEEIPADMQELADEWRLNL
FT                   VEAAAEASEELMDKYLEGEELTEAEIKNALRTRTINNEIVLATCGSAFKNKGVQAVLDA
FT                   VVEFLPAPIDVPAIKGLDENDNEVERHADDNEPFAALAFKIATDPFVGTLTFIRVYSGV
FT                   VNSGDGVYNSVKQKRERFGRIVQLHANKREEVKEIRAGDIAAAIGLKDVTTGDTLCDQN
FT                   AKVVLERMEFPEPVIQIAVEPRTQADQEKMGVALGKLAAEDPSFRVETDKESGQTLISG
FT                   MGELHLDIIVDRMKREFSVECNVGKPQVAYRETIRGKAEVEGKFIRQSGGRGQYGHVWL
FT                   RIEPAEHDAGFVFVDETVGGSVPREYISSVAKGIEEQMHNGVLAGYPVLDVKATLFDGS
FT                   YHDVDSNEMAFRIAGSMAFKNGALEAQPVILEPTMKVEITTPEDWMGDVVGDLNRRRGM
FT                   IEGMDDGVAGLKIIRAQVPLSEMFGYATSLRSATQGRASYSMEFSEYGEVPKNVADRIM
FT                   G"
FT   misc_feature    order(354888..355041,355047..355736)
FT                   /gene="fusA"
FT                   /locus_tag="VSAL_I0312"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 2e-111"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    354915..354938
FT                   /gene="fusA"
FT                   /locus_tag="VSAL_I0312"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    355851..356054
FT                   /gene="fusA"
FT                   /locus_tag="VSAL_I0312"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 9.6e-21"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    356316..356675
FT                   /gene="fusA"
FT                   /locus_tag="VSAL_I0312"
FT                   /note="HMMPfam hit to PF03764, Elongation factor G, domain
FT                   IV, score 5.5e-70"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    356679..356945
FT                   /gene="fusA"
FT                   /locus_tag="VSAL_I0312"
FT                   /note="HMMPfam hit to PF00679, Elongation factor G
FT                   C-terminus, score 3.2e-49"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   CDS_pept        357073..358257
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="VSAL_I0313"
FT                   /old_locus_tag="TVSa0184"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ77998"
FT                   /db_xref="GOA:B6ENS0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B6ENS0"
FT                   /protein_id="CAQ77998.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKIYGGVAK
FT                   DFASIDNAPEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVAATDGPMPQTREHILLGRQVGIPFIVVFMNKCDMVDDEELLELVEMEVRELLSEYDY
FT                   PGDDLPVIQGSALGALNGEKQWEDKIIELAEALDTYIPLPERAVDMPFLLPIEDVFSIQ
FT                   GRGTVVTGRIERGILRVGDEVEIIGIKETTVSTCTGVEMFRKLLDEGRAGENVGALLRG
FT                   TKRDDVERGQVLAAKGSINPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   DITLPEGVEMVMPGDNVQMTVELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFA"
FT   misc_feature    357100..357684
FT                   /gene="tuf"
FT                   /locus_tag="VSAL_I0313"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 1.3e-97"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    357127..357150
FT                   /gene="tuf"
FT                   /locus_tag="VSAL_I0313"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    357223..357270
FT                   /gene="tuf"
FT                   /locus_tag="VSAL_I0313"
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:ProSite:PS00301"
FT   misc_feature    357745..357954
FT                   /gene="tuf"
FT                   /locus_tag="VSAL_I0313"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 2.4e-24"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    357967..358251
FT                   /gene="tuf"
FT                   /locus_tag="VSAL_I0313"
FT                   /note="HMMPfam hit to PF03143, Elongation factor Tu
FT                   C-terminal domain, score 2.5e-60"
FT                   /inference="protein motif:HMMPfam:PF03143"
FT   repeat_region   complement(order(358438..359302,362595..363168))
FT                   /note="VSa9"
FT   CDS_pept        complement(join(358604..359302,362595..363089))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0314"
FT                   /old_locus_tag="TVSa0185"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Pasteurella piscicida Putative
FT                   transposase UniProt:Q2VL27 (402 aa) fasta scores:
FT                   E()=9.9e-89, 49.6% id in 387 aa. CDS is disrupted by the
FT                   insertion of two IS elements after codon 165"
FT                   /db_xref="PSEUDO:CAQ77999.1"
FT                   /inference="similar to sequence:UniProt:Q2VL27"
FT   misc_feature    complement(358814..359302)
FT                   /locus_tag="VSAL_I0314"
FT                   /note="HMMPfam hit to PF04986, Putative transposase, score
FT                   3e-24"
FT                   /inference="protein motif:HMMPfam:PF04986"
FT   repeat_region   order(359306..360102,361108..362589)
FT                   /note="VSa2"
FT   repeat_region   359306..359329
FT                   /note="IR of VSa2"
FT   CDS_pept        359387..359698
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0315"
FT                   /old_locus_tag="TVS4514"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78000"
FT                   /db_xref="UniProtKB/TrEMBL:B6EKJ3"
FT                   /protein_id="CAQ78000.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPATEPHWIGLLLKGYQS"
FT   CDS_pept        359695..360042
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0316"
FT                   /old_locus_tag="TVS4515"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78001"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ78001.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   misc_feature    359710..360036
FT                   /locus_tag="VSAL_I0316"
FT                   /note="HMMPfam hit to PF05717, IS66 Orf2 like protein,score
FT                   5.1e-32"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   repeat_region   complement(360103..361107)
FT                   /note="VSa6"
FT   repeat_region   complement(360103..360121)
FT                   /note="IR of VSa6"
FT   CDS_pept        complement(360130..361011)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0317"
FT                   /old_locus_tag="TVS4516"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78002"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B6EH02"
FT                   /protein_id="CAQ78002.1"
FT                   /translation="MNKLVDIFCDVDDFCYQFLSQWEKYLVEASERKRKRQSVMSTSEC
FT                   MTIVIAFHQSNHRDFKNFYIGLVHQYWKGYFPNLLSYTRFVSKMPSLIAPMCAYFQSIK
FT                   GKPTGIAFVDSTSLKVCHNIRIPRHKVFDGVAKRGKGTMGWFFGFKLHLLINHLGEIIS
FT                   LKITAGNVNDRTPVPDLCKELSGKLYADKGYIGKKLSESLKNSDVDLVTTSRKNMKAKE
FT                   ISAFDKAMLSKRYIIETINDQLKNISQIEHSRHRSVTGFMLNVISGVVAYCLKKQKPRI
FT                   KLSECEFELILA"
FT   misc_feature    complement(360190..360684)
FT                   /locus_tag="VSAL_I0317"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   9.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   complement(361089..361107)
FT                   /note="IR of VSa6"
FT   CDS_pept        join(361121..361339,361338..362573)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0318"
FT                   /old_locus_tag="TVSa0189"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella sp. (strain W3-18-1)
FT                   transposase is66. UniProt:A1RLT8 (EMBL:CP000503) (500 aa)
FT                   fasta scores: E()=1.8e-109, 55.781% id in 493 aa. CDS
FT                   contains a frameshift after codon 73"
FT                   /db_xref="PSEUDO:CAQ78003.1"
FT                   /inference="similar to sequence:UniProt:A1RLT8"
FT   misc_feature    361410..362009
FT                   /locus_tag="VSAL_I0318"
FT                   /note="HMMPfam hit to PF03050, Transposase IS66
FT                   family,score 8.3e-57"
FT                   /inference="protein motif:HMMPfam:PF03050"
FT   repeat_region   362566..362589
FT                   /note="IR of VSa2"
FT   CDS_pept        363557..363868
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="VSAL_I0319"
FT                   /old_locus_tag="TVS3217"
FT                   /product="30S ribosomal subunit protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78004"
FT                   /db_xref="GOA:B6EPS4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPS4"
FT                   /protein_id="CAQ78004.1"
FT                   /translation="MQNQRIRIRLKAFDYKLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLTSPHVNKDARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG"
FT   misc_feature    363569..363856
FT                   /gene="rpsJ"
FT                   /locus_tag="VSAL_I0319"
FT                   /note="HMMPfam hit to PF00338, Ribosomal protein S10p/S20e,
FT                   score 2e-60"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    363641..363688
FT                   /gene="rpsJ"
FT                   /locus_tag="VSAL_I0319"
FT                   /note="PS00361 Ribosomal protein S10 signature."
FT                   /inference="protein motif:ProSite:PS00361"
FT   CDS_pept        363881..364510
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="VSAL_I0320"
FT                   /old_locus_tag="TVS3218"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78005"
FT                   /db_xref="GOA:B6EPS5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPS5"
FT                   /protein_id="CAQ78005.1"
FT                   /translation="MIGLVGRKVGMTRIFTEEGVSIPVTVVEVEVNRVSQVKTVETDGY
FT                   NAIQVTCGSKKANRVSKPEAGHFAKAGVEAGRGLWEFRLENGEEFTVGAELSVEIFNEI
FT                   KKVDVTGTSKGKGFQGAIKRWNFATQDMTHGNSLSHRAPGSIGQCQTPGRVFKGKKMAG
FT                   HMGAERCTTQNLEIVRVDAERNLLLIKGAVPGSTGGNVIVKPAVKA"
FT   misc_feature    363902..364492
FT                   /gene="rplC"
FT                   /locus_tag="VSAL_I0320"
FT                   /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
FT                   5.2e-98"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    364181..364252
FT                   /gene="rplC"
FT                   /locus_tag="VSAL_I0320"
FT                   /note="PS00474 Ribosomal protein L3 signature."
FT                   /inference="protein motif:ProSite:PS00474"
FT   CDS_pept        364528..365130
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="VSAL_I0321"
FT                   /old_locus_tag="TVS3219"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78006"
FT                   /db_xref="GOA:B6EPS6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPS6"
FT                   /protein_id="CAQ78006.1"
FT                   /translation="MELMVKGAAALTVSETTFGREFNEALVHQVVVAYAAGARQGTRAQ
FT                   KTRSEVSGGGAKPWRQKGTGRARAGTIRSPIWRSGGVTFAAKPQDHSLKVNKKMYRGAL
FT                   KSILSELVRQDRLIVVEDFSIEAPKTKELVAKLKELELNDVLIVTGEVDENLFLAARNL
FT                   YKVDARDVAGIDPVSLVAFNKVLMTAAAVKQVEEMLA"
FT   misc_feature    364555..365121
FT                   /gene="rplD"
FT                   /locus_tag="VSAL_I0321"
FT                   /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1
FT                   family, score 2.6e-55"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS_pept        365127..365429
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="VSAL_I0322"
FT                   /old_locus_tag="TVS3220"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78007"
FT                   /db_xref="GOA:B6EPS7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPS7"
FT                   /protein_id="CAQ78007.1"
FT                   /translation="MISEERLLKVLRGPHISEKATMTAEGNNTIVFKVVINATKKEIKA
FT                   AVEKLFEVEVKSVNTLITKGKTKRQGARQGRRSDVKKAYVILKEGQDLDFVGGAE"
FT   misc_feature    365148..365423
FT                   /gene="rplW"
FT                   /locus_tag="VSAL_I0322"
FT                   /note="HMMPfam hit to PF00276, Ribosomal protein L23,score
FT                   9.3e-33"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   CDS_pept        365445..366269
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="VSAL_I0323"
FT                   /old_locus_tag="TVS3221"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78008"
FT                   /db_xref="GOA:B6EPS8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPS8"
FT                   /protein_id="CAQ78008.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKIVNADLHKGKPYAPLLEKNSKSGGRNN
FT                   NGRITVRHVGGGHKQHYRLIDFKRTKDGIPAIVERLEYDPNRSANIALVLFADGERRYI
FT                   IAPKGLKAGDTVQSGVDAPIKAGNCLPLRNIPVGSTVHCVELKPGKGAQVARSAGAYAQ
FT                   IIARDGAYVTLRLRSGEMRKVLSEGRATIGEVGNSEHMLRELGKAGATRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGMPTKGFKTRKNKSTDKYIVRRRNK"
FT   misc_feature    365568..365798
FT                   /gene="rplB"
FT                   /locus_tag="VSAL_I0323"
FT                   /note="HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA
FT                   binding dom, score 1.1e-45"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    365814..366200
FT                   /gene="rplB"
FT                   /locus_tag="VSAL_I0323"
FT                   /note="HMMPfam hit to PF03947, Ribosomal Proteins
FT                   L2,C-terminal doma, score 1.4e-87"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    366096..366131
FT                   /gene="rplB"
FT                   /locus_tag="VSAL_I0323"
FT                   /note="PS00467 Ribosomal protein L2 signature."
FT                   /inference="protein motif:ProSite:PS00467"
FT   CDS_pept        366289..366567
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="VSAL_I0324"
FT                   /old_locus_tag="TVS3222"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78009"
FT                   /db_xref="GOA:B6EPS9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPS9"
FT                   /protein_id="CAQ78009.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPTMI
FT                   NLTIAVHNGRQHVPVFVTEDMIGHKLGEFAPTRTYRGHAADKKAKKR"
FT   misc_feature    366295..366537
FT                   /gene="rpsS"
FT                   /locus_tag="VSAL_I0324"
FT                   /note="HMMPfam hit to PF00203, Ribosomal protein S19,score
FT                   9.3e-52"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    366445..366519
FT                   /gene="rpsS"
FT                   /locus_tag="VSAL_I0324"
FT                   /note="PS00323 Ribosomal protein S19 signature."
FT                   /inference="protein motif:ProSite:PS00323"
FT   CDS_pept        366578..366910
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="VSAL_I0325"
FT                   /old_locus_tag="TVS3223"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78010"
FT                   /db_xref="GOA:B6EPT0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT0"
FT                   /protein_id="CAQ78010.1"
FT                   /translation="MEAIAKHRFASISPQKARLVADQIRGKSVDQALEILTFSNKKAAV
FT                   IIKKVVESAIANAEHNEGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSHIT
FT                   IVVADR"
FT   misc_feature    366590..366904
FT                   /gene="rplV"
FT                   /locus_tag="VSAL_I0325"
FT                   /note="HMMPfam hit to PF00237, Ribosomal protein L22p/L17e,
FT                   score 5.1e-56"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    366638..366661
FT                   /gene="rplV"
FT                   /locus_tag="VSAL_I0325"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    366824..366898
FT                   /gene="rplV"
FT                   /locus_tag="VSAL_I0325"
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:ProSite:PS00464"
FT   CDS_pept        366930..367628
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="VSAL_I0326"
FT                   /old_locus_tag="TVS3224"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78011"
FT                   /db_xref="GOA:B6EPT1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT1"
FT                   /protein_id="CAQ78011.1"
FT                   /translation="MGQKVHPNGIRLGIVKPWNATWFASSQEFADNLDGDFKVRQYLTK
FT                   ELKKASLSRIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRAGVAKIAGVPAQINIA
FT                   EVRKPELDAHLVADSIASQLERRVMFRRAMKRAVQNAMRLGAQGIKVQVGGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYATASAHTQYGVIGVKVWIFKGEVLGGMPAANAVEPKAD
FT                   KPKKQRRSRK"
FT   misc_feature    366930..367115
FT                   /gene="rpsC"
FT                   /locus_tag="VSAL_I0326"
FT                   /note="HMMPfam hit to PF00417, Ribosomal protein
FT                   S3,N-terminal domai, score 3.2e-27"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    367116..367280
FT                   /gene="rpsC"
FT                   /locus_tag="VSAL_I0326"
FT                   /note="HMMPfam hit to PF07650, KH domain, score 2.1e-19"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    367284..367535
FT                   /gene="rpsC"
FT                   /locus_tag="VSAL_I0326"
FT                   /note="HMMPfam hit to PF00189, Ribosomal protein
FT                   S3,C-terminal domai, score 2.4e-52"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    367416..367520
FT                   /gene="rpsC"
FT                   /locus_tag="VSAL_I0326"
FT                   /note="PS00548 Ribosomal protein S3 signature."
FT                   /inference="protein motif:ProSite:PS00548"
FT   CDS_pept        367640..368050
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="VSAL_I0327"
FT                   /old_locus_tag="TVS3225"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78012"
FT                   /db_xref="GOA:B6EPT2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT2"
FT                   /protein_id="CAQ78012.1"
FT                   /translation="MLQPKRTKFRKVMTGRNRGLAKGTEVSFGEFGLKAVGRGRLTARQ
FT                   IEAARRAMTRHVKRQGQIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVAQIQPGKVMYE
FT                   MNGVPEELAREAFRLAARKLPIKTTFVTKQVM"
FT   misc_feature    367640..368032
FT                   /gene="rplP"
FT                   /locus_tag="VSAL_I0327"
FT                   /note="HMMPfam hit to PF00252, Ribosomal protein L16,score
FT                   5.1e-85"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    367811..367846
FT                   /gene="rplP"
FT                   /locus_tag="VSAL_I0327"
FT                   /note="PS00586 Ribosomal protein L16 signature 1."
FT                   /inference="protein motif:ProSite:PS00586"
FT   CDS_pept        368050..368241
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="VSAL_I0328"
FT                   /old_locus_tag="TVS3225a"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78013"
FT                   /db_xref="GOA:B6EPT3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT3"
FT                   /protein_id="CAQ78013.1"
FT                   /translation="MKAQDLREKNVEELNEELLNLLREQFNLRMQAATGQLQQTHTLKA
FT                   VRRDIARVKTLLNEKAGA"
FT   misc_feature    368056..368229
FT                   /gene="rpmC"
FT                   /locus_tag="VSAL_I0328"
FT                   /note="HMMPfam hit to PF00831, Ribosomal L29 protein,score
FT                   8.4e-29"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   CDS_pept        368241..368495
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="VSAL_I0329"
FT                   /old_locus_tag="TVS3225b"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78014"
FT                   /db_xref="GOA:B6EPT4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT4"
FT                   /protein_id="CAQ78014.1"
FT                   /translation="MSEKIRTMQGRVISDKMDKSIVVAIERMVKHPIYGKYIKRTTKLH
FT                   AHDENNECGQGDLVVIRECRPLSKTKSWTLVNIVEKAKA"
FT   misc_feature    368268..368474
FT                   /gene="rpsQ"
FT                   /locus_tag="VSAL_I0329"
FT                   /note="HMMPfam hit to PF00366, Ribosomal protein S17,score
FT                   1.7e-39"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   CDS_pept        368658..369029
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="VSAL_I0330"
FT                   /old_locus_tag="TVS3225c"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78015"
FT                   /db_xref="GOA:B6EPT5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT5"
FT                   /protein_id="CAQ78015.1"
FT                   /translation="MIQMQSTLDAADNSGARKVMCIKVLGGSHRRYAHIGDVIKVTVKE
FT                   AIPRGKVKKGDVLKAVVVRTRKGVRRPDGSIIRFDRNACVLLNDTTEQPVGTRIFGPVT
FT                   RELRNAKFMKIVSLAPEVL"
FT   misc_feature    368658..369026
FT                   /gene="rplN"
FT                   /locus_tag="VSAL_I0330"
FT                   /note="HMMPfam hit to PF00238, Ribosomal protein L14p/L23e,
FT                   score 2.1e-74"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   CDS_pept        369040..369357
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="VSAL_I0331"
FT                   /old_locus_tag="TVS3225d"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78016"
FT                   /db_xref="GOA:B6EPT6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT6"
FT                   /protein_id="CAQ78016.1"
FT                   /translation="MAAKIRRNDEVIVLVGKDKGKKGKVTKVLETGKVIVEGINLVKKH
FT                   QKPVPALGQQGGIVEKEAAIDASNIAIFNDATGKADRIGFRFEEGKKVRFFKSNGETIS
FT                   N"
FT   misc_feature    369052..369150
FT                   /gene="rplX"
FT                   /locus_tag="VSAL_I0331"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 1.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   CDS_pept        369385..369924
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="VSAL_I0332"
FT                   /old_locus_tag="TVS0142"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78017"
FT                   /db_xref="GOA:B6EPT7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT7"
FT                   /protein_id="CAQ78017.1"
FT                   /translation="MAKLHDYYKSSVVAELTKEFSYSSVMQVPRVEKITLNMGVGEAIN
FT                   DKKLLENAAADMAIISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLV
FT                   SIALPRVRDFRGVSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTSANTD
FT                   AEGRALLAAFNFPFRK"
FT   misc_feature    369454..369624
FT                   /gene="rplE"
FT                   /locus_tag="VSAL_I0332"
FT                   /note="HMMPfam hit to PF00281, Ribosomal protein L5, score
FT                   2e-33"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    369634..369918
FT                   /gene="rplE"
FT                   /locus_tag="VSAL_I0332"
FT                   /note="HMMPfam hit to PF00673, ribosomal L5P family
FT                   C-terminus, score 3e-59"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS_pept        369942..370247
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="VSAL_I0333"
FT                   /old_locus_tag="TVS0143"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78018"
FT                   /db_xref="GOA:B6EPT8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT8"
FT                   /protein_id="CAQ78018.1"
FT                   /translation="MAKQSMKAREAKRAKLVTKFAEKRAALKVLISDVNASEEDRWNAV
FT                   LKLQSLPRDSSASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW"
FT   misc_feature    370077..370241
FT                   /gene="rpsN"
FT                   /locus_tag="VSAL_I0333"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 4.9e-23"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   misc_feature    370128..370196
FT                   /gene="rpsN"
FT                   /locus_tag="VSAL_I0333"
FT                   /note="PS00527 Ribosomal protein S14 signature."
FT                   /inference="protein motif:ProSite:PS00527"
FT   CDS_pept        370277..370669
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="VSAL_I0334"
FT                   /old_locus_tag="TVS0144"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78019"
FT                   /db_xref="GOA:B6EPT9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPT9"
FT                   /protein_id="CAQ78019.1"
FT                   /translation="MSMQDPISDMLTRVRNGQSANKVAVKMPSSKLKVAIAALLKAEGY
FT                   IADFAVEGDIKPELEITLKYFQAKQVIEQIQRVSRPGLRVYKKNDALPSVMGGLGIAVI
FT                   STSKGLMSDRAARKAGLGGEIICYVA"
FT   misc_feature    370289..370666
FT                   /gene="rpsH"
FT                   /locus_tag="VSAL_I0334"
FT                   /note="HMMPfam hit to PF00410, Ribosomal protein S8, score
FT                   2.6e-65"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    370574..370627
FT                   /gene="rpsH"
FT                   /locus_tag="VSAL_I0334"
FT                   /note="PS00053 Ribosomal protein S8 signature."
FT                   /inference="protein motif:ProSite:PS00053"
FT   CDS_pept        370682..371215
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="VSAL_I0335"
FT                   /old_locus_tag="TVS0145"
FT                   /product="50E ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78020"
FT                   /db_xref="GOA:B6EPU0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU0"
FT                   /protein_id="CAQ78020.1"
FT                   /translation="MSRVAKAPVVLPAGVEVKLNGQEITIKGGKGELTRVLNNAVVVSQ
FT                   EDNSIVFGPREGVANAWAQAGTARALVNNMVVGVNEGFTKKLTLKGVGYRATMKGNAVG
FT                   LTLGFSHPVEHALPEGIKAECPTQTEIIITGCDKQVVGQVAADIRSYRKPEPYKGKGVR
FT                   YADEIVRTKEAKKK"
FT   misc_feature    370712..370927
FT                   /gene="rplF"
FT                   /locus_tag="VSAL_I0335"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   1.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    370949..371176
FT                   /gene="rplF"
FT                   /locus_tag="VSAL_I0335"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   5.9e-31"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    371141..371167
FT                   /gene="rplF"
FT                   /locus_tag="VSAL_I0335"
FT                   /note="PS00525 Ribosomal protein L6 signature 1."
FT                   /inference="protein motif:ProSite:PS00525"
FT   CDS_pept        371225..371578
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="VSAL_I0336"
FT                   /old_locus_tag="TVS0146"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78021"
FT                   /db_xref="GOA:B6EPU1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU1"
FT                   /protein_id="CAQ78021.1"
FT                   /translation="MDKKASRIRRATRARRKIAELCATRLVVHRTPRHTYAQVIAPNGS
FT                   EVIAAASTVEKAIREQVGNTSNKAAAVAIGKLIAERAIEKGITNVAFDRSGFQYHGRVA
FT                   ALADSAREAGLKF"
FT   misc_feature    371225..371575
FT                   /gene="rplR"
FT                   /locus_tag="VSAL_I0336"
FT                   /note="HMMPfam hit to PF00861, Ribosomal L18p/L5e
FT                   family,score 1.5e-50"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS_pept        371593..372093
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="VSAL_I0337"
FT                   /old_locus_tag="TVS0147"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78022"
FT                   /db_xref="GOA:B6EPU2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU2"
FT                   /protein_id="CAQ78022.1"
FT                   /translation="MAKEQQQATDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   IGFGYGKAREVPAAIQKSMEKARRNMFTIALNEGTLHHAVKGRHTGSKVYMQPASEGTG
FT                   IIAGGAMRAVLEVVGVRNVLAKAYGSTNPINVVRATILGLTSVKSPEMVAAKRGLTVEA
FT                   ISE"
FT   misc_feature    371620..371820
FT                   /gene="rpsE"
FT                   /locus_tag="VSAL_I0337"
FT                   /note="HMMPfam hit to PF00333, Ribosomal protein
FT                   S5,N-terminal domai, score 7.1e-38"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    371674..371772
FT                   /gene="rpsE"
FT                   /locus_tag="VSAL_I0337"
FT                   /note="PS00585 Ribosomal protein S5 signature."
FT                   /inference="protein motif:ProSite:PS00585"
FT   misc_feature    371845..372066
FT                   /gene="rpsE"
FT                   /locus_tag="VSAL_I0337"
FT                   /note="HMMPfam hit to PF03719, Ribosomal protein
FT                   S5,C-terminal domai, score 9.7e-37"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS_pept        372099..372278
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="VSAL_I0338"
FT                   /old_locus_tag="TVS0148"
FT                   /product="50S ribosomal protein L30"
FT                   /note="No description. Coding potential quality =
FT                   -0.00667893331308523"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78023"
FT                   /db_xref="GOA:B6EPU3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU3"
FT                   /protein_id="CAQ78023.1"
FT                   /translation="MSKTIKVTQTKSSIGRLPKHVLCLKGLGLRRINHTVELEDTACVR
FT                   GMINKVHYMVKIEE"
FT   misc_feature    372105..372263
FT                   /gene="rpmD"
FT                   /locus_tag="VSAL_I0338"
FT                   /note="HMMPfam hit to PF00327, Ribosomal protein
FT                   L30p/L7e,score 1.5e-19"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   CDS_pept        372285..372719
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="VSAL_I0339"
FT                   /old_locus_tag="TVS0149"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78024"
FT                   /db_xref="GOA:B6EPU4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU4"
FT                   /protein_id="CAQ78024.1"
FT                   /translation="MRLNTLSPAAGSNPSKKRVGRGIGSGLGKTGGRGHKGQKSRSGGK
FT                   VRVGFEGGQMPLKQRLPKFGFTSRKSLVTAEVRLSELAKVEGNVIDLNSLKAANVITKN
FT                   IVFAKVVLSGEIATAVTVKGLRVTKGAKAAIEAAGGKIEE"
FT   misc_feature    372285..372587
FT                   /gene="rplO"
FT                   /locus_tag="VSAL_I0339"
FT                   /note="HMMPfam hit to PF01305, Ribosomal protein L15 amino
FT                   terminal re, score 6.7e-51"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    372609..372704
FT                   /gene="rplO"
FT                   /locus_tag="VSAL_I0339"
FT                   /note="HMMPfam hit to PF00256, Ribosomal protein L15,score
FT                   6.6e-09"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    372609..372701
FT                   /gene="rplO"
FT                   /locus_tag="VSAL_I0339"
FT                   /note="PS00475 Ribosomal protein L15 signature."
FT                   /inference="protein motif:ProSite:PS00475"
FT   CDS_pept        372740..374071
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="VSAL_I0340"
FT                   /old_locus_tag="TVS0150"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78025"
FT                   /db_xref="GOA:B6EPU5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPU5"
FT                   /protein_id="CAQ78025.1"
FT                   /translation="MAKKPGKEVNSAQSGLAELKSRLLFVIGALLVFRAGSFVPIPGID
FT                   AAVLADLFEQQQGTIIEMFNMFSGGALSRASILALGIMPYISASIVVQLLTVVHPPLAE
FT                   LKKEGESGRRKINQYTRYGTLVLATFQAIGISTGLPSMIPGLVSNPDMMFYLTATVSLI
FT                   TGTMFLMWLGEQITERGIGNGISLIIFTGIVAGLPPAIGETIQQARQGELHVLLLLLIA
FT                   VLSFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKINMAGVIPAIFASSI
FT                   ILFPGTLAQWFGGNGEGTFGWLTDVSMALSPGQPLYVMLYAAAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTTKYIDKVMTRLTLAGAMYITFICLIPEFMMIAWNVRF
FT                   YFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKANLKGYGR"
FT   misc_feature    order(372800..372868,372962..373030,373103..373171,
FT                   373199..373258,373277..373345,373373..373441,
FT                   373550..373618,373685..373753,373856..373924,
FT                   373934..373993)
FT                   /gene="secY"
FT                   /locus_tag="VSAL_I0340"
FT   misc_feature    372965..373996
FT                   /gene="secY"
FT                   /locus_tag="VSAL_I0340"
FT                   /note="HMMPfam hit to PF00344, eubacterial secY
FT                   protein,score 7.4e-196"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    372965..373024
FT                   /gene="secY"
FT                   /locus_tag="VSAL_I0340"
FT                   /note="PS00755 Protein secY signature 1."
FT                   /inference="protein motif:ProSite:PS00755"
FT   misc_feature    373250..373306
FT                   /gene="secY"
FT                   /locus_tag="VSAL_I0340"
FT                   /note="PS00756 Protein secY signature 2."
FT                   /inference="protein motif:ProSite:PS00756"
FT   misc_feature    373274..373330
FT                   /gene="secY"
FT                   /locus_tag="VSAL_I0340"
FT                   /note="PS00095 C-5 cytosine-specific DNA methylases
FT                   C-terminal signature."
FT                   /inference="protein motif:ProSite:PS00095"
FT   misc_RNA        374286..374394
FT                   /locus_tag="VSAL_I3105s"
FT                   /product="alpha operon ribosome binding site"
FT                   /note="Alpha operon ribosome binding site (RF00140)
FT                   predicted by Rfam, score 56,91"
FT   CDS_pept        374362..374718
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="VSAL_I0341"
FT                   /old_locus_tag="TVS0151"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78026"
FT                   /db_xref="GOA:B6EPU6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPU6"
FT                   /protein_id="CAQ78026.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGIGKTRSQAILAAVGIAEDVKI
FT                   SELNDEQIDILRDGVAKYTVEGDLRREVSMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   misc_feature    374368..374685
FT                   /gene="rpsM"
FT                   /locus_tag="VSAL_I0341"
FT                   /note="HMMPfam hit to PF00416, Ribosomal protein
FT                   S13/S18,score 7.5e-59"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    374389..374475
FT                   /gene="rpsM"
FT                   /locus_tag="VSAL_I0341"
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00061"
FT   misc_feature    374422..374445
FT                   /gene="rpsM"
FT                   /locus_tag="VSAL_I0341"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    374620..374661
FT                   /gene="rpsM"
FT                   /locus_tag="VSAL_I0341"
FT                   /note="PS00646 Ribosomal protein S13 signature."
FT                   /inference="protein motif:ProSite:PS00646"
FT   CDS_pept        374740..375129
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="VSAL_I0342"
FT                   /old_locus_tag="TVS0152"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78027"
FT                   /db_xref="GOA:B6EPU7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU7"
FT                   /protein_id="CAQ78027.1"
FT                   /translation="MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCGEMAKEYGVKNLEVMVKGPGPGRESTIRALNAAG
FT                   YRITNIVDATPIPHNGCRPPKKRRV"
FT   misc_feature    374794..375123
FT                   /gene="rpsK"
FT                   /locus_tag="VSAL_I0342"
FT                   /note="HMMPfam hit to PF00411, Ribosomal protein S11,score
FT                   1.3e-70"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   CDS_pept        375161..375781
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="VSAL_I0343"
FT                   /old_locus_tag="TVS0153"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78028"
FT                   /db_xref="GOA:B6EPU8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU8"
FT                   /protein_id="CAQ78028.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGVHGARR
FT                   GRLSEYGVQLREKQKVRRMYGVLEKQFRNYYKDAARIKGNTGENLLQLLEGRLDNVVYR
FT                   MGFGSTRAESRQLVSHKSILVNGKVVNVPSFKVSANDVVSIREKAKLQSRIKAALEVAE
FT                   QREKPTWIEVDAGKMEGTFKRLPERSDLSADINEHLIVELYSK"
FT   misc_feature    375164..375445
FT                   /gene="rpsD"
FT                   /locus_tag="VSAL_I0343"
FT                   /note="HMMPfam hit to PF00163, Ribosomal protein S4/S9
FT                   N-terminal domai, score 6.2e-36"
FT                   /inference="protein motif:HMMPfam:PF00163"
FT   misc_feature    375440..375514
FT                   /gene="rpsD"
FT                   /locus_tag="VSAL_I0343"
FT                   /note="PS00632 Ribosomal protein S4 signature."
FT                   /inference="protein motif:ProSite:PS00632"
FT   misc_feature    375446..375589
FT                   /gene="rpsD"
FT                   /locus_tag="VSAL_I0343"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 5e-20"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        375805..376794
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="VSAL_I0344"
FT                   /old_locus_tag="TVS0154"
FT                   /product="RNA polymerase alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78029"
FT                   /db_xref="GOA:B6EPU9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPU9"
FT                   /protein_id="CAQ78029.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSLTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIEGVLHEYSTKEGVQEDILEILLNLKGLAVKVEGKDEVIITLNK
FT                   SGAGPVVAGDITHDGDVEIANPEHVICHLTDDNAEISMRIKVERGRGYVPSTARIHTEE
FT                   DERPIGRLLVDATYSPVDKISYAVEAARVEQRTDLDKLVIDMETNGTLDPEEAIRRAAT
FT                   ILAEQLDAFVDLRDVRVPEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIAED"
FT   misc_feature    375877..376503
FT                   /gene="rpoA"
FT                   /locus_tag="VSAL_I0344"
FT                   /note="HMMPfam hit to PF01193, RNA polymerase Rpb3/Rpb11
FT                   dimerisation, score 8.2e-22"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    375979..376338
FT                   /gene="rpoA"
FT                   /locus_tag="VSAL_I0344"
FT                   /note="HMMPfam hit to PF01000, RNA polymerase Rpb3/RpoA
FT                   insert domain, score 8.4e-59"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    376528..376731
FT                   /gene="rpoA"
FT                   /locus_tag="VSAL_I0344"
FT                   /note="HMMPfam hit to PF03118, Bacterial RNA
FT                   polymerase,alpha chain C, score 9.8e-36"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS_pept        376831..377211
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="VSAL_I0345"
FT                   /old_locus_tag="TVS0155"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78030"
FT                   /db_xref="GOA:B6EPV0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPV0"
FT                   /protein_id="CAQ78030.1"
FT                   /translation="MRHRKSGRQLNRNSSHRKAMFSNMACSLVRHEIIKTTVPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNEVVAKLFTELGPRFAQRAGGYTRILKCGFRT
FT                   GDKAPMAYIELVDRPEVEAAAE"
FT   misc_feature    376888..377178
FT                   /gene="rplQ"
FT                   /locus_tag="VSAL_I0345"
FT                   /note="HMMPfam hit to PF01196, Ribosomal protein L17,score
FT                   1.4e-62"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    376930..376998
FT                   /gene="rplQ"
FT                   /locus_tag="VSAL_I0345"
FT                   /note="PS01167 Ribosomal protein L17 signature."
FT                   /inference="protein motif:ProSite:PS01167"
FT   CDS_pept        complement(377275..378285)
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="VSAL_I0346"
FT                   /old_locus_tag="TVS0156"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78031"
FT                   /db_xref="GOA:B6EPV3"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPV3"
FT                   /protein_id="CAQ78031.1"
FT                   /translation="MSEIRTLGEFIVAKQHDFPHASGELSSLIGSIKLAAKIVNREINK
FT                   AGLVDITGASGDENIQGEQQQKLDIYANDKFKAALENRDQVCGVASEEEDEAVAFNKEL
FT                   NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRISPIGSPATEEDFLQPGNKQVAAGY
FT                   IIYGSSTMLVYTTGNGVHGFTYDPSLGVFCLSHEDMKIPQDGNIYSINEGNYIRFPEGV
FT                   KQYLKYCQEIKPAENRPYTSRYIGSLVADFHRNLLKGGIYLYPSTQAYPNGKLRLLYEC
FT                   NPMAMLIEEAGGKATSGEERILDITPTELHQRVPFFVGSINMVDKVQNFLDEWQD"
FT   misc_feature    complement(377284..378273)
FT                   /gene="fbp"
FT                   /locus_tag="VSAL_I0346"
FT                   /note="HMMPfam hit to PF00316,Fructose-1-6-bisphosphatase,
FT                   score 5.6e-197"
FT                   /inference="protein motif:HMMPfam:PF00316"
FT   misc_feature    complement(377431..377469)
FT                   /gene="fbp"
FT                   /locus_tag="VSAL_I0346"
FT                   /note="PS00124 Fructose-1-6-bisphosphatase active site."
