(data stored in ACNUC7421 zone)

EMBL: FM180569

ID   FM180569; SV 1; circular; genomic DNA; STD; PRO; 97978 BP.
XX
AC   FM180569;
XX
PR   Project:PRJEA32571;
XX
DT   26-NOV-2008 (Rel. 97, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Escherichia coli 0127:H6 E2348/69 plasmid pMAR2, strain E2348/69
XX
KW   .
XX
OS   Escherichia coli O127:H6 str. E2348/69
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
OG   Plasmid pMAR2
XX
RN   [1]
RP   1-97978
RA   Thomson N.R.;
RT   ;
RL   Submitted (16-JUL-2008) to the INSDC.
RL   Thomson N.R., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01238-08.
RX   PUBMED; 18952797.
RA   Iguchi A., Thomson N.R., Ogura Y., Saunders D., Ooka T., Henderson I.R.,
RA   Harris D., Asadulghani M., Kurokawa K., Dean P., Kenny B., Quail M.A.,
RA   Thurston S., Dougan G., Hayashi T., Parkhill J., Frankel G.;
RT   "Complete genome sequence and comparative genome analysis of
RT   enteropathogenic Escherichia coli O127:H6 strain E2348/69";
RL   J. Bacteriol. 191(1):347-354(2009).
XX
DR   MD5; 24fa3ed91743cfd33fc6f8ffaf6900cc.
DR   BioSample; SAMEA1705959.
DR   EnsemblGenomes-Gn; E2348_P1_002.
DR   EnsemblGenomes-Gn; E2348_P1_017.
DR   EnsemblGenomes-Gn; E2348_P1_023.
DR   EnsemblGenomes-Gn; E2348_P1_024.
DR   EnsemblGenomes-Gn; E2348_P1_025.
DR   EnsemblGenomes-Gn; E2348_P1_026.
DR   EnsemblGenomes-Gn; E2348_P1_027.
DR   EnsemblGenomes-Gn; E2348_P1_028.
DR   EnsemblGenomes-Gn; E2348_P1_029.
DR   EnsemblGenomes-Gn; E2348_P1_030.
DR   EnsemblGenomes-Gn; E2348_P1_031.
DR   EnsemblGenomes-Gn; E2348_P1_032.
DR   EnsemblGenomes-Gn; E2348_P1_079.
DR   EnsemblGenomes-Gn; E2348_P1_080.
DR   EnsemblGenomes-Gn; E2348_P1_082.
DR   EnsemblGenomes-Gn; E2348_P1_088.
DR   EnsemblGenomes-Gn; E2348_P1_089.
DR   EnsemblGenomes-Gn; E2348_P1_091.
DR   EnsemblGenomes-Gn; E2348_P1_093.
DR   EnsemblGenomes-Gn; E2348_P1_094.
DR   EnsemblGenomes-Gn; E2348_P1_095.
DR   EnsemblGenomes-Gn; E2348_P1_100.
DR   EnsemblGenomes-Gn; EBG00001076461.
DR   EnsemblGenomes-Tr; E2348_P1_002.
DR   EnsemblGenomes-Tr; E2348_P1_017.
DR   EnsemblGenomes-Tr; E2348_P1_023.
DR   EnsemblGenomes-Tr; E2348_P1_024.
DR   EnsemblGenomes-Tr; E2348_P1_025.
DR   EnsemblGenomes-Tr; E2348_P1_026.
DR   EnsemblGenomes-Tr; E2348_P1_027.
DR   EnsemblGenomes-Tr; E2348_P1_028.
DR   EnsemblGenomes-Tr; E2348_P1_029.
DR   EnsemblGenomes-Tr; E2348_P1_030.
DR   EnsemblGenomes-Tr; E2348_P1_031.
DR   EnsemblGenomes-Tr; E2348_P1_032.
DR   EnsemblGenomes-Tr; E2348_P1_079.
DR   EnsemblGenomes-Tr; E2348_P1_080.
DR   EnsemblGenomes-Tr; E2348_P1_082.
DR   EnsemblGenomes-Tr; E2348_P1_088.
DR   EnsemblGenomes-Tr; E2348_P1_089.
DR   EnsemblGenomes-Tr; E2348_P1_091.
DR   EnsemblGenomes-Tr; E2348_P1_093.
DR   EnsemblGenomes-Tr; E2348_P1_094.
DR   EnsemblGenomes-Tr; E2348_P1_095.
DR   EnsemblGenomes-Tr; E2348_P1_100.
DR   EnsemblGenomes-Tr; EBT00001679866.
DR   EuropePMC; PMC2612414; 18952797.
DR   EuropePMC; PMC3067099; 21173179.
DR   EuropePMC; PMC3133550; 21689465.
DR   EuropePMC; PMC5293775; 28224117.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC6291465; 30574131.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF00107; FinP.
DR   RFAM; RF00243; traJ_5.
DR   StrainInfo; 844885; 0.
DR   UniProtKB/Swiss-Prot; P43476; PERD_ECO27.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..97978
FT                   /organism="Escherichia coli O127:H6 str. E2348/69"
FT                   /plasmid="pMAR2"
FT                   /strain="E2348/69"
FT                   /serotype="O127:H6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:574521"
FT   CDS_pept        275..1252
FT                   /transl_table=11
FT                   /gene="repI"
FT                   /locus_tag="E2348_P1_001"
FT                   /product="replication initiation protein"
FT                   /note="bind to repeated iterons in RepFIB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_001"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07437"
FT                   /db_xref="GOA:B7UTD0"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD0"
FT                   /protein_id="CAS07437.1"
FT                   /translation="MDKSSGEVVNLTPNASNTVQPVALMRLGVFVPTLKSLKNSKKNTL
FT                   SRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGVIHSFARHKVIGDKVELP
FT                   FVEFAKLCGIPSSQSSRKLRERISPSLKRIAGTVISFSRTTEKHTKEYITHLVQSAYYD
FT                   TEKDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPAPISL
FT                   ARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPKLKPPH
FT                   DESAENPQLPATTGDVSPEMAEKLKLLEKLGITLDDLEKLFKSR"
FT   CDS_pept        complement(1581..2225)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="rsvA"
FT                   /locus_tag="E2348_P1_002"
FT                   /note="pseudogene, putative recombinase, truncated by
FT                   premature stop codon and 30 aa deleted"
FT   CDS_pept        2646..3227
FT                   /transl_table=11
FT                   /gene="bfpA"
FT                   /locus_tag="E2348_P1_003"
FT                   /product="major pilin structural unit bundlin"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_003"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07439"
FT                   /db_xref="GOA:P33553"
FT                   /db_xref="InterPro:IPR007971"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="PDB:1QT2"
FT                   /db_xref="PDB:1ZWT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33553"
FT                   /protein_id="CAS07439.1"
FT                   /translation="MVSKIMNKKYEKGLSLIESAMVLALAATVTAGVMFYYQSASDSNK
FT                   SQNAISEVMSATSAINGLYIGQTSYSGLDSTILLNTSAIPDNYKDTTNKKITNPFGGEL
FT                   NVGPANNNTAFGYYLTLTRLDKAACVSLATLNLGTSAKGYGVNISGENNITSFGNSADQ
FT                   AAKSTAITPAEAATACKNTDSTNKVTYFMK"
FT   CDS_pept        3274..3675
FT                   /transl_table=11
FT                   /gene="bfpG"
FT                   /locus_tag="E2348_P1_004"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_004"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07440"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD2"
FT                   /protein_id="CAS07440.1"
FT                   /translation="MRTVILFFCLLVSCFTQAQESANKNEKLFSGDTTSVALQASERTI
FT                   KNAKADWSVIKGQTLYGVLSDWAQQSGWTVLWHANYNYTLNASAVFKDMSLDDAVKKLL
FT                   ESMGNVSPRVFIKFYNGNHVILVTQSPEG"
FT   CDS_pept        3682..5340
FT                   /transl_table=11
FT                   /gene="bfpB"
FT                   /locus_tag="E2348_P1_005"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_005"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07441"
FT                   /db_xref="GOA:Q47068"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47068"
FT                   /protein_id="CAS07441.1"
FT                   /translation="MKLGRYSLFLLCPLLASCSGNGFYKDNLGVIDKNILHADTSLLKS
FT                   KNKEHYKSSDMVSKTDSIYIGNSSFQTYHGEPLPGKLEGVHGIILRSSTPLGFDEVLSM
FT                   IQDSSGIPIVKHTTKDVISGGVSSKSLAATVAEKMNSATGGKSTDQFDHLLLEVSSEHQ
FT                   LMDVNYQGALSTFLDKVAANYNLYWTYESGRIAFSNEETKRFSISILPGGKYTSKNSIS
FT                   SDSNSSSGSSGSSGSSSSDSGAELKFDSDVDFWKDIENSIKLILGSDGSYSISTSTSSV
FT                   IVRTSSANMKKINEYINTLNAQLERQVTIDVAIYNVTTTDSSDLAMSLEALLKHNGGVL
FT                   GSVSTSNFAATSGTPSFTGYLNGNGDSSNQVLLNLLAEKGKVSVVTSASVTTMSGQPVP
FT                   LKVGNDRTYVSEIGTVLSQSSTSTTASTSTVTSGFLMNLLPQVADDGNILLQYGVTLSE
FT                   LVGSNNGFDQATVNGTVIQLPNVDSTTFVQSSMLRNGNTLVLAGYEKKRNESVDQGVGT
FT                   TSFKLLGGALNGSASRTVTVICITPRIIDLKASGE"
FT   CDS_pept        5337..6545
FT                   /transl_table=11
FT                   /gene="bfpC"
FT                   /locus_tag="E2348_P1_006"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_006"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07442"
FT                   /db_xref="GOA:B7UTD4"
FT                   /db_xref="PDB:3VHJ"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD4"
FT                   /protein_id="CAS07442.1"
FT                   /translation="MIKNNLGVAVIGSKQYAVNLLWGSSQDTETTNQALNKSLTLMSSK
FT                   LYSVIGRFQGEQFAVGDKNIGHKRGQVTLLSAIDFDGSSFCGLFPADNELWLVIGVDKD
FT                   GMVHFDKSFHSKDDAKKFFFDHVAYGYPWDRTYSPSDVGVGESRSISELSLIKGKKLKE
FT                   KGAGQLMPLLLSGVGIIIFFVIIYNFMNLWLSGRDKDILNEEPSPAVSEEVRNIPWEGK
FT                   SKPGSLFSKCIKEMDSFRFQAASVPGWMPENKVTCNDSDINFSVYRSGGLNIWYENPGL
FT                   FFHSGDIPDITRNDNDKITFTWPLETVRYDSSILDVHTLNKTQEIIRYLSRQFENSWIE
FT                   IKFEPSVPDGNTERVGFSFSFNHDPRILLPILSEVNGLIITNIDYDFSGSNWNVKGVFW
FT                   GRA"
FT   CDS_pept        6523..7017
FT                   /transl_table=11
FT                   /gene="bfpU"
FT                   /locus_tag="E2348_P1_007"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_007"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07443"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD5"
FT                   /protein_id="CAS07443.1"
FT                   /translation="MFFGGELSLKKILFTFLFVVSSVVNAEVNTSVDVSGKNDSRKEEN
FT                   KLPDVDLEKYKDELLSYQELQRKNMMLKLQSENQKLESEIKKSGSFISYDTNENTIYLM
FT                   SIMTTPKKGLCATIFNGAISRVCKGDIINEHSVVSDITGNYVEIRSINNISDPVQKIFL
FT                   R"
FT   CDS_pept        7024..8631
FT                   /transl_table=11
FT                   /gene="bfpD"
FT                   /locus_tag="E2348_P1_008"
FT                   /product="nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_008"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07444"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD6"
FT                   /protein_id="CAS07444.1"
FT                   /translation="MMLNKTEKTSDLMFERFKRNVSEIVTGDGGELELTVEQRKYFLIF
FT                   KNGDFLVSSCHMKHHLVQMLREIATRKGYPNLTIYEVNLKDIRLLYEASLKTVQNNGQD
FT                   LLPVEKRASMLLFECAEMRVSDLHIKVYDAEADIYIRKDGDMELLRQIESNTAHSILAS
FT                   LYNNADDSDATYKINAYQAARIVASKSRLALPPVIQAVRLQFNPLGQGGRYLIARFLYT
FT                   DKSEKQKEMDPTRFGFHHSHAESFSRMRNLPIGINIISGPTGSGKSTTLKNLLELLYIE
FT                   KKKKVNIISIEDPPEYEIDGTAQLPITNVETEAQRGEEYRKAITAALRSDPDIIMPGEA
FT                   RDAEVINLLFTAAMTGHQVWTSLHANNALAIFDRLKDQGVDEFKLTDPELITGLVAQRL
FT                   VRKLCAQCSITLTEYIASGGGISDTDRKIISGHETSVRFPNPRAKKCCRDGYNGRTILA
FT                   EVIEPDSKLLRLVAEGKREDAQHYWLTSLHGMALKEHAWLKIISGEICVMDAVNKISGI
FT                   DNITEERKKYLFSRDNEI"
FT   CDS_pept        8638..9696
FT                   /transl_table=11
FT                   /gene="bfpE"
FT                   /locus_tag="E2348_P1_009"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_009"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07445"
FT                   /db_xref="GOA:B7UTD7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD7"
FT                   /protein_id="CAS07445.1"
FT                   /translation="MKEKLNRLLFTSKTRMRVFSKLSRYLSNGVPVTFALAELYKFTSD
FT                   EGRKKDNPDAFALQRWLIAVRNGKTLAEAMRGWVPFDELSIISAGEISGNVHQALDDII
FT                   YMNDTKKKVKGALAGIIYPVVLLLTTCLYLHIFGTQVVPAFSGILPVEKWQGAGRTMYY
FT                   LAVFVQDYLVITLLSFMMVILLILATLSRWTGRLRLFFDRFIPWSIYKTIIGCGFLLSL
FT                   ASLINAGIPVPEALRIIMKTASPWYKERLVAIRYRLLNGERNLGEALNSSGYIFPSKQM
FT                   IMDLRSYAALGGFDEMLNKLSVQWQDDSVAYITKQMTVLKNVAIIIMGLVFMWIVSGMF
FT                   SLQQQISDAARF"
FT   CDS_pept        9680..10675
FT                   /transl_table=11
FT                   /gene="bfpF"
FT                   /locus_tag="E2348_P1_010"
FT                   /product="nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_010"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07446"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD8"
FT                   /protein_id="CAS07446.1"
FT                   /translation="MQQDSDFFLRCDIMNIINELNFADLLISKDSYNFRFLEGQPYPIC
FT                   NVPDNYNAEVQEMVQELECIREAKGNEFFYLHLGVPYRVAVVQTITGSGFFLRKLKLPV
FT                   PSLDSLGFSEPFLNTLKLMGKKRGLLLVSGATGSGKSTTIYALLTYYVQKYGDIAISIE
FT                   DPPEVPVQGNYGDNQEGVWFQMDARELGGYENAMISAMRYNPRYIFLGEIRSAKTAKEA
FT                   IRAAVNGHLVVSTIHGSSVQGAIYALQQIASAEGEADLVRSIIADGLLGIVHQELRFTE
FT                   NGQRSLSANILCNDGSASISSKIRSGKLELLSSEIEQQRIMLSHGKNLIS"
FT   CDS_pept        10682..11431
FT                   /transl_table=11
FT                   /gene="bfpP"
FT                   /locus_tag="E2348_P1_011"