FT                   /inference="protein motif:ProSite:PS00124"
FT   CDS_pept        378499..379860
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="VSAL_I0347"
FT                   /old_locus_tag="TVS0157"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelat
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78032"
FT                   /db_xref="GOA:B6EPV4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPV4"
FT                   /protein_id="CAQ78032.1"
FT                   /translation="MHIHILGICGTFMGGAATLARQLGHKVTGSDANVYPPMSTLLESQ
FT                   GIEIIEGFDPSQLDPAPDLVVIGNAMSRGNPCVEYVLDKNLKYTSGPQWLQEFLLQDRW
FT                   VLAVAGTHGKTTTSSMLAWVLEECGYKPGFLVGGVLGNFGESARLGESMFFVVEADEYD
FT                   SAFFDKRSKFVHYRPRTLVLNNLEFDHADIFDDLAAIQRQFHHLIRTVPSSGRIFAPKQ
FT                   DKPLAEVLEQGCWSEIEFTGEEGEWKASKLKKDGSQFDVYFNDENVGQVNWNLVGDHNV
FT                   SNALMVVASARHVGVTPDLACEALGSFINTKRRLEFKGEVNGVTVYDDFAHHPTAIDLT
FT                   LSGLRNKVGDNKIIAVLEPRSSTMKLGVHKDTLAGSLHAADSVYLFQPDNISWSVDDVA
FT                   KQCVQPAYTHHEINAFVDMIVAEAKEGDQILVMSNGGFEGIHGKLLSALEQKAI"
FT   sig_peptide     378499..378558
FT                   /gene="mpl"
FT                   /locus_tag="VSAL_I0347"
FT   misc_feature    378502..378807
FT                   /gene="mpl"
FT                   /locus_tag="VSAL_I0347"
FT                   /note="HMMPfam hit to PF01225, Mur ligase family,catalytic
FT                   domain, score 2e-30"
FT                   /inference="protein motif:HMMPfam:PF01225"
FT   misc_feature    378814..379371
FT                   /gene="mpl"
FT                   /locus_tag="VSAL_I0347"
FT                   /note="HMMPfam hit to PF08245, Mur ligase middle
FT                   domain,score 1e-18"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    379429..379671
FT                   /gene="mpl"
FT                   /locus_tag="VSAL_I0347"
FT                   /note="HMMPfam hit to PF02875, Mur ligase family,glutamate
FT                   ligase doma, score 1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        379862..380491
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0348"
FT                   /old_locus_tag="TVS0158"
FT                   /product="probable aromatic acid decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78033"
FT                   /db_xref="GOA:B6EPV5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPV5"
FT                   /protein_id="CAQ78033.1"
FT                   /translation="MYKKQKTITLAMTGASGAPYGLRLLECLLAADYQVYFLISSAARV
FT                   VMVTEHNLKLPSGPDAMKAVLVEHLGCDADKLIVCGKEDWFSPVASGSAAPKQMVVCPC
FT                   SAGSVASIAHGISDNLIERAADVVLKERGQLIMVVRETPFSTLHLENMLKLSQMGTTIM
FT                   PAAPGFYHQPKSIEDLIDFMVARILDHLGVEQGLVPRWGYDQRQKS"
FT   sig_peptide     379862..379912
FT                   /locus_tag="VSAL_I0348"
FT   misc_feature    379877..380281
FT                   /locus_tag="VSAL_I0348"
FT                   /note="HMMPfam hit to PF02441, Flavoprotein, score 1.3e-22"
FT                   /inference="protein motif:HMMPfam:PF02441"
FT   misc_RNA        380531..380644
FT                   /locus_tag="VSAL_I3106s"
FT                   /product="TPP riboswitch (THI element)"
FT                   /note="TPP riboswitch (THI element) (RF00059) predicted by
FT                   Rfam, score 68.34"
FT   CDS_pept        380696..381712
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="VSAL_I0349"
FT                   /old_locus_tag="TVS0159"
FT                   /product="thiamine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78034"
FT                   /db_xref="GOA:B6EPV6"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPV6"
FT                   /protein_id="CAQ78034.1"
FT                   /translation="MKTRYISPLLKTLPIALAVSSLSSFSASASETLTVYTYDSFAADW
FT                   GPGPTIKAAFEKQCGCNLDLVALDDGVSILNRLRLEGSNSKADIVLGLDNNLMAEAKVT
FT                   GLLAEHNVNTDSVTIPNGWNDKTFVPYDYGYFAFVYNKEKVKNPPKSLKELVEQRDDLT
FT                   VIYQDPRTSTPGQGLLLWMKSVYGDDVAQAWKQLAKKTVTVTKGWSEAYSMFLEGESDL
FT                   VLSYTTSPAYHSLAEKDDRFAAANFSEGHYMQVEVAAKVKNTQHNALTDEFLAFILSKE
FT                   FQSAMPTGNWMYPVTNITLPKGFEDLKVPTKALSFSSAEIAKQRKLWIREWQHALIF"
FT   sig_peptide     380696..380782
FT                   /gene="tbpA"
FT                   /locus_tag="VSAL_I0349"
FT   misc_feature    380726..381547
FT                   /gene="tbpA"
FT                   /locus_tag="VSAL_I0349"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 0.00062"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   CDS_pept        381775..383397
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="VSAL_I0350"
FT                   /old_locus_tag="TVS0160"
FT                   /product="thiamine transport system permease protein ThiP"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78035"
FT                   /db_xref="GOA:B6EPV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPV1"
FT                   /protein_id="CAQ78035.1"
FT                   /translation="MKTNPLNSIPYIGYMIATVIVIFVGGAIGALLIASPSINVSLIWS
FT                   DPYYIHITKFSFYQATLSTLFSVVLAVPTAYALSRRSFLGRGLLLKLCATTLVLPVLVG
FT                   VFGLLAIYGNSGLLAKVFAFFGGKLPFSIYGLNGILLAHVFFNYPFATRLFLQSLDSIP
FT                   MEQHQLSAHLGLTGWNKFNVVAWPRVKQQFPHVAGLVFMLCFTSFATVMALGGGPKSTT
FT                   IELAIYQAIKFDFDLQAGAILALWQMLLCAGLSLCIQRFSTSIAVDSATLGKPIIYQDS
FT                   KRQKLWDKGWIILLTLFILPPLLMVVISGINSEVITVMTSSAFWSAFANSFIVAFCAAL
FT                   LAMVFGVLLLHTTRALRLNHQRFLADKLDLIGTMILVTPGLVISTGLFLLLRNITDVFS
FT                   MAIWIVILVNALMALPYVIKTLAQPLLHMAQQYQLLCASLGLNGFTRFRLIEWRGLRKP
FT                   MAHAFAFAFAIAFILSMGDLSAIALFGSQDFRTLPLYLFQLLGSYQMEAAAVVSLCLLL
FT                   LSVGVFSTVEWLFSSKNLQRENV"
FT   misc_feature    order(381808..381876,381943..382011,382048..382116,
FT                   382159..382227,382351..382419,382477..382545,
FT                   382642..382710,382753..382821,382882..382950,
FT                   382963..383028,383161..383229,383296..383364)
FT                   /gene="thiP"
FT                   /locus_tag="VSAL_I0350"
FT   misc_feature    381919..382575
FT                   /gene="thiP"
FT                   /locus_tag="VSAL_I0350"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 0.002"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    382744..383370
FT                   /gene="thiP"
FT                   /locus_tag="VSAL_I0350"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 0.0049"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        383397..384071
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="VSAL_I0351"
FT                   /old_locus_tag="TVS0161"
FT                   /product="thiamine transport ATP-binding protein ThiQ"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78036"
FT                   /db_xref="GOA:B6EPV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPV2"
FT                   /protein_id="CAQ78036.1"
FT                   /translation="MLTFSNVKYRYHSEVFEFDMSVKQGEVVAILGPSGAGKSTLLSLL
FT                   AGFINPELGDIVINGHSVLSLAPHQRPLSMLFQEHNLFAHLSIADNIGLGIKANLRLND
FT                   EEKERVIYAAQQVGVDELLLRLPEQLSGGQKQRVALARCLVHNKPVLLLDEPFSALDPM
FT                   LREEMIVLIRTLIKTQQLTVLMVTHSLQDAKELASGYAFVCHHKILSYGKMSEIMTQDT
FT                   PP"
FT   misc_feature    383469..384014
FT                   /gene="thiQ"
FT                   /locus_tag="VSAL_I0351"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-55"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    383490..383513
FT                   /gene="thiQ"
FT                   /locus_tag="VSAL_I0351"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    383784..383828
FT                   /gene="thiQ"
FT                   /locus_tag="VSAL_I0351"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   CDS_pept        384295..387204
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="VSAL_I0352"
FT                   /old_locus_tag="TVS0162"
FT                   /product="RNA polymerase-associated protein RapA
FT                   (ATP-dependent helicase hepA)"
FT                   /EC_number="3.6.1.-"
FT                   /note="Expression may be stress-induced"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78037"
FT                   /db_xref="GOA:B6EPV7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EPV7"
FT                   /protein_id="CAQ78037.1"
FT                   /translation="MSFALGQRWISDTESDLGLGTVVAVDDRTVSVLFAASEENRLYAK
FT                   HDAPITRVTFNKGDTIESHEGWSLEVEDVIEDGGLLTYIGTRTDTDEVNVVLRETLLSH
FT                   QIRFNKPQDKLFAGQIDRMDRFALRFRALQNQYEQHKNPMRGLCGMRAGLIPHQLFIAH
FT                   EVGRRYAPRVLLADEVGLGKTIEAGMIIHQQVLSGRAERVLIVVPETLQHQWLVEMMRR
FT                   FNLHFSIFDEERCIESYADSENPFDTAQLVLCSLDFIRRSKRRFEQVVEADWDLLVVDE
FT                   AHHLEWNQTKPSRAYQVIEAIAEETAGVLLLTATPEQLGHESHFARLRLLDPDRFYDYD
FT                   AFVEEERQYQPVADAVTALMSGDKLSNDAKNRIAELLSEQDVEPLFRIIESDGSEEQQS
FT                   QVRQELVDNLMDRHGTGRVLFRNTRAAIKGFPQRNLNLMPMALPPQYATSMRVATMMGG
FT                   RMSNEARAMKMLYPEEIFQEFEGDSATWWQFDPRVNWLLELLKENRNEKVLIIASRAST
FT                   ALQLEQALREREGIRGTVFHEGMSIIERDKAAAYFAQEEGGAQVLICSEIGSEGRNFQF
FT                   ANQLVMFDLPFNPDLLEQRIGRLDRIGQKRDIDIHVPYLQGTSQELLARWFDEGLNAFG
FT                   ETCPTGRAVYEKFSDTIIAILATGKSDGLEPLIEESAALNKELKAQLEQGRDRLLEVHS
FT                   NGGNKAKELAEKIAATDGDIHLVNFALNLFDTIGLNQDDKGENAIVVTPAENMLVSSYP
FT                   GLPYEGCTITFDRKTALSREDMNLISWEHPMIQGGIDLVLTEGVGATAVSLLKNKALPA
FT                   GTLLLELIYVVDAQAPKKSGIGRFLPKTPIRLMMDSKGNDLSAQVEFESFNRQLSPVNR
FT                   HMASKLVNSVQKEIHALIDTAEVSIEDRIEAVRVDANAEMKTALNGELDRLQALKAVNP
FT                   NIRDEELTQIETQMSELSAYIGKAQVQLDSLRLIVVSHN"
FT   misc_feature    384745..385248
FT                   /gene="rapA"
FT                   /locus_tag="VSAL_I0352"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 9.8e-06"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    384763..385662
FT                   /gene="rapA"
FT                   /locus_tag="VSAL_I0352"
FT                   /note="HMMPfam hit to PF00176, SNF2 family N-terminal
FT                   domain, score 9.2e-48"
FT                   /inference="protein motif:HMMPfam:PF00176"
FT   misc_feature    385867..386103
FT                   /gene="rapA"
FT                   /locus_tag="VSAL_I0352"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 8.7e-16"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    386254..386277
FT                   /gene="rapA"
FT                   /locus_tag="VSAL_I0352"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        387207..387941
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="VSAL_I0353"
FT                   /old_locus_tag="TVS0163"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78038"
FT                   /db_xref="GOA:B6EPV8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B6EPV8"
FT                   /protein_id="CAQ78038.1"
FT                   /translation="MAMLEYNPPMEPLDIVYQDEAILAVNKPAGLLSNPGRAPEHYDSV
FT                   WSRVVAEFPDAQLVHRLDMSTSGLMIFALYKEAERHIKKQFQYRLTHKVYYARVWGNVE
FT                   KVEGQIDLPLICDWPNRPRQKVCYEHGKSSQTGYEVIQVEEKTTLVRLLPITGRSHQLR
FT                   VHMMEEGHEIVGDEFYASKEALAFSDRLQLHSAELSFYHPETDKFISLFAPCAFYPEAQ
FT                   AGVLDAMDIAPVRPDYKTLPKQ"
FT   misc_feature    387267..387710
FT                   /gene="rluA"
FT                   /locus_tag="VSAL_I0353"
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase, score 1.9e-44"
FT                   /inference="protein motif:HMMPfam:PF00849"
FT   misc_feature    387381..387425
FT                   /gene="rluA"
FT                   /locus_tag="VSAL_I0353"
FT                   /note="PS01129 Rlu family of pseudouridine synthase
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01129"
FT   CDS_pept        complement(388002..388439)
FT                   /transl_table=11
FT                   /gene="uspF"
FT                   /locus_tag="VSAL_I0354"
FT                   /old_locus_tag="TVS0164"
FT                   /product="universal stress protein F"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78039"
FT                   /db_xref="GOA:B6EL34"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL34"
FT                   /protein_id="CAQ78039.1"
FT                   /translation="MYKQILVPVDLNDKGFADKAVEMAVWHAKHSNAELHLLNVLPGIH
FT                   MSMVSTYFPKGAAKQMKEDVSKQLNEFAAKFVDDDVVYRVHVAEGKPYVTILDYAERLG
FT                   ADLIVMPSHKRSKIDKVMLGSVASKVVENSPINVMVVKPQG"
FT   misc_feature    complement(388014..388439)
FT                   /gene="uspF"
FT                   /locus_tag="VSAL_I0354"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 2.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        complement(388495..391074)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0355"
FT                   /old_locus_tag="TVS0165"
FT                   /product="integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78040"
FT                   /db_xref="GOA:B6EL35"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL35"
FT                   /protein_id="CAQ78040.1"
FT                   /translation="MTQSSNTSQDVQEMVAQSDTGARSPEGLSGRILWFVPLCWSLFQL
FT                   WYASPLPFIFNFGILNDTEARSVHLAFAIFLAFTAYPALKNSPRDRIPVIDWILAFAGS
FT                   FSAAYIYIFYTQLAERSGAPTTPDIIASVVGMVLLLEATRRALGPPLMVVAAVFLLYTF
FT                   AGPHMPDVIAHKGASLNKAMSHLWLTTEGVFGVALGVSTSFVFLFVLFGAMLEKAGAGA
FT                   YFIKVAFSLLGHMKGGPAKAAVVASGLSGLVSGSSIANVVTTGTFTIPLMKRVGFSGEK
FT                   AGAVEVAASTNGQLTPPIMGAAAFLMVEYVGISYVEVIKAALLPALISYIALLYIVHLE
FT                   ACKAGMKGLPRRHTPTLVHSLLSFTGTILGLCVLSAAVYYGIGWTKDVFGDAATPIVTV
FT                   ALLLSYVGLTSISAKYQEHAMMAIDEELTEVPDPGPTIKSGLHFLLPIVVLVWCLTVER
FT                   FSPGLSAFWASVFMIFILLTQRPLIGFFTKEGTLVNQVKQGVDDLLESLVSGARNMIGI
FT                   GVATAAAGIVVGVVTLTGIGLVMTDFVEFISGGSIILMLLFTAVISLILGMGLPTTANY
FT                   IVVSTLMAPVIVTLGAAHGLIIPLIAVHLFVFYFGILADDTPPVGLAAFAAAAIAKSDP
FT                   IRTGIQGFTYDIRTAILPFMFVFNTQLLLMGIDSWWHLALTIISSIIAMLTFSAATQGW
FT                   WFTKTKWWEVVLLLLITFSLFRPGFWWDQIYPAKDYYQGIEIAQLAEELNVGQSLTLEV
FT                   SGENLEGNIVSKTVRLPFDDRAVTGEERVSSMGLMLSKVDNKMIVDMVEFGSPAEASGI
FT                   DFDWEITNVVLDAERPLKEWVFIPTLLLLFALGFNQRRRAKKENLAA"
FT   misc_feature    complement(order(388915..388974,389002..389070,
FT                   389083..389151,389194..389262,389281..389349,
FT                   389377..389445,389458..389526,389623..389691,
FT                   389842..389910,389938..390006,390064..390132,
FT                   390274..390342,390430..390498,390580..390639,
FT                   390736..390795,390823..390876,390895..390963))
FT                   /locus_tag="VSAL_I0355"
FT   misc_feature    complement(389059..390675)
FT                   /locus_tag="VSAL_I0355"
FT                   /note="HMMPfam hit to PF06808, DctM-like transporters,score
FT                   5.2e-77"
FT                   /inference="protein motif:HMMPfam:PF06808"
FT   CDS_pept        complement(391308..392282)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0356"
FT                   /old_locus_tag="TVS0166"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78041"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL36"
FT                   /protein_id="CAQ78041.1"
FT                   /translation="MALKNLIKVSAVAAAMLGAGMGTASAQEFITIGTGSVTGVYYPTG
FT                   GAICKLVNKDRKEHNVRCSVESTGGSIYNVNTIRSGELDFGIVQSDWQYHGYNGTSKFE
FT                   AQGPYKKLRAMFSLHTEPFNIIARSDSGINDVSDLAGKRVNIGNPGSGDRATMGVVMNA
FT                   MGWTNDSFKLASELKSSELSQALCDNKIDAFIYMVGHPNGSIKEATTSCDAKLVPATGP
FT                   KIDKIVADNPYYAYTTVPASMYRGTEGDVNSFGVAATVVTTSDVSDEVAYSVAKAVFEN
FT                   FNTFKRLHPAFATLKKEDMVKAGISIPLHPGAVKYYKEVGLLK"
FT   sig_peptide     complement(392205..392282)
FT                   /locus_tag="VSAL_I0356"
FT   repeat_region   392617..394027
FT                   /note="VSa1"
FT   repeat_region   392617..392635
FT                   /note="IR of VSa1"
FT   CDS_pept        join(392708..393397,393397..394014)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0357"
FT                   /old_locus_tag="TVS0167"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella oneidensis issod7,transposase.
FT                   UniProt:Q8CM19 (EMBL:AE014299) (440 aa) fasta scores:
FT                   E()=8.1e-88, 48.409% id in 440 aa. CDS contains a
FT                   frameshift after codon 230"
FT                   /db_xref="PSEUDO:CAQ78042.1"
FT                   /inference="similar to sequence:UniProt:Q8CM19"
FT   misc_feature    393086..393744
FT                   /locus_tag="VSAL_I0357"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   7.6e-28"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   394009..394027
FT                   /note="IR of VSa1"
FT   CDS_pept        complement(394047..394517)
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="VSAL_I0358"
FT                   /old_locus_tag="TVS0168"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78043"
FT                   /db_xref="GOA:B6EL38"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL38"
FT                   /protein_id="CAQ78043.1"
FT                   /translation="MRNNEKQERLVKEFKSILKAERFGSQGEIVDALRISGFDNINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPIELGVPTVSSSLRELVMDVDYNSALVVIHTGPGA
FT                   AQLIARLLDSLGKAEGILGVVAGDDTIFITPTRNIEIKTLFDSVCDLFEYSI"
FT   misc_feature    complement(394065..394277)
FT                   /gene="argR"
FT                   /locus_tag="VSAL_I0358"
FT                   /note="HMMPfam hit to PF02863, Arginine
FT                   repressor,C-terminal domain, score 4.3e-21"
FT                   /inference="protein motif:HMMPfam:PF02863"
FT   misc_feature    complement(394293..394505)
FT                   /gene="argR"
FT                   /locus_tag="VSAL_I0358"
FT                   /note="HMMPfam hit to PF01316, Arginine repressor, DNA
FT                   binding domai, score 6e-26"
FT                   /inference="protein motif:HMMPfam:PF01316"
FT   CDS_pept        394789..395724
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="VSAL_I0359"
FT                   /old_locus_tag="TVS0169"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78044"
FT                   /db_xref="GOA:B6EL39"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EL39"
FT                   /experiment="The expressed protein is found to be exported
FT                   (extracellular) by Aliivibrio salmonicida"
FT                   /protein_id="CAQ78044.1"
FT                   /translation="MKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAAD
FT                   LSHIPTPVSIKGYCGEDPTPALEGADVVLISAGVARKPGMDRSDLFNINAGIVKSLAEK
FT                   IAVTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDVIRSETFVAELKG
FT                   KNPGEICVPVIGGHSGVTILPLLSQVEGVEFTAEEVAALTPRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAACRFGLSLVKALSGEKGVVECAYVEGNGEHARFFAQPILLGKNGVEEIQHY
FT                   GELSTFEQDALDSMLDTLKADIKIGEEFIK"
FT   misc_feature    394789..395223
FT                   /gene="mdh"
FT                   /locus_tag="VSAL_I0359"
FT                   /note="HMMPfam hit to PF00056, lactate/malate
FT                   dehydrogenase, NAD binding do, score 3.3e-72"
FT                   /inference="protein motif:HMMPfam:PF00056"
FT   sig_peptide     394789..394839
FT                   /gene="mdh"
FT                   /locus_tag="VSAL_I0359"
FT   misc_feature    395224..395262
FT                   /gene="mdh"
FT                   /locus_tag="VSAL_I0359"
FT                   /note="PS00068 Malate dehydrogenase active site signature."
FT                   /inference="protein motif:ProSite:PS00068"
FT   misc_feature    395227..395718
FT                   /gene="mdh"
FT                   /locus_tag="VSAL_I0359"
FT                   /note="HMMPfam hit to PF02866, lactate/malate
FT                   dehydrogenase, alpha/beta C-t, score 9.8e-70"
FT                   /inference="protein motif:HMMPfam:PF02866"
FT   CDS_pept        complement(395817..396788)
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="VSAL_I0360"
FT                   /old_locus_tag="TVS0170"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78045"
FT                   /db_xref="GOA:B6EL40"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL40"
FT                   /protein_id="CAQ78045.1"
FT                   /translation="MDFKAIQALTADDMAIVNETILAQLNSDVALINQLGFYIVSGGGK
FT                   RLRPVLAILSAKALGYEGKDHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAEFG
FT                   NAASVLVGDFIYTRSFQMMTSLGSIKILSLMSESVNVIAEGEVLQLMNCNDPNTTEESY
FT                   MQVIYSKTARLFEAATQIGAILNNASQEIETALQNYGKYLGTAFQLIDDVMDYTSDGED
FT                   MGKNVGDDLAEGKPTLPLLHAMNNGNAEQAAMIRHAIEQGNGLDKLDPILACMKEVGSL
FT                   EYTKQKADEEADKAIAELSIIPESEYKEALKALAHLAVKRSK"
FT   misc_feature    complement(395934..396698)
FT                   /gene="ispB"
FT                   /locus_tag="VSAL_I0360"
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase,score
FT                   4.6e-106"
FT                   /inference="protein motif:HMMPfam:PF00348"
FT   misc_feature    complement(396144..396182)
FT                   /gene="ispB"
FT                   /locus_tag="VSAL_I0360"
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT                   /inference="protein motif:ProSite:PS00444"
FT   misc_feature    complement(396504..396548)
FT                   /gene="ispB"
FT                   /locus_tag="VSAL_I0360"
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT                   /inference="protein motif:ProSite:PS00723"
FT   CDS_pept        397065..397376
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="VSAL_I0361"
FT                   /old_locus_tag="TVS0171"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78046"
FT                   /db_xref="GOA:B6EL41"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EL41"
FT                   /protein_id="CAQ78046.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVDFDNVLMIANGE
FT                   EITVGAPLVAGGKVTAEVVQHGRGDKVKIVKFRRRKHSRKQQGHRQWFTEVRITGISA"
FT   misc_feature    397065..397352
FT                   /gene="rplU"
FT                   /locus_tag="VSAL_I0361"
FT                   /note="HMMPfam hit to PF00829, Ribosomal prokaryotic L21
FT                   protein, score 1.8e-59"
FT                   /inference="protein motif:HMMPfam:PF00829"
FT   misc_feature    397278..397346
FT                   /gene="rplU"
FT                   /locus_tag="VSAL_I0361"
FT                   /note="PS01169 Ribosomal protein L21 signature."
FT                   /inference="protein motif:ProSite:PS01169"
FT   CDS_pept        397394..397651
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="VSAL_I0362"
FT                   /old_locus_tag="TVS0172"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78047"
FT                   /db_xref="GOA:B6EL42"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EL42"
FT                   /protein_id="CAQ78047.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKF
FT                   HAGTNVGIGKDHTLFALSEGKVKFEVKGPKNRKFVSIDAE"
FT   misc_feature    397397..397642
FT                   /gene="rpmA"
FT                   /locus_tag="VSAL_I0362"
FT                   /note="HMMPfam hit to PF01016, Ribosomal L27 protein,score
FT                   1.2e-56"
FT                   /inference="protein motif:HMMPfam:PF01016"
FT   misc_feature    397493..397537
FT                   /gene="rpmA"
FT                   /locus_tag="VSAL_I0362"
FT                   /note="PS00831 Ribosomal protein L27 signature."
FT                   /inference="protein motif:ProSite:PS00831"
FT   CDS_pept        397929..399107
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0363"
FT                   /old_locus_tag="TVS0173"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78048"
FT                   /db_xref="GOA:B6EL43"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EL43"
FT                   /protein_id="CAQ78048.1"
FT                   /translation="MKFVDEATIKVDAGDGGNGTVSFWREKFVAKGGPDGGDGGDGGDV
FT                   YLEADENLNTLIDYRFNRFYDAERGKNGGGTNSTGRRGEDITLKVPVGTRAIDIDTGEK
FT                   VAELMAHGMKIMVAKGGWHGLGNTRFKSSVNRAPRQKTMGTKGEVRELRLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLIPSLGVVRARGNKSFVIADIPGLIEGAA
FT                   EGAGLGVRFLKHLERCRVLLHVIDILPIDGSDPVQNALTIIDELERYSEKVAGKPRWLL
FT                   FNKTDLLLEAEADEKIAEILEALAWEGAHFKIAAVSRTGTQEVCNELSDFMDTLPKEIM
FT                   TDEEKAALKVDFMWDDYHKDAMSGKNVVTEDGDDDDDWDDEEDDGHVIYARD"
FT   misc_feature    397935..398402
FT                   /locus_tag="VSAL_I0363"
FT                   /note="HMMPfam hit to PF01018, GTP1/OBG, score 2.1e-82"
FT                   /inference="protein motif:HMMPfam:PF01018"
FT   misc_feature    398406..398786
FT                   /locus_tag="VSAL_I0363"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown
FT                   function,score 1.9e-37"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    398424..398447
FT                   /locus_tag="VSAL_I0363"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    398565..398606
FT                   /locus_tag="VSAL_I0363"
FT                   /note="PS00905 GTP1/OBG family signature."
FT                   /inference="protein motif:ProSite:PS00905"
FT   CDS_pept        399220..399999
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0364"
FT                   /old_locus_tag="TVS0174"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78049"
FT                   /db_xref="GOA:B6EL44"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL44"
FT                   /protein_id="CAQ78049.1"
FT                   /translation="MRIQMEEQQREISRLVAKAGQMLLQHGAESSLVSDVSRRLGIAVG
FT                   ADEVEISLSASSLVITTVINEHCVTTARRAPDRGINMRAITEIQRICIMSEKGLLDRHE
FT                   ATHKLNNISPERYNRWLVVVMIGLSCASFSRLAGGDWPVFMMTFLASSLGMIVRQEIGH
FT                   RHFNPLLNFGITAFVTTLISSQAVIYHIGNTPFLAMASSVLMLVPGFPLINAVADMVKG
FT                   YVNMGIARWTFATLLTLATSIGIVGAMNLVGVWGWIN"
FT   misc_feature    399274..399846
FT                   /locus_tag="VSAL_I0364"
FT                   /note="HMMPfam hit to PF06738, Protein of unknown function
FT                   (DUF1212), score 7.6e-63"
FT                   /inference="protein motif:HMMPfam:PF06738"
FT   misc_feature    order(399577..399636,399646..399705,399724..399792,
FT                   399802..399870,399925..399993)
FT                   /locus_tag="VSAL_I0364"
FT   CDS_pept        399999..400490
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0365"
FT                   /old_locus_tag="TVS0175"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78050"
FT                   /db_xref="GOA:B6EL45"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL45"
FT                   /protein_id="CAQ78050.1"
FT                   /translation="MDNVTMQSIFELFLALLNDMFFAMIPAIGFALVFNVPVKALKYCA
FT                   IGGAIGHGTRFLLMHYGAPLEWATLCAATVVGMIGVHWSHRFLAHPKVFTVAALIPMIP
FT                   GVFAFKAMIAVVEINHLGYSPELWALMIDNLIKTLFTIAALAIGLAMPGLLFYRRKSIV
FT                   "
FT   misc_feature    order(400032..400100,400182..400250,400275..400343,
FT                   400401..400469)
FT                   /locus_tag="VSAL_I0365"
FT   CDS_pept        400556..401077
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="VSAL_I0366"
FT                   /old_locus_tag="TVS0176"
FT                   /product="dihydrofolate reductase type 3"
FT                   /EC_number="1.5.1.3"
FT                   /note="Expression may be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78051"
FT                   /db_xref="GOA:B6EL46"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL46"
FT                   /protein_id="CAQ78051.1"
FT                   /translation="MKISMIAAMANNGKIDKSCNLSNSQSRIIGKNNQMPWHLPADFAW
FT                   FKQCTMGKPIVMGRKTYESIGRPLPGRLNIVLSRDASLKIEGVTCVTSIDEAKQVAGDI
FT                   EELMIIGGGSIYQACLPDADTLYLTFIDADIDGDTQFPDWGEGWNQTHSEMYLKDEKNQ
FT                   YDMEFVVLER"
FT   misc_feature    400559..401074
FT                   /gene="folA"
FT                   /locus_tag="VSAL_I0366"
FT                   /note="HMMPfam hit to PF00186, Dihydrofolate
FT                   reductase,score 4.8e-52"
FT                   /inference="protein motif:HMMPfam:PF00186"
FT   CDS_pept        complement(401288..402109)
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="VSAL_I0367"
FT                   /old_locus_tag="TVS0177"
FT                   /product="bis(5'nucleosyl)-tetraphosphatase"
FT                   /EC_number="3.6.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78052"
FT                   /db_xref="GOA:B6EL47"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EL47"
FT                   /protein_id="CAQ78052.1"
FT                   /translation="MATYFVGDIQGCLDELLLLLDQVSFDKEKDQLWLTGDLVARGPKS
FT                   LETLRFVKSLDKAAVTILGNHDLHLLAVSQGISRIKEKDKTASIFTAPDSEELLTWLRH
FT                   QPLLATHAQHNIVMTHAGISPQWNIETATECAREIESVLVSDKWVWLLENMYENQPDLW
FT                   QSDLTGINRYRYIINAFTRMRFCYPDGRLDMECKQPPQELSSDDKEKLIPWFDLKSRCP
FT                   LSHTVIFGHWAALMGYENNGVIALDTGCVWGEYMTMYRVDDGQYFTQKAIS"
FT   misc_feature    complement(401405..402109)
FT                   /gene="apaH"
FT                   /locus_tag="VSAL_I0367"
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 1.5e-15"
FT                   /inference="protein motif:HMMPfam:PF00149"
FT   CDS_pept        complement(402206..403039)
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="VSAL_I0368"
FT                   /old_locus_tag="TVS0178"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78053"
FT                   /db_xref="GOA:B6EL48"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EL48"
FT                   /protein_id="CAQ78053.1"
FT                   /translation="MSTRNDVHLGHKAKKRFGQNFLNDPYVIDGIVSAINPLPGQNLVE
FT                   IGPGLGAITEPVGREIDKFTVIELDRDLAARLRTHPELGSKLTIYEGDAMRFDFTQLIQ
FT                   EGNKLRIFGNLPYNISTPLMFHLFEFHKDIQDMHFMLQKEVVNRLAAGPGTKAYGRLTV
FT                   MAQYYCKVMPVLEVPPTAFVPPPKVDSAVVRLVPYEVLPFPAKNLKWLDRVCREGFNQR
FT                   RKTVRNCFKALLTKEQLEALGVNPSHRPENLTLEQFVIMANWLNDNYQAESTESA"
FT   misc_feature    complement(402239..403012)
FT                   /gene="ksgA"
FT                   /locus_tag="VSAL_I0368"
FT                   /note="HMMPfam hit to PF00398, Ribosomal RNA adenine
FT                   dimethylase, score 1.1e-96"
FT                   /inference="protein motif:HMMPfam:PF00398"
FT   CDS_pept        complement(403036..404025)
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="VSAL_I0369"
FT                   /old_locus_tag="TVS0179"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78054"
FT                   /db_xref="GOA:B6EL49"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL49"
FT                   /protein_id="CAQ78054.1"
FT                   /translation="MNNIKRIAITPGEPAGIGPDLVLSIAQQDWPHQLVICGNRTALEQ
FT                   RAKQLKLSINIENYDVNTPAKSHRAGTLIVDNIELGIDVIAGELNEANGHYVLETLTRA
FT                   AQGNMDGEFDAVVTGPVHKGVINRAGVAFSGHTEFFAELSNTQQVVMMLATEGLRVALV
FT                   TTHIPLAYVAKAITDDRLKQVIRILHQDLITKFGITNPAIFVCGLNPHAGEDGCLGREE
FT                   IDIITPALNDLREKESMNLIGPLPADTLFQDKYLQEADAVLAMYHDQGLPVLKFKGFGK
FT                   SVNITLGLPFIRTSVDHGTALELAGTGKADAGSFITALTHAIELVENK"
FT   misc_feature    complement(403057..403953)
FT                   /gene="pdxA"
FT                   /locus_tag="VSAL_I0369"
FT                   /note="HMMPfam hit to PF04166, Pyridoxal phosphate
FT                   biosynthetic protein Pdx, score 1.6e-161"
FT                   /inference="protein motif:HMMPfam:PF04166"
FT   CDS_pept        complement(404018..405328)
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="VSAL_I0370"
FT                   /old_locus_tag="TVS0180"
FT                   /product="chaperone SurA precursor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78055"
FT                   /db_xref="GOA:B6EL50"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL50"
FT                   /protein_id="CAQ78055.1"
FT                   /translation="MKNWKIPFISSLLLMLTINVHAAPVELDRVIAIVDEGVVLQSDIE
FT                   TSLKTVKINAQEKGQPLPEENVLREQVLEKLILDTIQSQQAEKMGIRIDDTRLEEALNN
FT                   IAKDNKMTLAQLQQKAASQGLAYADFREQIRKEIAASEARNAQVRRRINILPQEVESLA
FT                   LLLSEETQATVQYKISHIQLRTDGATQAEKEALEKQALELTERLKQGADFATMAYTYSK
FT                   GPKALQGGDWGWMRKEEMPTIFADQITGQGKSSIIGPFRSGVGFHIIKIDDVKGLETVA
FT                   VTEVNARHILVKTSVIMSDEGAERLLNQITSDIESGKETFAAMAQRYSQDPGSAAANGE
FT                   LGFQTPDLYVPEFKHQVEILPVGQISKPFKTVHGWHIAEVLERRQVDRTDAAMKNKAYR
FT                   ILMNRKFNEESGAWLQEIRASAYVEILQDNDDSDENE"
FT   misc_feature    complement(404183..404464)
FT                   /gene="surA"
FT                   /locus_tag="VSAL_I0370"
FT                   /note="HMMPfam hit to PF00639, PPIC-type PPIASE
FT                   domain,score 8.1e-27"
FT                   /inference="protein motif:HMMPfam:PF00639"
FT   misc_feature    complement(404510..404791)
FT                   /gene="surA"
FT                   /locus_tag="VSAL_I0370"
FT                   /note="HMMPfam hit to PF00639, PPIC-type PPIASE
FT                   domain,score 9.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00639"
FT   sig_peptide     complement(405263..405328)
FT                   /gene="surA"
FT                   /locus_tag="VSAL_I0370"
FT   CDS_pept        complement(405399..407753)
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="VSAL_I0371"
FT                   /old_locus_tag="TVS0181"
FT                   /product="organic solvent tolerance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78056"
FT                   /db_xref="GOA:B6EL51"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL51"
FT                   /experiment="The expressed protein is found to be
FT                   associated with the outer membrane in Aliivibrio
FT                   salmonicida"
FT                   /protein_id="CAQ78056.1"
FT                   /translation="MSFTSRSLLASFTGCLLYGSPAIADDAGQFIPPENNIIFPLKTDA
FT                   VNSCQVPVKMSKEEEDQQPVLIQADSVEAHNNSKATYKGNVHVIKGRQEIKADNITLHQ
FT                   QENIAIAEGNVDYSSMDMRSTSDKVTTDLNTEDTTMINTSYKMSCQPIRGTASRVLKTG
FT                   QAIYQLEDASFTTCPAGDKSWRVKASDIELDQSDEWATFYNARFEILDVPILYLPYITV
FT                   PVGDTRKTGVLIPSAGLDSKNGFELSIPIYWNIAPNYDATTTINYMEKRGTQLEGNFRY
FT                   LTDFGSGQVDAEYLGDDAKYKEKGARWGASWNHSGIYKQNWKFEVEYSQVSDITYFQDL
FT                   NSSIGTRDEGQLQQSGEVSYRTQDWDLTMRVRDFQVLVENSYPYRLMPQMEFNYYAPQF
FT                   YNEFDFNLNSHISKFETDDPTKPSATRVHMEPKLSLPLSGTWWSLTPETSLLYTYYTQE
FT                   FDAKKDPSLSDLAEETDRTIPEVRINGAIYLDSTHKFLGKYLQTLEPKIQYLYVPEVDQ
FT                   SDIYGGKGEGGYDSSKLQLDYYGLFRDRQYSGVDYIAAANQFSIGATSRFYDDTYKERM
FT                   NISFGQILYMNGSGTANEGDDKNSSAWAIESDFNYDDYLFYHGGVQYDSNVDELQVANS
FT                   TIEYQHSNGYVQLNYRYVSKNYIQSNVNFQDDLDKITQHGIYQAGFLTQYNINNSWQLQ
FT                   AQYFHDTKEDYMLEALVGATYLSDCWSFGLTYSDQLIAPESAGSIGSYEPEYESNLMLS
FT                   IAIRGLGTNTGITSGTATNALGYGRPFYLNN"
FT   misc_feature    complement(405681..406841)
FT                   /gene="imp"
FT                   /locus_tag="VSAL_I0371"
FT                   /note="HMMPfam hit to PF04453, Organic solvent tolerance
FT                   protein, score 1.7e-135"
FT                   /inference="protein motif:HMMPfam:PF04453"
FT   misc_feature    complement(407157..407738)
FT                   /gene="imp"
FT                   /locus_tag="VSAL_I0371"
FT                   /note="HMMPfam hit to PF03968, OstA-like protein, score
FT                   2.4e-44"
FT                   /inference="protein motif:HMMPfam:PF03968"
FT   sig_peptide     complement(407682..407753)
FT                   /gene="imp"
FT                   /locus_tag="VSAL_I0371"
FT   CDS_pept        407960..408811
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="VSAL_I0372"
FT                   /old_locus_tag="TVS0182"
FT                   /product="DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78057"
FT                   /db_xref="GOA:B6EL52"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B6EL52"
FT                   /protein_id="CAQ78057.1"
FT                   /translation="MQIFGKILGGFFGFLFGGFFGAALGVFIGHQFDKAKRMANSGFTF
FT                   QTGGASQTEKQAEFFHAAFAVMGHVAKAKGQVTAQEIQLASMMMERMNLSTAQKKEAQE
FT                   AFIEGKENNFPLRETLQKIRSITGGRYDLLQFFLELQIASALADGDIHPSERDILHIVA
FT                   EELGFSAAQLEKRLKMQEAAFRFQQGGGFSGQQSGSHQSNGQWQKASSANQLKDAYNLL
FT                   GVSEDADAKAIKRAHRKLMNEHHPDKLVAKGLPPEMMNMAKEKAQEIQGAYDLIKKAKG
FT                   IK"
FT   sig_peptide     407960..408034
FT                   /gene="djlA"
FT                   /locus_tag="VSAL_I0372"
FT   misc_feature    407978..408046
FT                   /gene="djlA"
FT                   /locus_tag="VSAL_I0372"
FT   misc_feature    408608..408805
FT                   /gene="djlA"
FT                   /locus_tag="VSAL_I0372"
FT                   /note="HMMPfam hit to PF00226, DnaJ domain, score 1.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00226"
FT   CDS_pept        complement(408841..409680)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0373"
FT                   /old_locus_tag="TVS0183"
FT                   /product="exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78058"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELJ6"
FT                   /protein_id="CAQ78058.1"
FT                   /translation="MFNDLFKLVSLNNTKVRHLTMKIFISSLLLLFSFNSFAAPKSELW
FT                   DYWNISNENNPTTISHQYWQQTLDKYVVAEGEYTLFDYANVTDADERTLNSYLRQMRRI
FT                   DPREYKKAEQYAYWVNLYNAITVKIILDNYPIKSITKLGGLFSFGPWDENVVTVAGKTL
FT                   TLNDIEHRILRPIWNDPRTHYAVNCASFGCPNLQSKAFTARNSDKLLEKAATEFINSKK
FT                   GVLITDNKVQLSSIYDWFAVDFGNKQQLFEHLKKYRPELRPFEGDIKYDYDWKLNQQ"
FT   misc_feature    complement(409027..409407)
FT                   /locus_tag="VSAL_I0373"
FT                   /note="HMMPfam hit to PF04784, Protein of unknown function,
FT                   DUF547, score 4.1e-38"
FT                   /inference="protein motif:HMMPfam:PF04784"
FT   sig_peptide     complement(409567..409680)
FT                   /locus_tag="VSAL_I0373"
FT   CDS_pept        complement(409804..410406)
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="VSAL_I0374"
FT                   /old_locus_tag="TVS0184"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78059"
FT                   /db_xref="GOA:B6ELJ7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELJ7"
FT                   /protein_id="CAQ78059.1"
FT                   /translation="MSGFKQHTGLVVPLDTANIDTDAIIPKQFLQKVNRTGFGKHLFHD
FT                   WRFLDDAGQQPNPEFVMNAPRYQGASILLARENFGCGSSREHAPWALADYGIQVMIAPS
FT                   FADIFYGNSINNQMIPVRLTDIEVDEIFQFVEANEGAEVAVDLEAMLVSANGKQYSFEI
FT                   DEFRRHCLLNGLDNIGLTLQHADKISEYEAKIPNFLK"
FT   misc_feature    complement(410029..410406)
FT                   /gene="leuD"
FT                   /locus_tag="VSAL_I0374"
FT                   /note="HMMPfam hit to PF00694, Aconitase C-terminal domain,
FT                   score 3.8e-62"
FT                   /inference="protein motif:HMMPfam:PF00694"
FT   CDS_pept        complement(410418..411833)
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="VSAL_I0375"
FT                   /old_locus_tag="TVS0185"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78060"
FT                   /db_xref="GOA:B6ELJ8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELJ8"
FT                   /protein_id="CAQ78060.1"
FT                   /translation="MSNAKTLYEKVYDAHVAVAAKGETPILYIDRHLVHEVTSPQAFDG
FT                   LREKGRNVRQVGKTFATMDHNVSTQTKDINASGEMARIQMETLSKNCEEFGVTLYDLNH
FT                   KYQGIVHVMGPELGITLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEHVLATQTLKQA
FT                   RAKTMKIEVKGKVTEGITAKDIVLAIIGKTTAAGGTGYVVEFCGEAITDLTMEGRMTVC
FT                   NMAIELGAKAGLIAPDATTFDYITGRKFSPQGEDLTAAIEYWSSLKTDDDAKFDAVVSL
FT                   DASEIKPQVTWGTNPGQVIAIDQPIPAPESFSDPVEKVSAEKALAYMGLEAGKSLTDYN
FT                   VDKVFVGSCTNSRIEDIRAAAAVAKGNKVAAHVQALIVPGSEQVKAQAEKEGLDIIFKE
FT                   AGFEWRLPGCSMCLAMNNDRLGPQERCASTSNRNFEGRQGRDGRTHLVSPAMAAAAAIA
FT                   GHFVDIRTITEKA"
FT   misc_feature    complement(410457..411818)
FT                   /gene="leuC"
FT                   /locus_tag="VSAL_I0375"
FT                   /note="HMMPfam hit to PF00330, Aconitase family (aconitate
FT                   hydratase), score 3.4e-266"
FT                   /inference="protein motif:HMMPfam:PF00330"
FT   misc_feature    complement(410592..410633)
FT                   /gene="leuC"
FT                   /locus_tag="VSAL_I0375"
FT                   /note="PS01244 Aconitase family signature 2."
FT                   /inference="protein motif:ProSite:PS01244"
FT   misc_feature    complement(410763..410813)
FT                   /gene="leuC"
FT                   /locus_tag="VSAL_I0375"
FT                   /note="PS00450 Aconitase family signature 1."
FT                   /inference="protein motif:ProSite:PS00450"
FT   CDS_pept        complement(411849..412940)
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="VSAL_I0376"
FT                   /old_locus_tag="TVS0186"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78061"
FT                   /db_xref="GOA:B6ELJ9"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELJ9"
FT                   /protein_id="CAQ78061.1"
FT                   /translation="MTNKTYKIAILPGDGIGPEVMDQAHKVLDAIEKKHAISFSREQHD
FT                   VGGIAIDNHGCPLPESTVKGCEESDAVLFGSVGGPKWENLPPNDQPERGALLPLRKHFE
FT                   LFCNLRPAQIHKGLEGFSPLRADISGNGFDIVVVRELTGGIYFGQPKGREGEGPQEKAY
FT                   DTEIYHRYEIERIAKIAFESALLRNKNVYSIDKANVLQSSILWREVVEEVAKGYPEVKL
FT                   SHMYIDNATMQLIKDPSQFDVMLCSNIFGDIISDECAMITGSMGMLPSASLNKDNFGLY
FT                   EPAGGSAPDIAGKNIANPVAQILSAALMLRYSLGEEEAAQSIEAAVSKALSAGELTADL
FT                   AGNKPALTTSAMGDKIAEYILNS"
FT   misc_feature    complement(411873..412922)
FT                   /gene="leuB"
FT                   /locus_tag="VSAL_I0376"
FT                   /note="HMMPfam hit to PF00180, Isocitrate/isopropylmalate
FT                   dehydrogenase, score 2.2e-210"
FT                   /inference="protein motif:HMMPfam:PF00180"
FT   misc_feature    complement(412140..412199)
FT                   /gene="leuB"
FT                   /locus_tag="VSAL_I0376"
FT                   /note="PS00470 Isocitrate and isopropylmalate
FT                   dehydrogenases signature."
FT                   /inference="protein motif:ProSite:PS00470"
FT   CDS_pept        complement(413018..414565)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="VSAL_I0377"
FT                   /old_locus_tag="TVS0187"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78062"
FT                   /db_xref="GOA:B6ELK0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELK0"
FT                   /protein_id="CAQ78062.1"
FT                   /translation="MSDQVIIFDTTLRDGEQALSASLTVKEKLQIAFALERLGVDVIEA
FT                   GFPISSPGDFESVRTIAKHIKNSRICALSRAVTKDIDVAADALKVAEAFRIHTFISTST
FT                   VHVQDKLRRSYDDVVEMGVKAVQRARKYTDDVEFSCEDAGRTPIDNLCRMVEAAINAGA
FT                   NTINIPDTVGYTIPGEFGGIIQTLFNRVPNIDKAIISVHCHDDLGMSVANSIAAVQAGA
FT                   RQVEGTINGIGERAGNCSLEEIAMILQTRSEYLGVHTSLKNDEIHRTSKLVSQLCNMPI
FT                   QSNKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESIGLKNKALNLTSRSGRAAVKSH
FT                   MDSMGYKAEEYNLDTLYADFVKLADRKGQVFDYDLEALMHFANLRDEDDFYKLNYLSVQ
FT                   SGSVMATTSIKLLCGDEEKCEAAVGNGPVDALYQCIYKLTGYEIVLDKFDLTAKGEGED
FT                   GLGQADIIANYKGRKYHGTGLATDIIEASGQALLHVINSIHRADQIAEIKQNKITTV"
FT   misc_feature    complement(413069..413461)
FT                   /gene="leuA"
FT                   /locus_tag="VSAL_I0377"
FT                   /note="HMMPfam hit to PF08502, LeuA allosteric
FT                   (dimerisation) domain, score 8.3e-52"
FT                   /inference="protein motif:HMMPfam:PF08502"
FT   misc_feature    complement(413729..414529)
FT                   /gene="leuA"
FT                   /locus_tag="VSAL_I0377"
FT                   /note="HMMPfam hit to PF00682, HMGL-like, score 3.4e-137"
FT                   /inference="protein motif:HMMPfam:PF00682"
FT   misc_feature    complement(413930..413971)
FT                   /gene="leuA"
FT                   /locus_tag="VSAL_I0377"
FT                   /note="PS00816 Alpha-isopropylmalate and homocitrate
FT                   synthases signature 2."
FT                   /inference="protein motif:ProSite:PS00816"
FT   misc_feature    complement(414482..414532)
FT                   /gene="leuA"
FT                   /locus_tag="VSAL_I0377"
FT                   /note="PS00815 Alpha-isopropylmalate and homocitrate
FT                   synthases signature 1."
FT                   /inference="protein motif:ProSite:PS00815"
FT   CDS_pept        join(415037..415447,415451..415681)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0378"
FT                   /old_locus_tag="TVS0188"
FT                   /product="transcriptional regulator, AcrR/TetR family
FT                   (pseudogene)"
FT                   /note="Similar to Vibrio fischeri Hypothetical protein
FT                   UniProt:Q5E855 (214 aa) fasta scores: E()=1.2e-60, 80.193%
FT                   id in 207 aa. CDS contains a nonsense mutation (CAA to TAA)
FT                   after codon 137. The sequence has been checked and is
FT                   believed to be correct"
FT                   /db_xref="PSEUDO:CAQ78063.1"
FT                   /inference="similar to sequence:UniProt:Q5E855"
FT   misc_feature    415097..415237
FT                   /locus_tag="VSAL_I0378"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 4.5e-12"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   CDS_pept        415681..417000
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0379"
FT                   /old_locus_tag="TVS0189"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78064"
FT                   /db_xref="GOA:B6ELK2"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELK2"
FT                   /protein_id="CAQ78064.1"
FT                   /translation="MKITKKLLFFPVVAIGVIILVTITKLRPEAEVKPVEDRSKIVKTI
FT                   ALEQQSIAPKVIGFGKIRPKFEWKAIAEVSGKVVYRHPELNKGNVLLAGTEVLRIDPLD
FT                   YELKLAQAEADLGSSETQLAKVDLEEKNIRNTLKIEKNRLAISKKELSRKVNLQKKGLT
FT                   SQSDLDQQNQSYLAQQKVVLDIQNQILLLPDERKVAQAIVKVNQAKLKEAQRSLDKTSI
FT                   VLPTDVRISEVDIEADQVVNLQQEIFIAHGIKTMEVEAQVSIHDMQTLVHSFGMFQSNE
FT                   QGMPNLDSLPLKANVQLSSGRFNAEWQAQVARISETVDPNQATVGIILEIQQDYRSLTP
FT                   STLPPLVNGMFVKAEIEGEVSPQWVIPESALHGDKIYLLNNDSQLTILPVNIVFRRDNQ
FT                   VAIVGDITSGDLLILNDLLPAINGMQLRSVEQRKEGESAE"
FT   misc_feature    415699..415752
FT                   /locus_tag="VSAL_I0379"
FT   CDS_pept        416997..420101
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0380"
FT                   /old_locus_tag="TVS0190"
FT                   /product="integral membrane protein, AcrB/AcrD/AcrF family"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78065"
FT                   /db_xref="GOA:B6ELK3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELK3"
FT                   /protein_id="CAQ78065.1"
FT                   /translation="MIKFFARHPTAANLLMLSILLLGVVSLSQLKRETFPEFSPPYILA
FT                   GVVYPGASPQEVEESICIRLEDAVDGLGNIEETKCEAIEGSARLVIKLNAKADIGRMLV
FT                   DVQTQIDSINDFPKEIESPIVQELDWNEPVVDVAITADTTWPELKAYAEKLKQSLKLDY
FT                   DVSLVEVSGFSDHQYRVELDEGAIRQLGLNVSDIANKLAEQNVKLPSGSIETPEKNFLI
FT                   RFDERKTTPQELAKTVMGASANGALIRLGDIATITDRFELDEQKVLFDGKPSALLKISK
FT                   NKEEDALRIKDRVTEFVKYQQSVAPDGVALEMTNDLSSLLWDRLTMMVKNGWQGIILVF
FT                   LTMWLFFTFRYSFWVAAGLPVAFLGGLFLMASFGLSINIMSLVALLMAIGIMMDDAIVI
FT                   AESIASHLDRGQEIDDAVYNGVKKVFPGVLSSFLTTVCIFGSLMFLQGEMGAVLKVIPQ
FT                   VLILVLSLSLIEAFLILPNHLSHSLHKAKKDKPISGIKKIVLDRFEHFRNVTLVKAVTK
FT                   VVEWRYAFLGAVIASLLISFSLISGGALKFVGFPELDGDIAEARIILPPGTSLSQTEIV
FT                   VDKIVSAAEKLNKEWCDNNEDGRPLVEHITQQFNTNADASESGPHLATIRLDLLGAEER
FT                   TTLIDDFIDAWREEVGDLAEPITMVYKQPTMGPGGRAIEIRMMDDDLHTLKSASLEVQA
FT                   YLNEFSGVYGVLDDMRMGKEEVLVKLRPGAETYGVTGQLIANQLRAAYFGQTADEIQLG
FT                   VENIEIEVRLNKEQAGDLHTLENFPIIMPDGSQIPLASIATLDFQRNYVRIQRINGLRT
FT                   LSVFGDVHASQVSSSEILAQFRSELAPALQNKYPRLRFDFEGEAKDTAETGQSMGTGFM
FT                   LGLFGVFVILSFQFRSYLEPFVVMLAIPLALIGVLWGHVLLGHPLSMPSIMGFVSLAGI
FT                   VVNDSILLVQYIRHHVDEGDSVYEAVVKASQERFRAVFLTSVTTAVGLLPLLLETSLQA
FT                   QVIQPLVVSIVFGIFTSTLLVLFMIPAAYAILADFGLVKKHEELH"
FT   misc_feature    416997..420062
FT                   /locus_tag="VSAL_I0380"
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family,score
FT                   3.6e-72"
FT                   /inference="protein motif:HMMPfam:PF00873"
FT   sig_peptide     416997..417080
FT                   /locus_tag="VSAL_I0380"
FT   misc_feature    order(417024..417077,417990..418058,418086..418154,
FT                   418266..418334,418362..418430,418563..418631,
FT                   419592..419651,419670..419729,419757..419825,
FT                   419886..419945,419988..420056)
FT                   /locus_tag="VSAL_I0380"
FT   CDS_pept        complement(420124..421125)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0381"
FT                   /old_locus_tag="TVS0191"
FT                   /product="putative exported protein"
FT                   /note="130 amino acid residues longer than the V.fischeri
FT                   homologue"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78066"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELK4"
FT                   /protein_id="CAQ78066.1"
FT                   /translation="MLKKVLLTGLIAINASVHASEIESEDADTSPPSPRESQVELGYGS
FT                   DNSLSLNCSLEPVYTSGQNSHASDVKYYLSKDECETDTEQLTLEKKPSISVPTSEIDTE
FT                   DDDTSPPSPWESQVEFGYQSSKGNDDSQSLNGRLEASYTSGQHRHTGEVKYYLSKEDGE
FT                   TDKDQLSLNLQSDYKISPDYYLYANFKGLETEYSAYFKDYTFSGGLGYQASNTEKLVLE
FT                   LELGPGYRYQNPNLDEIDDDDLIFPETVAEAILRTNITVSWKPMDVLTLASEVTVTSGR
FT                   SNTRIDSEVSLTNNITEEIALKIAQSQEYLDRVPPGLSKTDSVISVNLLFLF"
FT   misc_feature    complement(420127..420843)
FT                   /locus_tag="VSAL_I0381"
FT                   /note="HMMPfam hit to PF04338, Protein of unknown function,
FT                   DUF481, score 3.4e-73"
FT                   /inference="protein motif:HMMPfam:PF04338"
FT   sig_peptide     complement(421069..421125)
FT                   /locus_tag="VSAL_I0381"
FT   CDS_pept        421307..422704
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="VSAL_I0382"
FT                   /old_locus_tag="TVS0192"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78067"
FT                   /db_xref="GOA:B6ELK5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELK5"
FT                   /protein_id="CAQ78067.1"
FT                   /translation="MADNRNQNRKYDAQVDALKVPPHSLEAEQSVLGGLLLDNERWDTV
FT                   AEKVVAVDFYSRPHRLIFESVKSILEDSMPLDLITLSEHLERHEKLDSVGGFAYLADLV
FT                   KNTPSAANINAYADIVRERAMVRNLISVANEIADAGYDPQGRTSEDLLDMAESKVFAIA
FT                   EARTTENEGPQTVDTILERTLERIELLYQSPQDGVTGVSTGFTDLNKKTAGLQGSDLII
FT                   VAARPSMGKTTFAMNLCENAAMDQDKPVLIFSLEMPAEQLMMRMLASMSRVDQTKIRTG
FT                   QLDDEDWARISSTMGILTQKKNMYIDDSSGLTPTELRSRARRVARESGGLSMIMIDYLQ
FT                   LMRVPGMQDNRTQEISEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPINSDLRES
FT                   GAIEQDADLIMFIYRDEVYNPESNRKGIAEIILGKQRNGPIGSVSLTFQGQFSRFDNYA
FT                   GPAFDDE"
FT   misc_feature    421364..421672
FT                   /gene="dnaB"
FT                   /locus_tag="VSAL_I0382"
FT                   /note="HMMPfam hit to PF00772, DnaB-like helicase N
FT                   terminal domain, score 3.8e-54"
FT                   /inference="protein motif:HMMPfam:PF00772"
FT   misc_feature    421895..422494
FT                   /gene="dnaB"
FT                   /locus_tag="VSAL_I0382"
FT                   /note="HMMPfam hit to PF03796, DnaB-like helicase C
FT                   terminal domain, score 2e-141"
FT                   /inference="protein motif:HMMPfam:PF03796"
FT   misc_feature    421979..422002
FT                   /gene="dnaB"
FT                   /locus_tag="VSAL_I0382"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    422384..422449
FT                   /gene="dnaB"
FT                   /locus_tag="VSAL_I0382"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1557.000, SD 4.49 at aa 360-381, sequence
FT                   RSLKALAKELNVPVVALSQLNR"
FT   CDS_pept        422726..423802
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="VSAL_I0383"
FT                   /old_locus_tag="TVS0193"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78068"
FT                   /db_xref="GOA:B6ELK6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELK6"
FT                   /protein_id="CAQ78068.1"
FT                   /translation="MTAAAAQIDMSALAHNLQKIKQQAPNSKLLAVVKANGYGHGLLNI
FT                   AKGAHGVDAFGVARIEEALQLRAGGIVKQVLLLEGFYSAGDLPILVANNIQTAVHCKEQ
FT                   LEALENADLEGPVVVWLKVDSGMHRLGIRPEEYQEYVDRLHACKNVAQPLRYMSHFGCA
FT                   DELDNPTTNEQIETFMSLTDGCQGERSLAASAGLLAWPDSQLDWVRPGIIMYGVSPFSE
FT                   KTAQDLGYLPTMTLTSHLIAVREVKAGESVGYGAMWTSERDTKIGVIAIGYGDGYPIAA
FT                   PNGTPVLVNGRKVPVAGRVSMDMLTVDLGPDAEDNVGDEAILWGRDLPAEEVAEHIGTI
FT                   AYELVTKLTSRVQMQYIP"
FT   misc_feature    422732..423385
FT                   /gene="alr"
FT                   /locus_tag="VSAL_I0383"
FT                   /note="HMMPfam hit to PF01168, Alanine racemase,N-terminal
FT                   domain, score 1.7e-93"
FT                   /inference="protein motif:HMMPfam:PF01168"
FT   misc_feature    422816..422848
FT                   /gene="alr"
FT                   /locus_tag="VSAL_I0383"
FT                   /note="PS00395 Alanine racemase pyridoxal-phosphate
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00395"
FT   misc_feature    423422..423796
FT                   /gene="alr"
FT                   /locus_tag="VSAL_I0383"
FT                   /note="HMMPfam hit to PF00842, Alanine racemase,C-terminal
FT                   domain, score 7.1e-72"
FT                   /inference="protein motif:HMMPfam:PF00842"
FT   CDS_pept        423817..425037
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0384"
FT                   /old_locus_tag="TVS0194"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78069"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELK7"
FT                   /protein_id="CAQ78069.1"
FT                   /translation="MRVNLKQLFLRSATGLALFLISPYVFSESDIWPNSLPETAAVPFM
FT                   YSSESLGTTIGVAGVMKGVGQPQATLFAAGMYSSKGSYLTYLSSDNNQVGHSWLFGANA
FT                   YNASFKDMDYYIGTAGSNNSHQSDEVFTDSTEAQYHLTANYILPIGNAKDIGAQAAYTP
FT                   NRKVKSGNPFDSGVSSIELSPFYYSRTLSDVSDWDEPESNWGMKVNFDWDNRNSVRNTT
FT                   NGSRTELDFTYSPETSSQEEWWTWEFQQSAFFDLGGIGNVIKKQVLAFDFYLADTPSWE
FT                   DGAHQPPEYAGIKLGGLYRLRSYGGGRFHGRSAVHYSAEYRVMPDWQPLEDWPIFNLYD
FT                   VPWWQWVAFVDTGRVADEFSLSTLHDDMRWSAGGAIRFQVEGIVVRTEMAWGSEENVFR
FT                   VMINQPF"
FT   sig_peptide     423817..423897
FT                   /locus_tag="VSAL_I0384"
FT   CDS_pept        425233..426885
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="VSAL_I0385"
FT                   /old_locus_tag="TVS0195"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78070"
FT                   /db_xref="GOA:B6ELK8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELK8"
FT                   /protein_id="CAQ78070.1"
FT                   /translation="MLKNINPTETQAWADLTAHFETAQNFNLADLFSADAQRFDKFSTT
FT                   FGQDILVDFSKNLVTEETMQKLFSLAEQTELSEAIKAMFSGEKINKTEDRSVLHTALRN
FT                   RSNTPVIVDGEDVMPAVNAVLEKMKAFTERLISGEWKGYTGKEITDIVNIGIGGSDLGP
FT                   YMVSEALAPYKTRLNMHFVSNVDGTHIVETLKPLNPETTLFLIASKTFTTQETMTNAHS
FT                   ARDWFLAEAGDQAHVAKHFAALSTNAESVSEFGIDTDNMFEFWDWVGGRYSLWSAIGLS
FT                   IALAVGFDNFVELLEGAHEVDNHFANTELENNVPVILALIGLWYNNFHGSESESILPYD
FT                   QYLHRFAAYFQQGNMESNGKCVDRNGNPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKL
FT                   IPCDFIAPAISHNQVGDHHQKLMSNFFAQTEALAFGKKEETVRAEFAAAGKTEAEMAEL
FT                   VAFKVFEGNRPTNSILVKKVTPKTLGNLIAMYEHKIFVQGVIWNIFSFDQWGVELGKQL
FT                   ANQILPELADDKAINSHDSSTNGLINAFKAFKA"
FT   misc_feature    425389..426858
FT                   /gene="pgi"
FT                   /locus_tag="VSAL_I0385"
FT                   /note="HMMPfam hit to PF00342, Phosphoglucose
FT                   isomerase,score 0"
FT                   /inference="protein motif:HMMPfam:PF00342"
FT   misc_feature    426028..426069
FT                   /gene="pgi"
FT                   /locus_tag="VSAL_I0385"
FT                   /note="PS00765 Phosphoglucose isomerase signature 1."
FT                   /inference="protein motif:ProSite:PS00765"
FT   misc_feature    426217..426249
FT                   /gene="pgi"
FT                   /locus_tag="VSAL_I0385"
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:ProSite:PS00133"
FT   misc_feature    426724..426777
FT                   /gene="pgi"
FT                   /locus_tag="VSAL_I0385"
FT                   /note="PS00174 Phosphoglucose isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00174"
FT   CDS_pept        complement(426981..427475)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0386"
FT                   /old_locus_tag="TVS0196"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78071"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELK9"
FT                   /protein_id="CAQ78071.1"
FT                   /translation="MRAEFVNPFLASLMNVLKTMASMELKPQKPRIKKDEIARGDVSGL
FT                   IGMVASQSRGSMSITFEESLALQIMQNMLGERPNSINEEVTDMVGEITNMVTGGAKRIL
FT                   SESGFEFDMAIPMVVSGRAHTITHKCEGAIIIMPFTSEWGNAFIEICFENRDELKKERL
FT                   M"
FT   misc_feature    complement(427116..427226)
FT                   /locus_tag="VSAL_I0386"
FT                   /note="HMMPfam hit to PF04509, CheC-like family, score
FT                   6.6e-08"
FT                   /inference="protein motif:HMMPfam:PF04509"
FT   CDS_pept        complement(427496..427945)
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="VSAL_I0387"
FT                   /old_locus_tag="TVS0197"
FT                   /product="zinc uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78072"
FT                   /db_xref="GOA:B6ELL0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL0"
FT                   /protein_id="CAQ78072.1"
FT                   /translation="MNSSQKQKVEQLCQQRGVRLTQQRLTVLELIVIHHGAISAYDLLE
FT                   QLKKIEPQAKPPTIYRALDFLVTQGFVHKVESINSYISCCVIGEHAHFSQLFICRTCDD
FT                   VVECHDTKITEQLTKHAEQIEFSVENHIVETHGTCKACLHSDNQN"
FT   misc_feature    complement(427538..427903)
FT                   /gene="zur"
FT                   /locus_tag="VSAL_I0387"
FT                   /note="HMMPfam hit to PF01475, Ferric uptake regulator
FT                   family, score 1.2e-05"
FT                   /inference="protein motif:HMMPfam:PF01475"
FT   CDS_pept        428519..428800
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0388"
FT                   /old_locus_tag="TVS0198"
FT                   /product="hypothetical protein, putative phage gene"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78073"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL1"
FT                   /protein_id="CAQ78073.1"
FT                   /translation="MMTANSIKLELFLSNERFNLLSLFNGCAHRYEFKQLIRCMHSENE
FT                   CSSLPFASLLRYVDCYQLKGIFSLMEYYSNGHSIESAFSPEYFQTLLK"
FT   CDS_pept        complement(428844..429683)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0389"
FT                   /old_locus_tag="TVS0199"
FT                   /product="hypothetical protein, putative phage gene"
FT                   /note="Similar to central part of Vibrio parahaemolyticus
FT                   (Q8L0W3) Hypothetical protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78074"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL2"
FT                   /protein_id="CAQ78074.1"
FT                   /translation="MLKNWTVITQAVKNGADGIMARERYLLSTQHPNHKHTELIIPIIG
FT                   NKNTSLRIAIAGEKFKLQQKINNKKGGRPLSSFGMEYCLTLPKIHRPTPQQWRAIIADC
FT                   CMCLAYTLKLNPNELIQYKSQIRAVLHQQPQIGRTGSGDHVHLIIGKVINNKVLKELQQ
FT                   KKVTSLIKQAFNTAVLKHVGLDHREYKTYELSRGKRLETWKYQHQKAEESICIQKNIIK
FT                   LQNQTNKWLTAFELSNFKNKNRQFNRLIKTFDLLSTYSLSPEQQRQIDSMKAIINKI"
FT   CDS_pept        429880..430272
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0390"
FT                   /old_locus_tag="TVS0200"
FT                   /product="hypothetical protein, putative phage gene"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78075"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL3"
FT                   /protein_id="CAQ78075.1"
FT                   /translation="MEKKHSALSDNVETENQQYNFNKSLAYALMDSRRGHVMLRKFVLD
FT                   LCEKSRLITADDETKKTLKYRWLIDVIELNIKTIELLELSDSGDYTYNSIEDMKVSIEA
FT                   KSIIIVKDIVRRIIHTPMYFPINKDK"
FT   misc_feature    430090..430113
FT                   /locus_tag="VSAL_I0390"
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00867"
FT   CDS_pept        430429..431454
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0391"
FT                   /old_locus_tag="TVS0201"
FT                   /product="hypothetical protein, ADP-ribose binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78076"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL4"
FT                   /protein_id="CAQ78076.1"
FT                   /translation="MIVYVKGDLLNDDAEALVNAVNTVGVMGKGLAYQFKEKFHENFLI
FT                   YRDVCKKELLSVGKVLLVETDEGSIPNYIINFPTKAHWRGKSKIEYIEEGLNDLIKVVK
FT                   ENQINSVALPALGSGLGGLPWSQVERVMLDKLSNIENIEWRIYAPNNTPNLRKKLPLTE
FT                   GRSILIYTLNYYLRMTKKQQLTELEIHCLMYLLQCNGLSLTGIKFNEFREVPFSDVLHV
FT                   ALSKMDGDFLYISGVNKPIQSSFITLESKIVVEAKKLLQKKVEKIKKISDVMELISGYE
FT                   SKDGMAIISTALWVANENKNANVDLANTTLDIISNNFNSSNGVVKGAFVRLYEEKWLPL
FT                   N"
FT   misc_feature    430480..430824
FT                   /locus_tag="VSAL_I0391"
FT                   /note="HMMPfam hit to PF01661, Appr-1-p processing enzyme
FT                   family, score 1.5e-22"
FT                   /inference="protein motif:HMMPfam:PF01661"
FT   CDS_pept        complement(431463..431678)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0392"
FT                   /old_locus_tag="TVS0202"
FT                   /product="hypothetical protein, putative phage gene"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78077"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL5"
FT                   /protein_id="CAQ78077.1"
FT                   /translation="MNQRDYGDDEGRSVCMAECLSPNPVPATNITQIYVATQENKESVE
FT                   SILRDYQLSPHVNLNAAMFPKRGSRD"
FT   repeat_region   431696..432817
FT                   /note="VSa8"
FT   repeat_region   431696..431724
FT                   /note="IR of VSa8"
FT   CDS_pept        431804..432226
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0393"
FT                   /old_locus_tag="TVS0203"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78078"
FT                   /db_xref="GOA:B6EGL6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGL6"
FT                   /protein_id="CAQ78078.1"
FT                   /translation="MKAVNPLTDNEKITLKEAIANHPKNRVRIRAHAIILSDKGYSILA
FT                   LTDILDAKFETISSWIDHWEACGMLGLYDAVRIGRKPIYTEAEVYRLKSLVDEEPHQLK
FT                   RAQAILEEETGKKSSLDTIKRNIKKVITVTKEPDTH"
FT   CDS_pept        432244..432810
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0394"
FT                   /old_locus_tag="TVS0204"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78079"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL7"
FT                   /protein_id="CAQ78079.1"
FT                   /translation="MKFNNFSNILNSLIEMERTNKCELFYFDESGFSQKSNLPYCWGPI
FT                   GVQSLRPAHSHSKRLNVLGFLSRQGKLSFQTTEGRVTTDTVIDAFEHFINARKNDKPCF
FT                   IILDNASFHRSAKFKQKLHEWLINDVLVCYLPPYSPELNIIEILWKKVKYEWLPCEAFK
FT                   TFEDLSINIKNILNYYGEKFTITFA"
FT   repeat_region   432789..432817
FT                   /note="IR of VSa8"
FT   CDS_pept        complement(432820..433170)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0395"
FT                   /old_locus_tag="TVS0205"
FT                   /product="hypothetical protein, putative phage gene
FT                   (fragment)"
FT                   /note="No significant database matches. CDS is probably
FT                   truncated by the insertion of the downstream IS element and
FT                   subsequent recombination events"
FT   CDS_pept        complement(433433..434509)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0396"
FT                   /old_locus_tag="TVS0206"
FT                   /product="hypothetical protein, putative phage gene"
FT                   /note="Weakly similar to Bacteriophage BFK20 ORF43
FT                   UniProt:Q3V5F2 (982 aa) fasta scores: E()=1.5e-11, 33.803%
FT                   id in 213 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78081"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL8"
FT                   /inference="similar to sequence:UniProt:Q3V5F2"
FT                   /protein_id="CAQ78081.1"
FT                   /translation="MEFKHMSQQIQNLELNTKNHLERFGTLLFSIGSKGYDCVANWLVH
FT                   DLIPSSSFGIIYGASGSLKSFLAIDLCCSITRGNHWNYHAVKKGAVVYVAAEGQMGVAK
FT                   RIKACEIANSIKTEHLYVLGHSLTMSEESNQEALITAIQEIEQTRNVKVQLVVLDTLAR
FT                   CYSGDENTSRDMSAFVHGCDIVRAVTDTTILCIHHSGRDEAKGARGSSALKAACDFEFH
FT                   VKRTGKSKLLTFTNTKQKDGEEAPNMEVEFDSIELGINDVNGKALTSLALIKSVVQQHN
FT                   LIVSDNPVIKALQENSISKIKRTHLKEMLFPNTTMNVAQRKSLSRWLKNLESDGKILIE
FT                   KISIQKSSPDDMIVNLLH"
FT   CDS_pept        complement(434540..435601)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0397"
FT                   /old_locus_tag="TVS0207"
FT                   /product="shufflon-specific DNA recombinase"
FT                   /note="Similar to Escherichia coli Shufflon-specific DNA
FT                   recombinase rci UniProt:P16470 (384 aa) fasta scores:
FT                   E()=1e-14, 33.065% id in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78082"
FT                   /db_xref="GOA:B6ELL9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELL9"
FT                   /inference="similar to sequence:UniProt:P16470"
FT                   /protein_id="CAQ78082.1"
FT                   /translation="MATKTIETVKRKNGTSYKARVRLTSYGKTIAEYCQCFNLYIDAKK
FT                   WSEKIAKEADSKGATWLNAQKNPKKILISDVLLMVLTRSPTAENLKKSKRSNLKKLQSY
FT                   PIAKIPLTSLTAKHLFEHCVLRCQTVKPQTVAHDLSNLSTALKDASVFFDLPFDSSVFT
FT                   NAYSSLQRHGFIARSDIRTRRPNKNELKLIIDELSLNRKNYLLHIFELTLETALRRGEI
FT                   TKLRWQDFNLKNKTLTVRGRKHPCNSKRQTTTIPLSKKAVEILIKIPKNIESDLIFTIK
FT                   SASISTNWRKLMKKLKIKDLHFHDLRAEAACRFFELGLTPVEIAKITGHRDINILMNIY
FT                   LRLKVSPERLLVA"
FT   misc_feature    complement(434546..435064)
FT                   /locus_tag="VSAL_I0397"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,score
FT                   2.5e-27"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(435736..436806)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0398"
FT                   /old_locus_tag="TVS0208"
FT                   /product="shufflon-specific DNA recombinase"
FT                   /note="Similar to Escherichia coli Shufflon-specific DNA
FT                   recombinase rci UniProt:P10487 (384 aa) fasta scores:
FT                   E()=1.3e-11, 27.211% id in 294 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78083"
FT                   /db_xref="GOA:B6ELM0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM0"
FT                   /inference="similar to sequence:UniProt:P10487"
FT                   /protein_id="CAQ78083.1"
FT                   /translation="MATVAIEKVIGKKAIKYKARVRLTSNRKRIFEQSKTFTKESEAKN
FT                   WATKLAKQLNKSGVPTEKQKTILIGDLITKYLIDPVTSASIGRSKYAVLSRLRAYDIAL
FT                   IQADLLTAHDLINHCRVRKEESTHPLPQTIYHDITYLKSVIDVAEPMFGYIANTKAHHD
FT                   AIPTLVRYDLIGRSQRRERRPTNKELVTMEQGLTRRQSHRCANIPLVDIFHLSIMTCMR
FT                   LGEITRITWDDVDFKASTLTIRDRKDPRNKHGNNCIIPLYQKVKEIIERQPKVGTLIFP
FT                   YKKESIGAAWQRVCKEEGIEDLHYHDLRAEGACQLFERGLNIVEVSKITGHKDINVLNN
FT                   VYLRLGISEIHHNLSS"
FT   misc_feature    complement(435751..436221)
FT                   /locus_tag="VSAL_I0398"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,score
FT                   2.7e-14"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        437014..438030
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="VSAL_I0399"
FT                   /old_locus_tag="TVS0209"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78084"
FT                   /db_xref="GOA:B6ELM1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM1"
FT                   /protein_id="CAQ78084.1"
FT                   /translation="MANTLNSKEILTMHPLQRFSVAPMLDWTDRHCRYFHRQLSEHALL
FT                   YSEMITTGAIIHGKGDFLAYNEEEHPLALQLGGSNAKDLAHCAKLAADRGYDEINLNVG
FT                   CPSDRVQNGRFGACLMADPELVAECIAEMKAVVDIPVTVKTRIGIDDQDSYEFLTKFVS
FT                   TVHEKGGCDQFTIHARKAWLSGLSPKENREIPPLDYPRAYQIKKDFPQLIIAVNGGIKT
FT                   LEEAKEHLAHLDGVMIGREAYQSPYLLAEVDQQLFGSDKPIKKRREIVESMYPYIERQL
FT                   ENGAHLGHITRHMLGLFQSMPGARQWRRYISENAHKPGSGIEVVQAALAKIPAELDV"
FT   misc_feature    437071..438012
FT                   /gene="dusA"
FT                   /locus_tag="VSAL_I0399"
FT                   /note="HMMPfam hit to PF01207, Dihydrouridine synthase
FT                   (Dus), score 2.3e-131"
FT                   /inference="protein motif:HMMPfam:PF01207"
FT   misc_feature    437308..437364
FT                   /gene="dusA"
FT                   /locus_tag="VSAL_I0399"
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01136"
FT   CDS_pept        438149..438847
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0400"
FT                   /old_locus_tag="TVS0210"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78085"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM2"
FT                   /protein_id="CAQ78085.1"
FT                   /translation="MNKLSLTTVVASVVLVLAVPAHSAEKEFTTKIAIDAWFPDGKVGS
FT                   KDNAVRDNDVDASQAFSIAFEHPYPILPNVKVRYTPVKADRFEYDQIDYTGYYKLLDTN
FT                   GLQFDVGLTLTQFANGEFNKGGSVDSTQPHDQSFSETAMNMYADASLHIPNTNFHIFGQ
FT                   YDFGSSSDTRTMDGQAGVKYILPVDETVDVEFKLGYRVMDHEFGYFEGFDSDQANVMVD
FT                   GWFGGLSFDF"
FT   sig_peptide     438149..438217
FT                   /locus_tag="VSAL_I0400"
FT   CDS_pept        438951..439223
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0401"
FT                   /old_locus_tag="TVS0211"
FT                   /product="hypothetical protein"
FT                   /note="Alternative start at codon 15"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78086"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM3"
FT                   /protein_id="CAQ78086.1"
FT                   /translation="MDITMIFIFVKDAVMTTLSELKLMYQEDQLVEAVIESAMVEDTWI
FT                   VEFRHVHGGLVLLTDMKGGELKYRDLESASKSALAVGFNQVRIND"
FT   CDS_pept        439340..441181
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="VSAL_I0402"
FT                   /old_locus_tag="TVS0212"
FT                   /product="sulfite reductase [NADPH] flavoprotein
FT                   alpha-component"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78087"
FT                   /db_xref="GOA:B6ELM4"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029758"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM4"
FT                   /protein_id="CAQ78087.1"
FT                   /translation="MNRDVVMLLKELSALASPLNDQQIGQLQLAASELSPQQLAWVSGY
FT                   LWGVSQTSGATQPANQAAVAVSSEPVSKLSIIYASQTGNAKGVAEALKAEASAIGIRVE
FT                   LFDASDYKGKNLAKETHVIIVASTNGEGEAPDNGIELHEFLQSKKAPKLDKLHYGVIGL
FT                   GDSSYEFFCQTGKDFDGFLAKKGATAFIDRIDLDVDYEASAVEWRKQALEKVKETLSTD
FT                   NESKNGQVVQLPVGQAARSASQYSKQNPYTATLLASQKITGRDSGKDVRHIEIDLEDSG
FT                   LTYQPGDALGVWFENSLELVTAVLKQVGLTGEEHIEVDDESISLQKALIEKYEITSANP
FT                   QQVSKFSELSGSKKLEKLVQDKDKLRQYAGNTQVIDLLSEKKTKLTAEQLVGLLRRLTP
FT                   RLYSIASSQSEVDEEVHLTVGVVEYQLGDETRFGGASSFLSHRLEEGAEVNVFIEHNNN
FT                   FKLPQDDNVPVIMIGPGTGIAPFRAFVQERDNRDAEGKNWLFFGDRTFTQDFLYQVEWQ
FT                   KYLKSGVINQLDVAFSRDQQEKVYVQHRILEHSIQVWQWLQDGAYIYVCGDATRMAKDV
FT                   HEALITIVEQQGKKNREEAEQFVNDLRKAKRYQRDVY"
FT   misc_feature    439565..439960
FT                   /gene="cysJ"
FT                   /locus_tag="VSAL_I0402"
FT                   /note="HMMPfam hit to PF00258, Flavodoxin, score 1.2e-34"
FT                   /inference="protein motif:HMMPfam:PF00258"
FT   misc_feature    440066..440653
FT                   /gene="cysJ"
FT                   /locus_tag="VSAL_I0402"
FT                   /note="HMMPfam hit to PF00667, FAD binding domain, score
FT                   1e-43"
FT                   /inference="protein motif:HMMPfam:PF00667"
FT   misc_feature    440747..441073
FT                   /gene="cysJ"
FT                   /locus_tag="VSAL_I0402"
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain, score 7.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00175"
FT   CDS_pept        441181..442911
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="VSAL_I0403"
FT                   /old_locus_tag="TVS0213"
FT                   /product="sulfite reductase [NADPH] hemoprotein
FT                   beta-component"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78088"
FT                   /db_xref="GOA:B6ELM5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELM5"
FT                   /protein_id="CAQ78088.1"
FT                   /translation="MSEQIAVKTILSGTELGPLADNERLKRESKNLRGTIVEDLQDRIT
FT                   GGFTNDNFQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARMPGGIITPKQWLAID
FT                   KFAEENTSYGSLRLTTRQTFQFHGVLKPNIKLMHQTLNSIGIDSIATAGDVNRNVLCTT
FT                   NPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLETTDEEPILGSNYLPRKFKT
FT                   TVVIPPQNDVDVHANDLNFIAIANNGKLVGFNVLVGGGLAMTHGDTATYPRRADDFGFV
FT                   PLEKTLEVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGVDVFKAEVEKRAGIQFEASRP
FT                   YELTERGDRIGWVDGIDGKHHLALFIENGRLLDYPGKPLKTGVAEIAKIHQGDFRMTAN
FT                   QNLIVAGVPAEQKDQIEQIAREHGLIDDGHSEQRKNSMACVAFPTCPLAMAEAERFLPE
FT                   FVTEIEGVLKKHNLPEDDNIIFRVTGCPNGCGRAMLAEIGLIGKAPGRYNFHLGGNRSG
FT                   TRVPKMYKENITDRQILSEIDELVGRWATERQENEGFGDFTIRAGIVDEVKVSKRDFYA
FT                   "
FT   misc_feature    441400..441612
FT                   /gene="cysI"
FT                   /locus_tag="VSAL_I0403"
FT                   /note="HMMPfam hit to PF03460, Nitrite/Sulfite reductase
FT                   ferredoxin-lik, score 1.7e-20"
FT                   /inference="protein motif:HMMPfam:PF03460"
FT   misc_feature    441706..442185
FT                   /gene="cysI"
FT                   /locus_tag="VSAL_I0403"
FT                   /note="HMMPfam hit to PF01077, Nitrite and sulphite
FT                   reductase 4Fe-4S do, score 1.7e-56"
FT                   /inference="protein motif:HMMPfam:PF01077"
FT   misc_feature    442228..442446
FT                   /gene="cysI"
FT                   /locus_tag="VSAL_I0403"
FT                   /note="HMMPfam hit to PF03460, Nitrite/Sulfite reductase
FT                   ferredoxin-lik, score 8.2e-18"
FT                   /inference="protein motif:HMMPfam:PF03460"
FT   misc_feature    442627..442677
FT                   /gene="cysI"
FT                   /locus_tag="VSAL_I0403"
FT                   /note="PS00365 Nitrite and sulfite reductases
FT                   iron-sulfur/siroheme-binding site."