FT                   /product="prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_011"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07447"
FT                   /db_xref="GOA:B7UTD9"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTD9"
FT                   /protein_id="CAS07447.1"
FT                   /translation="MQESIFLLLVFIYAATITSFIWLAVERLPHQLKWVDNPVSDITIW
FT                   SPGSKCNNCGKKIRWYYLIPVLGYFLCRGECGYCHAKVPVRYPLTEFICGVCSVIIFVF
FT                   LGDRLYDAVIVSLLFLCLVFLALIDLRENWLPACVTYPLFWAGMITPGFASSDDKIFGA
FT                   FTGFLIMYISMKLVSALRKEDVFAGGDIALATAAGAWLGIDKMPFFLILSSFIFILYSL
FT                   PARLRGQVFVPMGPALSASFFICLVYH"
FT   CDS_pept        11413..11859
FT                   /transl_table=11
FT                   /gene="bfpH"
FT                   /locus_tag="E2348_P1_012"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_012"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07448"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTE0"
FT                   /protein_id="CAS07448.1"
FT                   /translation="MFSLSLITGVAACVLNASSVNNIEPALLLSVMTVEGGKPGSISIN
FT                   KNGSHDLGIMQINTHAWLKLISKSFFNGDERSAYAKLKDDACFNISVGAWILRRSIIFE
FT                   GGNLWEGVGRYHSATPEYKYRYIDKVKNVYGQITYSQSIHQRNM"
FT   CDS_pept        11880..12425
FT                   /transl_table=11
FT                   /gene="bfpI"
FT                   /locus_tag="E2348_P1_013"
FT                   /product="prepilin"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_013"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07449"
FT                   /db_xref="GOA:B7UTE1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTE1"
FT                   /protein_id="CAS07449.1"
FT                   /translation="MFILRNKRKESGLSLIEASLVIILSGLVIVLVQSAISKIIKYAVH
FT                   ENALHDVSYVMSYIQDTLQTSCYGKENIVCDGVISSVKSNVNSGNKIKVDVKKDGKYVS
FT                   VYILYTLSGNEYFGRNEDFGSMLFTHVSAYSGRMDSSTGVVSSVLGWWKVNSDDTIFLG
FT                   GDNNKNLFFYNNFRVDVL"
FT   CDS_pept        12422..12973
FT                   /transl_table=11
FT                   /gene="bfpJ"
FT                   /locus_tag="E2348_P1_014"
FT                   /product="prepilin"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_014"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07450"
FT                   /db_xref="GOA:B7UTE2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTE2"
FT                   /protein_id="CAS07450.1"
FT                   /translation="MIRKESGLSLIEVMIGVLFFSIVSLSVYNYYNRSAEQHYMNNVSV
FT                   VMCRYADALSYYLQDSTATNGNGSVSLSTLVASGYLPPMQETSGVGEYEIKMYVDKNKN
FT                   GLIALYGGEYYSLTSENIKKFLGIRGASAKDNKIISAGGYYSLPVSDFTGFRTVNLRGL
FT                   MLIPSIQTSGQNCDRGGYDF"
FT   CDS_pept        12963..13451
FT                   /transl_table=11
FT                   /gene="bfpK"
FT                   /locus_tag="E2348_P1_015"
FT                   /product="prepilin"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_015"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07451"
FT                   /db_xref="GOA:B7UTE3"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTE3"
FT                   /protein_id="CAS07451.1"
FT                   /translation="MIFEGRQQKGLSLIEIAMVIILSVVFISGGSYIISLFKVFAQSCV
FT                   VATDMNSVRNIIISSDVEYKTGKYDVSSITNDNRFNKYQVYFGNDGYTLISGSSPVSVD
FT                   VFFITCYLAKYNCVWILNTNNKIYAKHMSAVLPLELLSAYGLNYSGESGVTGLLFKRY"
FT   CDS_pept        13454..13903
FT                   /transl_table=11
FT                   /gene="bfpL"
FT                   /locus_tag="E2348_P1_016"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_016"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07452"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTE4"
FT                   /protein_id="CAS07452.1"
FT                   /translation="MLFFWCGFFSLIVSILNISMGYNDRLFLDEQNRIIKENIYVDYLT
FT                   VNAAVLSEICTTDAGKCKDKTSILSDELSESLKDKLSGYDNSITPEFCINHGKVIVYTT
FT                   YHFNISRYKDSSLFNLSDVPNSDRLACSINDNSGIAIIKTFNKTG"
FT   repeat_region   14151..15159
FT                   /locus_tag="E2348_P1_rr__01"
FT   CDS_pept        14191..15109
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_017"
FT                   /note="pseudogene, transposase of IS481 family, fragmented
FT                   by multiple mutations"
FT   repeat_region   15460..16717
FT                   /locus_tag="E2348_P1_rr__02"
FT   CDS_pept        complement(15490..16356)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_018"
FT                   /product="transposase Orf2 of ISEc17"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_018"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07454"
FT                   /db_xref="GOA:B7UTE5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTE5"
FT                   /protein_id="CAS07454.1"
FT                   /translation="MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTRISTRQQF
FT                   RQHCDSVVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRKFSP
FT                   VSYRAHGLPVSENLLEQDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWS
FT                   MSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKG
FT                   CCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQ
FT                   FENQNLA"
FT   CDS_pept        complement(16353..16652)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_019"
FT                   /product="transposase Orf1 of ISEc17"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_019"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07455"
FT                   /db_xref="GOA:B7UP29"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B7UP29"
FT                   /protein_id="CAS07455.1"
FT                   /translation="MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQ
FT                   LYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK"
FT   repeat_region   16785..16933
FT                   /locus_tag="E2348_P1_rr__03"
FT                   /note="3' fragment"
FT   CDS_pept        17176..18000
FT                   /transl_table=11
FT                   /gene="perA"
FT                   /locus_tag="E2348_P1_020"
FT                   /product="transcriptional activator of the bfp operon"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_020"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07456"
FT                   /db_xref="GOA:P43459"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43459"
FT                   /protein_id="CAS07456.1"
FT                   /translation="MLTSKKEMQSSENKQEENLALLLTNYISYQNIVIFTGGNQFKIRN
FT                   KKEFTEYTIESNSLFFLAKNTHWDMEIVGIDNSNPYRKIIIDDALIKLLHSISSDDSCY
FT                   VKKKIFTANLNEMQLNIVSNIITDIKYSGNNKKIFKILYLLSFFNDYNDIVNVILSASS
FT                   KSIVDRVIKVIELDISKNWKLGDVSSSMFMSDSCLRKQLNKENLTFKKIMLDIKMKHAS
FT                   LFLRTTDKNIDEISCLVGFNSTSYFIKVFKEYYNTTPKKYNGVYSITQGTLP"
FT   CDS_pept        18048..18437
FT                   /transl_table=11
FT                   /gene="perB"
FT                   /locus_tag="E2348_P1_021"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_021"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07457"
FT                   /db_xref="GOA:B7UTE8"
FT                   /db_xref="InterPro:IPR009513"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UTE8"
FT                   /protein_id="CAS07457.1"
FT                   /translation="MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFI
FT                   PPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSY
FT                   ASNVIKFLITMEGGGDILSESKRAP"
FT   CDS_pept        18487..18756
FT                   /transl_table=11
FT                   /gene="perC"
FT                   /locus_tag="E2348_P1_022"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_022"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07458"
FT                   /db_xref="GOA:B7UTE9"
FT                   /db_xref="InterPro:IPR024684"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UTE9"
FT                   /protein_id="CAS07458.1"
FT                   /translation="MEIRDKKAKYLEEKGFYRRAADRWAEIMVLLSSDAERKLAAQKRA
FT                   FCINKSLRNNLQADNYSDIKQGVYKAYKKMGLVNEKIFRNYKEN"
FT   repeat_region   18784..18946
FT                   /locus_tag="E2348_P1_rr__04"
FT                   /note="5' fragment"
FT   repeat_region   18947..19857
FT                   /locus_tag="E2348_P1_rr__05"
FT   CDS_pept        complement(18984..19785)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_023"
FT                   /note="pseudogene, transposase of IS1414, fragmented by
FT                   multiple mutations"
FT   repeat_region   19865..20904
FT                   /locus_tag="E2348_P1_rr__06"
FT                   /note="3' fragment"
FT   CDS_pept        19865..20879
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_024"
FT                   /note="pseudogene, transposase of ISfl1, fragmented by
FT                   multiple mutations"
FT   repeat_region   21559..21677
FT                   /locus_tag="E2348_P1_rr__07"
FT                   /note="3' fragment"
FT   repeat_region   22397..24104
FT                   /locus_tag="E2348_P1_rr__08"
FT                   /note="fragment"
FT   CDS_pept        22792..23886
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_025"
FT                   /note="pseudogene, transposase of IS91 family, fragmented
FT                   by multiple mutations"
FT   CDS_pept        complement(24113..24571)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_026"
FT                   /note="pseudogene, putative acetyltransferase, N-ter part
FT                   missing"
FT   CDS_pept        24572..26540
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_027"
FT                   /note="pseudogene, toxin B, truncated by multiple
FT                   mutations"
FT   repeat_region   26597..27022
FT                   /locus_tag="E2348_P1_rr__09"
FT   CDS_pept        26630..27022
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_028"
FT                   /note="pseudogene, truncated transposase Orf2 of IS3
FT                   family"
FT   repeat_region   27089..28058
FT                   /locus_tag="E2348_P1_rr__10"
FT   CDS_pept        complement(27114..27527)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_029"
FT                   /note="pseudogene, transposase Orf2 of IS21, fargmented by
FT                   deletion"
FT                   /db_xref="PSEUDO:CAS07465.1"
FT   CDS_pept        complement(27540..28058)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_030"
FT                   /note="pseudogene, C-ter part of transposase Orf1 of IS21"
FT   repeat_region   28063..29403
FT                   /locus_tag="E2348_P1_rr__11"
FT   CDS_pept        28145..29133
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_031"
FT                   /note="pseudogene, transposase Orf1 of IS100, truncated by
FT                   frameshift mutation"
FT   CDS_pept        29136..29402
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_032"
FT                   /note="pseudogene, transposase Orf2 of IS100, truncated by
FT                   premature stop codon"
FT   CDS_pept        complement(29608..29895)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_033"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_033"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07469"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH9"
FT                   /protein_id="CAS07469.1"
FT                   /translation="MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLR
FT                   GLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGKRERSNVYNLASERMR"
FT   CDS_pept        complement(29892..30143)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_034"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_034"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07470"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI0"
FT                   /protein_id="CAS07470.1"
FT                   /translation="MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCV
FT                   PAELYERMLDALDDQELVKLVTERSNQPLHDVDLDSYL"
FT   CDS_pept        complement(31108..31965)
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="E2348_P1_035"
FT                   /product="replication protein of IncFII family"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_035"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07471"