FT                   /inference="protein motif:ProSite:PS00365"
FT   CDS_pept        442904..443665
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="VSAL_I0404"
FT                   /old_locus_tag="TVS0214"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78089"
FT                   /db_xref="GOA:B6ELM6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELM6"
FT                   /protein_id="CAQ78089.1"
FT                   /translation="MPKLQLSELLSLNKVEQILRLAEINTELEQLTAQERVSWALDNLE
FT                   GKPAVSSSFGIQAAVMLQLVTDVKSDTPVILTDTGYLFPETYQFIDTLTERLNLNLQVF
FT                   TADETPMWQEARYGKLWEQGVDGLKHYNRLNKVQPMRRALDQLQVGVWFSGLRRDQSSS
FT                   RSHLPILSIQNGVFKFLPVIDWSNQEVHYYLEEKGLPYHPLRDEGYLSVGDTHTTQKWE
FT                   PGMKEEDTRFFGLKRECGLHEDDAEAEGSGI"
FT   misc_feature    443042..443563
FT                   /gene="cysH"
FT                   /locus_tag="VSAL_I0404"
FT                   /note="HMMPfam hit to PF01507, Phosphoadenosine
FT                   phosphosulfate reductase, score 1.8e-71"
FT                   /inference="protein motif:HMMPfam:PF01507"
FT   CDS_pept        complement(443742..444215)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0405"
FT                   /old_locus_tag="TVS0215"
FT                   /product="putative membrane protein"
FT                   /note="Expression may be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78090"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM7"
FT                   /protein_id="CAQ78090.1"
FT                   /translation="MTMKKTLILSTLAIALTAAAPANAFLSSLFGGGDDEAKTEQAAAS
FT                   NPLVGMLTDNLGISADQAAGGAGALLAMAGNGLSSSESSELNSMVPGLESLTGAIPGGL
FT                   GGMISNMDSVKTAFSALGLDPALISKFTPLITQYLTSQDASSGLLDSLTSLWK"
FT   misc_feature    complement(444129..444197)
FT                   /locus_tag="VSAL_I0405"
FT   sig_peptide     complement(444144..444215)
FT                   /locus_tag="VSAL_I0405"
FT   CDS_pept        complement(444332..444952)
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="VSAL_I0406"
FT                   /old_locus_tag="TVS0216"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78091"
FT                   /db_xref="GOA:B6ELM8"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM8"
FT                   /protein_id="CAQ78091.1"
FT                   /translation="MSEVKLETVEQRASYGIGLQMGQQLAQSGLEGLNVAAIAKGIATS
FT                   LTGDMPEIEVDAINEALQALHMRAEETRAEASKAAAADGETFLADNALRSEVTVLESGL
FT                   QYEVLTEGTGEIPTSDKTVRVHYHGMLTDGSVFDSSVERGQPAEFPVTGVIAGWVEALQ
FT                   LMPVGSKWKLSIPQDLAYGERGAGAAIPPYAALVFEVELLDIL"
FT   misc_feature    complement(444344..444619)
FT                   /gene="fklB"
FT                   /locus_tag="VSAL_I0406"
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomeras, score 3.5e-43"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    complement(444407..444493)
FT                   /gene="fklB"
FT                   /locus_tag="VSAL_I0406"
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00454"
FT   misc_feature    complement(444533..444580)
FT                   /gene="fklB"
FT                   /locus_tag="VSAL_I0406"
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:ProSite:PS00453"
FT   CDS_pept        445092..445754
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0407"
FT                   /old_locus_tag="TVS0217"
FT                   /product="opacity-associated protein A"
FT                   /function="This protein is required for efficient
FT                   nasopharyngeal mucosal colonisation in Haemophilus
FT                   influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78092"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELM9"
FT                   /protein_id="CAQ78092.1"
FT                   /translation="MNKKKKPNIKRPDFKVQLAVVQKKLEPIAARFSPFWDRLPAFHQK
FT                   ALMVLLPVTLVLVLLPSGNQEVDSATVESISPTMIPADEMQRQTVSLNLEGLSEQEEAI
FT                   RNAPSPYELEQEKSAEEITEVKTSPQERSAEKWHDYKIKEGDTLYQVFRKNNLSLTELN
FT                   KVLKVEGADKPLSNVKKGQLFRFKLNTRGDLDIIQIEREGQAVMYFRMSDGNFGRSK"
FT   misc_feature    445191..445280
FT                   /locus_tag="VSAL_I0407"
FT                   /note="HMMPfam hit to PF08525, Opacity-associated protein A
FT                   N-terminal moti, score 1e-08"
FT                   /inference="protein motif:HMMPfam:PF08525"
FT   misc_feature    445497..445751
FT                   /locus_tag="VSAL_I0407"
FT                   /note="HMMPfam hit to PF04225, Opacity-associated protein A
FT                   LysM-like domai, score 9.5e-50"
FT                   /inference="protein motif:HMMPfam:PF04225"
FT   CDS_pept        complement(445766..446635)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0408"
FT                   /old_locus_tag="TVS0218"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78093"
FT                   /db_xref="GOA:B6ELN0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN0"
FT                   /protein_id="CAQ78093.1"
FT                   /translation="MTQLKPQISPTNMAILLLVLGNLMASLSDVAVKVLEGGVSPFQYI
FT                   FIRQLVSLALIFPFWIKQPSAERQISNIKMTAIRAHVVLIGSGCMVVSITYLSLATANA
FT                   IFYTAPLIMIPLSMLLLKEKPSTKKIIQTLIGFLGVLIILRPSQFHWAAIFALGTAITL
FT                   ALFNILIRRIPSEQSVITTLLWTTLLSLPVSGTLAFLYWQPLTLHAFFWVALSASCIIT
FT                   YNGLATMAYKKAPATQISLAEYSGLIFVVLFGVWWFDEVPDSLTLVGIGLIIFPLMPKA
FT                   WLKNLRGK"
FT   misc_feature    complement(order(445787..445846,445862..445921,
FT                   445955..446023,446033..446101,446126..446185,
FT                   446195..446248,446273..446326,446339..446392,
FT                   446453..446512,446540..446599))
FT                   /locus_tag="VSAL_I0408"
FT   misc_feature    complement(446201..446569)
FT                   /locus_tag="VSAL_I0408"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 2e-16"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   sig_peptide     complement(446543..446635)
FT                   /locus_tag="VSAL_I0408"
FT   CDS_pept        complement(446635..447087)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0409"
FT                   /old_locus_tag="TVS0219"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78094"
FT                   /db_xref="GOA:B6ELN1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN1"
FT                   /protein_id="CAQ78094.1"
FT                   /translation="MIQWQKIPFSKLTTPQLYDLLRLRVDVFVVEQTCPYPELDGKDCV
FT                   DGVYHLIGIKNNEMVACARLLPPGTSYDHVSIGRVATKESARGHGFGHQLLSEALLHCE
FT                   ELWPGETIDIGAQEHLTHFYQKHGFTVISDMYLEDDIPHVDMRLEK"
FT   misc_feature    complement(446698..446937)
FT                   /locus_tag="VSAL_I0409"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.3e-11"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        complement(447153..447725)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0410"
FT                   /old_locus_tag="TVS0220"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78095"
FT                   /db_xref="GOA:B6ELN2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN2"
FT                   /protein_id="CAQ78095.1"
FT                   /translation="MLNDFIHRLQCYDFTAKEIEVLISKTKQTQLASKQIIIKQDDMTD
FT                   NLYFLIDGICHASYLTEHGKQFSKEFYWQGDWIICFESLVNNQTSPYTLETITPVTLLS
FT                   IPISFLKTWRAQSHPFYLQLLETQLMYKEKKERFMLLYSPQEKYQIFCQTYPALIEKLT
FT                   DYQIAAYLGITHISLSRIKGRIKNKLT"
FT   misc_feature    complement(447177..447242)
FT                   /locus_tag="VSAL_I0410"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1314.000, SD 3.66 at aa 162-183, sequence
FT                   LTDYQIAAYLGITHISLSRIKG"
FT   misc_feature    complement(447369..447644)
FT                   /locus_tag="VSAL_I0410"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 1.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   CDS_pept        complement(447735..449507)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0411"
FT                   /old_locus_tag="TVS0221"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78096"
FT                   /db_xref="GOA:B6ELN3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN3"
FT                   /protein_id="CAQ78096.1"
FT                   /translation="MVTSPFRLPRVTPFGLGESFAEWVTGLNRLDTHYQERPKGLNSFE
FT                   FMRYTLQCLDVTYDIHQGELDSIPTTGPVVIVANHPLGALEGVILAEMVGRVRPDVKVL
FT                   ANEYLKQIPEISELFIGVDVFETKQAKKTNANALREAHQHLANNGVLIIFPAGEVSTYN
FT                   KETKLLSDKRWSYSATKFIQKHNATTVPIYIDGRNSHTFYLAGKIHPLLRTLMLGREML
FT                   NKKENTINLSIGNPISHKELSGFNSPIETINYLRLNTYLLATNTDQTPQPEVKATALSP
FT                   IMPAINADILEKEIHGLPESAKLLEQSGLAVYCTKSQFIPAVIQEIGRIREVTFRDVGE
FT                   GTGLSCDLDEYDTHYYHLFIWHQENKEIVGSYRLGLVDELIEEFGLDGLYSRSLFNYQQ
FT                   PFINTLHNSIEVGRSVVAKKYQRNVSSLLLLWKGISTFVYQRPQYTHLFGPVSISNDYS
FT                   LSARQLIASTLTIHHYDNEKAALVSATTPLKPIIKKVWNGDMLSLLGDLKLLSKVLSRI
FT                   EKGKGLPVLLRQYIGLNGKLICFNVDPDFNDALDGLIVVDMSNVPHKTLSKYMGKEEAM
FT                   CYLEKHNRNNIHSK"
FT   misc_feature    complement(448923..449333)
FT                   /locus_tag="VSAL_I0411"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   3.7e-06"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   CDS_pept        complement(449511..449969)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0412"
FT                   /old_locus_tag="TVS0222"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78097"
FT                   /db_xref="GOA:B6ELN4"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN4"
FT                   /protein_id="CAQ78097.1"
FT                   /translation="MMKEKLLKYGPSVFIAFVFIQSLFFKFTGSYETDHIFGVLAEWSG
FT                   ITWFGVNGGYLIGTAELIASLLLFTRFHGLGAIMTVGIMSGAIFFHLFTPLGIQMPEFN
FT                   SVGNIIGYDGGLLFGMACLVWLCGVFLSVRDLKSDNGFLALLLNSKGI"
FT   misc_feature    complement(order(449577..449645,449688..449756,
FT                   449769..449837,449895..449951))
FT                   /locus_tag="VSAL_I0412"
FT   CDS_pept        complement(450040..450465)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0413"
FT                   /old_locus_tag="TVS0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78098"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN5"
FT                   /protein_id="CAQ78098.1"
FT                   /translation="MIMKKLLCLFMLIFSQSSFASDAIYTGFFSNKAIDGYDSVSYFTA
FT                   EKPLKGSSEFVTSYMDADWYFVSQENLNLFTANPTKYAPQYGGFCAWAVAEKNDRAPGD
FT                   PNQFSIVDGKLYLNYDAGVKTLWEKDIQGFITQGDKN"
FT   misc_feature    complement(450208..450339)
FT                   /locus_tag="VSAL_I0413"
FT                   /note="HMMPfam hit to PF04945, YHS domain, score 9.4e-05"
FT                   /inference="protein motif:HMMPfam:PF04945"
FT   CDS_pept        complement(450478..451224)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0414"
FT                   /old_locus_tag="TVS0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78099"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN6"
FT                   /protein_id="CAQ78099.1"
FT                   /translation="MCTVSWFNTPTGYELFFNRDEQRSRSDALTPQVFQENNVDYIMPI
FT                   DPVGGGSWISLNNHGISICLLNYYQGSTPPNNALSRGLLIKELATCHHIDSIQHVLSKM
FT                   DFSHFASFTLLIFPSTASNENNTVKGFRWDGQSFDSITPISPMISSSVDAKSVIEHRLS
FT                   VYKELTDSGVNRQTLNTFHQHHHVKLGHRSPCMHRQDAQTVSFTHIIVDNENNTLRYFS
FT                   GSPCQTKKYLAYDVPFHSYNNTHSYS"
FT   CDS_pept        complement(451224..451832)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0415"
FT                   /old_locus_tag="TVS0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78100"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN7"
FT                   /protein_id="CAQ78100.1"
FT                   /translation="MERRETTHSSISTDRLNKKEFLMPTLATQEVHQSPVISGCIDELT
FT                   KGVTLLNLINDSDYIHLALPYVESSIGKHFRHILDLFQALIKKEPTEPINYNVRRRGHP
FT                   IEKNKDIAITELNDTIDWLTHFPIEQLTSQVSLITEVCPYKKQDHIMLSSIEREITFAS
FT                   LHASHHYALIKVITLSIGINTQSTFGFAPTTTTYLRGEA"
FT   CDS_pept        complement(451784..452914)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0416"
FT                   /old_locus_tag="TVS0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78101"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN8"
FT                   /protein_id="CAQ78101.1"
FT                   /translation="MTNNTINTIAKGHINAGMPELESDTHRSVSPYEFLPSWFFYTPVV
FT                   IQSFFLGLKHFDFTLPLIANPSIKLSGMVGESKHDILNLAGPIAQQWISPFTTITTTND
FT                   PILQQTQNAIDEMNQHQLSFPVVAKPDLGCRGVGVKLIQSPKQLSDYFNSFPIHARFLI
FT                   QEKAPYAAEAGIFYVRYPNEKKGNIISITLKYSPLVVGDGISTLKQLIENDSRAGQLAH
FT                   LYLPRHEKKINMVLDEGKEFQLAFAGSHSRGSIFRDGNQYITDQLAERLDQIFNDLEGF
FT                   HYGRLDVKFKDIQSLMKGDDFTILEINGASSEAAHIWDRNTPLKTIFSTLLLQYKILFE
FT                   IGALQKKQGHHSPKIKELLAAWKEEKQLTLQYPPTD"
FT   CDS_pept        complement(452914..453504)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0417"
FT                   /old_locus_tag="TVS0227"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78102"
FT                   /db_xref="GOA:B6ELN9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELN9"
FT                   /protein_id="CAQ78102.1"
FT                   /translation="MNDLVANIQEALFTSHSSELSIFVGIILLSYLLEDLAIVTAASLS
FT                   AQEMVTPMIGLLAAFIGIASGDLGLYFLGRLSTRFRLLRYKTLTNAHLRYLRKKLQSNP
FT                   MLNLFIIRFIPGLRTIGFTLSGVFHIRVLTFLTAVMSATAVWTALVFPSVYFLGSSSWI
FT                   KASEHQWLLIPIMTLVLFATNRIAKKKISKELT"
FT   misc_feature    complement(order(452944..452997,453034..453102,
FT                   453115..453183,453283..453351,453379..453447))
FT                   /locus_tag="VSAL_I0417"
FT   CDS_pept        453631..454044
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0418"
FT                   /old_locus_tag="TVS0228"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78103"
FT                   /db_xref="GOA:B6ELP0"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP0"
FT                   /protein_id="CAQ78103.1"
FT                   /translation="MNKRFWLHLGTAIGLFGFFFIAAFVFHIYEVFYFFSFLAYGVLIF
FT                   NLLSAIVYADQWFHYVLCSVLLIILGTFASIDVLSARDELLTNWIEAEWLGLTVKNSDD
FT                   YIQVILILINIFTGSLAANTLFYGLCKKNSTVK"
FT   sig_peptide     453631..453792
FT                   /locus_tag="VSAL_I0418"
FT   misc_feature    order(453643..453711,453721..453789,453802..453870,
FT                   453943..454011)
FT                   /locus_tag="VSAL_I0418"
FT   CDS_pept        complement(454084..456066)
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="VSAL_I0419"
FT                   /old_locus_tag="TVS0229"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase
FT                   precursor"
FT                   /EC_number="3.1.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78104"
FT                   /db_xref="GOA:B6ELP1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP1"
FT                   /protein_id="CAQ78104.1"
FT                   /translation="MENTMKLSIKPLSLAVLGGLLTLSGCTPAETNEVIKLRIVETTDI
FT                   HTNLMDYDYYKDKPSQKIGLARTATLVKEARGEVINSVLVDNGDLLQGSPMGDYMADKG
FT                   LEEGEVHPAYKAMNQLSYDAGNIGNHEFNYGLDFLAESINDANFPYINANVYDAKTKEH
FT                   YFKPYIIKTHKFKDTAGVEHYIKVGYIGFVPPQIMVWDKKNLEGKVFVKDIIETANEII
FT                   PQMKSEGADVIVAIPHSGVSTNPYKQGEENSTYYLSEVEGIDAIAFGHSHAVFPGKGFD
FT                   NMQGIDNVNGTINGVAAVMPGRWGSHVGVMDLTLEQKDGKWIVAKSQAEARPIFDKENN
FT                   KSLAAADEGIVKALEADHKGTREFVNQPIGKADDVMYSFLALVQDDPTVQIVNLAQKDY
FT                   VERFIQGDPDLDGTPVLSAAAPFKAGGRGNDPTNFTEVESGQLTFRNAADLYLYPNTLV
FT                   AMKVTGKEVKEWLECSAGQFKQIDINSTAPQQLIDWDGFRTYNFDVIDGVNYQINVTQP
FT                   AKYDGDCNLINEGSERIIGLTYQGKPIDAKQDFLIATNNYRAYSGKFPGTGTDFIAFDS
FT                   PDENRTVLASYISRVSKEEGQVQPSADNNWSFAPIEGGENLDIRFETSPTEKATQFIKD
FT                   NGQYPMKQVATDDVGFAVYNINLSK"
FT   misc_feature    complement(454360..454965)
FT                   /gene="cpdB"
FT                   /locus_tag="VSAL_I0419"
FT                   /note="HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal
FT                   domain, score 3.2e-58"
FT                   /inference="protein motif:HMMPfam:PF02872"
FT   misc_feature    complement(455245..455958)
FT                   /gene="cpdB"
FT                   /locus_tag="VSAL_I0419"
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 8.7e-15"
FT                   /inference="protein motif:HMMPfam:PF00149"
FT   misc_feature    complement(455668..455703)
FT                   /gene="cpdB"
FT                   /locus_tag="VSAL_I0419"
FT                   /note="PS00786 5'-nucleotidase signature 2."
FT                   /inference="protein motif:ProSite:PS00786"
FT   sig_peptide     complement(455974..456066)
FT                   /gene="cpdB"
FT                   /locus_tag="VSAL_I0419"
FT   misc_feature    complement(455989..456021)
FT                   /gene="cpdB"
FT                   /locus_tag="VSAL_I0419"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        456434..457342
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="VSAL_I0420"
FT                   /old_locus_tag="TVS0230"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78105"
FT                   /db_xref="GOA:B6ELP2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELP2"
FT                   /protein_id="CAQ78105.1"
FT                   /translation="MDAKRLTHLQQLEAESIHIIREVAAEFDNPVMMYSIGKDSSVMLH
FT                   LARKAFYPGKIPFPLLHVDTDWKFKEMIEFRDKTAKKYGFDLLVHKNPEGIEMGISPFV
FT                   HGSSKHTDIMKTQGLKQALNQHGFDAAFGGARRDEEKSRAKERVYSFRDKNHTWDPKNQ
FT                   RPELWNTYNGQVNKGESIRVFPLSNWTELDIWQYIYLESIDIVPLYLAEKRPVVDRDGM
FT                   LIMVDDERMELKEGEKIEYKDIRFRTLGCYPLTGAVESKANTLPEIIEEMLVATSSERQ
FT                   GRAIDHDSSGSMEQKKRQGYF"
FT   misc_feature    456518..457204
FT                   /gene="cysD"
FT                   /locus_tag="VSAL_I0420"
FT                   /note="HMMPfam hit to PF01507, Phosphoadenosine
FT                   phosphosulfate reductase, score 2.6e-135"
FT                   /inference="protein motif:HMMPfam:PF01507"
FT   CDS_pept        457371..458807
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="VSAL_I0421"
FT                   /old_locus_tag="TVS0231"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78106"
FT                   /db_xref="GOA:B6ELP3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6ELP3"
FT                   /protein_id="CAQ78106.1"
FT                   /translation="MNSAVEQELAELGIEAYLSQHQHKSMLRFLTCGSVDDGKSTLIGR
FT                   LLHDSKQIYADQLEAVHADSQRVGTTGERPDLALLVDGLQAEREQGITIDVAYRYFSTQ
FT                   KRKFIISDTPGHEQYTRNMATGASTCDVAVILIDARKGVLDQTRRHSYIANLLGIRHFV
FT                   VAVNKMDLVDYSQSRFEEIKEEYVTFSKKLNNPNLDISILPLSALEGDNVVNHSAALAW
FT                   YKGAPLLEVLEDIDIDADRGNGEFRFPVQYVNRPNLDFRGFSGSVSSGEIKVGDDIIAL
FT                   PSGKKSKVARIVTFDGDLPSAQAGQAVTLTLEDEIDISRGDLLVKSTSNLTATDQFKAE
FT                   IVWMTEKGLQPGRQYDIKIAGKKTVGQIDAIHHQVNINSLETFVTDELPLNGIGLCDVS
FT                   LTEVVSLDRYQDCADTGGFIFIDRLTNVTVGAGMIQNLSELSDVAPINDNVSAFEVELN
FT                   ALVRKHFPHWGAQDISKLLS"
FT   misc_feature    457440..458084
FT                   /gene="cysN"
FT                   /locus_tag="VSAL_I0421"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 1.2e-69"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    457467..457490
FT                   /gene="cysN"
FT                   /locus_tag="VSAL_I0421"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    457614..457661
FT                   /gene="cysN"
FT                   /locus_tag="VSAL_I0421"
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:ProSite:PS00301"
FT   misc_feature    458148..458345
FT                   /gene="cysN"
FT                   /locus_tag="VSAL_I0421"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 2.9e-10"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   CDS_pept        458830..460557
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0422"
FT                   /old_locus_tag="TVS0232"
FT                   /product="ion transporter superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78107"
FT                   /db_xref="GOA:B6ELP4"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP4"
FT                   /protein_id="CAQ78107.1"
FT                   /translation="MPWEQGFVLALLTLIIVSLLASKLKPSVIFAGSAFIAFMVGMIDL
FT                   PSLAKNFTNSSLLTLVLLILSSCALEKTRLISWVGRYISEGRLGSVVGKLGLSTALLSS
FT                   FTNNTAVVVSLIGAIKRNQRHAPSRLLIPLSYAAILGGTLTLIGTSTNLIINSFVEDAG
FT                   LPSLSFFAPTAIGLVVLAGGLLILIPLSYLLPQYDDGSQDELPYFLEARVEGASPLVGK
FT                   SISENNLRALRKLFLAEVIREGRTITSVDPDMILLAGDRLLFCGDIESVTTLQEINGLT
FT                   LFGQHHLNGQNLIEVVVSQSASIRGKSIKSAHFRERFDAVVVAIRRGHERLEGGLGKIE
FT                   LQAGDTLVLVPGKNFEQSKQQLKREFVIISDLDSAAKLDGDKSTFVLLGFASVIAAALL
FT                   DVFPIIKGLSVYLLAMFAFGVVSLGELRRRFPIDIVVIVGAALSIAQLMLSSGLSVQLG
FT                   DMFIELFNGWGVMGALIAVYLITLVLTELITNNAAAALAFPIGYSMALGYGVDPMPFIM
FT                   AVLFGASASFISPYGYQTNLLVFSVGNYTLLDYVKVGLPMSIIYSVLVLSLIPHFFPF"
FT   sig_peptide     458830..458976
FT                   /locus_tag="VSAL_I0422"
FT   misc_feature    order(458842..458895,458908..458976,459118..459186,
FT                   459223..459291,459334..459402,459976..460044,
FT                   460057..460110,460129..460197,460210..460278,
FT                   460291..460359,460372..460440,460477..460545)
FT                   /locus_tag="VSAL_I0422"
FT   misc_feature    458851..460398
FT                   /locus_tag="VSAL_I0422"
FT                   /note="HMMPfam hit to PF03600, Citrate transporter, score
FT                   9.5e-05"
FT                   /inference="protein motif:HMMPfam:PF03600"
FT   misc_feature    458860..460548
FT                   /locus_tag="VSAL_I0422"
FT                   /note="HMMPfam hit to PF06808, DctM-like transporters,score
FT                   7.5e-05"
FT                   /inference="protein motif:HMMPfam:PF06808"
FT   misc_feature    459451..459666
FT                   /locus_tag="VSAL_I0422"
FT                   /note="HMMPfam hit to PF02080, TrkA-C domain, score
FT                   1.3e-11"
FT                   /inference="protein motif:HMMPfam:PF02080"
FT   misc_feature    459475..459498
FT                   /locus_tag="VSAL_I0422"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    459706..459921
FT                   /locus_tag="VSAL_I0422"
FT                   /note="HMMPfam hit to PF02080, TrkA-C domain, score
FT                   1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF02080"
FT   CDS_pept        460572..461204
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="VSAL_I0423"
FT                   /old_locus_tag="TVS0233"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78108"
FT                   /db_xref="GOA:B6ELP5"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP5"
FT                   /protein_id="CAQ78108.1"
FT                   /translation="MTTEQTKERQVVNDENVVWHQYSVTKETRSGLKKQKPVVLWFTGL
FT                   SGAGKSTIAGALEVKLAELGYHTYLLDGDNVRHGLCKDLGFSDHDRQENIRRIGELAKL
FT                   MSDAGLIVLSAFISPHRAERQIVRELLPENEFLEVFVNTSLDECEKRDPKGLYKKARAG
FT                   EIKHFTGIDSDYEQPLNPDIDLLAGTQSIDELVEQCLAVLKEKNIIQ"
FT   misc_feature    460677..461147
FT                   /gene="cysC"
FT                   /locus_tag="VSAL_I0423"
FT                   /note="HMMPfam hit to PF01583, Adenylylsulphate
FT                   kinase,score 1.2e-108"
FT                   /inference="protein motif:HMMPfam:PF01583"
FT   misc_feature    460701..460724
FT                   /gene="cysC"
FT                   /locus_tag="VSAL_I0423"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(461248..462144)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0424"
FT                   /old_locus_tag="TVS0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78109"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP6"
FT                   /protein_id="CAQ78109.1"
FT                   /translation="MDNKKNVIVNDAQNSKEKATHKKEHYVVSSERRLKEIAIKQGLGA
FT                   KLQAPKPEETLLKRALYREKLLREQQQNNLEQIIKYAHGYCSDETAGDPDPDWLHRFFE
FT                   MAKDIHDPSMQRLWSQIFKQEVVSPGATSMKALKVLKDMTQREAQTFQRAASLACSFGQ
FT                   DNSKKLLLGYKCAGTLFTFYKTEGPQLIHLGNYKLPYSSLLLLIDLGLLLGTELESGEI
FT                   EFEPALPLHYQGKQLAIKPMQKGSRLIYYRFSPTGAELCKLLGNKPNDSYYDSLTGLLS
FT                   QKFMVETDVKTSISTMV"
FT   CDS_pept        complement(462468..462953)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0425"
FT                   /old_locus_tag="TVS0235"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78110"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP7"
FT                   /protein_id="CAQ78110.1"
FT                   /translation="MKKKLLLCLLLLLPFSAFSDEVLKLDWIDLVPEQERHQFDAIGMP
FT                   KVNHNGAQMQQSLVGGVRQELNGSMVKIPGFVIPLEGDDKMITEFLLVPYFGACIHVPP
FT                   PPPNQIIYVKFKKGAPIQQLWDVVYIVGTLKTETIDSELAETGYLIDGVRLEEYDDE"
FT   sig_peptide     complement(462897..462953)
FT                   /locus_tag="VSAL_I0425"
FT   CDS_pept        complement(462963..464222)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0426"
FT                   /old_locus_tag="TVS0236"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78111"
FT                   /db_xref="GOA:B6ELP8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP8"
FT                   /protein_id="CAQ78111.1"
FT                   /translation="MVGILQLAWKSLKNRKTTVLLTVATIAISVMLLVGVERIRTQAKT
FT                   SFANTISNTDLIVGARSGQVNLLLYSVFRIGNATNNIDWKSYQEIISQRAVKWSIPISL
FT                   GDSHKGFRVMGTNQDYFRFYQYGKKQPLAFKEGKPFDDLFDVVLGADVAQKLNYHLGDK
FT                   LVIAHGISDKSFTRHDKLPFTVVGILKPTGTPVDKTLHVSLGAISAIHVGWESGAHLGN
FT                   TPDAKILEKQKFEPTEITAFMLGLKSKIQTFALQRYINDYTKEPLSAILPGIALHELWG
FT                   MMSVAEQALLAVSIFVVAAGLMGMLTSLLTSLQERRREMAILRAMGAQPKHIFILLVSE
FT                   AVVITSFGIIVGLIGLYLSLSILQPIIQQYYGIAIELTLPTLYELKLLALVLCSGFIIG
FT                   VIPAIQAYRHSLSDGMTIRL"
FT   misc_feature    complement(462990..463508)
FT                   /locus_tag="VSAL_I0426"
FT                   /note="HMMPfam hit to PF02687, Predicted permease, score
FT                   6.9e-27"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   misc_feature    complement(order(462996..463064,463158..463226,
FT                   463284..463352,464115..464168))
FT                   /locus_tag="VSAL_I0426"
FT   misc_feature    complement(464085..464135)
FT                   /locus_tag="VSAL_I0426"
FT                   /note="PS00358 Ribosomal protein L5 signature."