FT                   /db_xref="GOA:B7UTI1"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI1"
FT                   /protein_id="CAS07471.1"
FT                   /translation="MTDLQQTYYRQVKNPNPVFTPRKGAGTLKFCEKLMEKAVGFTSRF
FT                   DFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLA
FT                   TESGAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDVSEV
FT                   AVASARRSRVEWENRQRKKQGLDALGMDELIAKAWRFVRERFRSYQTELKYRGIKRARA
FT                   RRDANRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKERMILSRNRNYSRLA
FT                   TASP"
FT   misc_RNA        32050..32141
FT                   /locus_tag="E2348_P1_mR_1"
FT                   /product="antisesce sRNA, regulates copy number through
FT                   inhibition of replication inhibitor protein synthesis"
FT                   /note="identified in Rfam screening as CopA-like RNA"
FT   CDS_pept        complement(32279..32527)
FT                   /transl_table=11
FT                   /gene="copB"
FT                   /locus_tag="E2348_P1_036"
FT                   /product="regulation of plasmid copy number"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_036"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07472"
FT                   /db_xref="GOA:B7UTI2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI2"
FT                   /protein_id="CAS07472.1"
FT                   /translation="MSQTENAVTSSSGTKRAYRKGNPLTLAERQQASLARKRATHKELR
FT                   VFIPAALKAQLQEMCEAEGVTQAEMIAELIKQKSAFS"
FT   CDS_pept        complement(32811..32960)
FT                   /transl_table=11
FT                   /gene="srnB"
FT                   /locus_tag="E2348_P1_037"
FT                   /product="post-segregational killing toxin"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_037"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07473"
FT                   /db_xref="GOA:B7UTI3"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI3"
FT                   /protein_id="CAS07473.1"
FT                   /translation="MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAY
FT                   EARK"
FT   repeat_region   32984..34533
FT                   /locus_tag="E2348_P1_rr__12"
FT   CDS_pept        33149..34522
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_038"
FT                   /product="transposase of ISEc13"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_038"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07474"
FT                   /db_xref="GOA:B7UFC5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:B7UFC5"
FT                   /protein_id="CAS07474.1"
FT                   /translation="MVLSDCYSWANEQFGHARLGDPRRTRRLVSLASSLAQHAGLSIVK
FT                   SSQSTAQVEGAYRLIRNPSVSPQAIAEAGFTATVRACEAHPLLLALEDTTTINFSHSTA
FT                   SDDLGNTTTNPKTRGLLAHSVLMYAPDSALPVGLIEQQRWSRATDTYGVKHQRKERPYE
FT                   EKESYRWQQASERMAERLGEIQKRVITVCDREADIWHYLHYKVSHGQRFVVRAAQNRRL
FT                   EEAPGKLFELPEVLATAGSHTLNVMQKGGRAARQARMFISYSEVSIKNPDNSGQALPLT
FT                   YVCCREQAEDGACWHLLTSEKVASAADARRIVSHYERRWLIEEYHKAWKSGGTCVESLR
FT                   MQTRDNLERMVVIKAFIAVRVLGLRQGGISEETQNDSCEKILTPTEWKLLWVKLEGKPL
FT                   PSQMPTLKWACLKLAKLGRWHDSKRTGRPGWVVMWDGWFRLQDMVEGYLVMKSLDQEI"
FT   CDS_pept        complement(34555..35112)
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="E2348_P1_039"
FT                   /product="fertility inhibition protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_039"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07475"
FT                   /db_xref="GOA:B7UTI5"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR021065"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI5"
FT                   /protein_id="CAS07475.1"
FT                   /translation="MTEQKRPVLTLKRKTEGETPTRSRKTIINVTTPPKWKVKKQKLAE
FT                   KAAREAELAAKKAQARQALSIYLTLPSLDEAVNTLKPWWPGLFDGNTPRLLACGIREVL
FT                   LDEVSQRNIPLSHKKLRRALKAITRSESYLGAMKAGACRYDTEGYVTEHITQEEEQYAQ
FT                   ARLEKVRRQNRIKDELRAILAE"
FT   CDS_pept        complement(35215..36075)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_040"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_040"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07476"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI6"
FT                   /protein_id="CAS07476.1"
FT                   /translation="MKITDHKLPEGIALTFRVPEGNIKHPLILLCHGFCGIRNVLLPSF
FT                   ANAFTEAGFATITFDYRGFGESEGERGRLVPAMQTEDIISVINWAEKQVCIDNQRIGLW
FT                   GTSLGGCHVFNAAAQDKRVKSIVSQLAFADGEVLVTGEMNELEKASFLSTLNKMAEKKK
FT                   NTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKIPFLTVMETLQYKPAESAAKVQC
FT                   PVLVVIAGQDSVNPPEQGRALYDAVASGTKELYEEADACHYDIYEGAFFERVAAVQTQW
FT                   FKKHL"
FT   CDS_pept        complement(36134..36880)
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="E2348_P1_041"
FT                   /product="acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_041"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07477"
FT                   /db_xref="GOA:B7UTI7"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="InterPro:IPR014125"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI7"
FT                   /protein_id="CAS07477.1"
FT                   /translation="MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMV
FT                   LDHANRILHLDQSWMFLVGRGAFPLFALVWGLNLSRHTHIRQEAINRLWGWAVIAQFAY
FT                   YLAGFPWYEGNILFAFAVAAQVLTWCETRTWWRSAETMLLLAMWLPFSGTSYGIAGLLM
FT                   LAVSHRLYRAEDRMERLALVACLLAVIPALNLATSDAAAVAGLVMTVLTVGLVSCTGKS
FT                   LPRFWYGDFFPTFYACHLTVLGVLAV"
FT   CDS_pept        complement(36900..42170)
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="E2348_P1_042"
FT                   /product="oriT-specific relaxase; helicase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_042"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07478"
FT                   /db_xref="GOA:B7UTI8"
FT                   /db_xref="InterPro:IPR009767"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040668"
FT                   /db_xref="InterPro:IPR040987"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI8"
FT                   /protein_id="CAS07478.1"
FT                   /translation="MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQG
FT                   SVDKDVFTRLLEGKLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLID
FT                   AHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHAVVA
FT                   NVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEALGYETEVVGKHG
FT                   MWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQTL
FT                   KETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVL
FT                   ARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDI
FT                   MKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMARE
FT                   QGREVQIIAADRRSQMNLKQDERLSGELITGRRQLQEGMAFTPGNTVIVDQGEKLSLKE
FT                   TLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQRPATIISEPDR
FT                   NVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGRPEVTMTALS
FT                   PVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSNSLTLRDAQGETQVVR
FT                   ISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRA
FT                   EPASLPVSDSPFMALKLENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDV
FT                   RLYSSLDETRTAEKLARHPSFTVVSEQIKARAGETLLETAISLQKTGLHTPAQQAIHLA
FT                   LPVVESKNLAFSMVDLLTEAKSFAAEGTSFTELGGEINAQIKRGDLLYVDVAKGYGTGL
FT                   LVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMILETSDRFTV
FT                   VQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLH
FT                   DTQLLQRSGETPNFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIA
FT                   PGQPFRLQQTRSAADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQ
FT                   EGAWVPEHSVTEFSHSQEAKLAEAQQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEARE
FT                   QTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVMVPVLNTANIRDGELRRLSTWETHR
FT                   DALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVTLYTPDTIRVGTGD
FT                   RMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAITA
FT                   HGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAV
FT                   QKGTAHDVLEPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGR
FT                   KYPQPYVALPAFDRNGKSAGIWLNPLTTDDGNGLRGFSGEGREKGSGDAQFVALQGSRN
FT                   GESLLADNMQDGVRIARDNPDSGVVVRIAGEGRPWNPGTITGGRVWGDIPDNSVQPGAG
FT                   NGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLPDGKTEQAVRDIAGLERD
FT                   RSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKEKTLGGD
FT                   "
FT   CDS_pept        42252..42479
FT                   /transl_table=11
FT                   /gene="mvpT"
FT                   /locus_tag="E2348_P1_043"
FT                   /product="post-segregational killing toxin"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_043"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07479"
FT                   /db_xref="GOA:B7UTI9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTI9"
FT                   /protein_id="CAS07479.1"
FT                   /translation="METTVFFSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGE
FT                   TWDEWFDGHNVSADFMDNREQPGMQERESF"
FT   CDS_pept        42479..42877
FT                   /transl_table=11
FT                   /gene="mvpA"
FT                   /locus_tag="E2348_P1_044"
FT                   /product="putative anti-toxin of post-segregational killing
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_044"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07480"
FT                   /db_xref="GOA:B7UTJ0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ0"
FT                   /protein_id="CAS07480.1"
FT                   /translation="MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIY
FT                   GAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHSGQIRAELARQGRPVGPFDQMIAGH
FT                   ARSRGLIIVTNNTREFERVDGLRIEDWS"
FT   CDS_pept        complement(42886..45039)
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="E2348_P1_045"
FT                   /product="coupling protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_045"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07481"
FT                   /db_xref="GOA:B7UTJ1"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ1"
FT                   /protein_id="CAS07481.1"
FT                   /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIILYCLFIFFWILVGLVL
FT                   WVKISWQTFVNGCIYWWCTTLEGMRDLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWC
FT                   GEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQQSENEITGGRQLTDNPKEVARML
FT                   KKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRS
FT                   GEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGS
FT                   GRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISI
FT                   RAVLTNYVKAIRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVIS
FT                   MWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYA
FT                   QLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQYSYGADPVR
FT                   DGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQTRPKVAPEFIPRD
FT                   INPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPVSPAINDKKS
FT                   DAGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAVYEAWQREQNPDIQQKMQ
FT                   RREEVNINVHRERGEDVEPGDDF"
FT   CDS_pept        complement(45292..46023)
FT                   /transl_table=11
FT                   /gene="traT"
FT                   /locus_tag="E2348_P1_046"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_046"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07482"
FT                   /db_xref="GOA:B7UTJ2"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ2"
FT                   /protein_id="CAS07482.1"
FT                   /translation="MKTKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIWL
FT                   EPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKADKM
FT                   DLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMVEDVN
FT                   YTMITDVQIAERTKTTVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSSANKVNL
FT                   KFEEAKPVLEDQLAKSIANIL"
FT   CDS_pept        complement(46037..46546)
FT                   /transl_table=11
FT                   /gene="traS"
FT                   /locus_tag="E2348_P1_047"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_047"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07483"
FT                   /db_xref="GOA:B7UTJ3"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ3"
FT                   /protein_id="CAS07483.1"
FT                   /translation="MITHYDIKMETQKLKDVLSVEGVNIPPLLQVIKPGGYVFLWVLLW
FT                   PTFLRLLADKVDIRDAGFDICFSGVMGFILFVAITNGMMLYLAIPEKFRDESKVISFMY
FT                   DKNKTYILSFLIAFSMVSFAHTLLYEFLLIALFIIFFFIYAIDINRYNLSAIASVIGLF
FT                   KKESVS"
FT   CDS_pept        complement(46543..49368)
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="E2348_P1_048"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_048"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07484"
FT                   /db_xref="GOA:B7UTJ4"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ4"
FT                   /protein_id="CAS07484.1"
FT                   /translation="MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVA
FT                   VMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKIHRVDNVPVGLAMPLSL
FT                   TTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELVSKSTDFLSRNPEIANLFQDYVQN
FT                   CVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTCKDASVSLKDKLN
FT                   LDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNVTINAL
FT                   KEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTGIAIGIF
FT                   PLLVLAAVFNKLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPVVLSEISQ
FT                   IQLKYSDLASTAGYLSMMIPPLSWMMVRGLGAGFSSVYSHFASSAISPTASAAGSVVDG
FT                   NYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDASGAMSRLPV
FT                   GINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNTLSQFGSNRGSSDSVTGGAD
FT                   STMSAQDSMMSSRMRSAVESYAKAHNISNEQATRELASRSTTASAGLYGDAHAGLDAKP
FT                   SLFGVRVDVGAKVGGRASIDGSDLDSHEASSGSRASHDARHDIDARASKDFKEASDYFT
FT                   SRKVSESGSHTDNNADFRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQ
FT                   MSEDLSQQFAQYVMKHAPQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRE
FT                   SRGDIGKRMESVPSGGGSQNIIADHQGHQAIIDQRTQDSNIRNDVKHQVDNMVTEYKGN
FT                   IGDTQNSIHGEENIVRGQYSELQNHHKTEALSQNNKYNEERESQKIIPEPSGEAVKKMI
FT                   DGKKERLKGPL"
FT   CDS_pept        complement(49365..50738)
FT                   /transl_table=11
FT                   /gene="traH"
FT                   /locus_tag="E2348_P1_049"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_049"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07485"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ5"
FT                   /protein_id="CAS07485.1"
FT                   /translation="MFRIKPLFILCAALLTLTPAASADVNSDMNQFFNKLGFASNTTQP
FT                   GVWQGQAAGYAYGGSLYARTQVKNVQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQR
FT                   FVKQIMSNAAGYFFDLALQTTVPEIKTAKDFVQKMASDINSMNLSSCQAAQGIIGGLFP
FT                   RTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDKDKERVTKNINIMW
FT                   NALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTSDRSIIRAMMEGGTAKIY
FT                   HCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKVVSDTPLDDKEKGFISSTTI
FT                   PVFKYLVDPQMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHI
FT                   NDNMNDATRQIAAFQSQVQVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL"
FT   CDS_pept        complement(50738..51118)
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="E2348_P1_050"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_050"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07486"
FT                   /db_xref="GOA:B7UTJ6"
FT                   /db_xref="InterPro:IPR016386"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ6"
FT                   /protein_id="CAS07486.1"
FT                   /translation="MRENKNNPELKIRSTERDYKYISRITDRYAGLSLVFLTAGIVLWT
FT                   VMNIIFDTCIDSWKADPELNNLRYMWNILMYAIPCTLWALASGFFCCGLSAAFMCIIRQ
FT                   KYHDTPAETPYAPGEHIKGGQQ"
FT   CDS_pept        complement(51105..51446)
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="E2348_P1_051"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_051"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07487"
FT                   /db_xref="GOA:B7UTJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ7"
FT                   /protein_id="CAS07487.1"
FT                   /translation="MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLN
FT                   IPFIRQGLFYPASPVEIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSKI
FT                   SEGTYNERK"
FT   CDS_pept        complement(51376..51921)
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /locus_tag="E2348_P1_052"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_052"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07488"
FT                   /db_xref="GOA:B7UTJ8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ8"
FT                   /protein_id="CAS07488.1"
FT                   /translation="MSLTKLLPVILLMMVTGVQASTRDEIERLWNPQGMAAQPAQPAAD
FT                   TSARTEKPAPRWFRLSNGRQVNLADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSVFP
FT                   YTLDGQGDTAFPEALPVPPEVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGATDAAGF
FT                   MARMDTVLQMYGGKKGAK"
FT   CDS_pept        complement(51908..52192)
FT                   /transl_table=11
FT                   /gene="traQ"
FT                   /locus_tag="E2348_P1_053"
FT                   /product="pilin chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_053"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07489"
FT                   /db_xref="GOA:B7UTJ9"
FT                   /db_xref="InterPro:IPR014112"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTJ9"
FT                   /protein_id="CAS07489.1"
FT                   /translation="MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAE
FT                   LIAAILVLFGAYQVLDAWIARVSREEREALEARQQAMMAEQQEGGHVSH"
FT   CDS_pept        52273..52587
FT                   /transl_table=11
FT                   /gene="artA"
FT                   /locus_tag="E2348_P1_054"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_054"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07490"
FT                   /db_xref="GOA:B7UTK0"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK0"
FT                   /protein_id="CAS07490.1"
FT                   /translation="MEKRSFKEKLEIIRNIIRESLLGNAAIIALIYAASHSLPVNDFPD
FT                   YLVISLLSIAAGIVVLWLFSIIYIYFCELFRSHWIAVWFIIWSSVINLIILYGFYDRFI
FT                   "
FT   CDS_pept        complement(52589..52921)
FT                   /transl_table=11
FT                   /gene="trbA"
FT                   /locus_tag="E2348_P1_055"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_055"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07491"
FT                   /db_xref="GOA:B7UTK1"
FT                   /db_xref="InterPro:IPR016385"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK1"
FT                   /protein_id="CAS07491.1"
FT                   /translation="MKMFTGVVLLIFVIIAGYFFSERNDRKMFLLSSLVFLVINIACLY
FT                   VLTASLWFLCGAIMSQGAALVVSIVAAALPDVTSFDRFRRIFICIVLSSVWSGVMWFFI
FT                   RGFMTG"
FT   CDS_pept        complement(52952..53713)
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="E2348_P1_056"
FT                   /product="putative disulfide-bond-forming protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_056"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07492"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK2"
FT                   /protein_id="CAS07492.1"
FT                   /translation="MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENK
FT                   PVPAAPRQEPDIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMS
FT                   ARKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPID
FT                   GQLVQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQ
FT                   GSVRPLSYGFISQDDLAKQFLNVSEDFKPNF"
FT   CDS_pept        complement(53688..53948)
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="E2348_P1_057"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_057"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07493"
FT                   /db_xref="GOA:B7UTK3"
FT                   /db_xref="InterPro:IPR020150"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK3"
FT                   /protein_id="CAS07493.1"
FT                   /translation="MMKVIFTSNRFIDFLIRLLITAIVISPVIIWSWDTVKETTADGML
FT                   AAAFVILYSGVLLFILYFCFSALTDLQKPDERKSDERNEDE"
FT   CDS_pept        complement(53973..55781)
FT                   /transl_table=11
FT                   /gene="traN"
FT                   /locus_tag="E2348_P1_058"
FT                   /product="mating stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_058"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07494"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK4"
FT                   /protein_id="CAS07494.1"
FT                   /translation="MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGF
FT                   KPQESIPGYNANPDETKYYDGVTAGGDGGLKNDGTTEWATGETGKTITESFMNKPKDIL
FT                   SPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRSEYTNYTCERDLQVEQYCTRTARM
FT                   ELQGSTTWETRTLEYEMSQLPAREVNGQYVVSITSPVTGEIVDAHYSWSRTYLQKSVPM
FT                   TITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMKLRLVV
FT                   RVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDT
FT                   YVTQSADKGTCQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGKVMVCGGD
FT                   VFCLDGECDKAQSGQSNDFAEAVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAA
FT                   GYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLTVSVGEFCSKKVLGVCLEKKRSYC
FT                   QFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQFNRLDFTNFYEDLMNN
FT                   QKIPDSGVLTQKVKEQIADQLKQAGQ"
FT   CDS_pept        complement(55778..56416)
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="E2348_P1_059"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_059"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07495"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK5"
FT                   /protein_id="CAS07495.1"
FT                   /translation="MKLSMKSLAALLMMLNGAVMASENVNTPENRQFLKQQENLSRQLR
FT                   EKPDHQLKAWAEKQVLENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPEEG
FT                   LKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTLFSQYGIRTV
FT                   RALVVFCSQGYDIIRGNLRVSQALEKVAATGDCRQVAHDLLAGKGDSGK"
FT   CDS_pept        complement(56425..57417)
FT                   /transl_table=11
FT                   /gene="traU"
FT                   /locus_tag="E2348_P1_060"
FT                   /product="DNA transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_060"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07496"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK6"
FT                   /protein_id="CAS07496.1"
FT                   /translation="MKRSLWLLILFLLAGHVPAASADSACEGRFVNPITDICWSCIFPL
FT                   SLGSIKVSQGKVPDTANPSMPIQICPAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVN
FT                   LGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYPLTYWLNIITSLGCLEGGDLDIAY
FT                   LSEIDPTWTDSSLATILNPEAVIFANPIAQGACAADAIASAFNMPIDALFWCAGSQGSM
FT                   YPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERWR
FT                   YQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL"
FT   CDS_pept        complement(57414..58046)
FT                   /transl_table=11
FT                   /gene="traW"