FT                   /inference="protein motif:ProSite:PS00358"
FT   sig_peptide     complement(464121..464222)
FT                   /locus_tag="VSAL_I0426"
FT   CDS_pept        complement(464216..464905)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0427"
FT                   /old_locus_tag="TVS0237"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78112"
FT                   /db_xref="GOA:B6ELP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELP9"
FT                   /protein_id="CAQ78112.1"
FT                   /translation="MNIIELSDLTFHWPNQKELTINIPFFSQKQGNKLFIKGPSGSGKS
FT                   TLLSLLTGIVSPTSGSVIINGTDINHLSSNQRDRFRADNIGYIFQQFNLLPYLSVIDNV
FT                   VLPYQFSSKSKLSKKELRQEAERLLTQLQLPRSHFDRPITDLSIGQQQRVAAARAFIGK
FT                   PTLIIADEPTSALDHETRFAFIKLLMNECENSQASLLFVSHDPSLESLFDQSIDLRTLN
FT                   TAGEYSW"
FT   misc_feature    complement(464249..464815)
FT                   /locus_tag="VSAL_I0427"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.9e-50"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(464771..464794)
FT                   /locus_tag="VSAL_I0427"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(464942..465583)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0428"
FT                   /old_locus_tag="TVS0238"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78113"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ0"
FT                   /protein_id="CAQ78113.1"
FT                   /translation="MLIRNKKILLSLAISSSLFSISNASNANTHDHAHDGDQQHESEHR
FT                   HHDAHVHGVVETNIAQDGDHLLFEITAPGADVVGFEHAPKDDTQKRILSEAVKTLNNPS
FT                   VIFTLPAEAKCTLEEAHVSHNLTPHDHDHDHDHDHDHDQHDGEHHKEHSKHGEFNAQYE
FT                   YHCEAISKLDNIETQWFTHFTHTQKMTIQYLGDAGQKADTLTPNSPIITL"
FT   sig_peptide     complement(465503..465583)
FT                   /locus_tag="VSAL_I0428"
FT   CDS_pept        complement(465635..465925)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0429"
FT                   /old_locus_tag="TVS0239"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78114"
FT                   /db_xref="GOA:B6ELQ1"
FT                   /db_xref="InterPro:IPR019731"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ1"
FT                   /protein_id="CAQ78114.1"
FT                   /translation="MQSYFFTKQRWLNWSLVILLALFGILVANHQIDTNIQHHENHHCQ
FT                   MFHSIGSGITAHVASLPIIPQLIISSTFTSVENSNPSSITVHSRAPPFSIL"
FT   misc_feature    complement(order(465719..465787,465845..465898))
FT                   /locus_tag="VSAL_I0429"
FT   sig_peptide     complement(465842..465925)
FT                   /locus_tag="VSAL_I0429"
FT   CDS_pept        complement(465991..466542)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0430"
FT                   /old_locus_tag="TVS0240"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78115"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ2"
FT                   /protein_id="CAQ78115.1"
FT                   /translation="MKKITLLTLAACLLPTLGFAHNITLNKTVPTVSIDNYGEIFFEDS
FT                   AATYQPWDSEQLKGKVRVLQAIAGRSSAKAMNTELMSAITLEKFPETQYQTTTIINQDD
FT                   SIWGTGGFVKSSAEESKEEFSWSSMVLDENGTAAKTWDLQPESSAIIVQNKEGNVLFVK
FT                   EGKLTSDEIKQVISLIHAQL"
FT   sig_peptide     complement(466483..466542)
FT                   /locus_tag="VSAL_I0430"
FT   CDS_pept        466791..467000
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0431"
FT                   /old_locus_tag="TVS0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="Expression may be stress-induced"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78116"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ3"
FT                   /protein_id="CAQ78116.1"
FT                   /translation="MFRNFKAYRPLQVARFVKTLFKGQIHIEGVGTFDFDEGKILMPSL
FT                   ENKRMLSVMSEVNQHIRQLSLMPA"
FT   misc_feature    466794..466997
FT                   /locus_tag="VSAL_I0431"
FT                   /note="HMMPfam hit to PF06526, Protein of unknown function
FT                   (DUF1107), score 3.9e-30"
FT                   /inference="protein motif:HMMPfam:PF06526"
FT   CDS_pept        complement(467069..467719)
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="VSAL_I0432"
FT                   /old_locus_tag="TVS0243"
FT                   /product="peptide methionine sulfoxide reductase MSRA"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78117"
FT                   /db_xref="GOA:B6ELQ4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ4"
FT                   /protein_id="CAQ78117.1"
FT                   /translation="MVIYSFYRVAQGKCLLNYSVKGCDMTMEKHTVQPLHFISQHDIES
FT                   IPTGCEQILFGMGCFWGTERLFWKLTGVYSTAVGYSGGKTKIPTYKDVCSGSTDHVEVV
FT                   KVVFNPALISLEELLHSFWQTHNPTQGMRQGNDIGTQYRSVIYTYDKNQQEIATHTKKQ
FT                   YQHALSQQGIEEPITTEITPANDFYFAEEYHQQYLAKNPNGYCGLSGTGVCFL"
FT   misc_feature    complement(467087..467569)
FT                   /gene="msrA"
FT                   /locus_tag="VSAL_I0432"
FT                   /note="HMMPfam hit to PF01625, Peptide methionine sulfoxide
FT                   reductase, score 1.9e-96"
FT                   /inference="protein motif:HMMPfam:PF01625"
FT   CDS_pept        467761..469482
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0433"
FT                   /old_locus_tag="TVS0244"
FT                   /product="surface antigen protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78118"
FT                   /db_xref="GOA:B6ELQ5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ5"
FT                   /protein_id="CAQ78118.1"
FT                   /translation="MTKKLSLFFTFCLFAISSNVSAETELDIEGLEGSLLSNVEAYISG
FT                   IPEEDYSVSLRFQARLEESTTDALKALGYYQPVITFTIEGEKSKHTLIMTVEEGEPVVI
FT                   YVSDIVITGEARNDIDFTNAVDSSGLNLGQVLNHGRYESLKSTLQNLALRKGYFDGEFS
FT                   VSRLEVAPGRHQAMVRLRYDSGKRYSFGETTIDGSQVEEKRVRSIIPFEPGDPYLASLV
FT                   GDLNQSLSNTEWFSSVYVEPDLDAVGETHQLPMKVHVSPQVRNQLETSIGYSTDVGARG
FT                   KIRWKNPWLNKYGHSLDTALSISKPEQEARISYKIPLEQVLKDYYIVKYGLKNVDNRDT
FT                   DSLESNLAFERHWVYDSGWHRTIYTRFLYEEFTQGIQDGTAWLVLPGISFSKSRTRGGT
FT                   MPMWGDKKAFTIEGTDEALTSDVRMLRLQAQGAIVRSIGENHRGVARADIGAIYTDDFY
FT                   KLPPSIRFFAGGDNSIRGYGYEEVSPKDSSGYLTGGQFMATTSLEYQYRVVGNWWLATF
FT                   IDYGDAWITTPDWKTGAGLGIRWASPVGPVRLDFAWGFDAEPGDEFKIHFTLGPEV"
FT   sig_peptide     467761..467826
FT                   /locus_tag="VSAL_I0433"
FT   misc_feature    468322..468546
FT                   /locus_tag="VSAL_I0433"
FT                   /note="HMMPfam hit to PF07244, Surface antigen variable
FT                   number repeat, score 5.6e-05"
FT                   /inference="protein motif:HMMPfam:PF07244"
FT   misc_feature    468625..469479
FT                   /locus_tag="VSAL_I0433"
FT                   /note="HMMPfam hit to PF01103, Surface antigen, score
FT                   5.4e-76"
FT                   /inference="protein motif:HMMPfam:PF01103"
FT   misc_feature    469267..469305
FT                   /locus_tag="VSAL_I0433"
FT                   /note="PS00213 Lipocalin signature."
FT                   /inference="protein motif:ProSite:PS00213"
FT   CDS_pept        469479..473276
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0434"
FT                   /old_locus_tag="TVS0245"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Vibrio fischeri Hypothetical outer
FT                   membrane protein UniProt:Q5E818 (1266 aa) fasta scores:
FT                   E()=0, 72.874% id in 1176 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78119"
FT                   /db_xref="GOA:B6ELQ6"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELQ6"
FT                   /inference="similar to sequence:UniProt:Q5E818"
FT                   /protein_id="CAQ78119.1"
FT                   /translation="MSSLSVNEEQNKPQLKKKRRFSRYCICLALFVPTIILMILLLIGA
FT                   LVFTNSGLKLIIWGAEKAVPELSIKNIDGSLIPEFTLSEVKYHNDDLLNADISRFHFGL
FT                   TAKCLLVPSLCIDDITIDGLVLDFPQLPTSPEDEATKAPTNNELLSIPIPINITKISIN
FT                   NIDATVLGNRIQWDSFSTGIKIYKSDLTITPLQWNRINLQLAESEKEKTKSKAPADKVS
FT                   DTPIVLPDVYVPLNIKVEQFSLRDFVLQQEALVKINQLDFKANIGENDIKVNDFYLDTP
FT                   QANLSLDNEISLQGDYPLTLNANAVIKETELKGHKVTIIAKGSVANLEASLNLTGGLKA
FT                   NVEANIHPLETTLPFDVHVYKTELYWPLSGVKEFKVSVPNIKAEGDLNQYKFASALYIE
FT                   GKTIPQTDLRLEGKGNLEKVELYDFMADTLGGSISGSAEADWASLVHWKADVHLQNIQP
FT                   GLQWPEAEGDISGELVTSGSLTKEGGWKVTVPTIDINGIFREYPLIIEGSLKADDVKGL
FT                   GEPYLEVAQLTLHHGDNGLTISGSLDKEWDLNVDIDFPELSDSVPDVHGQLMGNVALTG
FT                   KVTEPKINVDINAVELQLPQKTTLNKASIKGYVVPMPAIDADLSIKLLGGKYKKQTLKD
FT                   LVVRFSGKEHNHKLQIDLDSNVIQSHLLFNGSLERKKGWKGELSKADVVTEIGPWKLDK
FT                   KASLAYDIQKQELFVQANCWSQGKTSLCLNKDLVAGNSGSADVSIKHFEFSKIKKFLPE
FT                   ETNINGEVNLDALAKWAVGKPPYVKASLYLPKGNIEQEMETPLIVGWDKVNVNAEMKND
FT                   ELKSDWLIALTNNGELKGEMTVNQLTGSKKLNGYSNINTVSLAMLEPILGEYSQLEAMV
FT                   NSSIKVSGPIEHPKLFGDLSVDKIKVKGEISPVDISNGNINILFGGHSGKLTSLITTSD
FT                   GDLHLKGFGDWSALDAWKAGLDVFGNELQVNVPPMVKLKVKPDMKIRVIPTLAKITGSI
FT                   EIPWGRIVVKDLPESAIGVSKDEIILGDNLKPIESNTSLPMAVETDIDLSIGDDVLLSA
FT                   FGLEGGLVGKLNITQKNKGPFISGEINIEDGTYRSFGQDLQITKGKILFNGPADQPYVD
FT                   IEAIRNPDNTKDDVVAGVKVNGPADTPKVEIFSSPSMPQANALSYLLRGQDIDSDSGGN
FT                   AMTTTLIGLSLAKSGKVVGEIGKAFGVQDLQLDTAGSGGDSQVTISGYIAPDLQVKYGV
FT                   GIFNSLGEFTLRYRIVSDLYIEAISGLDNAVDLIYQFEFN"
FT   sig_peptide     469479..469625
FT                   /locus_tag="VSAL_I0434"
FT   misc_feature    469554..469622
FT                   /locus_tag="VSAL_I0434"
FT   misc_feature    470661..470684
FT                   /locus_tag="VSAL_I0434"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    472233..473000
FT                   /locus_tag="VSAL_I0434"
FT                   /note="HMMPfam hit to PF04357, Family of unknown function
FT                   (DUF490), score 5.9e-43"
FT                   /inference="protein motif:HMMPfam:PF04357"
FT   rRNA            473821..475357
FT                   /locus_tag="VSAL_I3107r"
FT                   /product="16S ribosomal RNA"
FT   rRNA            475688..478578
FT                   /locus_tag="VSAL_I3108r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            478672..478791
FT                   /locus_tag="VSAL_I3109r"
FT                   /product="5S ribosomal RNA"
FT   rRNA            479198..480734
FT                   /locus_tag="VSAL_I3110r"
FT                   /product="16S ribosomal RNA"
FT   tRNA            480806..480879
FT                   /locus_tag="VSAL_I3111t"
FT                   /product="transfer RNA-Ile"
FT   tRNA            480922..480994
FT                   /locus_tag="VSAL_I3112t"
FT                   /product="transfer RNA-Ala"
FT   rRNA            481267..484157
FT                   /locus_tag="VSAL_I3113r"
FT                   /product="23S ribosomal RNA"
FT   rRNA            484251..484370
FT                   /locus_tag="VSAL_I3114r"
FT                   /product="5S ribosomal RNA"
FT   tRNA            484466..484539
FT                   /locus_tag="VSAL_I3115t"
FT                   /product="transfer RNA-Asp"
FT   repeat_region   484654..486965
FT                   /note="VSa2"
FT   repeat_region   484654..484677
FT                   /note="IR of VSa2"
FT   CDS_pept        484735..485046
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0435"
FT                   /old_locus_tag="TVSa0112"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78120"
FT                   /db_xref="UniProtKB/TrEMBL:B6EKJ3"
FT                   /protein_id="CAQ78120.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINASTFLKVEALTSTIIATPQLPDIQLSIGKLRLTLPATEPHWIGLLLKGYQS"
FT   CDS_pept        485043..485390
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0436"
FT                   /old_locus_tag="TVSa0113"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78121"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ78121.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   CDS_pept        485462..486949
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0437"
FT                   /old_locus_tag="TVSa0114"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78122"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EHG8"
FT                   /protein_id="CAQ78122.1"
FT                   /translation="MTDKIKPLPDTIDELKALVLQLENKYNRLLEQFRLAQHQRFGKSS
FT                   ESDSTQFDLFNETEEEIIIENDDTQTITYTRQKPKRQRLPEDLPRTVIIHDIKDKTCKC
FT                   CGLEMHAMGKDISEKLEFVPAKVEVIQHVRPKYACRNCEKNNTSVDIKQAPMPASPIPK
FT                   GIATASLLAQIITAKFQYSLPLYRQETLFQQWGIIIGRRTMADWLIKCSVLFTPLNNEL
FT                   HRILLEQPTLHCDETTVNVLDVEKAKCYMWVYCSGYDSPGSGVLPGIVLYDYQSSRHGY
FT                   HPVNFLKGYNGYLHTDGYQGYEQTEAMLVGCWAHARRRFIEAQRVQVKGKTGSADWVLS
FT                   KIQKLYRIESLLKEASPEAKYVARQTEARDLLKELRDWLDSAVSRVSPKTKLGEAISYT
FT                   LNQWDKLVRYIDDGLLSIDNNRAERAVKPFVIGRKNWLFSGSTAGADSSAMLYSIVETA
FT                   KANGLIPYDYIRYCLDRLCVGSPDIDSLLPWNVKDKV"
FT   repeat_region   486942..486965
FT                   /note="IR of VSa2"
FT   repeat_region   complement(487011..488141)
FT                   /note="VSa1"
FT   repeat_region   complement(487011..487029)
FT                   /note="IR of VSa1"
FT   CDS_pept        complement(join(487024..487656,487704..487934,
FT                   487934..488119))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0438"
FT                   /old_locus_tag="TVS0262"
FT                   /product="transposase (fragment)"
FT                   /note="Similar to Shewanella oneidensis issod7,transposase.
FT                   UniProt:Q8CM19 (EMBL:AE014299) (440 aa) fasta scores:
FT                   E()=5e-36, 44.241% id in 382 aa. CDS contains frameshifts
FT                   and is truncated by the insertion of the upstream IS
FT                   element and subsequent recombination events"
FT                   /db_xref="PSEUDO:CAQ78123.1"
FT                   /inference="similar to sequence:UniProt:Q8CM19"
FT   repeat_region   488142..489402
FT                   /note="VSa11"
FT   CDS_pept        488216..488527
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0439"
FT                   /old_locus_tag="TVS0263"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78124"
FT                   /db_xref="GOA:B6ELR1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELR1"
FT                   /protein_id="CAQ78124.1"
FT                   /translation="MTKRIRRLFSTEFKLEAAQLVLDQNHSVAEVAKAMNVGKSTMDKW
FT                   VRQLKNERLGKSPKESPITPEQIEIRELKKKLARLEEHNSILKKATALLMSDSLNNSH"
FT   misc_feature    488231..488476
FT                   /locus_tag="VSAL_I0439"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 2.7e-16"
FT                   /inference="protein motif:HMMPfam:PF01527"
FT   misc_feature    488291..488356
FT                   /locus_tag="VSAL_I0439"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1720.000, SD 5.05 at aa 26-47, sequence
FT                   HSVAEVAKAMNVGKSTMDKWVR"
FT   CDS_pept        488524..489393
FT                   /transl_table=11
FT                   /transl_except=(pos:488524..488526,aa:Met)
FT                   /locus_tag="VSAL_I0440"
FT                   /old_locus_tag="TVS0264"
FT                   /product="transposase"
FT                   /note="CDS contanins a rare Leucine start codon (TTA)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78125"
FT                   /db_xref="GOA:B6ELR2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELR2"
FT                   /protein_id="CAQ78125.1"
FT                   /translation="MIEKLKQSYSISIICKVFDIHRSSYKYWREHLKEMIAEQVILRSE
FT                   VRAAHTARNGSAGARSIADILTNKGIKLSRYRASKLMKELEIVSCQIPKHKYNNEVKEH
FT                   IEIPNKLNRKFAATAPNKVWCGDVTYIWIGSRWAYLAIVMDLFSRKPIGWAMSLSPDST
FT                   LTGKALSMAFESRGRPKNVMFHSDQGCHYTSRQFRQLLWRYQIDQSLSRRGNCWDNSPM
FT                   ERFFRSLKSEWISKVGYRNVVEAKINIINYITSYYSTVRPHQYNGGLTPNESERIFWLN
FT                   SKAVASFT"
FT   misc_feature    488869..489351
FT                   /locus_tag="VSAL_I0440"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain,score
FT                   9.2e-44"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS_pept        complement(489668..490945)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0441"
FT                   /old_locus_tag="TVS0265"
FT                   /product="sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78126"
FT                   /db_xref="GOA:B6ELR3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELR3"
FT                   /protein_id="CAQ78126.1"
FT                   /translation="MSVYNTLCFLAAGAMLIAFFNSKIGKMQTTIAITAGSIMLSLAII
FT                   IAGHNGWFHLREIATETLTEINFEDFLLKGILGFLLFAGGLGIKLPHMKDQKWEITVLA
FT                   LGATLFSTFFIGFALWFICGFIGINFDLIYCLLFGALISPTDPIAVLAIVKKMNAPQRI
FT                   STQIEGESLFNDGFGLVIFVTLFTIAFGNETPTIGSVTSLFFQEAIGGIIYGFVLGLVF
FT                   HYLISSTNDHSMELLLTIGIPTAGYALADVIHVSGPLSMVVAGIMIGNWTRFIGFSKES
FT                   EEHLDHFWELVDEFLNGVLFLLIGMSMLLFKFHQEDWILMAISIPLVLTSRYLSVYVSY
FT                   IGFKRFRTYNPLSVKILTWGGLRGGLALAMALAIPSGIMVIPDKNIDVREIILVMTYSV
FT                   VVFSILVQGSTITNMIEKAKLLEKNK"
FT   misc_feature    complement(489695..490927)
FT                   /locus_tag="VSAL_I0441"
FT                   /note="HMMPfam hit to PF00999, Sodium/hydrogen exchanger
FT                   family, score 1.5e-51"
FT                   /inference="protein motif:HMMPfam:PF00999"
FT   misc_feature    complement(order(489707..489775,489803..489871,
FT                   489926..489994,490004..490063,490124..490192,
FT                   490268..490336,490373..490441,490484..490552,
FT                   490571..490639,490682..490750,490787..490855,
FT                   490883..490942))
FT                   /locus_tag="VSAL_I0441"
FT   sig_peptide     complement(490868..490945)
FT                   /locus_tag="VSAL_I0441"
FT   CDS_pept        491126..494806
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="VSAL_I0442"
FT                   /old_locus_tag="TVS0266"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78127"
FT                   /db_xref="GOA:B6ELR4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELR4"
FT                   /protein_id="CAQ78127.1"
FT                   /translation="MAGSMIKNQIEKQLLERILLIDGGMGTMIQEYKFEENDYRGERFI
FT                   DWHCDLKGNNDLLVLSNPSVIRDIHLAYLEAGADILETNTFNATTIAMADYDMESLSAE
FT                   INFEAAKLARKAADEWTLKTPHKPRYVAGVLGPTNRTCTLSPDVNDPGFRNVTFDGLVK
FT                   AYSESTRALIKGGSDLILIETIFDTLNAKACSFAVESVFEEMGITLPVMISGTITDASG
FT                   RTLSGQTTEAFYNALRHVKPISFGLNCALGPDELREYVGELSRISECSVSAHPNAGLPN
FT                   AFGEYDLSPEEMAEHVAEWARSGFLNLIGGCCGTTPEHIRQMAAAVEGVKPRVLPDIPV
FT                   ACRLSGLEPLTISKESLFVNVGERTNVTGSARFKRLIKEELYDEALSVAREQVENGAQI
FT                   IDINMDEGMLESEACMVRFLNLCASEPEISKVPVMVDSSKWEVIEAGLKCIQGKGIVNS
FT                   ISLKEGKEKFVEQAKLVRRYGAAVIVMAFDEKGQADTRERKIEICTNAYNILVNEVGFP
FT                   PEDIIFDPNIFAIATGIDEHNNYAVDFIEAVADIKRTLPHAMISGGVSNVSFSFRGNNY
FT                   VREAIQAVFLYHCFKHGMDMGIVNAGQLEIYDNVPEELREAVEDVVLNRRDDSTERLLD
FT                   IATAYLEKAVGKVEDKSALEWRTWTVEKRLEHSLVKGITDFIVDDTEEARVNSERPIHV
FT                   IEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAHLEPFINATKDVGSTNGKILL
FT                   ATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVSCEKILKVAKEENVDIIGLSGLITPS
FT                   LDEMVHVAKEMERQGFTVPLLIGGATTSKAHTAVKIEQNYSQPVVYVNNASRAVGVCTS
FT                   LLSNELKPAFIEKLDLDYDRVRDQHNRKIPRTKPITLERARANKVDIDWVSYTPPTPMK
FT                   PGVHIIDDVDIATLRKYIDWTPFFMTWSLMGKYPAILEHDEVGEEAKRLYKDANDLLDR
FT                   VDTEGLLKARGMCALFPAAGIGDDIEVYSDESRTTVVKVLHNLRQQTAKPKGFNYCLSD
FT                   YIAPKESGKKDWIGGFAVTGGIGERDLADAYKANGDDYNAIMIQAIADRLAEGFAEYLH
FT                   EKVRKEIWGYATDENLANDELIREKYQGIRPAPGYPACPEHTEKGALWELMKIEESIGM
FT                   SLTSSYAMWPGASVSGMYFSHPDSRYFAIAQIQKDQAESYAERKGWDMLEAEKWLGPNL
FT                   N"
FT   misc_feature    491177..492112
FT                   /gene="metH"
FT                   /locus_tag="VSAL_I0442"
FT                   /note="HMMPfam hit to PF02574, Homocysteine
FT                   S-methyltransferase, score 3.3e-151"
FT                   /inference="protein motif:HMMPfam:PF02574"
FT   misc_feature    492197..492844
FT                   /gene="metH"
FT                   /locus_tag="VSAL_I0442"
FT                   /note="HMMPfam hit to PF00809, Pterin binding enzyme,score
FT                   1.5e-70"
FT                   /inference="protein motif:HMMPfam:PF00809"
FT   misc_feature    493094..493357
FT                   /gene="metH"
FT                   /locus_tag="VSAL_I0442"
FT                   /note="HMMPfam hit to PF02607, B12 binding domain, score
FT                   1.2e-43"
FT                   /inference="protein motif:HMMPfam:PF02607"
FT   misc_feature    493370..493741
FT                   /gene="metH"
FT                   /locus_tag="VSAL_I0442"
FT                   /note="HMMPfam hit to PF02310, B12 binding domain, score
FT                   5e-28"
FT                   /inference="protein motif:HMMPfam:PF02310"
FT   misc_feature    494297..494710
FT                   /gene="metH"
FT                   /locus_tag="VSAL_I0442"
FT                   /note="HMMPfam hit to PF02965, Vitamin B12 dependent
FT                   methionine synth, score 9.4e-72"
FT                   /inference="protein motif:HMMPfam:PF02965"
FT   CDS_pept        complement(join(494875..495219,496227..497234))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="VSAL_I0443"
FT                   /old_locus_tag="TVS0267"
FT                   /product="lysine-sensitive aspartokinase III (pseudogene)"
FT                   /EC_number="2.7.2.4"
FT                   /note="Similar to Escherichia coli Lysine-sensitive
FT                   aspartokinase 3 LysC UniProt:P08660 (449 aa) fasta scores:
FT                   E()=1.7e-10, 57.407% id in 54 aa. CDS is disrupted by the
FT                   insertion of an IS element after codon 336"
FT                   /db_xref="PSEUDO:CAQ78128.1"
FT                   /inference="similar to sequence:UniProt:P08660"
FT   misc_feature    complement(order(495067..495219,496227..496304))
FT                   /gene="lysC"
FT                   /locus_tag="VSAL_I0443"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 0.00011"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   repeat_region   complement(495222..496226)
FT                   /note="VSa6"
FT   repeat_region   complement(495222..495240)
FT                   /note="IR of VSa6"
FT   CDS_pept        complement(495249..496130)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0444"
FT                   /old_locus_tag="TVS0268"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78129"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B6EH02"
FT                   /protein_id="CAQ78129.1"
FT                   /translation="MNKLVDIFCDVDDFCYQFLSQWEKYLVEASERKRKRQSVMSTSEC
FT                   MTIVIAFHQSNHRDFKNFYIGLVHQYWKGYFPNLLSYTRFVSKMPSLIAPMCAYFQSIK
FT                   GKPTGIAFVDSTSLKVCHNIRIPRHKVFDGVAKRGKGTMGWFFGFKLHLLINHLGEIIS
FT                   LKITAGNVNDRTPVPDLCKELSGKLYADKGYIGKKLSESLKNSDVDLVTTSRKNMKAKE
FT                   ISAFDKAMLSKRYIIETINDQLKNISQIEHSRHRSVTGFMLNVISGVVAYCLKKQKPRI
FT                   KLSECEFELILA"
FT   misc_feature    complement(495309..495803)
FT                   /locus_tag="VSAL_I0444"
FT                   /note="HMMPfam hit to PF01609, Transposase DDE domain,score
FT                   9.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   complement(496208..496226)
FT                   /note="IR of VSa6"
FT   misc_feature    complement(496395..497174)
FT                   /gene="lysC"
FT                   /locus_tag="VSAL_I0443"
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase
FT                   family,score 1.4e-27"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   misc_RNA        complement(497299..497473)
FT                   /locus_tag="VSAL_I3116s"
FT                   /product="lysine riboswitch"
FT                   /note="Lysine riboswitch (RF00168) predicted by Rfam,score
FT                   62.78"
FT   CDS_pept        497687..498796
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0445"
FT                   /old_locus_tag="TVS0270"
FT                   /product="aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78130"
FT                   /db_xref="GOA:B6ELR7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELR7"
FT                   /protein_id="CAQ78130.1"
FT                   /translation="MQSFIPPQRTLMGPGPSDVSPQVLQALSRPTIGHLDPLFIKMMDE
FT                   VKELLKYAFQTKNEFTIAVSAPGSAGMETCFVNLVERGEKVLVCRNGVFGERMRQNVER
FT                   CGGIAIVIDDEWGTPVSLAKVEEALIKDPEINVIAFVHAETSTGVLSDAKSISELAQKY
FT                   NCLTIVDAVTSLGGVPLFVDEWLLDAVYSGSQKCLSCIPGLSPVTFSNKAVEKMKSRKE
FT                   PVQSWFLDQSLVLGYWSGEGKRSYHHTAPVNSLYALHESLLMLKNEGLENAWKRHDHFH
FT                   QELKRGLESLGVSFIVDEKYRLPQLNAVYIPDGTDDALVRKVLLEEYNLEIGAGLGDLA
FT                   GKAWRIGLMGYAARKENVSLCLKALSDVL"
FT   misc_feature    497711..498769
FT                   /locus_tag="VSAL_I0445"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase
FT                   class-V,score 2.8e-13"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   misc_feature    498245..498307
FT                   /locus_tag="VSAL_I0445"
FT                   /note="PS00595 Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00595"
FT   CDS_pept        complement(498845..500602)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0446"
FT                   /old_locus_tag="TVS0271"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78131"
FT                   /db_xref="GOA:B6ELR8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B6ELR8"
FT                   /protein_id="CAQ78131.1"
FT                   /translation="MATLLTQGTQLEARKIKKPLTKSFLVSLSILFFVCAHFFQPNPGG
FT                   SGLHLAFNAASWIPASIAIAIAFYHIAKQGLIKYSTLTIVLFFSAVLLSVPLIYQDSSP
FT                   LLAAGKFFGLWAGWLFFLTLQQFAFSNKQKQWLLWCIIGSVLIEAIFGYIQYLFLESGN
FT                   SFGYNVISNRPYGIFQQPNVMASFLVTGLAIASYFLARQPIKYRENPVALTLLYITIIL
FT                   TLPLIIVLASRTGWIAAVFSLLLLIPYMWKYCTKKRFSSWVLALIMGVSGSFVILHFSQ
FT                   NDDFNNISLLSKKADLESPRRYTFPQALDMFLEKPITGYGNFEAAYILYTAKQHQISAD
FT                   YKSGLPSMDHPHNEVLYWGVEGGILAIFGLLLAAGGVLLKIRKSKLDTQFALLALISPI
FT                   FIHSQLEYPFYHSMLHWFTFIILLFWIDQLSCKYKKYRITGVSKISLRVSSLVLPIITA
FT                   FYMLSTLHTNWILTKFETTKPMNPEILNQVSNPVVWEDRFNWDVLSAQLSIGVINKRPD
FT                   LIIPYITWSKELIKNKPRPAFYQNLIIAYQALEQEANAEDIRREAVFLFPNNNFETVQL
FT                   DQKLRQIRK"
FT   misc_feature    complement(order(499193..499261,499325..499378,
FT                   499388..499447,499466..499534,499763..499831,
FT                   499850..499903,499913..499966,500003..500071,
FT                   500129..500197,500231..500299,500309..500368,
FT                   500387..500455,500483..500536))
FT                   /locus_tag="VSAL_I0446"
FT   misc_feature    complement(499499..499720)
FT                   /locus_tag="VSAL_I0446"
FT                   /note="HMMPfam hit to PF04932, O-Antigen Polymerase, score
FT                   6.5e-16"
FT                   /inference="protein motif:HMMPfam:PF04932"
FT   CDS_pept        complement(500682..503510)
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /old_locus_tag="TVS0272"
FT                   /product="UvrABC system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78132"
FT                   /db_xref="GOA:B6EM51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM51"
FT                   /protein_id="CAQ78132.1"
FT                   /translation="MDKIEVRGARTHNLKNISLTLPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARIGEPRCPEHHVELTAQTVSQMVDKALELPEGTKLMLLAPIIKERKGEHV
FT                   KTLENLAAQGFIRARIDGEVCDLSDPPTLELHKKHTIEVVVDRFKVRSDLQQRLAESFE
FT                   TALELTGGIAVIDYMDKTDNEPLIFSANFACPHCGYSMQELEPRLFSFNNPAGACGTCD
FT                   GLGVQQYFDADRIVLDNKLSIAEGAIKGWDQKNYYYFQMLTSLAEHYTFDLFSPFKSLS
FT                   KKIQQIILNGSGNEEVEFHYSNDRGDLRVKRHPFEGILNTLDRRYKETESSSVRDDLSK
FT                   YISTQSCSSCHGTRLRLEARSVFVADTTLSEICEMSIQDSMAFFSSLTLTGQKAQIADK
FT                   IMKEINERLNFLINVGLNYLNLSRGADTLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLKTLNHLRDLGNTVIVVEHDEDAIRSADHIIDIGPGAGVHGGYIVAEGD
FT                   YAAIINNPDSLTGQYLSGAKKIPVPKERVKADPKKQVELIGATGNNLKNVTLKLPVGLF
FT                   TCITGVSGSGKSTLINDTFFKIAHTQLNGATTSEPAPYKKIKGIEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGIFTPIRELFSGTPESRSRGYKPGRFSFNVRGGRCEACQGDGVIKVEM
FT                   HFLPDVYVPCDVCKSKRYNRETLEVKYKGKSIDEVLQMTIEDAHTFFAPVPVIARKLKT
FT                   LMDVGLSYIRLGQAATTLSGGEAQRVKLARELSKRDTGKTLYILDEPTTGLHFHDIQQL
FT                   LTVLHHLRERGNTIVVIEHNLDVVKTADWVVDLGPEGGNGGGEIIAEGTPEEVALVEGS
FT                   HTARFLKPMLSL"
FT   misc_feature    complement(500787..501614)
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.2e-40"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(500979..501023)
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(501570..501593)
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(501822..503441)
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.6e-08"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(502008..502052)
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(503397..503420)
FT                   /gene="uvrA"
FT                   /locus_tag="VSAL_I0447"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(503682..504551)
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="VSAL_I0448"
FT                   /old_locus_tag="TVS0273"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78133"
FT                   /db_xref="GOA:B6EM52"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM52"
FT                   /protein_id="CAQ78133.1"
FT                   /translation="MIKKCLFPAAGYGTRFLPATKSMPKEMMPIVNKPLIEYGVEEAIN
FT                   AGMDGICIVTGRGKHSLMDHFDKNYELEHQISGTNKEELLEDVRELIDAAHFTYIRQRE
FT                   MKGLGHAILTGRELIGDEPFAVVLADDLCVNEEQGVLSQMVALYKQFRCSIVAVEEVPD
FT                   NETHKYGVIAGEMIKDDLYRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFEIIEQTEPG
FT                   KGGEIQITDALLKQAQSGCVLAYKFKGKRFDCGSVEGYIQATNYCYENVYLKDKKSAEL
FT                   AKQTTGKK"
FT   misc_feature    complement(503742..504542)
FT                   /gene="galU"
FT                   /locus_tag="VSAL_I0448"
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl
FT                   transferase,score 3.6e-21"
FT                   /inference="protein motif:HMMPfam:PF00483"
FT   CDS_pept        complement(504688..505092)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0449"
FT                   /old_locus_tag="TVS0274"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78134"
FT                   /db_xref="GOA:B6EM53"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM53"
FT                   /protein_id="CAQ78134.1"
FT                   /translation="MDKKQQRLIANFYSALDGNISNELSFEQKKSIERAVIATGLGSNN
FT                   NIDIRKSVSFFNKRYFFVFLLGRDYRNKMRSESPLALFFMTLLTCFGVVALFGLAVVIL
FT                   YLIKSALGIDIFHNFSFGIWDWFKEVMHIS"
FT   misc_feature    complement(504787..504855)
FT                   /locus_tag="VSAL_I0449"
FT   CDS_pept        complement(505085..506215)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0450"
FT                   /old_locus_tag="TVS0275"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78135"
FT                   /db_xref="GOA:B6EM54"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM54"
FT                   /protein_id="CAQ78135.1"
FT                   /translation="MTTNITVIGTRGIPDVLGGVETHCQNLYPEIKTQFDTEICVIARS
FT                   PYVDYKKSTYRGVNTKAIWAPKKKSLEAIVHSTLSSFSTLFDRSNIVHVHAIGPGLVVP
FT                   LLRVLGKKVVFTHHGPDYDRQKWGGFAKRMLQLGERLAVTYATEVIVISDVINDIIKSK
FT                   YNRHDAHLVYNGVNLPTPLPQEKIDAVLTQFTLTENNYLVAVGRLVEEKGFHDLISAYE
FT                   KANIDIPLVIMGDTDHPTPYSEQLKAQAKHVDGVIMTGFLKGEQLQSIFSKAKAFVMPS
FT                   YHEGLPIALLEAMSYSLPAIVSNIPANLEVKLSPESYFPVGDIDSLTTALINHSIGSES
FT                   NVNYSQYLAHYDWHKIAGKTMAIYDTIEKKRTQHDG"
FT   misc_feature    complement(505163..505657)
FT                   /locus_tag="VSAL_I0450"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        complement(506219..507424)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0451"
FT                   /old_locus_tag="TVS0276"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78136"
FT                   /db_xref="GOA:B6EM55"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM55"
FT                   /protein_id="CAQ78136.1"
FT                   /translation="MKVRLVNKFFFMKGGAETVYFQERDMLLSEGIDIIEFSMNHEKNL
FT                   ESNYSYFFVNNVDYYQEQTLKNKITTAVNFIHNSEACIKFKQLLEQEKPDLVHFHNIYH
FT                   QLTPSIIKVAKQFGCKTVLTAHDTKIACPSYTMYRDGHTCEDCVHGSVFNATIHRCQES
FT                   SLIKSFLLSAEAIYQKVSGNYQQLDAIVSPSRFLGRFIQQKLPHNRVDIIVNGIDEHVS
FT                   NEGISDQGYFLYLGRLSTEKGVPTLAKAHQLMKENTALKIVGDGPVFNELKETYPRAEL
FT                   LGFKSGDELLTLIKQAKAVIVPSECYENCSMSVLEAMSYSKPVIASRIGGLPEQIRDGV
FT                   DGYLFEAGNAQALADKLDVLAASLSASAEMGKNARQRFLSKYTLTKHKTDLLNLYNELL
FT                   KG"
FT   misc_feature    complement(506294..506776)
FT                   /locus_tag="VSAL_I0451"
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group,
FT                   score 8e-33"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        complement(507421..508419)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0452"
FT                   /old_locus_tag="TVS0277"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78137"
FT                   /db_xref="GOA:B6EM56"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM56"
FT                   /protein_id="CAQ78137.1"
FT                   /translation="MTSSPFISVIIKTYNEESGIANTITSIQEHMSKYPHKIIVADSLS
FT                   TDKTQKIATQMGVTVVSLTNEEDRCCGVGHQLGYLHSEGDFLLLLDGDMKLESGFIDHG
FT                   ISFLLEHPEYAAVAGAVEMDDVDSYEFKSRKQRIHQIYPIGDCSHLGGGGLYRKSVIDE
FT                   IGYLTNRNLHAYEESELGMRLGLAGYKLHRLDVPYFSHTSYTMSSFELIKHRWKGGYLF
FT                   ASGELLKGSFGTPLFKKALSTVQNEAIFTLYLLLLISTLFTFNSLIIMLTALPLFAFIT
FT                   LKTIKNRSIKDALHSVINLSVFSAGLLRGLFLPLKSPTQPPQHKIINEGKK"
FT   misc_feature    complement(order(507475..507543,507580..507648))
FT                   /locus_tag="VSAL_I0452"
FT   misc_feature    complement(507925..508398)
FT                   /locus_tag="VSAL_I0452"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase family,
FT                   score 8e-17"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   CDS_pept        complement(508412..509794)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0453"
FT                   /old_locus_tag="TVS0278"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78138"
FT                   /db_xref="GOA:B6EM57"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM57"
FT                   /protein_id="CAQ78138.1"
FT                   /translation="MMPLNTGFFLQIYAVISLVLCGLTQYFTGISAILWLPFLLAFTMT
FT                   GLLFLQNRYTPLDLDHKEIIILVLFIGFFVQAVLSTFLQNGITTTIVGLKNELALSLIL
FT                   FCLLLRFCRESQIYRVTKTLYWIFYAQFPVILFQIFVILPKRVAAHGEYEKWDSVVGTF
FT                   GGDPMGGGNTAAMGLFCLLIMLLKLSEYKHGLCSIKSTILHIGAAFTLCILGEVKFVIL
FT                   LSPILLAYVWLAPSYIKGMKSYDIKIILAIIGGMLLLMSIAILLLSLSYSSAFGSDPSK
FT                   GPLDIFIGSLEYIFDPNYIMPTGELGRMTTIFFWLDNNDFYGLPNALFGYGLNTTNHGS
FT                   SVSPGFLNVLFNVILDTTALSVLLWELGIIGTLFFISMTLYILRVCKPTPLFNRDDVTQ
FT                   EDIRLMSYPPAFNAFAIACLLSLPYSQILMLVPMLQFIFYLSLGSNLVIRKSLITAAAN
FT                   HD"
FT   misc_feature    complement(order(508451..508519,508646..508714,
FT                   508985..509053,509096..509191,509228..509296,
FT                   509366..509425,509459..509527,509555..509608,
FT                   509645..509698,509708..509776))
FT                   /locus_tag="VSAL_I0453"
FT   CDS_pept        complement(509794..510999)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0454"
FT                   /old_locus_tag="TVS0279"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78139"
FT                   /db_xref="GOA:B6EM58"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM58"
FT                   /protein_id="CAQ78139.1"
FT                   /translation="MSLLKSVSTIAGASVISQIIGAVSIWLISHKYDMAQVGVYALVYS
FT                   VVLIGAQICTFASQLLLPKQSDSQVTQNIIFSLLQSVIIALPYTVIIIQFFDLNGYLLY
FT                   LLTLCHAWVLISENLLLRIENIRLLAFQRISISLLVIGAVALTQTTELFYVCWAIGLFI
FT                   LVSIWICHSVSFSKIRFSHFSLSNNVQFMKENRAHLSGIGSAEVLAMANNNLPTLLINF
FT                   WFSPLIAGYFAVVNRFCLAPVTIVGNAVRNSIFAKWSIDFRNNKFNYQEFKKVRLMLLI
FT                   LGLIATAGVLLFYPLIMQLGFNDEWLSSVPTSRYMLPYLLPALAVCPLTVIELVFGSPK
FT                   YFLRIQIEQLLVITIAFIIFPYFYHNYAYSVLLFSILSFVRYSFIYLKVNKRAHLLAQE
FT                   NK"
FT   misc_feature    complement(order(509845..509898,509908..509976,
FT                   509989..510057,510100..510168,510277..510345,
FT                   510475..510543,510562..510615,510712..510780,
FT                   510817..510885,510913..510981))
FT                   /locus_tag="VSAL_I0454"
FT   sig_peptide     complement(510934..510999)
FT                   /locus_tag="VSAL_I0454"
FT   CDS_pept        complement(join(511007..512431,513552..514313))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0455"
FT                   /old_locus_tag="TVS0280"
FT                   /product="putative chain length determinant protein
FT                   (pseudogene)"
FT                   /EC_number="2.7.10.2"
FT                   /note="Similar to Escherichia coli Tyrosine-protein kinase
FT                   etk UniProt:P38134 (726 aa) fasta scores:
FT                   E()=8.8e-08,19.214% id in 458 aa. CDS is disrupted by the
FT                   insertion of an IS element after codon 255"
FT                   /db_xref="PSEUDO:CAQ78140.1"
FT                   /inference="similar to sequence:UniProt:P38134"
FT   misc_feature    complement(511862..511921)
FT                   /locus_tag="VSAL_I0455"
FT   repeat_region   complement(512434..513555)
FT                   /note="VSa8"
FT   repeat_region   complement(512434..512462)
FT                   /note="IR of VSa8"
FT   CDS_pept        complement(512441..513007)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0456"
FT                   /old_locus_tag="TVS0281"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78141"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGL7"
FT                   /protein_id="CAQ78141.1"
FT                   /translation="MKFNNFSNILNSLIEMERTNKCELFYFDESGFSQKSNLPYCWGPI
FT                   GVQSLRPAHSHSKRLNVLGFLSRQGKLSFQTTEGRVTTDTVIDAFEHFINARKNDKPCF
FT                   IILDNASFHRSAKFKQKLHEWLMNDVLVCYLPPYSPELNIIEILWKKVKYEWLPCEAFK
FT                   TFEDLSINIKNILNYYGEKFTITFA"
FT   CDS_pept        complement(513025..513447)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0457"
FT                   /old_locus_tag="TVS0282"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78142"
FT                   /db_xref="GOA:B6EGL6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGL6"
FT                   /protein_id="CAQ78142.1"
FT                   /translation="MKAVNPLTDNEKITLKEAIANHPKNRVRIRAHAIILSDKGYSILA
FT                   LTDILDAKFETISSWIDHWEACGMLGLYDAVRIGRKPIYTEAEVYRLKSLVDEEPHQLK
FT                   RAQAILEEETGKKSSLDTIKRNIKKVITVTKEPDTH"
FT   repeat_region   complement(513527..513555)
FT                   /note="IR of VSa8"
FT   misc_feature    complement(513795..514274)
FT                   /locus_tag="VSAL_I0455"
FT                   /note="HMMPfam hit to PF02706, Chain length determinant
FT                   protein, score 2.2e-17"
FT                   /inference="protein motif:HMMPfam:PF02706"
FT   misc_feature    complement(514158..514226)
FT                   /locus_tag="VSAL_I0455"
FT   CDS_pept        complement(514317..514898)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0458"
FT                   /old_locus_tag="TVS0284"
FT                   /product="polysaccharide biosynthesis/export protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78143"
FT                   /db_xref="GOA:B6EM62"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM62"
FT                   /protein_id="CAQ78143.1"
FT                   /translation="MKSFFISFCLFISVLSHAYASETSPVKNTEIQKSDTTIQKDDLGY
FT                   VLGAGDSIQISVFKEPDMTLRLKIHRGGFVNFPYLGDVQLLGRTPAQIEKDIETKLADG
FT                   YIVQPMVTVSIESFRKFFISGEVANPNGYEFQPGLTVEQAIAMAGGFTDRSDRDGINVR
FT                   LAATNELIEDVGPTYPVGPGDVVIIEQSFF"
FT   misc_feature    complement(514443..514799)
FT                   /locus_tag="VSAL_I0458"
FT                   /note="HMMPfam hit to PF02563, Polysaccharide
FT                   biosynthesis/export protei, score 1.6e-33"
FT                   /inference="protein motif:HMMPfam:PF02563"
FT   sig_peptide     complement(514839..514898)
FT                   /locus_tag="VSAL_I0458"
FT   CDS_pept        complement(514899..516215)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0459"
FT                   /old_locus_tag="TVS0285"
FT                   /product="putative exported protein"
FT                   /note="Weakly similar to Vibrio parahaemolyticus CPS
FT                   biosynthesis protein CpsB UniProt:Q847V4 (402 aa) fasta
FT                   scores: E()=2e-14, 24.936% id in 393 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78144"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM63"
FT                   /inference="similar to sequence:UniProt:Q847V4"
FT                   /protein_id="CAQ78144.1"
FT                   /translation="MSVIPPIKLACTQRVLLLMFYMMSSFCYAALTPKPHIGPAGIEFQ
FT                   SNVDLDYGYDDNVNFQSEKAPHVTSDFFNLKPFLKLEGKRNADTYTVEYLGDYRQYQND
FT                   ATSDDYDDHTIRFIGSWEKGLNNDLLFTIENVLAHENRGEGLTDGLSAEQFKQYGIDDV
FT                   LKTNMLNTELRYSIDKQDSIGKLSFAAQYKEFSYDGRESNDVHKNNFNQYIKDQNWNQT
FT                   TFTIELFDQASSRTRFRYSIISNLRDYEEDNKKNTNETFLVAGIKSQQTGKTTIDANIA
FT                   WLYKTFPNQPDSQGFSGLNWDVDIAWSPVRYSTFHLFTDQRVEDPTEVGGYVLNTKYGT
FT                   RWEHFWWSNRFSSELGFNYETSADQHKNDGKTTTTTDAMAKLTYKFRPSIILELSYQQM
FT                   INTSDKEFDDFTINNSAETIIQTLGYDKSIIMFTTKVQI"
FT   sig_peptide     complement(516129..516215)
FT                   /locus_tag="VSAL_I0459"
FT   CDS_pept        complement(join(516193..517509,517517..517627))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="wcaJ"
FT                   /locus_tag="VSAL_I0460"
FT                   /old_locus_tag="TVS0286"
FT                   /product="colanic biosynthesis UDP-glucose lipid carrier
FT                   transferase (pseudogene)"
FT                   /note="Similar to Escherichia coli Putative colanic
FT                   biosynthesis UDP-glucose lipid carrier transferase
FT                   UniProt:P71241 (464 aa), E()=3.5e-63 id 48.387%; ungapped
FT                   id 51.429%; 372 aa overlap. Contains a framshift after
FT                   codon 37. The sequence has been checked and is believed to
FT                   be correct."