FT                   /locus_tag="E2348_P1_061"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_061"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07497"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="InterPro:IPR025864"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK7"
FT                   /protein_id="CAS07497.1"
FT                   /translation="MRCRGLIALLVWGQSVAAADLGTWGDLWPVKELDMLTVIMQRLTV
FT                   LEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYGSRLFDPSVRLAADIRDNEGRV
FT                   FARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEMQKA
FT                   LDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK"
FT   CDS_pept        complement(58043..58429)
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="E2348_P1_062"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_062"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07498"
FT                   /db_xref="GOA:B7UTK8"
FT                   /db_xref="InterPro:IPR014115"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK8"
FT                   /protein_id="CAS07498.1"
FT                   /translation="MTTTQKTTDVTAPRCSHWWWTVPGCLAMVLLNAAISYGIVRLNAP
FT                   VTAAFNMKQTVDAFFDSASQKQLSEVQSKALSARFNTALEASLQAWQQKHHAVILVSPA
FT                   VVQGAPDITREIQQDIARRMRAEP"
FT   CDS_pept        complement(58426..61053)
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="E2348_P1_063"
FT                   /product="pilus assembly/outgrowth protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_063"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07499"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTK9"
FT                   /protein_id="CAS07499.1"
FT                   /translation="MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLP
FT                   YRDYNQESGLFMNDTTMGFMLEAIPINGANESIVEALDHMLRTKLPRGIPLCIHLMSSQ
FT                   LVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAATQFPLPEGMNLPLTLRHYRVFIS
FT                   YCSPSKKKSRADILEMENLVKIIRTSLQGASITTQTVDAQAFIDIVGKMINHNPDSLYP
FT                   KRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFLW
FT                   NMADNYSNLLNSELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPS
FT                   VEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELI
FT                   SPRFNHMRNFLTCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLA
FT                   PTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGD
FT                   GYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSVMASPNGNLDEVHEGLL
FT                   LQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYTANGTY
FT                   GQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNV
FT                   IDEGWRLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNS
FT                   SYKIILKQSAKEFAKYNQLYPDQFQPLQRDMIGKFGAARDQWFSSFLLQVENHSSWHRL
FT                   FVDPLSRAMYSSDGPDFEFVQQKRKEGLSIHEAVWQLAWKKSGPEMASLEAWLEEHEKY
FT                   RSVA"
FT   CDS_pept        complement(61213..61434)
FT                   /transl_table=11
FT                   /gene="traR"
FT                   /locus_tag="E2348_P1_064"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_064"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07500"
FT                   /db_xref="GOA:B7UTL0"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012783"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL0"
FT                   /protein_id="CAS07500.1"
FT                   /translation="MSDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIP
FT                   EARRKIFPGVTLCVECQAYQERQRKHYA"
FT   CDS_pept        complement(61569..62084)
FT                   /transl_table=11
FT                   /gene="traV"
FT                   /locus_tag="E2348_P1_065"
FT                   /product="pilus assembly lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_065"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07501"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL1"
FT                   /protein_id="CAS07501.1"
FT                   /translation="MKQISFFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEK
FT                   AKKLEQSSEAKPVAASLPRLAEGNFRTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPL
FT                   FTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVIKPS
FT                   AWGKPRIN"
FT   CDS_pept        complement(62081..62332)
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="E2348_P1_066"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_066"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07502"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL2"
FT                   /protein_id="CAS07502.1"
FT                   /translation="MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAY
FT                   VYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKGEGQ"
FT   CDS_pept        complement(62325..62645)
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="E2348_P1_067"
FT                   /product="predicted protein"
FT                   /note="similar to traD of F plasmid, 96% identity in 61 aa
FT                   overlap but with C-terminal extension"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_067"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07503"
FT                   /db_xref="InterPro:IPR024396"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL3"
FT                   /protein_id="CAS07503.1"
FT                   /translation="MNMRNINVITALSVPGQTVSDDFMHAVLSNCATRIVLPAPEKFGS
FT                   ESLPDNFNMTAVGVMKKGMSMSLFSSPGHIVVAGQSGGGKSVPVKELIDRIIQKYKEPF
FT                   DE"
FT   CDS_pept        complement(62632..63222)
FT                   /transl_table=11
FT                   /gene="traP"
FT                   /locus_tag="E2348_P1_068"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_068"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07504"
FT                   /db_xref="GOA:B7UTL4"
FT                   /db_xref="InterPro:IPR009913"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL4"
FT                   /protein_id="CAS07504.1"
FT                   /translation="MANNMSSRQACHAARYVVARVLRGLFWCLKYTVILPLATMALMAL
FT                   FVLWKDNTTPGKLLVKEINFVRQTAPAGQFPVSECWFSSSDSSGRSEIQDICHYRAADA
FT                   ADYVRETDRSLMQLVTALWATLALMYVSLAAITGKYPVRPGKMKCIRVVTADEHLKEVY
FT                   TEDASLPGKIRKCPVYLPHDRTNRNNGDKNEHA"
FT   CDS_pept        complement(63212..64639)
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="E2348_P1_069"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_069"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07505"
FT                   /db_xref="GOA:B7UTL5"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL5"
FT                   /protein_id="CAS07505.1"
FT                   /translation="MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETV
FT                   AEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQR
FT                   RIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPPQGS
FT                   VAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPSLPYIPSGSFAKA
FT                   MLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAIV
FT                   RTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGME
FT                   RASQPAVGLGATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEV
FT                   TVVFQDGFQLKTVEEMALERTQSRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNL
FT                   NPQQFMSGSQGGGNDGK"
FT   CDS_pept        complement(64639..65367)
FT                   /transl_table=11
FT                   /gene="traK"
FT                   /locus_tag="E2348_P1_070"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_070"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07506"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL6"
FT                   /protein_id="CAS07506.1"
FT                   /translation="MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISN
FT                   TSPNLFTVPGDRIIAVNSLDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQ
FT                   AVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVT
FT                   KETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPA
FT                   SQLLAGARMDVYVIRDGEGN"
FT   CDS_pept        complement(65354..65920)
FT                   /transl_table=11
FT                   /gene="traE"
FT                   /locus_tag="E2348_P1_071"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_071"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07507"
FT                   /db_xref="GOA:B7UTL7"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL7"
FT                   /protein_id="CAS07507.1"
FT                   /translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQ
FT                   RTAVTPMAFNAPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRPGA
FT                   QNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTDIKH
FT                   YILILKRENGVTWLDNFGETDDEKK"
FT   CDS_pept        complement(65942..66253)
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="E2348_P1_072"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_072"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07508"
FT                   /db_xref="GOA:B7UTL8"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR016382"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL8"
FT                   /protein_id="CAS07508.1"
FT                   /translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTS
FT                   KYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK"
FT   CDS_pept        complement(66268..66633)
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="E2348_P1_073"
FT                   /product="sex pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_073"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07509"
FT                   /db_xref="GOA:B7UTL9"
FT                   /db_xref="InterPro:IPR008873"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTL9"
FT                   /protein_id="CAS07509.1"
FT                   /translation="MDAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFF
FT                   PQLAMAAGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAG
FT                   FAIISVFIAVGMAVVGL"
FT   CDS_pept        complement(66667..66894)
FT                   /transl_table=11
FT                   /gene="traY"
FT                   /locus_tag="E2348_P1_074"
FT                   /product="positive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_074"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07510"
FT                   /db_xref="GOA:B7UTM0"
FT                   /db_xref="InterPro:IPR008876"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTM0"
FT                   /protein_id="CAS07510.1"
FT                   /translation="MRRRNARGGISRTVSVYLDEDTNNRLIKAKNRSGRSKTIEVQIRL
FT                   RDHLKRFPDFYNEEIFREVTEESESTFKEL"
FT   CDS_pept        complement(66989..67675)
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="E2348_P1_075"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_075"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07511"
FT                   /db_xref="GOA:B7UTM1"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016384"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTM1"
FT                   /protein_id="CAS07511.1"
FT                   /translation="MCALDRRERPLNSQSVNKYILNVQNIYRNSPVPVCVRNKNRKILY
FT                   ANGAFIELFSREDKPLSGESYIRLQVEIFLSSLELECQALGHGSAFCRRFNFHGEIYQI
FT                   RMENVSFYNDESVVLWQINPFPDYPFFALNQSVSNTNTSGQLTIWNDLSPGTLVVFSFY
FT                   MLGVGHATIARELGITDRASEDRIKPVKRKIKEFFEHFDLFRVSCIYKGEIDSLLSIIR
FT                   EFYDVK"
FT   misc_RNA        67669..67744
FT                   /gene="finP"
FT                   /locus_tag="E2348_P1_mR_2"
FT                   /product="antisense sRNA, regulates the transfer of F-like
FT                   plasmid"
FT                   /note="identified in Rfam screening as FinP"
FT   misc_RNA        complement(67670..67777)
FT                   /locus_tag="E2348_P1_mR_3"
FT                   /product="cis acting RNA element, regulates the transfer of
FT                   F-like plasmid"
FT                   /note="identified in Rfam screening as traJ 5' UTR"
FT                   /note="regulates plasmid transfer"
FT   CDS_pept        complement(67865..68248)
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="E2348_P1_076"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_076"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07512"
FT                   /db_xref="GOA:B7UTF1"
FT                   /db_xref="InterPro:IPR007925"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR042073"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF1"
FT                   /protein_id="CAS07512.1"
FT                   /translation="MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLEL
FT                   GLRVYDAQMERKESAFNQTEFNKLLLECVVKTQSTVAKILGIESLSPHVSGNPKFEYAS
FT                   MVDDIREKVSVEMDRFFPKNDDE"
FT   CDS_pept        68674..69183
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_077"
FT                   /product="putative lytic transglycosylase"
FT                   /note="similar to ygfA of F plasmid, 99% identity in 169 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_077"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07513"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF2"
FT                   /protein_id="CAS07513.1"
FT                   /translation="MKKWMLAICLMFINEICHATDCFDLAGRDYKIDPDLLRAISWKES
FT                   RYRVNAIGINPVTGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAF
FT                   KKWGVSWEAVGAYNAGFRKTERQNQRRLAYASDVYRIYTGIKSSKGIQIPATKKSLPEI
FT                   NSVQNN"
FT   CDS_pept        complement(69479..70300)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_078"
FT                   /product="predicted protein"
FT                   /note="similar to ygeB of F plasmid, 98% identity in 273 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_078"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07514"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF3"
FT                   /protein_id="CAS07514.1"
FT                   /translation="MRLASRFGRYNSIRRERPLTDDELMQFVPSVFSGDKHESRSERYT
FT                   YIPTINIINKLRDEGFQPFFACQSRVRDLGRREYSKHMLRLRREGHINGQEVPEIILLN
FT                   SHDGSSSYQMIPGIFRFVCTNGLVCGNNFGEIRVPHKGDIAGQVIEGAYEVLGIFDKVT
FT                   DNMEAMKEIHLNSDEQHLFGRAALMVRYEDENKTPVTPEQIITPRRWEDKQNDLWTTWQ
FT                   RVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWVIAEQFRKWKS"
FT   CDS_pept        complement(70419..70705)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_079"
FT                   /note="pseudogene, conserved predicted protein, truncated
FT                   by premature stop codon"
FT   CDS_pept        complement(71406..71558)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_080"
FT                   /note="pseudogene, C-ter part of conserved predicted
FT                   protein, disrupted by ISEc13"
FT                   /db_xref="PSEUDO:CAS07516.1"
FT   repeat_region   complement(71560..73109)
FT                   /locus_tag="E2348_P1_rr__13"
FT   CDS_pept        complement(71571..72944)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_081"
FT                   /product="transposase of ISEc13"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_081"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07517"
FT                   /db_xref="GOA:B7UFC5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:B7UFC5"
FT                   /protein_id="CAS07517.1"
FT                   /translation="MVLSDCYSWANEQFGHARLGDPRRTRRLVSLASSLAQHAGLSIVK
FT                   SSQSTAQVEGAYRLIRNPSVSPQAIAEAGFTATVRACEAHPLLLALEDTTTINFSHSTA
FT                   SDDLGNTTTNPKTRGLLAHSVLMYAPDSALPVGLIEQQRWSRATDTYGVKHQRKERPYE
FT                   EKESYRWQQASERMAERLGEIQKRVITVCDREADIWHYLHYKVSHGQRFVVRAAQNRRL
FT                   EEAPGKLFELPEVLATAGSHTLNVMQKGGRAARQARMFISYSEVSIKNPDNSGQALPLT
FT                   YVCCREQAEDGACWHLLTSEKVASAADARRIVSHYERRWLIEEYHKAWKSGGTCVESLR
FT                   MQTRDNLERMVVIKAFIAVRVLGLRQGGISEETQNDSCEKILTPTEWKLLWVKLEGKPL
FT                   PSQMPTLKWACLKLAKLGRWHDSKRTGRPGWVVMWDGWFRLQDMVEGYLVMKSLDQEI"
FT   CDS_pept        complement(73108..73527)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_082"
FT                   /note="pseudogene, N-ter part of conserved predicted
FT                   protein, disrupted by ISEc13"
FT   CDS_pept        complement(73574..74935)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_083"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_083"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07519"
FT                   /db_xref="InterPro:IPR021944"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF6"
FT                   /protein_id="CAS07519.1"
FT                   /translation="MTLAAITMTAPEAASPVQMYRATYSPDDNKLRLYAVSRLDPETYK
FT                   KVHDAGFRWAPKQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGYSG
FT                   KRASESAQVLDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFERAEY
FT                   WEERARSALIHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLDLNMA
FT                   KLISSHDRISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRCHERQI
FT                   QHQQRWVNHYQNRLIYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLSIIRVNKSNGAV
FT                   SSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPGEGFREMT
FT                   KAQWAALPRDCKAVRSVAEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEIPQK"
FT   CDS_pept        74939..75199
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_084"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_084"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07520"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF7"
FT                   /protein_id="CAS07520.1"
FT                   /translation="MFSFRLLPPLAGRLTSSVKSAFQFECAEHLPESRVFHGGDVYTTP
FT                   PVKTPGYVSPEGFQHGGNFRRGDVFASETGMTAGLYSRCGR"
FT   CDS_pept        75635..76057
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_085"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_085"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07521"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF8"
FT                   /protein_id="CAS07521.1"
FT                   /translation="MGCSFTLDSQCGRLWLYQPPATGTHTGVWHPAGNEQGPAATTESA
FT                   CAKRRCPLHPGGLLSGCRERRPRRDRGGATGTVAANQGFASGIEARQGGDSSAGSVHDS
FT                   PPRQGDARKSHKQERNGKKRKRKRRRTITSTVTTEK"
FT   CDS_pept        complement(76395..76814)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_086"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_086"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07522"
FT                   /db_xref="InterPro:IPR009811"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTF9"
FT                   /protein_id="CAS07522.1"
FT                   /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWSLTDD
FT                   ELETVMQRLDDAFVYGACDRVVSDIVNELMEEKRVNRLVTVPAVLLEKVMVMAGSEIYR
FT                   LHAVGSENGGDGDAFVREEREIMRVMRQALDGENG"
FT   CDS_pept        complement(76861..77286)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_087"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_087"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07523"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG0"
FT                   /protein_id="CAS07523.1"
FT                   /translation="MQYAKSVTLNVEECDRLSFLPYLFGQDFLYAEASVYALAKKMMPE
FT                   YEGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSADAAGVILTSLVINRQLWLY
FT                   HDSGDAGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
FT   CDS_pept        77856..78578
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_088"
FT                   /note="pseudogene, N-ter part of predicted transposase"
FT   repeat_region   78580..78914
FT                   /locus_tag="E2348_P1_rr__14"
FT                   /note="5' fragment"
FT   CDS_pept        78616..78915
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_089"
FT                   /note="pseudogene, N-ter part of transposase Orf1 of IS911"
FT   repeat_region   78915..80135
FT                   /locus_tag="E2348_P1_rr__15"
FT   CDS_pept        complement(78922..80073)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_090"
FT                   /product="transposase of IS30"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_090"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07526"
FT                   /db_xref="GOA:B7UTG1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG1"
FT                   /protein_id="CAS07526.1"
FT                   /translation="MRRTFTAEEKASVFELWKNGTGFSEIANILGSKPGTIFTMLRDTG
FT                   GIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATELNRSPSTISREVQRNRGRRYY
FT                   KAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQISGWLRRTKPRQKTLR
FT                   ISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIHERS
FT                   RNIDNRRSLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLS
FT                   LPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKK
FT                   ICLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIERGVALTD"
FT   repeat_region   80136..80734
FT                   /locus_tag="E2348_P1_rr__16"
FT                   /note="fragment"
FT   CDS_pept        80204..80729
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_091"
FT                   /note="pseudogene, N-ter part of transposase Orf2 of IS911"
FT   repeat_region   80735..82108
FT                   /locus_tag="E2348_P1_rr__17"
FT   CDS_pept        81016..82092
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_092"
FT                   /product="transposase of ISEc13 of IS110 family"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_092"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07528"
FT                   /db_xref="GOA:B7UHC5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B7UHC5"
FT                   /protein_id="CAS07528.1"
FT                   /translation="MAGKVTETAVVGGVDTHKDLHVAAVVDQNNKVLGTQFFSTTRQGY
FT                   RQMLAWMTSFGALKRIGVECTGTYGSGLLRYLQNAGLDVLEVTAPDRMERRKRGKSDTI
FT                   DAECAAHAAFSGIRTVTPKTRNGMIESLRVLKTCRKTAISARRVALQIIHSNIISAPDE
FT                   LREQLRNMTRMQLIRTLGSWRPDASEYRNVTNVYRISLKSLARRYLELHDEIADLDVMI
FT                   AAIVDELAPELIKRNAIGYESASQLLITAGDNPQRLRSESGFAALCGVSPVPVSSGKTN
FT                   RYRLNRGGDRAANSALHIIAIGRLRTDDKTKEYVARRVAEGHTKMEAIRCLKRYISREV
FT                   YTLLRNQNRQINSIPITA"
FT   repeat_region   82109..82425
FT                   /locus_tag="E2348_P1_rr__18"
FT                   /note="3' fragment"
FT   CDS_pept        82109..82387
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_093"
FT                   /note="pseudogene, C-ter part of transposase Orf2 of IS911"
FT   repeat_region   82438..82616
FT                   /locus_tag="E2348_P1_rr__19"
FT                   /note="3' fragment"
FT   CDS_pept        82438..82602
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_094"
FT                   /note="pseudogene, C-ter part of tansposase Orf2 of ISH1"
FT   CDS_pept        82840..83458
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_095"
FT                   /note="pseudogene, glutamate decarboxylase, truncated by
FT                   frameshift mutation"
FT   CDS_pept        83582..85042
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_096"
FT                   /product="putative glutamate:gamma-aminobutyrate
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_096"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07532"
FT                   /db_xref="GOA:B7UTG3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR022520"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG3"
FT                   /protein_id="CAS07532.1"
FT                   /translation="MSNANIAPKSKKMTVGTLAIMNITAVVSLRFIPSEAEYGLGAIFY
FT                   YTFAAIMFLVPVAFVAAELATTYPQKGGAFRWIGEAFGARWGFVGMLMTWLQVIPYFPT
FT                   VLTFGAVSVAFIDVDMGVAESIASNKWYILFFVLFVYWGAICVALRGVGIFSQVSKWCG
FT                   IIGTIIPAIILVILGFSYLWFSGKPAVIPLGWGDLFPNIANFQNIVLAASIFLAYAGME
FT                   MNAVHVNDLDNPTKKYPIAITIASIGTIAIFLLSTLGVAFIIPTDKISLTQSLLVAYDM
FT                   LFEWAGVPWLGSVMAFMLAIGVLGGVVTWIAGPNTGVLAIAKAGYLPKFFQKTNRHGMG
FT                   HHLMFVQGIIVSVLSVTFVIMPSVQAAFQILSQLTVMLYLVMYMLMFAGAIYLRHSQPD
FT                   KKRPYRAPALFFWATLGFLGSFLAFVLSFIPPEQIPTGSPTSYVLYLLVLVALFLLIPI
FT                   LIYAFRKSDWKDPNSDFEPFSWEKRTSN"
FT   CDS_pept        85076..85885
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_097"
FT                   /product="putative glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_097"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07533"