FT                   /db_xref="PSEUDO:CAQ78145.1"
FT                   /inference="similar to sequence:UniProt:P71241"
FT   misc_feature    complement(516196..516768)
FT                   /gene="wcaJ"
FT                   /locus_tag="VSAL_I0460"
FT                   /note="HMMPfam hit to PF02397, Bacterial sugar transferase,
FT                   score 1.1e-37"
FT                   /inference="protein motif:HMMPfam:PF02397"
FT   misc_feature    complement(order(516688..516753,517195..517263))
FT                   /gene="wcaJ"
FT                   /locus_tag="VSAL_I0460"
FT   CDS_pept        517928..518479
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="VSAL_I0461"
FT                   /old_locus_tag="TVS0288"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78146"
FT                   /db_xref="GOA:B6EM65"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM65"
FT                   /protein_id="CAQ78146.1"
FT                   /translation="MASRGINKVILVGNLGQDPEIRYMPSGGAVANITIATSESWRDKA
FT                   TGEQREKTEWHRVALFGKLAEVAGEYLRKGSQVYVEGQLQTRKWQDQSGQDRFTTEVVV
FT                   QGFNGVMQMLGGRGQGQGAPAGGQQQQQQGNWGQPQQPAQQNNFAPQQQQQQAPQQQAP
FT                   QAAQPQYNEPPMDFDDDIPF"
FT   misc_feature    517943..518269
FT                   /gene="ssb"
FT                   /locus_tag="VSAL_I0461"
FT                   /note="HMMPfam hit to PF00436, Single-strand binding
FT                   protein family, score 3.6e-37"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   misc_feature    517943..517981
FT                   /gene="ssb"
FT                   /locus_tag="VSAL_I0461"
FT                   /note="PS00735 Single-strand binding protein family
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00735"
FT   misc_feature    518084..518113
FT                   /gene="ssb"
FT                   /locus_tag="VSAL_I0461"
FT                   /note="PS00736 Single-strand binding protein family
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00736"
FT   CDS_pept        complement(518552..519181)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0462"
FT                   /old_locus_tag="TVS0289"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78147"
FT                   /db_xref="GOA:B6EM66"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM66"
FT                   /protein_id="CAQ78147.1"
FT                   /translation="MVIANCFAVISKQYLNYSHMETIIRLFDLDREMNVPTLYSSCAMI
FT                   VASILLGLIAYIHKQKKERHLAWAGLSGIFLFLALDEMTELHEMLVGPVRNSLHTTGAL
FT                   YFAWVIPYAVLLVIFALTYFKFLFRLPKTTRNLLVISGIVYVSGALMMELIGGAISQQY
FT                   GTDSLIYSISYSIEETLEMLGIAFLIYTTTTYISAQFPNLTMTIKK"
FT   misc_feature    complement(order(518579..518647,518705..518773,
FT                   518810..518878,518921..518989,519008..519076))
FT                   /locus_tag="VSAL_I0462"
FT   repeat_region   complement(519226..520339)
FT                   /note="VSa8"
FT   repeat_region   complement(519226..519254)
FT                   /note="IR of VSa8"
FT   CDS_pept        complement(519233..519799)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0463"
FT                   /old_locus_tag="TVS0290"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78148"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGL7"
FT                   /protein_id="CAQ78148.1"
FT                   /translation="MKFNNFSNILNSLIEMERTNKCELFYFDESGFSQKSNLPYCWGPI
FT                   GVQSLRPAHSHSKRLNVLGFLSRQGKLSFQTTEGRVTTDTVIDAFEHFINARKNDKPCF
FT                   IILDNASFHRSAKFKQKLHEWLMNDVLVCYLPPYSPELNIIEILWKKVKYEWLPCEAFK
FT                   TFEDLSINIKNILNYYGEKFTITFA"
FT   CDS_pept        complement(519817..520239)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0464"
FT                   /old_locus_tag="TVS0291"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78149"
FT                   /db_xref="GOA:B6EGL6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGL6"
FT                   /protein_id="CAQ78149.1"
FT                   /translation="MKAVNPLTDNEKITLKEAIANHPKNRVRIRAHAIILSDKGYSILA
FT                   LTDILDAKFETISSWIDHWEACGMLGLYDAVRIGRKPIYTEAEVYRLKSLVDEEPHQLK
FT                   RAQAILEEETGKKSSLDTIKRNIKKVITVTKEPDTH"
FT   repeat_region   complement(520311..520339)
FT                   /note="IR of VSa8"
FT   CDS_pept        520546..522531
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0465"
FT                   /old_locus_tag="TVS0292"
FT                   /product="putative membrane associated signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78150"
FT                   /db_xref="GOA:B6EM69"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM69"
FT                   /protein_id="CAQ78150.1"
FT                   /translation="MRKTPNLRLSNRLISFVTLMVSAAIFVLFVGGAISFKQIGTEYLD
FT                   HYLVGVVNVVDEELLEPEEATSMAKWLPKLLKASSVMSMELSSESGPIYAFQSLAILPD
FT                   DNLLYQKTYPLDLNKGYSITFKSLPPYSAFTYSLGALFSITAAIAIIVVSLLWGVVWLR
FT                   KQLYGSELLEERGRMLLAGKVDSYEVGSEEEWPATASLALDNVIAELKDARKERSRFDT
FT                   FIRTHTFLDQLTGSANRVLFDSKLESTLQESESQGVLLLLRINGWEDLIEEQGKRAGDE
FT                   LIVELGKQLNNLIQRYSDSVLSRYYTSEFALLIPQQSLKEAKLLSSQCLKMVEKIIPPT
FT                   SLDADNWCHIGVSMYVSGEQRGRLMNELDMAHRSALLQNNNSWSLFKKQQQLIESLGSV
FT                   RWRTLFDAIFEQEQLVLYKQTTFLFEGNNIIPLHLELFSRIKDENGIQIKASRFLPAIE
FT                   QVGYQIKLDSAVLKQAFPLLNDTEMSQHSFSVHLHIKSLQNSAFIRQLRDRLLQTPREE
FT                   LQRLSFELAEGQVVTHLDSVRPIAKMLKSFGCKLVVEQAGRTIVSTHYIKDLHVDYVKL
FT                   HRSLIKDIHQRYENQLFVRSLLGACETTGAQVIAVGIEKDKELKRLKELGVKGGQGRIF
FT                   EVETSLFHQQKKIAIPKRRNRWEKRY"
FT   sig_peptide     520546..520656
FT                   /locus_tag="VSAL_I0465"
FT   misc_feature    order(520582..520650,520957..521025)
FT                   /locus_tag="VSAL_I0465"
FT   misc_feature    521215..521691
FT                   /locus_tag="VSAL_I0465"
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 2.8e-10"
FT                   /inference="protein motif:HMMPfam:PF00990"
FT   misc_feature    521734..522459
FT                   /locus_tag="VSAL_I0465"
FT                   /note="HMMPfam hit to PF00563, EAL domain, score 1.2e-41"
FT                   /inference="protein motif:HMMPfam:PF00563"
FT   CDS_pept        522657..524120
FT                   /transl_table=11
FT                   /gene="mshI"
FT                   /locus_tag="VSAL_I0466"
FT                   /old_locus_tag="TVS0293"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin D
FT                   (MSHI)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78151"
FT                   /db_xref="InterPro:IPR016871"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM70"
FT                   /protein_id="CAQ78151.1"
FT                   /translation="MNMMDAFKKLTLSRSIKTTTSIVLLQGGIYIAKSDDDNQLKESHY
FT                   TEINHPQAWKEALVSACQQAGVSDCGANIIVGSHLYQSFQIEKPNIPKEELIGALPFLV
FT                   KDLITDRVSDIVADGIETSNGKLQVYISQIATIKSIVDLLQPFSIQVINITPDELTWAN
FT                   AKPEQDGFMLLCHSKSADFKLLAFNEGRLHLNRSLRGIKAPLTGDESSHFQLDNLALEL
FT                   QRSLDYLSAHSQGVNINHLYFRCDDEDDSTLSTELQNRLGVKVASLLVDEPRVFRAGEV
FT                   LSWLGLFNKPNINLYNDTLKPKTDYLTLPNALISWGVGMVLVGIIAGYYQWQLYGVENK
FT                   VALASSQESIYNQELIEVNKKLAGHKPSAAKLAAIKRLKDDINAKKASLKMIDNFDEGM
FT                   QVGYSGLMSSLTQIGKGNISLTKIYISGNDVNFTGFARTPDVVPSWIQSFESELHLVGR
FT                   TFAQLNIKTDEKGVVSFTLNTTVSKESNE"
FT   CDS_pept        524113..524751
FT                   /transl_table=11
FT                   /gene="mshJ"
FT                   /locus_tag="VSAL_I0467"
FT                   /old_locus_tag="TVS0294"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin D
FT                   (MSHJ)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78152"
FT                   /db_xref="GOA:B6EM71"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM71"
FT                   /protein_id="CAQ78152.1"
FT                   /translation="MNNWIKAKDAFLALSQREKMLIVIVGWVAVIFISLTLVIEPQMAK
FT                   TQKAEQQLSRVTNSISSLKQQIELAQFRLQKDPNLEINKEYKELTLQSQDLANILSKRV
FT                   AALVSPSQMAQLLETVLQKSSKLRLSSMSTLPSERLLDENSNAGYYIHPIKLVLSGSYF
FT                   DFEEYLSNLESLPVKYYWRNFQYKVKTYPNAELSIEVYTLGSSKGFIGG"
FT   misc_feature    524170..524229
FT                   /gene="mshJ"
FT                   /locus_tag="VSAL_I0467"
FT   CDS_pept        524753..525094
FT                   /transl_table=11
FT                   /gene="mshK"
FT                   /locus_tag="VSAL_I0468"
FT                   /old_locus_tag="TVS0295"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin D
FT                   (MSHK)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78153"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM72"
FT                   /protein_id="CAQ78153.1"
FT                   /translation="MKYFLLLFVLLASSINASEISAGHDPTEPLSWLKPEPQQKKIVKK
FT                   SQYFPSLQAINCNGSGNADCYAVLDDKSMKQGEKISGYTLLSINDDNVFIGRAGKRWEL
FT                   SLFSQDIKH"
FT   sig_peptide     524753..524803
FT                   /gene="mshK"
FT                   /locus_tag="VSAL_I0468"
FT   CDS_pept        525107..526747
FT                   /transl_table=11
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT                   /old_locus_tag="TVS0296"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin D
FT                   (MSHD)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78154"
FT                   /db_xref="GOA:B6EM73"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM73"
FT                   /protein_id="CAQ78154.1"
FT                   /translation="MKACKIIVGLMVASLAGCSMGHRDPTEIKQTLDQSINDNGGQLLD
FT                   DLPASIQADLMPDLNSSTVSIDEPVKRFRIKANGVSAKAFFTSLVKGTEYSVILHPDVS
FT                   GRITMNVNEVTLDEVLRSVEDLYGYEIIKSGKVLQVYPATIRTETIPVDYLQLTRKGRS
FT                   LTTITTGSITNSDSNSSNSNDSSNSNNSSSSSSSSSATGGTEIETTSESDFWKELEKAV
FT                   SVMIGNGSGRSVVVSPQASVITITASPDELRKVKQFLGISHKRLQRQVILEAKLLEVTL
FT                   SDGYQQGINWSNLTAAVGGTDIVFGQVPGTTAGVLPGMDAIGSLLGGQTNITVSDGNFS
FT                   AVLSFMDTQGDLNVLSSPRVTAANNQKAVIKVGRDEYFVTEVSSVTGNGDNSNASPEVT
FT                   LTPFFSGISLDVTPQIDDKGNVMLHVHPSVIDVETETKIIDLGDVGGVLELPLAKSSIR
FT                   ESDSVIRAKSGDVVVIGGLMKSQTVDQVSKVPFLGDIPVLGHLFRNVSQLTTKTELVIL
FT                   LKPTVVGVDTWQEELERSRDLLQEWFPDE"
FT   sig_peptide     525107..525175
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT   misc_feature    525128..525160
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    525389..525535
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT                   /note="HMMPfam hit to PF07660, Secretin and TonB N terminus
FT                   short domai, score 2.6e-08"
FT                   /inference="protein motif:HMMPfam:PF07660"
FT   misc_feature    525545..525826
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT                   /note="HMMPfam hit to PF07655, Secretin N-terminal
FT                   domain,score 6.2e-26"
FT                   /inference="protein motif:HMMPfam:PF07655"
FT   misc_feature    525917..526678
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT                   /note="HMMPfam hit to PF00263, Bacterial type II and III
FT                   secretion syst, score 6.2e-67"
FT                   /inference="protein motif:HMMPfam:PF00263"
FT   misc_feature    526511..526612
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0469"
FT                   /note="PS00875 Bacterial type II secretion system protein D
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00875"
FT   CDS_pept        526758..527606
FT                   /transl_table=11
FT                   /gene="mshM"
FT                   /locus_tag="VSAL_I0470"
FT                   /old_locus_tag="TVS0297"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin D
FT                   (MSHM)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78155"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM74"
FT                   /protein_id="CAQ78155.1"
FT                   /translation="MYESHFGLKQLPFTLTPNTSLFHGLLPHYEAIQTVLSAISMGEGV
FT                   IKVTGEIGTGKTLVCRMLMNQLPSNVELLYLPNPVMNGHELRQALAKELRIEQHGDDIA
FT                   LTDRIHEKIIELQALGKTAVVFLDEAQALSDEALETLRLFGNLETDYKKLLQIVLFGQP
FT                   ELDERLQQYHLRQLRQRITFSATLRPLTMSETVAYIRFRMTESGCEVNPFSLTQMKAIW
FT                   RATTGVPRLINQVCHKSLLISFSEQLIIVSSRSVFSAIKDTTDTMKPTYYFPKFWGWRK
FT                   A"
FT   misc_feature    526905..526928
FT                   /gene="mshM"
FT                   /locus_tag="VSAL_I0470"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        527603..528676
FT                   /transl_table=11
FT                   /gene="mshN"
FT                   /locus_tag="VSAL_I0471"
FT                   /old_locus_tag="TVS0298"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin D
FT                   (MSHN)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78156"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM75"
FT                   /protein_id="CAQ78156.1"
FT                   /translation="MSVTNKALLNITKAKSDVENTSTISPAIVPNMESRFKAPFFFAIG
FT                   LLSSISVLGWATLNNEPTPVTTPIANDAAVVELASNSPTKNSTPESVSSIYLSESRDKT
FT                   EKQAAKITTPVPTAIIKTASTAEKPTVKNENTVPVISTKQNVKSESDAFYVEEVELLPS
FT                   ELAEKSRSAARKALDESDFKQAILEYYTVLKYQPRDDDSRKKLAALLYGKHQVKEAAVV
FT                   LQQGIKLDNDSVTLRLALASLLQREEQPEAALSVVEYIPLEASIDYLATRGGLAQQLKF
FT                   IDLAKESYQMLVNKDPDNGRWWLGLAIVYEREAEIDKAYDTYQSALIKPGLSRSSQVFV
FT                   RDRIKLLETMKEVNNAS"
FT   CDS_pept        join(528666..529007,529011..530399)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="mshE"
FT                   /locus_tag="VSAL_I0472"
FT                   /old_locus_tag="TVS0299"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin E
FT                   (MSHE) (pseudogene)"
FT                   /note="Similar to Vibrio cholerae Mannose-sensitive
FT                   hemagglutinin E MshE (fragment) UniProt:Q56676 (535 aa)
FT                   fasta scores: E()=5.8e-27, 73.874% id in 111 aa. Contains a
FT                   nonsense mutation (GAA to TAA) after codon 114. The
FT                   sequence has been checked and is believed to be correct"
FT                   /db_xref="PSEUDO:CAQ78157.1"
FT                   /inference="similar to sequence:UniProt:Q56676"
FT   misc_feature    order(528789..529007,529011..529124)
FT                   /gene="mshE"
FT                   /locus_tag="VSAL_I0472"
FT                   /note="HMMPfam hit to PF05157, GSPII_E N-terminal
FT                   domain,score 1.9e-23"
FT                   /inference="protein motif:HMMPfam:PF05157"
FT   misc_feature    529200..530036
FT                   /gene="mshE"
FT                   /locus_tag="VSAL_I0472"
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 3.7e-109"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    529638..529661
FT                   /gene="mshE"
FT                   /locus_tag="VSAL_I0472"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    529815..529859
FT                   /gene="mshE"
FT                   /locus_tag="VSAL_I0472"
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00662"
FT   CDS_pept        530410..531636
FT                   /transl_table=11
FT                   /gene="mshG"
FT                   /locus_tag="VSAL_I0473"
FT                   /old_locus_tag="TVS0301"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78158"
FT                   /db_xref="GOA:B6EM77"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM77"
FT                   /protein_id="CAQ78158.1"
FT                   /translation="MAMFKYSGRNARGIQVSGRVESVSQEGAAEQLMNEGIIPTSIVAS
FT                   KFGSSSSTLDWKKWFQPNIPLDVLVIFCRQMYSLTKAGVPLLRAMNGLSQNSSNKILKK
FT                   ALDEVTSDLTNGRSLSVSMQQHPHVFSSLFVSMIHVGENTGRLDQALMQLASYYEQEME
FT                   TRKRIKSAMRYPIFVLSFILLAMFVLNVKVIPQFTSMFARFGVELPLPTRILMATSSFF
FT                   VNYWHVLIAAMAGAFCAFQAWISRDDGREKWDKFRLKVPIVGDIVTRAQMSRFSRTFAL
FT                   MLKSGVPLNQSLALSAEALGNKYLENRLLEMKNGIESGTSMSATAAQSGIFTPLVQQMI
FT                   AVGEETGQIDDLLLEVSDFYDREVDYDLRTLTARIEPLLLVVVAGMVLILALGIFLPMW
FT                   NMLDVVKGS"
FT   misc_feature    530623..530994
FT                   /gene="mshG"
FT                   /locus_tag="VSAL_I0473"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 5.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   misc_feature    order(530935..531003,531076..531144,531538..531606)
FT                   /gene="mshG"
FT                   /locus_tag="VSAL_I0473"
FT   misc_feature    531232..531600
FT                   /gene="mshG"
FT                   /locus_tag="VSAL_I0473"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 2.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   CDS_pept        531636..532088
FT                   /transl_table=11
FT                   /gene="mshF"
FT                   /locus_tag="VSAL_I0474"
FT                   /old_locus_tag="TVS0302"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin
FT                   protein MshF"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78159"
FT                   /db_xref="GOA:B6EM78"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM78"
FT                   /protein_id="CAQ78159.1"
FT                   /translation="MVSSSRIMWGTIFVILLATIMWQWNKMEPEVENAALIMTSRDILS
FT                   SANEYRNYWVVSGEPASIQKEGINVQFSALGWPIVFNDGKLDCRAWLTLLLPEKKTIYT
FT                   DSITITHEIKESNYNRCNYGIADGKMISVMLINDIFKVNVIFSETK"
FT   misc_feature    531639..531707
FT                   /gene="mshF"
FT                   /locus_tag="VSAL_I0474"
FT   CDS_pept        532170..532739
FT                   /transl_table=11
FT                   /gene="mshB"
FT                   /locus_tag="VSAL_I0475"
FT                   /old_locus_tag="TVS0303"
FT                   /product="type IV pilus, prepilin-like protein (MSHB)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78160"
FT                   /db_xref="GOA:B6EM79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM79"
FT                   /protein_id="CAQ78160.1"
FT                   /translation="MIMKRQKGFSLVELVIVIVVIGLLATVALPRFLDVSLEAKKASVE
FT                   GVAGGYATAVLSARAQWEAEARPKIDGYNAVSYDGTEFWLTDPSQANQSDFRPGYPMAP
FT                   REDLDGATTGGYPSELTSKECILLMEMLLQNAPYVTDDAKDEKAKYLAEIITDNSRKQC
FT                   KYTQQENEGHFFTYEPESGRVVVTLQ"
FT   misc_feature    532188..532259
FT                   /gene="mshB"
FT                   /locus_tag="VSAL_I0475"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 2e-07"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    532188..532256
FT                   /gene="mshB"
FT                   /locus_tag="VSAL_I0475"
FT   misc_feature    532188..532250
FT                   /gene="mshB"
FT                   /locus_tag="VSAL_I0475"
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:ProSite:PS00409"
FT   CDS_pept        532892..533365
FT                   /transl_table=11
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0476"
FT                   /old_locus_tag="TVS0304"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin A"
FT                   /note="Expression may be regulated by Fur"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78161"
FT                   /db_xref="GOA:B6EM80"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM80"
FT                   /protein_id="CAQ78161.1"
FT                   /translation="MKRQGGFTLIELVVVIVILGILAVTAAPKFLNLQGDARKSSLQGL
FT                   KGAMAGASGIVYGKAAIEGVERGDASGDSKLADGTTLKYGYPTADNNGIESVVVGLAED
FT                   WSRASVSGASSLLVGFKVSGATETTIKATKCFVTYNEATASSAVTTLVTDDGC"
FT   sig_peptide     532892..532969
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0476"
FT   misc_feature    532904..532975
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0476"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 5.9e-08"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    532904..532972
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0476"
FT   misc_feature    532904..532966
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0476"
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:ProSite:PS00409"
FT   CDS_pept        533617..534087
FT                   /transl_table=11
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0477"
FT                   /old_locus_tag="TVS0305"
FT                   /product="type IV pilus, mannose-sensitive hemagglutinin A"
FT                   /note="Putative duplicate of TVS0304"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78162"
FT                   /db_xref="GOA:B6EM81"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM81"
FT                   /protein_id="CAQ78162.1"
FT                   /translation="MKRQGGFTLIELVVVIVILGILAVTAAPKFLNLQGDARKSSLQGL
FT                   KGAMSGASGIVYGKSAINGVEGAISGSVDSIDVAFGYPTATSAGIATAVVGLSDDWTSF
FT                   PDATTTPKSYVSTFKKDTLSDVSEIRATECFVEYKEGVSGAAPIITVDDDKC"
FT   sig_peptide     533617..533694
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0477"
FT   misc_feature    533629..533700
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0477"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 5.9e-08"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    533629..533697
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0477"
FT   misc_feature    533629..533691
FT                   /gene="mshA"
FT                   /locus_tag="VSAL_I0477"
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:ProSite:PS00409"
FT   CDS_pept        534214..534828
FT                   /transl_table=11
FT                   /gene="mshC"
FT                   /locus_tag="VSAL_I0478"
FT                   /old_locus_tag="TVS0306"
FT                   /product="type IV pilus, prepilin-like protein (MSHC)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78163"
FT                   /db_xref="GOA:B6EM82"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM82"
FT                   /protein_id="CAQ78163.1"
FT                   /translation="MKVPRIKLQQIKRIKINGFTLIELIVVIVLLAIIAAYASSKYMGV
FT                   SRFSSAAAQEQVMSILRQIQVASMQTNIPINETSKDGVDECRILHLASDKFGVSQACQN
FT                   QNMNSAVLSDYSKETNQQQLELMKLSYEFTNSDGAISISQLSFDLLGRPIIPLSSATSS
FT                   LCSGEDCRITITTSSSNESRSVCINGEGFIYRSILDEGCGL"
FT   sig_peptide     534214..534372
FT                   /gene="mshC"
FT                   /locus_tag="VSAL_I0478"
FT   misc_feature    534259..534327
FT                   /gene="mshC"
FT                   /locus_tag="VSAL_I0478"
FT   misc_feature    534262..534333
FT                   /gene="mshC"
FT                   /locus_tag="VSAL_I0478"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 1.4e-06"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   CDS_pept        534825..535418
FT                   /transl_table=11
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0479"
FT                   /old_locus_tag="TVS0307"
FT                   /product="type IV pilus, prepilin-like protein (MSHD)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78164"
FT                   /db_xref="GOA:B6EM83"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM83"
FT                   /protein_id="CAQ78164.1"
FT                   /translation="MKGYKYNQQGLTLIESVVGIVILGFALSILVSGVFSSSEKSHKAT
FT                   YEAQAAALGHSIMTDILSRQFDQHSDPNGGLYRCGEKNESNTLIPCSVTLGRDGDEQNV
FT                   SVNASVFNDVDDFIGCWGKAELCSSNGLINYDFDKLIASDSANEYKNFTVEIQVNYANV
FT                   DGGSSVSPPYKKIDITLYASQHARYTFSAYRGNY"
FT   misc_feature    534849..534920
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0479"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 0.004"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    534849..534911
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0479"
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:ProSite:PS00409"
FT   misc_feature    534861..534929
FT                   /gene="mshD"
FT                   /locus_tag="VSAL_I0479"
FT   CDS_pept        535418..536173
FT                   /transl_table=11
FT                   /gene="mshO"
FT                   /locus_tag="VSAL_I0480"
FT                   /old_locus_tag="TVS0308"
FT                   /product="exported protein MshO"
FT                   /note="Weakly similar to Vibrio cholerae Hypothetical
FT                   protein MshO UniProt:Q9ZA95 (256 aa) fasta scores:
FT                   E()=2e-14, 28.846% id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78165"
FT                   /db_xref="GOA:B6EM84"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM84"
FT                   /inference="similar to sequence:UniProt:Q9ZA95"
FT                   /protein_id="CAQ78165.1"
FT                   /translation="MNRQRGFTLIELILTVVVVAIVAMAASNTLLLGFQSYSTSIDRQD
FT                   TQMQAKFVIEKFSRELRHAVPNSIDASNGGECVSFVSIEASAFYLSLPLVGEDSIDTVI
FT                   MSTNFLDLDNTRLTINPSTQKDLIEASSLRYVSVNSVSMSSGVSTINFSSNNNPAFISN
FT                   STSERAFFYQPEVIEYCIQDNGVYRSRINASGDRVSTVQLANQVSSGKFEFESASMHRN
FT                   STVRMVLAFTNGLDEVTQYQHDVQVMNVP"
FT   sig_peptide     535418..535492
FT                   /gene="mshO"
FT                   /locus_tag="VSAL_I0480"
FT   misc_feature    535430..535501
FT                   /gene="mshO"
FT                   /locus_tag="VSAL_I0480"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 8.7e-07"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    535430..535492
FT                   /gene="mshO"
FT                   /locus_tag="VSAL_I0480"
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT                   /inference="protein motif:ProSite:PS00409"
FT   misc_feature    535451..535519
FT                   /gene="mshO"
FT                   /locus_tag="VSAL_I0480"
FT   CDS_pept        536163..536597
FT                   /transl_table=11
FT                   /gene="mshP"
FT                   /locus_tag="VSAL_I0481"
FT                   /old_locus_tag="TVS0309"
FT                   /product="exported protein MshP"
FT                   /note="Weakly similar to Vibrio cholerae MshP
FT                   UniProt:Q9ZA94 (141 aa) fasta scores: E()=0.017, 28.676% id
FT                   in 136 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78166"
FT                   /db_xref="GOA:B6EM85"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM85"
FT                   /inference="similar to sequence:UniProt:Q9ZA94"
FT                   /protein_id="CAQ78166.1"
FT                   /translation="MFHNYAKQSGNILILSVIIMVVVGFLSLNLLKVETSNHDAVSKEV
FT                   LGTQAWFLAYSGAEWGLVQLFPIGVSGADSSLCDEEIHRPNMALNNSGCSSEPEVVCVA
FT                   TPVNHLGEVITYFKITSTAVCGSGINQVARIQEVWAKEIN"
FT   sig_peptide     536163..536258
FT                   /gene="mshP"
FT                   /locus_tag="VSAL_I0481"
FT   misc_feature    536193..536285
FT                   /gene="mshP"
FT                   /locus_tag="VSAL_I0481"
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00044"
FT   misc_feature    536196..536255
FT                   /gene="mshP"
FT                   /locus_tag="VSAL_I0481"
FT   CDS_pept        join(536597..538102,538105..540891)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="mshQ"
FT                   /locus_tag="VSAL_I0482"
FT                   /old_locus_tag="TVS0310"
FT                   /product="hypothetical protein MshQ (pseudogene)"
FT                   /note="Weakly similar to Vibrio cholerae MshQ
FT                   UniProt:Q9ZA93 (1252 aa) fasta scores: E()=1e-07, 21.483%
FT                   id in 917 aa. CDS contains a frameshift after codon 502.
FT                   The sequence has been checked and is believed to be
FT                   correct"
FT                   /db_xref="PSEUDO:CAQ78167.1"
FT                   /inference="similar to sequence:UniProt:Q9ZA93"
FT   misc_feature    538480..538503
FT                   /gene="mshQ"
FT                   /locus_tag="VSAL_I0482"
FT                   /note="PS00881 Protein splicing signature."
FT                   /inference="protein motif:ProSite:PS00881"
FT   CDS_pept        541014..542057
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="VSAL_I0483"
FT                   /old_locus_tag="TVS0312"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78168"
FT                   /db_xref="GOA:B6EM87"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM87"
FT                   /protein_id="CAQ78168.1"
FT                   /translation="MFKKLRGMFSNDLSIDLGTANTLIYVKGQGIVLDEPSVVAIRQDR
FT                   NGSAKSVAAVGHEAKRMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNSFL
FT                   RPSPRVLVCVPCGSTQVERRAIRESAQGAGAREVFLIDEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEI
FT                   GSAYPGDDVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQCPPE
FT                   LASDVSEHGMVLTGGGALLRDLDRLLTEETGIPVVVAENPLTCVALGGGKALEMIDMHG
FT                   GDLFSDE"
FT   misc_feature    541041..542036
FT                   /gene="mreB"
FT                   /locus_tag="VSAL_I0483"
FT                   /note="HMMPfam hit to PF06723, MreB/Mbl protein, score
FT                   2e-235"
FT                   /inference="protein motif:HMMPfam:PF06723"
FT   CDS_pept        542080..542937
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="VSAL_I0484"
FT                   /old_locus_tag="TVS0313"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78169"
FT                   /db_xref="GOA:B6EM88"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM88"
FT                   /protein_id="CAQ78169.1"
FT                   /translation="MTPIFGRGPSLQLRLFIAVMVSASLMLADSRLNAFSDIRYLLNSF
FT                   VSPIHYAANLPRTMFDGMYERFNSRNALMFENQKLKQDMFIQNSNLLLLEQLKQENSRL
FT                   RDLLGSPFIRDEKKLVTEVMAVDSAPYTHQVMIDKGQVDGVYEGQPVISDKGIVGQINY
FT                   VGAHNSRVLLLTDPNNAIPVQVVRNDIRVIASGKGNLNLMQLEHIPTNTDIEIGDLLVS
FT                   SGLGGRYPEGYPVGYISSIDNNNKRPFASIELETAVEFDKLRYLLLVWPTEIEGKIKEV
FT                   TNDE"
FT   misc_feature    542440..542788
FT                   /gene="mreC"
FT                   /locus_tag="VSAL_I0484"
FT                   /note="HMMPfam hit to PF04085, rod shape-determining
FT                   protein MreC, score 1.4e-37"
FT                   /inference="protein motif:HMMPfam:PF04085"
FT   CDS_pept        542927..543418
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="VSAL_I0485"
FT                   /old_locus_tag="TVS0314"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78170"
FT                   /db_xref="GOA:B6EM89"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM89"
FT                   /protein_id="CAQ78170.1"
FT                   /translation="MTSSHLMRGRVIIWLSFLIALILQAAPWPGTLEVLRPSWIILVTF
FT                   YWVLALPHRVNVGTAMILGILWDLLLGTTLGIRGMTMAILVYLVAANFKLLRNLALWQQ
FT                   AAIFSALTLLGKLLEFLGEFLVHDVSFNGHFLWAGVLNFILWPWLFLLMRRVRRHWSIR
FT                   "
FT   sig_peptide     542927..543001
FT                   /gene="mreD"
FT                   /locus_tag="VSAL_I0485"
FT   misc_feature    542945..543394
FT                   /gene="mreD"
FT                   /locus_tag="VSAL_I0485"
FT                   /note="HMMPfam hit to PF04093, rod shape-determining
FT                   protein MreD, score 2.4e-34"
FT                   /inference="protein motif:HMMPfam:PF04093"
FT   misc_feature    order(542957..543010,543038..543097,543131..543199,
FT                   543323..543382)
FT                   /gene="mreD"
FT                   /locus_tag="VSAL_I0485"
FT   misc_feature    543086..543217
FT                   /gene="mreD"
FT                   /locus_tag="VSAL_I0485"
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00041"
FT   CDS_pept        543428..544003
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0486"
FT                   /old_locus_tag="TVS0315"
FT                   /product="Maf-like protein"
FT                   /note="Putative inhibitor of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78171"
FT                   /db_xref="GOA:B6EM90"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM90"
FT                   /protein_id="CAQ78171.1"
FT                   /translation="MSNQLFLASGSPRRKELLQQLGYQFEIVTVDVEEQHQSHESPLEY
FT                   VERLSKDKAQAGLRVVEQNKNTIVPVLGSDTIVVIDGVILEKPTDFEDAKRMLLALSGR
FT                   QHQVMTAVTLMTPEKTRTKTVITQVWFKTLSEQEIKTYWESGEPCDKAGSYGIQGSGGR
FT                   FVSRIDGSYHAVMGLPLMETDQLLHQFL"
FT   misc_feature    543434..544000
FT                   /locus_tag="VSAL_I0486"
FT                   /note="HMMPfam hit to PF02545, Maf-like protein, score
FT                   3.7e-66"
FT                   /inference="protein motif:HMMPfam:PF02545"
FT   CDS_pept        544023..545492
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="VSAL_I0487"
FT                   /old_locus_tag="TVS0316"
FT                   /product="ribonuclease G"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78172"
FT                   /db_xref="GOA:B6EM91"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM91"
FT                   /protein_id="CAQ78172.1"
FT                   /translation="MSTELLINVTPSETRVAMIEAGVLQEIHVEREARRGIVGNIYKGR
FT                   VSRVLPGMQAAFIDIGLDKAAFLHASDIVPHTECVSENEKRQFQVRDISQLVHQGQDLV
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEKERNRLKNTVSDYCD
FT                   EFGGFIIRTAAEGAKEAEISQDAAFLKRLWHKVIERRKKSKTKSMLYGELGLDQRILRD
FT                   FVGTELDLIRVDSKQAFEKLKEFTTEFVPELTKKLEYYSGDKPIFDMYETENEIQRALD
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGRRNLEETIFNTNIEATQAIARQLRLRNL
FT                   GGIIIIDFIDMMSEEHRRRVLQVLGAALDKDRVKTNINGFTQLGLVEMTRKRTRESIEH
FT                   VLCGQCPTCEGRGAVKTVESVCYEILREITRVNRAYDSDKFVVYAAVAVADALQGEESH
FT                   ALAELELFIGKQVKIQAEPLYIQEQFDVVMM"
FT   misc_feature    544125..544388
FT                   /gene="cafA"
FT                   /locus_tag="VSAL_I0487"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain,score
FT                   2.9e-15"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS_pept        545504..549367
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0488"
FT                   /old_locus_tag="TVS0317"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78173"
FT                   /db_xref="GOA:B6EM92"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM92"
FT                   /protein_id="CAQ78173.1"
FT                   /translation="MTTKLIRTERCLMGLLLLVFLLAALVITSLRLLLPTLNKYQPEIE
FT                   QLLSQSTGFSISIGEVKGRWRNTNPSLNLTKLTATDPNTGDEIISVGSVEIQLNILSSL
FT                   WAQQPQFADLRIDKLTADLTSLGNDKSEENKLEVDDKNTEDSLSKRLEDLFLVRLNHFS
FT                   IKNSHVTFTALNGNEKTILIDSLQWRNESRKHLAEGVVSVLGSEINQLKVIANFKEKGT
FT                   FKSLDGDFYVEAQNIQITPWIKDNIQQEYGVTEGEVSVNAWLSFKNGQPIDALVEAAPS
FT                   YINWEEDKTIHKLSIESGVFELQPEKEGWKVISSGIQIKHEDDEWPELAGNFVWQPSKW
FT                   ILNLGHIDLENALGLKTLLPASQDEITNLLGTLNPKGDIDDIRVEYDATTGLNYSASIH
FT                   AAGMNQWELLPGFHKLDILVAGDETKGKAELSLVDDTLPYGDVFQAPLNIENAKVTAYW
FT                   KVNDEGWRLWSDYIDVSTPDLQAKGEFRLDFPKDKPSVLSFYAEADAFNADQTWRYLPT
FT                   LALGQDLTDYLSSAVQGGSAKTVQLLWYGELSDFPYTKYDGIFQIKVGLKDAKFSFDTA
FT                   WPPLTNLQLDLMFQNASMFLSSHSADLMGVHATRVTGQIANLAEDGKLTIRARANGSGK
FT                   AVREYMTATPLVDSVGAALNSIQIDNRVDALLRLDIPFNSEDVRAWGYADLANNHIELQ
FT                   SPNIELTNAKGRIEFDNDVVKAKGIKASLLGQPISLSFNGETQSDFYGVNIDVKGKWNI
FT                   DPLREYIDSPLIDKVKGTSIWDTSINLQMADVGFTYQIGMDAALNDIQSTLPYPLALEK
FT                   GSTDKAVLQVSGNAERLSGRLIFPDAKYQAEISIDKETPVIDASYLIVGRGNFKVSPIV
FT                   GHSASLNTKNLDADAWIEEPIQSKEKPSSGSKSKASSFPVIPMPTRIDTDIKSLRLASI
FT                   DWNDVNADIRKKSQGWYFQVQSQEVDGKATWKNNEALAVQLDNLHIFIPSLDNVDSEGG
FT                   LNYAKAKDPLISSFDREFFKLMPNLELTIKDTWVQGYKLGKVETKLHKKNDTFYLDTLN
FT                   IVSGKNKFSMTGDWKLNKESSKSSFSANASGDDNSELLARFGISTGIQNATYTMSANLN
FT                   WDGAPWRIKTNTLAGDLASTLDEGVITDVKGAARFLGLFSMDSIIRKMKLDFRDVFDDG
FT                   MAFNSITGSGEMRKGVFVSNNLVMDAVAGEMKIKGKADLNTRLVDAEVNFTPDLTSGIP
FT                   IITAFAVAPQTAIIVLAVATAISPVIDVITQVNYKVEGPLDAPTVKELSRSQGEYKLPE
FT                   SNE"
FT   sig_peptide     545504..545581
FT                   /locus_tag="VSAL_I0488"
FT   misc_feature    545537..545605
FT                   /locus_tag="VSAL_I0488"
FT   CDS_pept        549469..550233
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0489"
FT                   /old_locus_tag="TVS0318"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78174"
FT                   /db_xref="GOA:B6EM93"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM93"
FT                   /protein_id="CAQ78174.1"
FT                   /translation="MKQLKLNLKGLHQQGAKLALTPENTLVFGQKEDYEKHAEPLGKGP
FT                   LQEKLAKLAKHYHLWLIIGSFPIRNADGSLSSTCLVFNHDGDLVEHYHKLHMFDVDVED
FT                   GHQSYRESDTFTAGSEIKVVDTPIGKIGLSICYDVRFPQLYSELRQQGAEILIVPAAFT
FT                   KVTGYAHWDILLRSRAIENQCWLLAAGQWGSHGSGRETWGHSMVVDPWGNKVVTQREGT
FT                   GVIAAEIDKNQTTAIRKKMPVAQHARLACNIQ"
FT   misc_feature    549475..549951
FT                   /locus_tag="VSAL_I0489"
FT                   /note="HMMPfam hit to PF00795, Carbon-nitrogen
FT                   hydrolase,score 2.2e-27"
FT                   /inference="protein motif:HMMPfam:PF00795"
FT   misc_feature    549862..549924
FT                   /locus_tag="VSAL_I0489"
FT                   /note="PS01227 Uncharacterized protein family UPF0012
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01227"
FT   CDS_pept        550344..551789
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="VSAL_I0490"
FT                   /old_locus_tag="TVS0319"
FT                   /product="protein TldD"
FT                   /function="suppresses the inhibitory activity of the carbon
FT                   storage regulator (CsrA) in E.coli"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78175"
FT                   /db_xref="GOA:B6EM94"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM94"
FT                   /protein_id="CAQ78175.1"
FT                   /translation="MSLQEVEQSLLNQAGIGQQELSQTLSSIAKRDVDYADIYFQSCWH
FT                   ESLVLEDSIIKDGSFNIDRGVGIRAVAGEKTGFAYSDQINLDALKQSAKAARGIVQQGG
FT                   SGKVNAFTAQPIPQFYAPMNPLNSLDKQKKIALLQEVDVYIRAKEPLIQEVSVSISGVY
FT                   EQMLVAALDGTYAADIRPLVRLSISVLVQRGDKRERGSAGGGGRYGYDYFLTEVDGKSI
FT                   ALEFADEAIRQALVNLDAEAAPAGMMPVVLGSGWPGVLLHEAVGHGLEGDFNRKGSSVF
FT                   SGKLGDKVTSSVCTIVDDGTMLDRRGSLNVDDEGVPGQYNTLIENGVLKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLPGEHTPEEIISTVKKGIYAPNFGGGQVDIT
FT                   SGKFVFSASEAYLIEDGKITRPVKGATLIGSGIEAMQQISMVGNDLSLDRGVGVCGKAG
FT                   QSVPVGVGQPTLKLDALTVGGTE"
FT   misc_feature    550443..551339
FT                   /gene="tldD"
FT                   /locus_tag="VSAL_I0490"
FT                   /note="HMMPfam hit to PF01523, Putative modulator of DNA
FT                   gyrase, score 9.6e-89"
FT                   /inference="protein motif:HMMPfam:PF01523"
FT   CDS_pept        complement(551887..552426)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0491"
FT                   /old_locus_tag="TVS0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78176"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM95"
FT                   /protein_id="CAQ78176.1"
FT                   /translation="MKTMARKNQKAPWEEEEEIIWVSRTEMKNDMEAIQKLGEELVGLK
FT                   PAVLAKFPLSELLQIAIFDAQRFRNEAKRRQLQYIGKLMRLEDPEAIQAALDKVRNKHS
FT                   QTTIALQKLEILRDRMIETPDAVIEDLMVKYPEADRQRFRQLARQAKKEKESNKPPKAY
FT                   REIFQVLKDLYLAKDL"
FT   misc_feature    complement(551896..552417)
FT                   /locus_tag="VSAL_I0491"
FT                   /note="HMMPfam hit to PF04751, Protein of unknown function
FT                   (DUF615), score 1.7e-96"
FT                   /inference="protein motif:HMMPfam:PF04751"
FT   CDS_pept        552536..553879
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="VSAL_I0492"
FT                   /old_locus_tag="TVS0321"
FT                   /product="protein PmbA (protein TldE)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78177"
FT                   /db_xref="GOA:B6EM96"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM96"
FT                   /protein_id="CAQ78177.1"
FT                   /translation="MDAKAQMMNQKIELEAAVAKALEMATKHASAAEVAITKTTGISVS
FT                   TLMGEVENVEFNRDGALGITVYRGHRKGSASTSDLSDKAIQETVAAALDIANYTSEDPF
FT                   SGPAPKELMAQNIPDLDLFHPDDPEPDYAAQKAIEAEEAALAYHSSIKQSDGASYDSHY
FT                   GIKVYGNSHGMLASYPSSRHSISCSVIGVDKNGNMERDYSYTVARHRDDLWDAKKVGLD
FT                   AAERTVSRLDAQKLNTMKVPVMFSADVATGLIGHLVMAISGANLYRKSTFMLDKLNEKI
FT                   LPDWFNVSERPHILKGLASSPFDSEGLYTQDREIITDGVLATYLLTSYAARKLNMTPTG
FT                   HAGGIHNWFVKSTGQSFDQMLKTMGTGLLVTELMGQGVNTVTGDYSRGAAGFWVENGEI
FT                   QYPVSEITIAGNLAEMYQNIIAVGSDVETRSQIQTGSILIESMKIAGQ"
FT   misc_feature    552623..553507
FT                   /gene="pmbA"
FT                   /locus_tag="VSAL_I0492"
FT                   /note="HMMPfam hit to PF01523, Putative modulator of DNA
FT                   gyrase, score 3.8e-64"
FT                   /inference="protein motif:HMMPfam:PF01523"
FT   CDS_pept        complement(553963..555318)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0493"
FT                   /old_locus_tag="TVS0322"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78178"
FT                   /db_xref="GOA:B6EM97"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM97"
FT                   /protein_id="CAQ78178.1"
FT                   /translation="MQELQDFDQTHQTLQEVSNALDSGMFVHVRRLLQDMEPEDIAHLL
FT                   EASPRKSRNVLWQLTDPEDYGEILDELSEDVKDGIVSRMNPESIAEATEGMETDDVAYV
FT                   LRSLPNDLSREILSQMDTVDRFRVETALSYPEDTAGGMMNTDFITIRADVEIDVVLRYL
FT                   RMKGDLPESTDALYVLDEESRLIGHLSLTTLLTTQQDTLVSDVMSDADEAIPVNTDDGE
FT                   VANLFERRNWVSAPVVDENHLLLGRITIDDVVDVIREDAEHSMMSMAGMDDEEDTFAPV
FT                   VKSARRRSVWLGMNVLAALAAASVSNMFEATLAQMASIAVLMTIVPSMGGVAGNQTVAL
FT                   VIRGLAVGHIGDSNQKELLMKEAGIGLLNGILWASIIGGIVMVWKSDMMLGAIISAAML
FT                   VNLTVAGIAGVSIPLILKKMNIDPALAGGMALTTITDIIGLFAFLGLATILM"
FT   misc_feature    complement(order(553969..554037,554080..554148,
FT                   554167..554235,554293..554361,554380..554448))
FT                   /locus_tag="VSAL_I0493"
FT   misc_feature    complement(553978..554355)
FT                   /locus_tag="VSAL_I0493"
FT                   /note="HMMPfam hit to PF01769, Divalent cation transporter,
FT                   score 1.5e-14"
FT                   /inference="protein motif:HMMPfam:PF01769"
FT   misc_feature    complement(554545..554898)
FT                   /locus_tag="VSAL_I0493"
FT                   /note="HMMPfam hit to PF00571, CBS domain pair, score
FT                   2.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    complement(554902..555288)
FT                   /locus_tag="VSAL_I0493"
FT                   /note="HMMPfam hit to PF03448, MgtE intracellular
FT                   domain,score 4.7e-44"
FT                   /inference="protein motif:HMMPfam:PF03448"
FT   CDS_pept        complement(555630..555908)
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="VSAL_I0494"
FT                   /old_locus_tag="TVS0323"
FT                   /product="phosphocarrier protein NPr"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78179"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B6EM98"
FT                   /protein_id="CAQ78179.1"
FT                   /translation="MPISSRHLLIKNRLGLHARAAIKLVEMAQSFKATITITNDENLQA
FT                   TADGVMGLLMLDSAQGQYVDVSADGPDAVQALNAICELIEAGFDEDE"
FT   misc_feature    complement(555648..555902)
FT                   /gene="ptsO"
FT                   /locus_tag="VSAL_I0494"
FT                   /note="HMMPfam hit to PF00381, PTS HPr component
FT                   phosphorylation site, score 1.4e-23"
FT                   /inference="protein motif:HMMPfam:PF00381"
FT   CDS_pept        complement(555911..556765)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0495"
FT                   /old_locus_tag="TVS0324"
FT                   /product="ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78180"
FT                   /db_xref="GOA:B6EM99"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EM99"
FT                   /protein_id="CAQ78180.1"
FT                   /translation="MKLMVVSGNSGAGKSVALRVLEDLGYYCVDNLPVDLLAQFVESIQ
FT                   HSSQNVAVSVDIRNLPKDPSLLKNTLTELKKSHDVTVIFLDAEDKELIKRYSETRRLHP
FT                   LSLIGEQCSLEQAVELEKSILCHFKEDADLVLDTTSKSIHDLSETLRSRILGRESKELV
FT                   MVFESFGFKHGLPTDADYVFDVRFLPNPHWEPTLRPMTGLDKPVADYLEKHAEVIQLKE
FT                   QIQHFLMTWLPALEKNNRSYLTVAIGCTGGQHRSVYITQQLGEYFKQQGQQVQIRHKTL
FT                   ERH"
FT   misc_feature    complement(555914..556765)
FT                   /locus_tag="VSAL_I0495"
FT                   /note="HMMPfam hit to PF03668, P-loop ATPase protein
FT                   family, score 3.3e-153"
FT                   /inference="protein motif:HMMPfam:PF03668"
FT   misc_feature    complement(556721..556744)
FT                   /locus_tag="VSAL_I0495"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(556789..557235)
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="VSAL_I0496"
FT                   /old_locus_tag="TVS0325"
FT                   /product="nitrogen regulatory IIA protein, PTS system"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78181"
FT                   /db_xref="GOA:B6EMA0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA0"
FT                   /protein_id="CAQ78181.1"
FT                   /translation="MQLSTILSLDCTKSAVQCTSKKRALELISEIAAPQLGQNPQALFE
FT                   SLLNREKMGSTGIGNGIAIPHGRLHNCDTAVAVLIQCQEPIEFDSIDNRPVDVLFALLV
FT                   PDEQCKLHLKTLSSVAEKLNDKQILRQLRHAESDQELYQIFTSE"
FT   misc_feature    complement(556792..557223)
FT                   /gene="ptsN"
FT                   /locus_tag="VSAL_I0496"
FT                   /note="HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent
FT                   sugar phosph, score 1.4e-37"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   misc_feature    complement(557035..557085)
FT                   /gene="ptsN"
FT                   /locus_tag="VSAL_I0496"
FT                   /note="PS00372 PTS EIIA domains phosphorylation site
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00372"
FT   CDS_pept        complement(557237..557524)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0497"
FT                   /old_locus_tag="TVS0326"
FT                   /product="sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78182"
FT                   /db_xref="GOA:B6EMA1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA1"
FT                   /protein_id="CAQ78182.1"
FT                   /translation="MQINITGQNVELTDSLREYVDTKFQKLERFFEHIHNVHVVLKLEK
FT                   VHHVAEATLHVNQGDIHAHSDSEDMYAAIDGLVDKLIRQLNKHKEKLSSH"
FT   misc_feature    complement(557240..557521)
FT                   /locus_tag="VSAL_I0497"
FT                   /note="HMMPfam hit to PF02482, Sigma 54 modulation protein
FT                   / S30EA r, score 1.2e-45"
FT                   /inference="protein motif:HMMPfam:PF02482"
FT   CDS_pept        complement(557544..559013)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /old_locus_tag="TVS0327"
FT                   /product="RNA polymerase sigma-54 factor (sigma-N)"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78183"
FT                   /db_xref="GOA:B6EMA2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA2"
FT                   /protein_id="CAQ78183.1"
FT                   /translation="MKASLQLKMGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSNP
FT                   LLDVEEEQLSTPESLLSPEPTPEKETATAEQEPSVTDSSDVIDSNNISEELEMDASWDD
FT                   VYSANSGSTGLAIDDDTPLYQGETTESLQDYLMWQAELTPFTEVDRAIATTIIESLDEY
FT                   GYLTISLDDVLESIGNEEVELDEVEAVLKRIQHFDPLGVASRDLAECLMIQLATYPVDT
FT                   PWLPETQLILTKHINLLGNRDYRQLAKETKLKEYDLKQVMMLIHQLDPRPGNRVIDTDT
FT                   EYVIPDVSVFKHNGKWVVTINPDSVPRLKVNAEYAALGKGLGNSPDGQFIRTNLQEAKW
FT                   LIKSLESRNETLLKVARCIVEHQQDFFEYGEEAMKPMVLNDIALDVEMHESTISRVTTQ
FT                   KFMHTPRGIFELKYFFSSHVSTDSGGECSSTAIRALVKKLVAAENQAKPLSDSKIATLL
FT                   AEQGIQVARRTIAKYRESLGIAPSNQRKRLL"
FT   misc_feature    complement(557553..558032)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="HMMPfam hit to PF04552, Sigma-54, DNA binding
FT                   domain, score 3.2e-112"
FT                   /inference="protein motif:HMMPfam:PF04552"
FT   misc_feature    complement(557592..557615)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="PS00718 Sigma-54 factors family signature 2."
FT                   /inference="protein motif:ProSite:PS00718"
FT   misc_feature    complement(557820..557885)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1190.000, SD 3.24 at aa 377-398, sequence
FT                   MVLNDIALDVEMHESTISRVTT"
FT   misc_feature    complement(557829..557888)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="PS00717 Sigma-54 factors family signature 1."
FT                   /inference="protein motif:ProSite:PS00717"
FT   misc_feature    complement(558066..558662)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="HMMPfam hit to PF04963, Sigma-54 factor, core
FT                   binding domain, score 1.4e-103"
FT                   /inference="protein motif:HMMPfam:PF04963"
FT   misc_feature    complement(558861..559007)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="HMMPfam hit to PF00309, Sigma-54 factor, Activator
FT                   interacting do, score 1.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00309"
FT   misc_feature    complement(558879..558998)
FT                   /gene="rpoN"
FT                   /locus_tag="VSAL_I0498"
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00041"
FT   CDS_pept        complement(559040..559765)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0499"
FT                   /old_locus_tag="TVS0328"
FT                   /product="ABC transport protein, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78184"
FT                   /db_xref="GOA:B6EMA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA3"
FT                   /protein_id="CAQ78184.1"
FT                   /translation="MAILEAKNLAKTYGSRKVVSDVSLTVESGKIVGLLGPNGAGKTTS
FT                   FYMIVGLVSRDEGSITIDGVDISLQPMHNRSKMGIGYLPQEASIFRKLSVFDNIMAVLQ
FT                   TRKDLSKAERLDKLEELLDEFNIQHIRNSNGMALSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIQHLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHMIANGTPE
FT                   HVLNDEHVKRVYLGDQFKL"
FT   misc_feature    complement(559127..559681)
FT                   /locus_tag="VSAL_I0499"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-59"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(559310..559354)
FT                   /locus_tag="VSAL_I0499"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(559637..559660)
FT                   /locus_tag="VSAL_I0499"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(559768..560268)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0500"
FT                   /old_locus_tag="TVS0329"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78185"
FT                   /db_xref="GOA:B6EMA4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA4"
FT                   /protein_id="CAQ78185.1"
FT                   /translation="MKLSHVSLLAGLLFSSSSWALSTDTEQPIHINSDTQNFDMQSNRV
FT                   TFNGDVTLKQGSIKIFADKLIVIRPQGQEGREILEAYGKPARFSQLTDDGKTLRGKANK
FT                   LRYELENEFLTMTDNAELTQDDSVIQGKVITYNMKTQKLIADGGKDERVTTILQPSQLN
FT                   KKQ"
FT   misc_feature    complement(559843..560265)
FT                   /locus_tag="VSAL_I0500"
FT                   /note="HMMPfam hit to PF03968, OstA-like protein, score
FT                   6.8e-60"
FT                   /inference="protein motif:HMMPfam:PF03968"
FT   sig_peptide     complement(560209..560268)
FT                   /locus_tag="VSAL_I0500"
FT   CDS_pept        complement(560249..560812)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0501"
FT                   /old_locus_tag="TVS0330"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78186"
FT                   /db_xref="GOA:B6EMA5"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA5"
FT                   /protein_id="CAQ78186.1"
FT                   /translation="MTLKHLFMTLLLLIASWSGYYLYYEYAKSEQQVIPDLQTPVFTGK
FT                   NVSNNNYDENGVRNYQINAKALARFAQTGNTNFTIPHLFVFKEGKVKEWEIISDVGVLN
FT                   KDHTLYLTGNVIIKNLLPEAAFDTMTTDSMTIELTTKDFMTDDVVNLVGPTFETTGVGM
FT                   KGNFTSQQTTLLENVQGIYEAFTR"
FT   misc_feature    complement(560264..560791)
FT                   /locus_tag="VSAL_I0501"
FT                   /note="HMMPfam hit to PF06835, Protein of unknown function
FT                   (DUF1239), score 1.3e-56"
FT                   /inference="protein motif:HMMPfam:PF06835"
FT   misc_feature    complement(560741..560800)
FT                   /locus_tag="VSAL_I0501"
FT   CDS_pept        complement(560809..561366)
FT                   /transl_table=11
FT                   /gene="kdsC"
FT                   /locus_tag="VSAL_I0502"
FT                   /old_locus_tag="TVS0331"
FT                   /product="3-deoxy-d-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78187"
FT                   /db_xref="GOA:B6EMA6"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA6"
FT                   /protein_id="CAQ78187.1"
FT                   /translation="MPTMIETLYGEVEESILSIAKTIKLLICDVDGVFSDGLVYMGNDG
FT                   EELKTFHTRDGYGVKSLMSAGVEVAIITGRNSQIVENRMRALGISLIYQGQDNKLQAYE
FT                   DILTKLNIAPEHTGYIGDDLIDWPVMEKVALKVCVADGHPLLVKRANYVTTIKGGHGAV
FT                   REVSDLILEAKGELEQHKGLSI"
FT   CDS_pept        complement(561366..562340)
FT                   /transl_table=11
FT                   /gene="kdsD"
FT                   /locus_tag="VSAL_I0503"
FT                   /old_locus_tag="TVS0332"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78188"
FT                   /db_xref="GOA:B6EMA7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA7"
FT                   /protein_id="CAQ78188.1"
FT                   /translation="MATQFDFCKAGKNVLQIEIDALTQLNNYINDDFTKACQLMLECKR
FT                   KVVIMGMGKSGHIGKKIAATLASTGTPSFFVHPGEASHGDLGMIEKGDVILAISNSGEA
FT                   AEILALLPVIKRQGITLITMTSKSSSSMANVADVNLLITVPQEACPLALAPTSSTTATL
FT                   VMGDALAMALLEARGFTSDDFALSHPGGALGRKLLLHLADIMHTDDELPMVTSDALIKT
FT                   ALLEVSEKGLGMTAIVDEDQKVIGIFTDGDLRRLLDNRIDIHTQTIGEVMAHTPSVASP
FT                   NLLAVEGLNLMQDKKINGLLLCDENNRLVGALNMHDLLKAGVM"
FT   misc_feature    complement(561372..561728)
FT                   /gene="kdsD"
FT                   /locus_tag="VSAL_I0503"
FT                   /note="HMMPfam hit to PF00571, CBS domain pair, score
FT                   1.4e-22"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    complement(561822..562232)
FT                   /gene="kdsD"
FT                   /locus_tag="VSAL_I0503"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 9.5e-36"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS_pept        complement(562544..563512)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0504"
FT                   /old_locus_tag="TVS0333"
FT                   /product="sodium/calcium exchanger protein"
FT                   /note="Similar to Escherichia coli Inner membrane protein
FT                   YrbG UniProt:P45394 (325 aa) fasta scores:
FT                   E()=9e-44,44.688% id in 320 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78189"
FT                   /db_xref="GOA:B6EMA8"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA8"
FT                   /inference="similar to sequence:UniProt:P45394"
FT                   /protein_id="CAQ78189.1"
FT                   /translation="MTELLMPSLLLVVGLSLLVWGADKLVFGSAALAKNYGISPLVIGM
FT                   TILAMGSSAPEMMVSAAAALDGKTDTAVGNVIGSNIANIALILGITALIKPLAISSGII
FT                   RRELPLMLIVTLLAGGIMYDNYLGFNEGILLVALFIAFILAMLYISRKEQPNGDTLLNE
FT                   QESEIPDGVPNGKAIFWVVVGLALLPLGANMLIDNAVIIAKHFGMSDLVIGLTIIAIGT
FT                   SLPELAASVAGVLKGEDDMAVGNIIGSNVFNILAVMGIPALLHPSSISEYIMSRDFYVM
FT                   LGVSVLLLIMALGKSRSINRIEGGILVTCFLIYQGFLFYTM"
FT   misc_feature    complement(order(562550..562609,562628..562681,
FT                   562724..562792,562811..562879,562907..562975,
FT                   563066..563134,563144..563212,563231..563299,
FT                   563342..563410,563447..563503))
FT                   /locus_tag="VSAL_I0504"
FT   misc_feature    complement(562559..562957)
FT                   /locus_tag="VSAL_I0504"
FT                   /note="HMMPfam hit to PF01699, Sodium/calcium exchanger
FT                   protein, score 5.8e-42"
FT                   /inference="protein motif:HMMPfam:PF01699"
FT   misc_feature    complement(563075..563467)
FT                   /locus_tag="VSAL_I0504"
FT                   /note="HMMPfam hit to PF01699, Sodium/calcium exchanger
FT                   protein, score 2.9e-36"
FT                   /inference="protein motif:HMMPfam:PF01699"
FT   misc_feature    complement(563306..563329)
FT                   /locus_tag="VSAL_I0504"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   sig_peptide     complement(563450..563512)
FT                   /locus_tag="VSAL_I0504"
FT   CDS_pept        563711..564517
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0505"
FT                   /old_locus_tag="TVS0334"
FT                   /product="toluene tolerance protein Ttg2A"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78190"
FT                   /db_xref="GOA:B6EMA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMA9"
FT                   /protein_id="CAQ78190.1"
FT                   /translation="MDTQPILVKVDNLTFRRGNRVIFDDISLFVPKGKITAIMGPSGIG
FT                   KTTLLRLIGGQILPESGDIHFEGWNIPKLGRKALYLARKKMGMLFQSGALFTDMNVFDN
FT                   VAFPLREHTQLSEEFIRTLVLLKLEAVGLRGASELMPSELSGGMARRAALARAIALDPD
FT                   LIMYDEPFVGQDPITMGVLVELIRNLNDALGLTSVVVSHDVPEVMSIADHVYLLANGKI
FT                   IAQGSPFELENNPDPQVRQFLDGRSDGPVPFRFPSKPLVEELFPGE"
FT   misc_feature    563807..564370
FT                   /locus_tag="VSAL_I0505"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.2e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    563828..563851
FT                   /locus_tag="VSAL_I0505"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    564140..564184
FT                   /locus_tag="VSAL_I0505"
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   CDS_pept        564510..565304
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0506"
FT                   /old_locus_tag="TVS0335"
FT                   /product="toluene tolerance protein Ttg2B"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78191"
FT                   /db_xref="GOA:B6EMB0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMB0"
FT                   /protein_id="CAQ78191.1"
FT                   /translation="MSNFSLILFVENIGKRALSTCEAIGRATFMLFGAIIAKPQPVRMF
FT                   PLLLQQLYSVGVLSLVIIVVSGLFIGMVISLQGYVILVDYGAETSLGQLVSLSLLRELG
FT                   PVVTALLFAGRAGSALTAEIGLMKTTEQLSSMEMMAIDPLRRIIAPRLWAGVISMPLLA
FT                   MIFMAVGIWGGQIVGVEWKGIDHGSFWSVMQASVDVRHDIVNSLIKCVVFAFVVTWIAL
FT                   FNGYDATPTSEGISLATTRTVVHSSLAVLGIDFVLTALMFGN"
FT   misc_feature    564558..565295
FT                   /locus_tag="VSAL_I0506"
FT                   /note="HMMPfam hit to PF02405, Domain of unknown function
FT                   DUF140, score 1.6e-117"
FT                   /inference="protein motif:HMMPfam:PF02405"
FT   misc_feature    order(564663..564731,564963..565031,565116..565178,
FT                   565236..565295)
FT                   /locus_tag="VSAL_I0506"
FT   CDS_pept        565307..565801
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0507"
FT                   /old_locus_tag="TVS0336"
FT                   /product="toluene tolerance protein Ttg2C"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78192"
FT                   /db_xref="GOA:B6EMB1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMB1"
FT                   /protein_id="CAQ78192.1"
FT                   /translation="MQQTRKIELLVGFFVLAGAAALLMLLLKVADVRSGGSGEYYTINA
FT                   QFDNIGSLKSRSPVKIGGVVVGRVSGITLDIESYLPVVSMQIDKQFGQFPETSAAQILT
FT                   AGLIGEQYVGIVPGFIDEDIDMLGEGDYIEDTKSALVLEDMIGQVLYSIGGDSSEKSED
FT                   K"
FT   sig_peptide     565307..565396
FT                   /locus_tag="VSAL_I0507"
FT   misc_feature    565325..565384
FT                   /locus_tag="VSAL_I0507"
FT   misc_feature    565421..565660
FT                   /locus_tag="VSAL_I0507"
FT                   /note="HMMPfam hit to PF02470, mce related protein, score
FT                   4.5e-18"
FT                   /inference="protein motif:HMMPfam:PF02470"
FT   CDS_pept        565801..566442
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0508"
FT                   /old_locus_tag="TVS0337"
FT                   /product="toluene tolerance protein Ttg2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78193"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMB2"
FT                   /protein_id="CAQ78193.1"
FT                   /translation="MKLGMKIVGIILSLFIGVAQAEPIDKTKPYEMMTKVSEDTFARLK
FT                   AEQVAIQKDPNILKTVVEEELMPYVNVKYAAYKLLGPHLKKTTAAEREQFVTAFRGYLV
FT                   SSYAQVLTLYTDQKIELEKPKAIPEKKSIISVRVDILDSARPTVKVDFKLRKNKKTSEW
FT                   QAFDMVAEGVSLLSTKQSEWSAKIRKEGIESVSKELTSLAAQPIRLEGSK"
FT   sig_peptide     565801..565863
FT                   /locus_tag="VSAL_I0508"
FT   misc_feature    565870..566409
FT                   /locus_tag="VSAL_I0508"
FT                   /note="HMMPfam hit to PF05494, Toluene tolerance,
FT                   Ttg2,score 1.7e-63"
FT                   /inference="protein motif:HMMPfam:PF05494"
FT   CDS_pept        566442..566762
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0509"
FT                   /old_locus_tag="TVS0338"
FT                   /product="conserved hypothetical protein containing"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78194"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMB3"
FT                   /protein_id="CAQ78194.1"
FT                   /translation="MSEMDLCEAKSDEISFKGTLDRETVPNLWNKLTEWKPKLEQVKVD
FT                   LTHVNRIDSAGVVLLLHLIEHAKKQNCHIMLAFVPDQLITLIQLSNVESLFADHLITQK
FT                   VE"
FT   misc_feature    566448..566732
FT                   /locus_tag="VSAL_I0509"
FT                   /note="HMMPfam hit to PF01740, STAS domain, score 0.0017"
FT                   /inference="protein motif:HMMPfam:PF01740"
FT   CDS_pept        566762..567019
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0510"
FT                   /old_locus_tag="TVS0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78195"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMB4"
FT                   /protein_id="CAQ78195.1"
FT                   /translation="MDSAEIKELLDAALQLQEIHVKGEGSHFEVIAVDESFNGMNRVKK
FT                   QQTIYGPLMEHISTNTIHALSIKAFTPEEWARDKKLNSLF"
FT   misc_feature    566762..566986
FT                   /locus_tag="VSAL_I0510"
FT                   /note="HMMPfam hit to PF01722, BolA-like protein, score
FT                   4.3e-33"
FT                   /inference="protein motif:HMMPfam:PF01722"
FT   CDS_pept        567032..568300
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="VSAL_I0511"
FT                   /old_locus_tag="TVS0340"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78196"
FT                   /db_xref="GOA:B6EMB5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMB5"
FT                   /protein_id="CAQ78196.1"
FT                   /translation="MYKFRIQGSDKPLSGEVTISGAKNAALPILFAALLAEEPVEVANV
FT                   PKLRDVDTTIELLQRLGAKVSRNGSVHIDASEVNNFCAPYDLVKTMRASIWALGPLVAR
FT                   FGKGQVSLPGGCAIGARPVDLHIHGLEQLGATIKLEDGYVKAEVDGRLKGAHIVMDKVS
FT                   VGATITVMCAATLAEGTTILENAAREPEIVDTAHFLNAIGAKVSGMGTDTITIEGVERL
FT                   GGGYHEVVADRIETGTFLVAAAVSGGKVVCKNTKASLLESVLAKLEEAGAKVESGEDWI
FT                   SLDMTGRELKAVNIRTAPHPAFPTDMQAQFTLLNMMAKGPGIITETIFENRFMHIPELQ
FT                   RMGAHAEIEGNTAICGDTDGLSGAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRG
FT                   YDKIEDKLTALGANIERVRSSEL"
FT   misc_feature    567047..568252
FT                   /gene="murA"
FT                   /locus_tag="VSAL_I0511"
FT                   /note="HMMPfam hit to PF00275, EPSP synthase
FT                   (3-phosphoshikimate 1-car, score 4.6e-167"
FT                   /inference="protein motif:HMMPfam:PF00275"
FT   CDS_pept        568435..569160
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="VSAL_I0512"
FT                   /old_locus_tag="TVS0341"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78197"
FT                   /db_xref="GOA:B6EMB6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMB6"
FT                   /protein_id="CAQ78197.1"
FT                   /translation="MIALLRLIALAIFAVFTFVFGCGYCLLSPRNPKHVYTFGLWFARM
FT                   SRVFGIKLEVRVPESVKNSGPSLYIANHQNSWDLFTVSGAIQPRTVTVGKKSIAWMPLF
FT                   GQLYWITGNILIDRNNRSKAVGTISQVADNIKKRNVSVWMFPEGTRSRGRGLLPFKTGA
FT                   FHAAIAADVPVTPIVCSNTEGVKLNRWNNGVVIVEILPPVSLDGYTKANVRELANECRE
FT                   QMKVKLEELNKEVAERNQA"
FT   sig_peptide     568435..568497
FT                   /gene="plsC"
FT                   /locus_tag="VSAL_I0512"
FT   misc_feature    568453..568521
FT                   /gene="plsC"
FT                   /locus_tag="VSAL_I0512"
FT   misc_feature    568468..568500
FT                   /gene="plsC"
FT                   /locus_tag="VSAL_I0512"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    568588..568974
FT                   /gene="plsC"
FT                   /locus_tag="VSAL_I0512"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   3.5e-47"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   CDS_pept        join(569231..569539,571809..572042)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0513"
FT                   /old_locus_tag="TVS0346"
FT                   /product="isopentenyl-diphosphate delta-isomerase
FT                   (pseudogene)"
FT                   /EC_number="5.3.3.2"
FT                   /note="Similar to Rhodobacter capsulatus
FT                   Isopentenyl-diphosphate delta-isomerase idi UniProt:P26173
FT                   (176 aa) fasta scores: E()=1.1e-16, 35.758% id in 165 aa.