FT                   /db_xref="GOA:B7UTG4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG4"
FT                   /protein_id="CAS07533.1"
FT                   /translation="MFSAESPIGVIDSGVGGLTSVKEIINLLPGEDIIYCGDNTNAPYG
FT                   NRSADDIISLTKKMLTFLQSRNVKLVAVACNTISSTLESEEYSGYAKSFPFPILSIIEP
FT                   AVEDVIRQQYKNVGIIATEFTIKTGCHKELIKKLNPTINIFGEPSKNLAMLIEEGNLNA
FT                   PAILNDIKKHVNHLISLHPVNEIILGCTHYPIVQNLFEAVAPDIKFINPAHDQAISIKN
FT                   HLGQLNLLNSSNIGTLQINTSGSMEIYKTVLGELSITKPHTFSIRQF"
FT   repeat_region   complement(85990..86755)
FT                   /locus_tag="E2348_P1_rr__20"
FT   CDS_pept        complement(86004..86399)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_098"
FT                   /product="transposase Orf1 of IS1N"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_098"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07534"
FT                   /db_xref="GOA:B7UTG5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG5"
FT                   /protein_id="CAS07534.1"
FT                   /translation="MAFICELDEQWSYVGSKARQHWIWYAYNTKTGGVLAYTFGPRTDQ
FT                   TCRELLALLTPFNIGMLTSDDWGSYGREVPKNKHLTGKIFTQCIERNNLTLRTRIKRLG
FT                   RKTICFSRSVEIHEKVIGAFIEKHMFY"
FT   CDS_pept        complement(86426..86698)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_099"
FT                   /product="transposase Orf2 of IS1N"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_099"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07535"
FT                   /db_xref="GOA:B7UTG6"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG6"
FT                   /protein_id="CAS07535.1"
FT                   /translation="MARVNIHCPRCQSAQVYRHGQNPKGRDRLRCRDCHRVFQLTYTYQ
FT                   ARKPGMKELITEMAFNGAGVRDTARTLKIGSNTVIRTLKNSRQSE"
FT   CDS_pept        87223..88202
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="impB"
FT                   /locus_tag="E2348_P1_100"
FT                   /note="pseudogene, fragmented DNA polymerase IV"
FT   CDS_pept        complement(88216..88608)
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="E2348_P1_101"
FT                   /product="plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_101"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07537"
FT                   /db_xref="InterPro:IPR019720"
FT                   /db_xref="InterPro:IPR038307"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG7"
FT                   /protein_id="CAS07537.1"
FT                   /translation="MDDERKRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFI
FT                   SGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRAVLTELGASQSV
FT                   EKMPPSATDSVQEAMNDVRLKMKKLF"
FT   CDS_pept        complement(88613..89584)
FT                   /transl_table=11
FT                   /gene="stbA"
FT                   /locus_tag="E2348_P1_102"
FT                   /product="plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_102"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07538"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG8"
FT                   /protein_id="CAS07538.1"
FT                   /translation="MNVYCDDGSTTIKLAWNDNGKICKSLSQNSFRHGWKVDGLGIRQT
FT                   FNYELDGKKYTYDEVSNQSILTTHIEYQYTEVNLLAVHHALLNSGLAPQPVSLTVTLPI
FT                   SEFYTKECQKNELNIQRKIENLMRPIRLNKGDVFTIEHVDVMPESLPAVFSRLVVDKVG
FT                   QFEKSLVVDIGGTTLDVGVIVGQFDSVSAIHGNSGIGVSSVTKAAMSALRMASSDTSFL
FT                   VADELIKRRNDPDFVRQVINDETKTDLVLNTIEGAIASLGEQVVNELGDFHHVNRVYVV
FT                   GGGAPLIYDSIKTAWHHLGQKVVMMESPQTALVEAIAAFKEE"
FT   CDS_pept        89813..90457
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_103"
FT                   /product="ParA-like protein, putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_103"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07539"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTG9"
FT                   /protein_id="CAS07539.1"
FT                   /translation="MITVVGGNKGGSGKTTIASNLAIALANKGREVCLLNGDLQRTAAK
FT                   HHAEREAAGLLPAITLVEKFDNLTQTLQALNEKFDDVIVDVAGRNSKEFITSGVVAHQI
FT                   IAPLQCSQPDLDTLTELEQQIDAMRNLNPELKVYCLQSMATTNPVLRGNERKEFLEYLE
FT                   EFPTIQVLDSVICFRKVYRDCMSNGTGVVETNNTAAKAEIEHLMNEVFGPW"
FT   CDS_pept        90451..90726
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_104"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_104"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07540"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH0"
FT                   /protein_id="CAS07540.1"
FT                   /translation="MVKKPSQQALNRAAVTVEQAEALAQRLADKPYGAPEKPEPEKQCR
FT                   TTISLGESMLVTIEDLALRNKRNGKDPKNVSAIVRVALEQYLKTLT"
FT   CDS_pept        complement(90864..91673)
FT                   /transl_table=11
FT                   /gene="rsvB"
FT                   /locus_tag="E2348_P1_105"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_105"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07541"
FT                   /db_xref="GOA:B7UTH1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH1"
FT                   /protein_id="CAS07541.1"
FT                   /translation="MSGSVIHSQSAARVPAVYSAGQSPQLPVVIDYPAALALRQMSMVH
FT                   DELPKYLLAPEVSALLHYVPDLRRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQ
FT                   LATLKQRTEKAARTAGRTPAGQQTHRLVPLSDSWYVSQLQTMVATLKIPLERRNKRTGR
FT                   TEKARIWEVTDRTVRTWIGEAVAAAATDGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVL
FT                   QSLMGHKSISSTEVYTKVFALDVAARHRVQFSMPESDAVTMLKNRHA"
FT   CDS_pept        complement(91674..91979)
FT                   /transl_table=11
FT                   /gene="ccdB"
FT                   /locus_tag="E2348_P1_106"
FT                   /product="post-segregation sytem cytotoxic protein CcdB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_106"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07542"
FT                   /db_xref="GOA:B7UTH2"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH2"
FT                   /protein_id="CAS07542.1"
FT                   /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
FT                   VSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
FT   CDS_pept        complement(91981..92199)
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="E2348_P1_107"
FT                   /product="post-segregation system antitoxin CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_107"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07543"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH3"
FT                   /protein_id="CAS07543.1"
FT                   /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWK
FT                   VENQEGMVEVARFIEMNGSFADENRDW"
FT   CDS_pept        92913..95534
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_108"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_108"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07544"
FT                   /db_xref="GOA:B7UTH4"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH4"
FT                   /protein_id="CAS07544.1"
FT                   /translation="MYPVFENGSCWVKVDFHLHTRADKEFRYAGESDRYIRDYVNALKA
FT                   AEVSVGVITNHNKFDPGEFKVLRKAARREGMDLLPGVELSVNDGQAGVHTLVVFADEWF
FT                   INPQQTNHIESFLTATFAGVDNFENENARSTENITQTIQRLDRYERDYFIVFAHVEAQN
FT                   GLWGGLSPGRIGELFDNDLVRRRVTGFQKVMTHDLRVKIKDVLGERYPAEVQGCDAKTL
FT                   DHIGARKVASYLKLGDYSFEAVRFALQDFPHRVSGEKPALTHSHIRQIAFEGAGSLGGT
FT                   VVKLSPELNTLIGIRGSGKSSILEGIRYALDIPFGEKASDRDYKENLVSNLLKSGGKIT
FT                   VDAVCRHGRAYQIVRIFGQEPQVIFDGQVRHGVALRETVLHKPVYFGQKDLSNTGAGFE
FT                   HDLIEKLVGERLAPVREKIRQQNAVVLDRLVQLRRLKTSGEALSEWQAKEKDAQFRLRF
FT                   YAQHGMEEKLERQTTFGRDERYLSSSTSLASRALDSLQDGIRETLDGLKQEQKHESAHN
FT                   QADIDDYREGYDRFTTHLSSLNTIVDGARQILDELNVKQQAFLQKKQALTEEFAEIERG
FT                   LAEELRLAGVEKADPADFLKLKAGLEVAEQKIAELTRAESSQTLLEKSLTEALNRLSEL
FT                   WVEEYQEIEAVLAAINQADSPLKIVPSFASDKKAMLAVLKEACTGSRLRESTYQTVVDS
FT                   FSNFGELWLNRDKLPGIINSSAETFSMYLEQQIESLIVWQIPNTYIIEFRGKPLEQHSL
FT                   GQRASALMLFVLNQQDNDVVIIDQPEDDLDNQTIYDDVIKIIRAMKPRTQFIFATHNAN
FT                   IPVLGDAENVCACEYSDGKIQIVGGGVDAPLVQQHIISVMEGGREAFERRREVYGSWLS
FT                   KT"
FT   CDS_pept        95733..95963
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_109"
FT                   /product="VagC-like protein, putative plasmid maintenance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_109"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07545"
FT                   /db_xref="GOA:B7UTH5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH5"
FT                   /protein_id="CAS07545.1"
FT                   /translation="MRTVSIFKNGNNRAIHLPRDLDFERVRELEIVREGDSIILRPVQP
FT                   NWGSFAQLEKADPDFMAERENVVSDEGRFDL"
FT   CDS_pept        95960..96310
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_110"
FT                   /product="VagD-like protein, putative plasmid maintenance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_110"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07546"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH6"
FT                   /protein_id="CAS07546.1"
FT                   /translation="MNKTYMLDTCICSFIMRKQPETVLKRLEQAACLVTALWSRPLLTL
FT                   KCASVPPVRRPPRVTCNWLINSARASMPSCLGTAPRWTAPRILKWHCARPGRRSARTIR
FT                   RLPGLKLENWVN"
FT   repeat_region   96315..96550
FT                   /locus_tag="E2348_P1_rr__21"
FT                   /note="fragment (middle part only)"
FT   CDS_pept        complement(96550..97080)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_111"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_111"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07547"
FT                   /db_xref="GOA:B7UTH7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH7"
FT                   /protein_id="CAS07547.1"
FT                   /translation="MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKVLR
FT                   GYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQKRVPYKNVPSVILGRLAIDKSIHH
FT                   QGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCDSLFYP
FT                   TKSIEVLFEVNDE"
FT   CDS_pept        complement(97084..97353)
FT                   /transl_table=11
FT                   /locus_tag="E2348_P1_112"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348_P1_112"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07548"
FT                   /db_xref="GOA:B7UTH8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:B7UTH8"
FT                   /protein_id="CAS07548.1"
FT                   /translation="MSALKKQRIDLRLNEDDKHMIEEAAAMTNQSISQFMVSTASARAA
FT                   EVIDQHRRLLLNEESWNLVMDAITNPPAPNDRLKRATNRLRELE"
XX
SQ   Sequence 97978 BP; 25455 A; 24035 C; 23007 G; 25481 T; 0 other;
     tgatcacata agctgtagca agtaaatcat aaactgtaac tggtatacaa taagctgtgt        60
     tatgcagagg atatactgta atgagcgagt gatataaact acagtgagta tgccccctga       120
     aagttcatca gggttgtgta taaactgaag ccagttgtct ggcgctttac aggccatcta       180
     atgaaaagag tggctgcttt tattcttaaa ctatccaccg atcggaggct atctggacaa       240
     ggacaatctg gacataaaaa agctgtttga agaggtggat aaatcctccg gtgaagtcgt       300
     aaatcttaca cctaatgcca gtaatacagt gcagcctgtg gcactgatgc ggcttggggt       360
     gtttgttccc acgcttaaat cactgaagaa cagcaaaaaa aacacgcttt cccggactga       420
     tgcgacggaa gaactgacgc gcctgtctct cgccagagcc gaaggttttg ataaggtgga       480
     gatcaccggc ccgcgtctgg atatggataa tgacttcaag acctgggtag gggtgattca       540
     ttcctttgcc cgccataagg ttatcggcga taaagttgag ctgccgtttg tcgagttcgc       600
     caaactctgc gggatcccct ccagtcagtc atcacgtaag cttcgtgaac gtataagccc       660
     ctcactcaaa cgtatcgcgg gtaccgtgat ctcattttcc cgcacaacgg aaaagcacac       720
     caaagagtac atcacacatc tggtgcagtc ggcttactat gatacggaaa aggatatcgt       780
     ccagctgcag gccgatccac gcctgtttga gctctaccag tttgaccgga aagtgctgct       840
     gcaactcaag gccatcaatg ccctgaagcg ccgggagtct gcgcaggccc tgtatacctt       900
     tatagagagt ctgccacggg atccggcgcc gatatctctg gcgcgtctgc gggcccgtct       960
     taacctgaaa tcccctgtgt tctcacagaa ccagacggtg aggcgtgcca tggagcagct      1020