FT                   CDS is disrupted by the insertion of an IS element after
FT                   codon 103"
FT                   /db_xref="PSEUDO:CAQ78198.1"
FT                   /inference="similar to sequence:UniProt:P26173"
FT   misc_feature    order(569315..569539,571809..572015)
FT                   /locus_tag="VSAL_I0513"
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 6.8e-16"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   repeat_region   complement(569549..571809)
FT                   /note="VSa2"
FT   repeat_region   complement(569549..569572)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(join(569565..570326,570328..570342,
FT                   570349..570372,570374..570391,570391..570420,
FT                   570420..571043))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0514"
FT                   /old_locus_tag="TVSb0092"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Shewanella sp. (strain W3-18-1)
FT                   transposase is66. UniProt:A1RLT8 (EMBL:CP000503) (500 aa)
FT                   fasta scores: E()=2.7e-115, 55.781% id in 493 aa. CDS
FT                   contains several frameshifts and translational stop codons"
FT                   /db_xref="PSEUDO:CAQ78199.1"
FT                   /inference="similar to sequence:UniProt:A1RLT8"
FT   CDS_pept        complement(571115..571462)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0515"
FT                   /old_locus_tag="TVSb0093"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78200"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B6EGN4"
FT                   /protein_id="CAQ78200.1"
FT                   /translation="MNVFTDVSTIYLHRDFVDFRKAINGLVVIVEQEMQLSPFSDALFI
FT                   FCNKPRDKLKILYWDKTGFALWYKRLDEDRFKWPRNINNDTLALSEQQLTLLLQGFDIL
FT                   GHQPVHYQTTL"
FT   misc_feature    complement(571120..571310)
FT                   /locus_tag="VSAL_II0220"
FT                   /note="HMMPfam hit to PF05717, IS66 Orf2 like protein,score
FT                   5.1e-32"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   misc_feature    complement(571121..571447)
FT                   /locus_tag="VSAL_I0515"
FT                   /note="HMMPfam hit to PF05717, IS66 Orf2 like protein,score
FT                   5.1e-32"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   CDS_pept        complement(571459..571728)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0516"
FT                   /old_locus_tag="TVS0345"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78201"
FT                   /db_xref="UniProtKB/TrEMBL:B6EHB3"
FT                   /protein_id="CAQ78201.1"
FT                   /translation="MQKDKKRTPEQWHALFESQQSSKLSAAEFCRNHNILPKTFSARKA
FT                   RWKQKINATPQLPDIQLSIGKLRLTLPANTEPHWIGLLLKGYQS"
FT   repeat_region   complement(571786..571809)
FT                   /note="IR of VSa2"
FT   CDS_pept        complement(572099..572488)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0517"
FT                   /old_locus_tag="TVS0347"
FT                   /product="Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78202"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMC1"
FT                   /protein_id="CAQ78202.1"
FT                   /translation="MTKVLHTDNAPAAIGPYIQGVDLGSMVLTSGQIPVNPATGEVSDD
FT                   IAEQARQSLENVKAVIESSGLTVSDIVKMTVFVKDLNDFGTVNEVYGNFFDEHNVANYP
FT                   ARSCVEVARLPKDVGIEIEAIAVRK"
FT   misc_feature    complement(572105..572470)
FT                   /locus_tag="VSAL_I0517"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,score
FT                   4.4e-63"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   misc_feature    complement(572123..572179)
FT                   /locus_tag="VSAL_I0517"
FT                   /note="PS01094 Uncharacterized protein family UPF0076
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01094"
FT   CDS_pept        complement(572628..573092)
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /locus_tag="VSAL_I0518"
FT                   /old_locus_tag="TVS0348"
FT                   /product="aspartate carbamoyltransferase regulatory chain"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78203"
FT                   /db_xref="GOA:B6EMC2"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMC2"
FT                   /protein_id="CAQ78203.1"
FT                   /translation="MSNKTELRVEAIKNGTVIDHIPANIGVKVLKLFQMDKTAERVTIG
FT                   LNLPSSALGSKDLLKIENTFVTPEQASKLALYAPHATVNQIENYEVVKKIPLILPKQIT
FT                   GVFECPNSNCITHGEPVDSSFKVIAKKGNIHLKCKYCEKVYSQEVVTDLH"
FT   misc_feature    complement(572637..572792)
FT                   /gene="pyrI"
FT                   /locus_tag="VSAL_I0518"
FT                   /note="HMMPfam hit to PF02748, Aspartate
FT                   carbamoyltransferase regulatory ch, score 3.4e-24"
FT                   /inference="protein motif:HMMPfam:PF02748"
FT   misc_feature    complement(572796..573089)
FT                   /gene="pyrI"
FT                   /locus_tag="VSAL_I0518"
FT                   /note="HMMPfam hit to PF01948, Aspartate
FT                   carbamoyltransferase regulatory ch, score 1e-50"
FT                   /inference="protein motif:HMMPfam:PF01948"
FT   CDS_pept        complement(573106..574035)
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="VSAL_I0519"
FT                   /old_locus_tag="TVS0349"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78204"
FT                   /db_xref="GOA:B6EMS5"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMS5"
FT                   /protein_id="CAQ78204.1"
FT                   /translation="MANSLYQKHIISIPELSREELELIVETAGNIKKEPQPDLLKNKVI
FT                   ASCFFEASTRTRLSFETAIQRLGGSVIGFDSAGNTSLAQKGETLADSVQIIASYANAYV
FT                   MRHPREGAARLASEFSNGTPVINAGDGANQHPTQTLLDLYTIYETQGRLDNLNIAFVGD
FT                   LKYGRTVHSLTQALAKFNGVKFFFIAPEVLAMPDYICEELDELGIEYQLLNSMEEAIPE
FT                   LDILYMTRVQKERFDESEYAHIKSAYILSAADLKPARENLKVLHPLPRIDEINIDVDKT
FT                   PHAYYFQQAENGVYARQALLALVLNESL"
FT   misc_feature    complement(573124..573579)
FT                   /gene="pyrB"
FT                   /locus_tag="VSAL_I0519"
FT                   /note="HMMPfam hit to PF00185, Aspartate/ornithine
FT                   carbamoyltransferase, As, score 3.3e-54"
FT                   /inference="protein motif:HMMPfam:PF00185"
FT   misc_feature    complement(573589..574014)
FT                   /gene="pyrB"
FT                   /locus_tag="VSAL_I0519"
FT                   /note="HMMPfam hit to PF02729, Aspartate/ornithine
FT                   carbamoyltransferase, ca, score 1.5e-60"
FT                   /inference="protein motif:HMMPfam:PF02729"
FT   misc_feature    complement(573868..573891)
FT                   /gene="pyrB"
FT                   /locus_tag="VSAL_I0519"
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT                   /inference="protein motif:ProSite:PS00097"
FT   CDS_pept        complement(574311..575315)
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="VSAL_I0520"
FT                   /old_locus_tag="TVS0350"
FT                   /product="ornithine carbamoyltransferase chain I"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78205"
FT                   /db_xref="GOA:B6EMS6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMS6"
FT                   /protein_id="CAQ78205.1"
FT                   /translation="MAFNLRNRNFLKLLDFTPKEIQHLLDLSADLKKAKYAGYEQPRLS
FT                   GKNIALIFEKSSTRTRCAFEVAAFDQGAKVTYLGPSGSQIGHKESIKDTARVLGRMYDG
FT                   IEYRGFGQSIVEELGKYAGVPVWNGLTDEFHPTQILADFLTMQEYAEDKQLNQIKFAYL
FT                   GDARNNMGNSLMVGAAKMGMEIRLVAPKQFWPEDTLVTQCQEIASQTGAKIILTEDVTT
FT                   GVEGCDFLYTDVWVSMGEAPEAWDERVALMTPYQINMNVIKATNNPNVKFMHCLPAFHN
FT                   DETALGKEIAEKYGMNGLEVTDEVFESDYSIVFDEAENRMHTIKAIMVATLGQ"
FT   misc_feature    complement(574323..574853)
FT                   /gene="argI"
FT                   /locus_tag="VSAL_I0520"
FT                   /note="HMMPfam hit to PF00185, Aspartate/ornithine
FT                   carbamoyltransferase, As, score 1.5e-87"
FT                   /inference="protein motif:HMMPfam:PF00185"
FT   misc_feature    complement(574869..575294)
FT                   /gene="argI"
FT                   /locus_tag="VSAL_I0520"
FT                   /note="HMMPfam hit to PF02729, Aspartate/ornithine
FT                   carbamoyltransferase, ca, score 4.5e-80"
FT                   /inference="protein motif:HMMPfam:PF02729"
FT   misc_feature    complement(575136..575159)
FT                   /gene="argI"
FT                   /locus_tag="VSAL_I0520"
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT                   /inference="protein motif:ProSite:PS00097"
FT   CDS_pept        complement(575411..576631)
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="VSAL_I0521"
FT                   /old_locus_tag="TVS0351"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78206"
FT                   /db_xref="GOA:B6EMS7"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMS7"
FT                   /protein_id="CAQ78206.1"
FT                   /translation="MSKLFVGSEIGQLRRVILHRPERALSHLTPTNCHNLLFDDVLSVE
FT                   KALHEHDQFVATLRQQDVEVLLLQDLLEETLAHPEAKQWLLRHQISHYRFGPTFANQIR
FT                   AFLLEKNNKELASILLGGLAFIELPFKAPSMLQQLSDPFDFVIDPLPNHLFTRDTSCWI
FT                   YGGVSINPMAKAARKRESNHLRAIYKWHPLFSNQSFPRYFGDENRHYDNATIEGGDVLI
FT                   IGKGNVLVGISERTTPQGIENLAKQLFRTEQAKQVIAIKLPENRSCMHLDTVMTHMDHN
FT                   VFSVYPRVIDKNMPCWSITPCGDQQLAIQEKPNFEHSLMQALELDSLNIITTGGDSYEA
FT                   EREQWHDANNVLTIKPGVVVAYERNVYTNEKYDKAGITVLPIMGDELGRGRGGARCMSC
FT                   PIERDGI"
FT   misc_feature    complement(575423..576610)
FT                   /gene="arcA"
FT                   /locus_tag="VSAL_I0521"
FT                   /note="HMMPfam hit to PF02274, Amidinotransferase, score
FT                   9.7e-174"
FT                   /inference="protein motif:HMMPfam:PF02274"
FT   CDS_pept        576784..577200
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0522"
FT                   /old_locus_tag="TVS0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78207"
FT                   /db_xref="GOA:B6EMS8"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMS8"
FT                   /protein_id="CAQ78207.1"
FT                   /translation="MSQEDEYLSVEQFLEFQKIETREIIESLKADGSEPEALYAIEHHL
FT                   MAEDFKALENAVVEAFKMGFEVLEAEELEDENGAKILCCDAVMDCALDADVIDSQVEKL
FT                   VLIAEKFDIIYDGWGTYYEGEDAEYDVIEDGDDE"
FT   misc_feature    576829..577149
FT                   /locus_tag="VSAL_I0522"
FT                   /note="HMMPfam hit to PF06877, Protein of unknown function
FT                   (DUF1260), score 3.2e-46"
FT                   /inference="protein motif:HMMPfam:PF06877"
FT   CDS_pept        577288..578124
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0523"
FT                   /old_locus_tag="TVS0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78208"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMS9"
FT                   /protein_id="CAQ78208.1"
FT                   /translation="MNSRILLNGEKALWQLSPLTDTSLPIKDIPIQQGVAFAYDVLSVE
FT                   DANHQEWHLMRFFDVDETLLSYPAIELVMSGVSRYAEVRINGVAVFDCNELMTRYRKDI
FT                   KEYLQLGGNRFEILFLEEDDEDWLLDDNEVSGVCEINQAYYRRFGAVQSIDIKDDIGVF
FT                   GVCFFQPIPHLSLNHISIEQIWHHGCELKVDVRFHTYKPNLISASIKFDGMTLTLPVDV
FT                   RSDHVSALFQVEAPKYWDDQMQNSDDLYVIDVILDGQHHELEIGLCRTENVIHFPL"
FT   CDS_pept        complement(578281..581142)
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="VSAL_I0524"
FT                   /old_locus_tag="TVS0354"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78209"
FT                   /db_xref="GOA:B6EMT0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT0"
FT                   /protein_id="CAQ78209.1"
FT                   /translation="MEKTYNPQSIEQALYQTWEEKGYFKPHGDTSKEAYSIMIPPPNVT
FT                   GSLHMGHAFQDTIMDTLIRAERMKGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTKHD
FT                   YGRETFIDKIWEWKAESGGTITKQLRRLGASVDWDRERFTMDDGLSAATQEVFVRLFEE
FT                   DLIYRGKRLVNWDPKLHTAISDLEVESKDKKGFMWHFRYPLANGVKTADGKDYIVVATT
FT                   RPETMLGDTGVAVNPEDPRYKDLIGQHIELPIVGRLIPIVGDEHADMDKGTGCVKITPA
FT                   HDFNDYEVGKRHSLPMINILTFNADIRETAEVFTTNGEESDVYSAELPAKYHGMERFAA
FT                   RKAIVAEFDELGLLEEIKDHDLTVPYGDRGGVVIEPMLTDQWYVRTAPLAAPAVKAVED
FT                   GQIKFVPKQYENMYFSWMRDVQDWCISRQLWWGHRIPAWYDNSGKVYVGRSEEEVREKN
FT                   NLAPVVVLRQDDDVLDTWFSSALWTFGTQGWPENTDALKTFHPSEVLVSGFDIIFFWVA
FT                   RMIMMTMHFVKDEEGNAQVPFKTVYMTGLIRDENGDKMSKSKGNVLDPIDMIDGIGLEE
FT                   LVEKRCGNMMQPQLAKKIEKATRKTFEGGIEPYGTDALRFTLAAMASTGRDINWDMKRL
FT                   EGYRNFCNKLWNASRYVLMNTEEHDCGMAEGAELEFSLADQWITSQFEVAAKEFNAHLD
FT                   NYRLDMAANTLYEFIWNQFCDWYLELTKPVLWKGTEAQQRATRYTLITVLEKTLRLAHP
FT                   ILPYITESIWQSVKPLVDGVEGETIMTQALPQFNEENFNADVVSDLEWVKAFITSIRNL
FT                   RAEYDIAPSKGLDVMIKVADEKDAARIKANEIVLTSLAKLDSIKVLDDNEETPACATSL
FT                   VGKSELMIPMAGLIDKDAELARLDKEVAKIQGEIKRIEGKLGNEGFVAKAPEVVIAKER
FT                   EKLDGYNETLVKLEAQKETIAAL"
FT   misc_feature    complement(578518..578541)
FT                   /gene="valS"
FT                   /locus_tag="VSAL_I0524"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(578656..579120)
FT                   /gene="valS"
FT                   /locus_tag="VSAL_I0524"
FT                   /note="HMMPfam hit to PF08264, Anticodon-binding
FT                   domain,score 1.9e-62"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   misc_feature    complement(579250..581106)
FT                   /gene="valS"
FT                   /locus_tag="VSAL_I0524"
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 0"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    complement(580984..581019)
FT                   /gene="valS"
FT                   /locus_tag="VSAL_I0524"
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00178"
FT   CDS_pept        complement(581253..581696)
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="VSAL_I0525"
FT                   /old_locus_tag="TVS0355"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78210"
FT                   /db_xref="GOA:B6EMT1"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT1"
FT                   /protein_id="CAQ78210.1"
FT                   /translation="MSQALFYVLESTSPAATQPGLLKFVCQLAHYYYSQNARVYILSDD
FT                   KEQALLIDELLWQNDVSEFIPHNLIGEGPKSGSPIEIGWGTLRPSGRRHVLINLAQEVA
FT                   TFAVSFAQVVDFVPCEEKVKQHARERYKIYRNAGRAMQTETLK"
FT   misc_feature    complement(581259..581696)
FT                   /gene="holC"
FT                   /locus_tag="VSAL_I0525"
FT                   /note="HMMPfam hit to PF04364, DNA polymerase III chi
FT                   subunit, HolC, score 1.5e-56"
FT                   /inference="protein motif:HMMPfam:PF04364"
FT   CDS_pept        complement(581790..583298)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="VSAL_I0526"
FT                   /old_locus_tag="TVS0356"
FT                   /product="cytosol aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78211"
FT                   /db_xref="GOA:B6EMT2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMT2"
FT                   /protein_id="CAQ78211.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISS
FT                   LLRRGDLEGKPGQMLLLHQVPNILSERVLLVGCGKERELGERQYKDIIKKTISTLNETG
FT                   SMEAVCFLTELHVKGRDTYWKVRQAVESTKDSLYTFNQFKSNKPETRRPLRKLVFNVPT
FT                   RRELSLGEKAINHGLSISSGVKASKDLGNMPPNVANPAYLASQARRLADDFETVTTKVI
FT                   GEEEMKKLGMTSYLAVGQGSHNESMMSVMEYKGHPNPDAKPIVLIGKGLTFDSGGISLK
FT                   PSDSMDEMKYDMCGAASVFGAMKALAKLNLPLNVVGILAGCENMPSSNSYRPGDILTTM
FT                   SGQTVEVLNTDAEGRLVLCDALTYVERYEPDCVVDVATLTGACVVALGHHINGLLSNHN
FT                   PLAHELINASEQSGDRAWRLPMSEEYNEQLNSPFADMANIGGKAGGTITAGCFLARFAK
FT                   KYNWAHIDSAGTAWVSGANKGSTGRPVSLLVQFLLNRSGPESVE"
FT   misc_feature    complement(581829..582749)
FT                   /gene="pepA"
FT                   /locus_tag="VSAL_I0526"
FT                   /note="HMMPfam hit to PF00883, Cytosol aminopeptidase
FT                   family, cataly, score 1.1e-186"
FT                   /inference="protein motif:HMMPfam:PF00883"
FT   misc_feature    complement(582231..582254)
FT                   /gene="pepA"
FT                   /locus_tag="VSAL_I0526"
FT                   /note="PS00631 Cytosol aminopeptidase signature."
FT                   /inference="protein motif:ProSite:PS00631"
FT   misc_feature    complement(582858..583244)
FT                   /gene="pepA"
FT                   /locus_tag="VSAL_I0526"
FT                   /note="HMMPfam hit to PF02789, Cytosol aminopeptidase
FT                   family, N-term, score 3.3e-41"
FT                   /inference="protein motif:HMMPfam:PF02789"
FT   CDS_pept        583488..584600
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0527"
FT                   /old_locus_tag="TVS0357"
FT                   /product="putative permease"
FT                   /note="Similar to Escherichia coli Inner membrane protein
FT                   YjgP UniProt:P0AF98 (366 aa) fasta scores:
FT                   E()=2.7e-54,43.443% id in 366 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78212"
FT                   /db_xref="GOA:B6EMT3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT3"
FT                   /inference="similar to sequence:UniProt:P0AF98"
FT                   /protein_id="CAQ78212.1"
FT                   /translation="MIIIRYLIKETLKSQLAIFFVLFLIFMSQKFIQILADASDGDIPG
FT                   GLILSLVGYNMPAMGLLMLPLSIFIGILLTFGRLYAESEITVMNATGMGNSILIRAALY
FT                   LALITGSIAAVNSLWLSPWSQEQSTKLMENVESDAGIELLQKGQFKPSPDGKAVVFIDD
FT                   ISDKGGKHLVNIFLAQPVPNDSLRPSVLISEKGTVKQLDDGRQVLVLDNGTRYEGIPTR
FT                   LDYLESNFESYEVLIGQKEVKEKRRDWDALPTLDLIKRTELEAKAELQWRISLILCIPL
FT                   LTMVVVPLSAVNPRQGRFAKLAPAILLYLAYFLSLSAGKSAIEEGSLHPSVGLWAINAV
FT                   LLIIGIILNSMDSVFVRKLKDKMRRKPKHV"
FT   sig_peptide     583488..583595
FT                   /locus_tag="VSAL_I0527"
FT   misc_feature    583500..584558
FT                   /locus_tag="VSAL_I0527"
FT                   /note="HMMPfam hit to PF03739, Predicted permease YjgP/YjgQ
FT                   family, score 2.9e-92"
FT                   /inference="protein motif:HMMPfam:PF03739"
FT   misc_feature    order(583533..583601,583659..583727,583788..583856,
FT                   584295..584363,584382..584444,584487..584555)
FT                   /locus_tag="VSAL_I0527"
FT   CDS_pept        584593..585669
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0528"
FT                   /old_locus_tag="TVS0358"
FT                   /product="putative permease"
FT                   /note="Similar to Escherichia coli Inner membrane protein
FT                   YjgQ UniProt:P0ADC6 (360 aa) fasta scores:
FT                   E()=2.6e-66,51.685% id in 356 aa"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78213"
FT                   /db_xref="GOA:B6EMT4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT4"
FT                   /inference="similar to sequence:UniProt:P0ADC6"
FT                   /protein_id="CAQ78213.1"
FT                   /translation="MFKILDWYIGRTIIATSSLCLVTLVGLSSIIKYVEQLRKVGKGTY
FT                   DLLDALYFVILSMPRDIEMFFPMAALLGALIGLGMLAASSELVVMQAAGYSKLDIGISV
FT                   LKTAIPLMLMVMALGQWGAPQAQKMARDLRAFSISGGNIASMRTGVWAKDGNDFIYLSR
FT                   VDDQAKLYGVTLWQFDKERKLDDIVFAKKAEYESKEEGWKLIDVSITDMKDENIITEKK
FT                   LDSLSWSTTLTPDKLAVVSVKPEEQSLTGLYDYVNYLKDSELDASRYELAFWRKALQPI
FT                   SVAVMMLLALSFVFGPLRSVTMGARILSGVIAGFSFYISNEVFGPMTLVYNIHPIFGAL
FT                   GPSFVFLLITLGLLNRKL"
FT   misc_feature    584611..585660
FT                   /locus_tag="VSAL_I0528"
FT                   /note="HMMPfam hit to PF03739, Predicted permease YjgP/YjgQ
FT                   family, score 2.2e-96"
FT                   /inference="protein motif:HMMPfam:PF03739"
FT   misc_feature    order(584611..584679,584791..584859,584896..584964,
FT                   585424..585492,585511..585579,585589..585657)
FT                   /locus_tag="VSAL_I0528"
FT   CDS_pept        complement(585746..586222)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0529"
FT                   /old_locus_tag="TVS0359"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78214"
FT                   /db_xref="GOA:B6EMT5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT5"
FT                   /protein_id="CAQ78214.1"
FT                   /translation="MEEKMKTQKQAGFMRRMGAWFYDTLIISAIMMLTGGIIVATLEML
FT                   YGMGLISYGSYPDVSSYLNNDPMWSNLYPITLISVFVGFFAYFWCKGQTLGMRAWKLQV
FT                   QQFDGSPITLTQAIIRMSTSAFGLGNFLVFISQDNSAFQDTWAKTQVIVLDKAV"
FT   misc_feature    complement(585764..586195)
FT                   /locus_tag="VSAL_I0529"
FT                   /note="HMMPfam hit to PF06271, RDD family, score 4.3e-29"
FT                   /inference="protein motif:HMMPfam:PF06271"
FT   misc_feature    complement(order(585956..586024,586082..586150))
FT                   /locus_tag="VSAL_I0529"
FT   tRNA            586390..586471
FT                   /locus_tag="VSAL_I3117t"
FT                   /product="transfer RNA-Leu"
FT   CDS_pept        complement(586622..586879)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0530"
FT                   /old_locus_tag="TVS0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78215"
FT                   /db_xref="InterPro:IPR021376"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT6"
FT                   /protein_id="CAQ78215.1"
FT                   /translation="MNPIIQTLKEHNVSDEKITEVFQALTQNPLAAMATIQSLGIPQEK
FT                   LQPLMMMVMTNPSLIKEAVEELGLDFSKVEEAKAKLEENK"
FT   CDS_pept        complement(586955..587341)
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="VSAL_I0531"
FT                   /old_locus_tag="TVS0361"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78216"
FT                   /db_xref="GOA:B6EMT7"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT7"
FT                   /protein_id="CAQ78216.1"
FT                   /translation="MTDTPSGKPANTGIKRVIKATQFSMQGLKAAFKHEAAVRQEFAML
FT                   VITAPIALLLDVTIVEKILLIGVFVLIFIVELLNSAIEAVVDRIGPEHHELSGRAKDIG
FT                   SSAVFVALCLAGFTWLMILGSHYL"
FT   misc_feature    complement(586967..587302)
FT                   /gene="dgkA"
FT                   /locus_tag="VSAL_I0531"
FT                   /note="HMMPfam hit to PF01219, Prokaryotic diacylglycerol
FT                   kinase, score 1.3e-44"
FT                   /inference="protein motif:HMMPfam:PF01219"
FT   misc_feature    complement(order(586967..587035,587096..587155,
FT                   587165..587218))
FT                   /gene="dgkA"
FT                   /locus_tag="VSAL_I0531"
FT   misc_feature    complement(587081..587116)
FT                   /gene="dgkA"
FT                   /locus_tag="VSAL_I0531"
FT                   /note="PS01069 Prokaryotic diacylglycerol kinase
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01069"
FT   tRNA            complement(587496..587568)
FT                   /locus_tag="VSAL_I3118t"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(587579..587651)
FT                   /locus_tag="VSAL_I3119t"
FT                   /product="transfer RNA-Phe"
FT   tRNA            complement(587662..587734)
FT                   /locus_tag="VSAL_I3120t"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(587814..587886)
FT                   /locus_tag="VSAL_I3121t"
FT                   /product="transfer RNA-Asn"
FT   tRNA            complement(587896..587968)
FT                   /locus_tag="VSAL_I3122t"
FT                   /product="transfer RNA-Phe"
FT   tRNA            complement(587979..588051)
FT                   /locus_tag="VSAL_I3123t"
FT                   /product="transfer RNA-Thr"
FT   tRNA            complement(588131..588203)
FT                   /locus_tag="VSAL_I3124t"
FT                   /product="transfer RNA-Phe"
FT   CDS_pept        complement(588313..589449)
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="VSAL_I0532"
FT                   /old_locus_tag="TVS0362"
FT                   /product="membrane-bound lytic murein transglycosylase C
FT                   precursor"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78217"
FT                   /db_xref="GOA:B6EMT8"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMT8"
FT                   /protein_id="CAQ78217.1"
FT                   /translation="MKKIILIVSTCLFLTSCSRESIESTFGINYDTTNRFAKNLAPLPG
FT                   QFTKDLKALDSLISSFNGNIEKRWGKKNLITAGKRSYVKYTDGYLSRSQVDFTSGRVTV
FT                   ETVAGTEPKAHLRQAIITTLLTPDDPAGVDLYSDADVTLGGKPFLYQQVLDQDKKPIEW
FT                   SWRASRYADYLIAHHLKQKNIDYKKAYYVDIPMVKNHEQLREYQYADIVRKASQRYDIP
FT                   EDLIYSIIRTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKKKSGDPTPEYLFNPH
FT                   NNIDTGAAYFHILKTRYLKDIRNPISKQYSMISAYNGGAGGVFTTFSSSRSRAINDINS
FT                   LNPNQVYWALTKKHKNAEARRYLEKVTAYKKEFNSGKI"
FT   misc_feature    complement(588433..588822)
FT                   /gene="mltC"
FT                   /locus_tag="VSAL_I0532"
FT                   /note="HMMPfam hit to PF01464, Transglycosylase SLT domain,
FT                   score 4.5e-36"
FT                   /inference="protein motif:HMMPfam:PF01464"
FT   misc_feature    complement(588679..588765)
FT                   /gene="mltC"
FT                   /locus_tag="VSAL_I0532"
FT                   /note="PS00922 Prokaryotic transglycosylases signature."
FT                   /inference="protein motif:ProSite:PS00922"
FT   sig_peptide     complement(589387..589449)
FT                   /gene="mltC"
FT                   /locus_tag="VSAL_I0532"
FT   misc_feature    complement(589399..589431)
FT                   /gene="mltC"
FT                   /locus_tag="VSAL_I0532"
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        complement(589560..589832)
FT                   /transl_table=11
FT                   /gene="yggX"
FT                   /locus_tag="VSAL_I0533"
FT                   /old_locus_tag="TVS0363"
FT                   /product="probable Fe(2+) trafficking protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78218"
FT                   /db_xref="GOA:B6EMT9"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMT9"
FT                   /protein_id="CAQ78218.1"
FT                   /translation="MSRTVFCVLLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHK
FT                   QTMLINEKKLNMMDPEHRKMLETEMEGFLFDGKDVVIDGYTPPSK"
FT   misc_feature    complement(589569..589832)
FT                   /gene="yggX"
FT                   /locus_tag="VSAL_I0533"
FT                   /note="HMMPfam hit to PF04362, Bacterial Fe(2+)
FT                   trafficking, score 4.8e-61"
FT                   /inference="protein motif:HMMPfam:PF04362"
FT   CDS_pept        complement(589835..590887)
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="VSAL_I0534"
FT                   /old_locus_tag="TVS0364"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78219"
FT                   /db_xref="GOA:B6EMU0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMU0"
FT                   /protein_id="CAQ78219.1"
FT                   /translation="MTSFSHAILEWYDNYGRKTLPWQLEKTPYKVWLSEIMLQQTQVTT
FT                   VIPYFERFMTRFPTVIDLANADQDEVLHLWTGLGYYARARNLHKTAQIIAEQYNGRFPE
FT                   TIDEVIALPGIGRSTAGAVLSLSLKQRHPILDGNVKRTLSRCFAIEGWSGKKSVENAMW
FT                   EIAEEHTPELGVERYNQAMMDMGAIVCTRSKPKCEICPVNDLCQAKAQDRQLDFPTKKP
FT                   KKEKPMKEAWFAIYYHDGEVWLEQRPQTGIWGGLFCFPEQPENTLVDLSVRYGVEIKST
FT                   QQLIAFRHTFSHYHLDITPVLITLVKKPNMVMEGTRGVWYNLSQPMTVGLAAPVQKLLD
FT                   ALPYEISNGE"
FT   misc_feature    complement(590270..590320)
FT                   /gene="mutY"
FT                   /locus_tag="VSAL_I0534"
FT                   /note="PS00764 Endonuclease III iron-sulfur binding region
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00764"
FT   misc_feature    complement(590384..590791)
FT                   /gene="mutY"
FT                   /locus_tag="VSAL_I0534"
FT                   /note="HMMPfam hit to PF00730, HhH-GPD superfamily base
FT                   excision DNA repair, score 4.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00730"
FT   misc_feature    complement(590510..590599)
FT                   /gene="mutY"
FT                   /locus_tag="VSAL_I0534"
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix
FT                   motif,score 0.0001"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS_pept        591105..591821
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="VSAL_I0535"
FT                   /old_locus_tag="TVS0366"
FT                   /product="tRNA (guanine-n(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78220"
FT                   /db_xref="GOA:B6EMU1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMU1"
FT                   /protein_id="CAQ78220.1"
FT                   /translation="MTEVTKNDFTEEGKIVRKIRSFVRREGRLTKGQEGAITECWSTMG
FT                   IDFVEQVLDWNEVFGNNNPVVLEIGFGMGASLVEMAQKAPDVNFLGIEVHRPGVGACLA
FT                   AAKEAGVTNLRVMCHDAVEVFESMIPDSSVTTLQLFFPDPWHKARHHKRRIVKAEFAEM
FT                   IRPKLNAEGVFHMATDWENYAEHMIEVMNAAPGYENIATDGDYIPRPDERPLTKFEARG
FT                   HRLGHGVWDIKFRRNA"
FT   misc_feature    591225..591815
FT                   /gene="trmB"
FT                   /locus_tag="VSAL_I0535"
FT                   /note="HMMPfam hit to PF02390, Putative
FT                   methyltransferase,score 3.6e-88"
FT                   /inference="protein motif:HMMPfam:PF02390"
FT   CDS_pept        591928..592848
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="VSAL_I0536"
FT                   /old_locus_tag="TVS0367"
FT                   /product="thermolabile glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78221"
FT                   /db_xref="GOA:B6EMU2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6EMU2"
FT                   /protein_id="CAQ78221.1"
FT                   /translation="MKPTKQILEDILNEVRPLIGQGEVADYIPALACVPSNKLGIAVYT
FT                   NDGEMITAGDANERFSIQSISKALSLTLAMELYQPEELWHRVGKEPSGQAFNSLIQLEM
FT                   EQGVPRNPFINAGAIVVADMLFSRFSAPKHRLLEFVRKLSGNEHIIYDRVVANSEMDHS
FT                   DRNASIAYLMRSFGNFENEVMPVLKNYFHACSLNMSCVDLAKTFGYLANKGIQPETNEF
FT                   IITPMQSKQINALMATCGLYDGAGEFAYRVGMPGKSGVGGGIIAIVPGEMTIAVWSPEL
FT                   DPSGNSLAGTQALELLSERIGRSIF"
FT   misc_feature    591991..592845
FT                   /gene="glsA"
FT                   /locus_tag="VSAL_I0536"
FT                   /note="HMMPfam hit to PF04960, Glutaminase, score 3.1e-182"
FT                   /inference="protein motif:HMMPfam:PF04960"
FT   CDS_pept        complement(592953..594113)
FT                   /transl_table=11
FT                   /gene="yggW"
FT                   /locus_tag="VSAL_I0537"
FT                   /old_locus_tag="TVS0368"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase-like protein"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78222"
FT                   /db_xref="GOA:B6EMU3"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMU3"
FT                   /protein_id="CAQ78222.1"
FT                   /translation="MLVPPPLSLYIHIPWCIQKCPYCDFNSHALKTTIPEAQYISALID
FT                   DLDTDLARYNMQNEPRKLHSIFIGGGTPSLITAPEIKRLLIEVEKRLPFADDIEITMEA
FT                   NPGTVEAGRFIEYREAGVNRISIGVQSFQQEKLEKLGRIHGKDEALRAARLAHEAGLNS
FT                   FNLDLMHGLPNQSIDDALSDLKQAIELNPPHLSWYQLTIEPNTVFYYKPPTLPDDDDLW
FT                   DIFEQGHQILADAGYVQYEISGYSKVGYQCRHNLNYWRFGDYLGIGCGAHGKLSFADGR
FT                   IIRTTKIKHPRGFLDLMKPYLIDEQEVADHDRSFEFFMNRFRLLEACPKQDFIDKTGLG
FT                   LESIQETMDWAKEKKYLEETETHWQITEHGKLFLNDLLEAFVSDEE"
FT   misc_feature    complement(592998..593348)
FT                   /gene="yggW"
FT                   /locus_tag="VSAL_I0537"
FT                   /note="HMMPfam hit to PF06969, HemN C-terminal region,score
FT                   3.3e-22"
FT                   /inference="protein motif:HMMPfam:PF06969"
FT   misc_feature    complement(593553..594086)
FT                   /gene="yggW"
FT                   /locus_tag="VSAL_I0537"
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 6e-28"
FT                   /inference="protein motif:HMMPfam:PF04055"
FT   CDS_pept        complement(594117..594713)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0538"
FT                   /old_locus_tag="TVS0369"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78223"
FT                   /db_xref="GOA:B6EMU4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMU4"
FT                   /protein_id="CAQ78223.1"
FT                   /translation="MSKIVLATGNQGKVREMADVLSDFGFDVVAQSEFNVSDVAETGTT
FT                   FIENAIIKARHAAKESGLPAIADDSGLEVDALHGAPGVYSARYSGEGATDQKNIDKMLA
FT                   AMKDIPEEKRTARFHCVLVLMKHENDPTPLICHGSWEGHITTEQQGENGFGYDPIFWVS
FT                   EDNCSSAELEPARKKQLSHRGQALKKLFAALKEGQ"
FT   misc_feature    complement(594132..594704)
FT                   /locus_tag="VSAL_I0538"
FT                   /note="HMMPfam hit to PF01725, Ham1 family, score 1.5e-97"
FT                   /inference="protein motif:HMMPfam:PF01725"
FT   CDS_pept        complement(594724..595155)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0539"
FT                   /old_locus_tag="TVS0370"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78224"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMU5"
FT                   /protein_id="CAQ78224.1"
FT                   /translation="MKKTLLLLSLFLFSLPSFAGQFVQIKNVEVHYSAFNSTFLTPKVA
FT                   RAYQLKRSGYTALINISVLDISQAGKPAISAQVSGTAKNLLGQTKTLTFREIKEKNAIY
FT                   YIAELPITNEETFRFDIDVSSGKKGAGKLKFNQKFYVEE"
FT   sig_peptide     complement(595099..595155)
FT                   /locus_tag="VSAL_I0539"
FT   CDS_pept        complement(595227..595478)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0540"
FT                   /old_locus_tag="TVS0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78225"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMU6"
FT                   /protein_id="CAQ78225.1"
FT                   /translation="MPIKYDNDDLVLRLYLQPKASRDQIVGIHGEELKVAITAPPVDGK
FT                   ANAHLIKYFSKLFKVAKGKITVEKGELNRHKQGSNSLS"
FT   misc_feature    complement(595239..595463)
FT                   /locus_tag="VSAL_I0540"
FT                   /note="HMMPfam hit to PF02594, Uncharacterised ACR, YggU
FT                   family COG1872, score 2.9e-34"
FT                   /inference="protein motif:HMMPfam:PF02594"
FT   CDS_pept        complement(595507..596061)
FT                   /transl_table=11
FT                   /locus_tag="VSAL_I0541"
FT                   /old_locus_tag="TVS0372"
FT                   /product="membrane protein, related to K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:VSAL_I0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ78226"
FT                   /db_xref="GOA:B6EMU7"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B6EMU7"
FT                   /protein_id="CAQ78226.1"
FT                   /translation="MNAMSFLISTVFDLYIMVVILRIWLQVARADFYNPFSQFIIKATQ
FT                   PVVSPLRRIIPSIGSLDLATVLFAYVLCVVKFVALQVVVSGGITFGPEFLIIGLIALAK
FT                   AAGGLLFWILLVRAILSWVSQGRSPIEYVMNQLTEPMLAPIRKILPQMGGLDLSVLVLF
FT                   IVLQFANFLMGDLLGPIWYSL"
FT   misc_feature    complement(order(595519..595587,595714..595782,
FT                   595801..595869,595981..596049))
FT                   /locus_tag="VSAL_I0541"
FT   misc_feature    complement(595534..595776)
FT                   /locus_tag="VSAL_I0541"
FT                   /note="HMMPfam hit to PF02325, YGGT family, score 1.1e-28"
FT                   /inference="protein motif:HMMPfam:PF02325"
FT   misc_feature    complement(595816..596061)
FT                   /locus_tag="VSAL_I0541"
FT                   /note="HMMPfam hit to PF02325, YGGT family, score 4.5e-23"
FT                   /inference="protein motif:HMMPfam:PF02325"
FT   CDS_pept        complement(596137..596955)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="VSAL_I0542"
FT                   /old_locus_tag="TVS0373"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_nu