     acgggagatt ggctacctgg attacactga gatccagcgg ggacgcacca aactcttctg      1080
     cattcattac cgccggccca agttaaagcc acctcatgat gagagtgcgg agaacccgca      1140
     gctgccagcc acaacgggtg atgtcagccc ggaaatggct gaaaaactga agctcctcga      1200
     gaaactgggc atcacccttg atgacctgga aaaactcttc aaatcccgct gaacataagc      1260
     tgtagtgagt aatctgtccc ggtttactta ctacagctta tattactgcc tctggtgagt      1320
     gttctgctca ctacagctta tataagcagt gatgagcgca gcccataccg gaaacacttc      1380
     cttcctgatc cacaagccct tcagaatggt attcctgtta ctgccggagc cctgcggacc      1440
     tgtcgtgtcc ctcataaatc gtaatctgct cactacagct tatgttgcct gctacagttt      1500
     atttcactca ctacagctta tctcaggtag ggtttactca ccacagctta tataaactgt      1560
     aatgagtgac gttgtcacgt cagagggggg agtgtccgca ggatctgcgc ggcatcatgc      1620
     ccgtcaccgg tgaacggcac agccagtgtg gcggccatgt ccagcgcgaa cacccgcgta      1680
     tacacctcca tcgagcgcgg atccttgtga ccggccagcg cctgaataac cttccggggc      1740
     tggcggtgat agagcatgtg catgatatag ctgtgccgga aggtatgtgg tgtgaccgga      1800
     atcgaaaaat gcacgccatc agcttcagcc cgcttcaccg cttgtttcag ccagttgcgc      1860
     attgtctcat ccgtgaccgg ccataacggc tcccgccggc gggggcgggt ggtcaccatc      1920
     cagctctcca tctgacgcac aaaagggcgc agaccatcca ggtcgaagga ttccggggtg      1980
     agtgtccggg cttcaccgat acggatcccg gtattccaca tggtggcgaa caacatgtgg      2040
     tgacgctggt ccggcatata tcagaggagg gcgctcactt ccggtgctag gaggtaagcc      2100
     ggcgtggcac ctgttgaggt ggccatccgc cggagtgcca ccgcggtcgc aaaatcaacg      2160
     cccggggcga tcggcaataa cgaaacgcgt tctggtgaat tctgcagggg aataatgttg      2220
     ttcatcggct atttttcacg tagcgcacgc actggtcatg gatacagtta ttctggcctg      2280
     aaaggcccga acctgccatc acaataaatc gcagcgcgcg gatccttttg ttgtcttatc      2340
     ccgcattatt gcgggaaaaa ccaaatgcgt aaaggatcct ttttctgctc aaatcctcca      2400
     tgaagccagt catgacgcgg gctgagggct ggtttacggt ttttgggaga aatggggtaa      2460
     tgccaggagt accggaagtc aaattcatgg ggatattgac tgtttatgta ctgggggggg      2520
     acggaaatat ataaaaaaaa aagaaaaaaa gattattttt tttcttggtg cttgcgtgtc      2580
     ttttttagtt ttaagattat tccgtgacct attaatacgg gggttttata aggaaaacag      2640
     tttttatggt ttctaaaatc atgaataaga aatacgaaaa aggtctgtct ttgattgaat      2700
     ctgcaatggt gcttgcgctt gctgccaccg ttaccgcagg tgtgatgttt tactaccagt      2760
     ctgcgtctga ttccaataag tcgcagaatg ctatttcaga agtaatgagc gcaacgtctg      2820
     caattaatgg tctgtatatt gggcagacca gttatagtgg attggactca acgattttac      2880
     ttaacacatc tgcaattccg gataattaca aagatacaac aaacaaaaaa ataaccaacc      2940
     catttggggg ggaattaaat gtaggtccag caaacaataa caccgcattt ggttactatc      3000
     tgacgcttac caggttggat aaagcggcat gtgttagtct tgcaaccttg aacttaggta      3060
     cttcagcgaa aggctacggt gttaatatct ctggcgaaaa taacattaca tcatttggta      3120
     atagcgctga tcaggctgct aaatcgactg ctattactcc tgctgaagcg gcaactgcat      3180
     gtaaaaatac tgattcaacc aataaagtta catattttat gaagtaatct acataatacg      3240
     ccctgttttg ggcgtattat atgggaggta tatgtgagga cagtaatcct ttttttttgt      3300
     cttttggtat cctgttttac tcaggcacag gaaagtgcaa ataaaaacga gaaacttttt      3360
     tcaggggaca caacgtctgt tgcactgcag gcaagtgaaa gaacaattaa aaatgccaaa      3420
     gctgactggt ctgtaataaa aggacagact ttatatggcg ttctttccga ctgggcgcaa      3480
     cagagcggat ggactgtatt atggcatgca aattataact atactttaaa tgcatctgca      3540
     gtgtttaagg atatgtcgct ggatgatgca gtaaagaaac tactagaatc gatgggaaat      3600
     gtgtcaccca gggtctttat taaattttat aacgggaatc atgtcattct cgttacacaa      3660
     tcacccgaag gataatttaa aatgaaactt ggcaggtatt cacttttctt attgtgtccg      3720
     ctcctggcat cttgctcggg taatggattt tataaagata atcttggcgt aatcgataaa      3780
     aatattctgc atgctgacac ctcattgctg aagtcgaaga ataaagaaca ttataaaagc      3840
     agtgatatgg taagcaaaac agacagtatt tatataggaa atagcagttt tcagacatat      3900
     catggagagc ccctgcccgg taaattagaa ggtgtacatg gaattattct gagatcaagt      3960
     acacctctgg gatttgatga agtactctct atgattcagg attccagtgg tattcccatt      4020
     gtaaaacata ccacgaaaga tgtgatcagt ggaggggtgt ccagcaaaag tctggccgca      4080
     actgtcgcgg aaaaaatgaa cagtgcaaca ggcggaaaaa gtactgatca atttgatcat      4140
     ctactgcttg aggtatcatc agaacatcag cttatggatg ttaattatca gggcgcgctt      4200
     tccacgtttc ttgataaagt tgcggcaaac tacaacctgt actggacata tgagtctggc      4260
     aggattgctt tttcaaacga ggaaactaaa cgcttcagta taagtatatt accgggtggt      4320
     aaatatacat caaaaaactc tatcagttcg gacagcaata gcagttcggg aagttcggga      4380
     agttcgggca gtagttccag tgattctgga gcagagttga aattcgattc agatgtggat      4440
     ttctggaaag atattgagaa ctcgataaaa ctgatactgg gcagcgatgg ttcgtattca      4500
     atatcgacaa gtacatcgtc tgttattgtc agaacatctt ctgcaaacat gaagaagata      4560
     aacgaatata ttaatacact gaatgcacag cttgaaagac aggttaccat tgatgtcgcg      4620
     atctataatg ttacaacaac tgacagcagt gatctggcaa tgtctctgga agctttgcta      4680
     aagcataacg gaggtgttct gggctctgtt tcaacctcaa attttgcggc aacaagcggc      4740
     accccttcat ttacaggata tctgaatggg aacggcgact caagcaacca ggttttgctt      4800
     aacttgttag ccgaaaaagg aaaagttagt gtggtgacat ctgcatctgt aactacgatg      4860
     tcaggtcagc cggttccttt gaaagtagga aatgacagaa catatgtatc tgagataggg      4920
     actgtattaa gccagtcatc aaccagtaca acagccagta cgtcaactgt taccagcggt      4980
     tttctgatga acctgttacc gcaggttgct gatgacggga atatattgtt gcagtatggt      5040
     gtaacgcttt cagaacttgt tggctcaaat aatggtttcg atcaggcaac tgttaatgga      5100
     accgtaattc aattacctaa tgttgattcc acaacctttg tgcaatcaag catgcttcgc      5160
     aatggtaata ctctggttct ggcaggatat gagaagaaga gaaacgaaag tgtggatcag      5220
     ggtgttggga caaccagttt taaactcttg ggtggcgcac tgaatggaag tgcttcccga      5280
     acagtcactg tcatttgtat aaccccgaga attattgatc tcaaggcttc tggcgaatga      5340
     taaagaataa tcttggcgta gcggtaattg gttcgaaaca atatgccgtg aatttattat      5400
     ggggaagttc tcaggataca gaaacaacaa atcaggctct gaataagagc ctgacgttga      5460
     tgtcctcaaa gctatattcc gttattggac gatttcaggg tgaacagttt gccgtaggag      5520
     ataaaaatat tggccacaaa agaggccagg tgaccttact gtctgcaatt gatttcgatg      5580
     gcagttcttt ttgtgggctg tttcctgctg ataatgaatt atggcttgtc atcggtgttg      5640
     ataaagatgg aatggttcac tttgacaagt cctttcacag taaggatgat gcaaaaaaat      5700
     tctttttcga ccatgtggca tatggatacc cgtgggacag aacatacagt ccttcagatg      5760
     ttggagtcgg tgaaagcagg agtatttctg agctttcact aatcaaaggg aagaaattaa      5820
     aggaaaaagg tgccggtcaa ctaatgccat tgctgttatc tggcgttgga attataatat      5880
     tctttgtcat catatataat tttatgaact tatggttaag tggcagagat aaggatattc      5940
     ttaacgaaga accatctccg gccgtcagtg aggaagtcag aaatatcccg tgggaaggga      6000
     aaagcaaacc gggctcattg ttttctaaat gtataaaaga aatggattca ttccggttcc      6060
     aagcagcatc cgttccaggc tggatgcctg aaaataaagt aacctgtaat gactctgata      6120
     taaactttag tgtttatcgt tctggcggac ttaatatatg gtatgaaaat ccgggcctgt      6180
     tttttcacag tggagacatc ccagacatta ccagaaatga taatgataaa ataacattta      6240
     catggcctct tgaaacggtc aggtatgaca gttcgatact cgacgtgcat accttgaata      6300
     agactcaaga aataataagg tatctttcac gtcagtttga gaatagctgg atagagataa      6360
     aatttgaacc gtccgtgccg gacggcaata cagaacgagt gggtttttct ttttcattta      6420
     accatgatcc gagaatctta ctcccaattc tttctgaagt aaatggactg attatcacta      6480
     atatcgatta tgatttttca ggaagtaact ggaacgtgaa aggtgttttt tgggggagag      6540
     cttagtttga aaaaaatatt gtttactttt ttgtttgtcg tttcttcagt cgtgaatgct      6600
     gaggtcaata caagtgttga tgtttccggt aagaatgact ctagaaaaga agaaaataaa      6660
     ttgcctgatg ttgatttaga aaagtataaa gatgaattgc tttcctatca ggaacttcag      6720
     cgtaagaata tgatgcttaa attacagtct gaaaatcaga aactggagag tgaaataaaa      6780
     aaaagtggat catttatctc atatgataca aatgaaaaca cgatatactt aatgtctata      6840
     atgacaactc ctaaaaaagg attatgtgca accatattta atggggctat aagcagagtc      6900
     tgtaagggcg atatcattaa cgaacattct gtggtgagtg acattaccgg taattatgtg      6960
     gagatcagga gtattaataa catatccgat cccgtgcaga aaatttttct gagataggta      7020
     agtttgatgc taaacaaaac agaaaaaact tcagatctga tgtttgaacg atttaagcgc      7080
     aatgtatctg aaatcgtcac gggagatggg ggggagcttg agcttactgt tgaacagaga      7140
     aaatactttc tgatattcaa aaatggtgat tttcttgttt cttcatgtca tatgaagcat      7200
     catctggtac agatgttacg tgaaatcgca acaagaaaag ggtatccaaa cctcactatt      7260
     tatgaggtga acttaaaaga tatcaggtta ttgtatgaag catctctcaa aaccgtacag      7320
     aataatggac aggatctatt accagtcgaa aaaagagctt caatgctact tttcgaatgc      7380
     gccgagatga gagtaagtga tttacacatc aaagtgtatg atgctgaggc tgatatttat      7440
     atacgtaaag atggggatat ggaactcttg cgtcagattg agtctaatac ggcgcattct      7500
     atccttgcat cattatataa taatgcagat gattctgatg caacctataa aattaatgct      7560
     tatcaggctg ctcgtatagt tgcttcaaaa tcgaggctgg cgttacctcc cgtaattcag      7620
     gcggtgcgcc ttcagtttaa ccctcttggt caaggtgggc gatatttaat cgcacgattc      7680
     ctgtatacag acaaaagtga aaaacaaaaa gaaatggatc caaccagatt cggattccat      7740
     cattcacatg ctgaatcatt ttcaagaatg cggaatctcc caattggtat aaatattatc      7800
     tccggaccga cgggttcggg taaatcaaca accctgaaaa atttacttga gttattgtat      7860
     atcgaaaaaa agaaaaaagt taatattatc agcattgaag atccacctga gtatgaaatt      7920
     gacggcacgg ctcagttacc tataacgaac gttgaaacag aggcacaaag gggtgaagaa      7980
     tatcgtaaag ccattacagc cgctttgcgt tctgatccgg atataataat gccaggggaa      8040
     gccagggatg ctgaagtgat aaaccttctt ttcactgcag caatgacagg acatcaggta      8100
     tggacatcat tacatgcaaa taatgcactg gctatattcg atcgattgaa agatcagggc      8160
     gtggatgaat ttaaacttac agatccggaa ttgatcactg gattggttgc ccagcgatta      8220
     gtcagaaaat tgtgcgctca atgtagcata acattaacag aatatatagc aagtggcggg      8280
     gggatatctg atacggacag aaaaataatc tcaggtcatg aaacatctgt acgatttccc      8340
     aatcctcgtg ctaaaaaatg ttgtcgggat gggtataatg gaaggacaat cctcgcggag      8400
     gttattgaac cggactcaaa attactaagg ttggttgctg aaggtaagcg agaggatgct      8460
     cagcattact ggttaacatc tcttcatggt atggccttaa aagagcatgc atggttaaaa      8520
     ataatttctg gtgaaatatg cgttatggat gcagtaaata aaatttcagg catcgataat      8580
     attacagaag aaaggaaaaa atatcttttc agcagagata acgagatata gttttctatg      8640
     aaagagaaat taaacagact gctattcacg tcgaaaacga gaatgcgtgt ttttagcaaa      8700
     ttatccaggt atctaagtaa tggtgttcca gtaacgtttg ccctagctga gctttataag      8760
     tttacgtctg atgagggaag aaaaaaagat aatccggatg catttgccct gcaaagatgg      8820
     ttaattgctg taagaaacgg gaaaacattg gctgaagcga tgagggggtg ggtacctttt      8880
     gacgaactgt caataatttc cgccggggaa atctcaggta atgttcacca ggcgttggat      8940
     gatatcattt atatgaatga tacaaaaaag aaagtaaaag gcgcactggc agggattatt      9000
     tatcctgtag tcctgcttct gacgacatgt ctgtatttgc atatatttgg aactcaggtt      9060
     gttccggcat tttcaggcat cctgcctgta gagaaatggc agggcgcagg caggactatg      9120
     tattatcttg ctgtattcgt tcaggattat cttgtcatta cactgctgtc ttttatgatg      9180
     gtgatattat taatactggc aactctgtca agatggaccg gaaggttgcg tctcttcttt      9240
     gacagattta ttccctggtc gatatacaaa accattatag gatgtggttt cttgttatca      9300
     ctggcatcgc ttattaatgc aggtatccct gtaccggaag ccttacgaat aataatgaaa      9360
     acggcaagtc cgtggtataa ggaaagatta gttgctataa gatacagatt attaaatgga      9420
     gagagaaatc ttggggaggc ccttaattca tctggttaca ttttcccatc caaacagatg      9480
     ataatggatc tccgttctta tgctgcactt ggaggctttg atgaaatgct taataaactt      9540
     tcagttcaat ggcaggatga cagtgttgct tatataacga aacaaatgac tgttctgaaa      9600
     aatgttgcta tcattattat ggggcttgta tttatgtgga tagtatcagg aatgttttca      9660
     ttacaacaac aaattagtga tgcagcaaga ttctgatttt tttcttcggt gtgatatcat      9720
     gaatattatt aatgagctca actttgcaga tttactgatc tcaaaggatt catataattt      9780
     ccgttttcta gaagggcaac catatccaat atgtaatgtg ccggataatt ataatgcaga      9840
     agtgcaggag atggtgcaag aacttgagtg tatccgggaa gcaaagggaa atgaattttt      9900
     ttatcttcat cttggggtac cttatcgagt tgcggttgtg caaacaatca ctggttcagg      9960
     ttttttctta cgtaaactga aactgccggt accatcactc gatagcctcg ggttttccga     10020
     accattcctg aatacattaa aattgatggg gaagaaaaga ggtttgcttt tagttagtgg     10080
     agctacaggc tctggcaagt ccacaacaat ctatgctttg ctgacatatt atgttcagaa     10140
     atacggtgat attgctattt caattgaaga tccaccggaa gttcctgttc agggaaatta     10200
     tggtgataat caggaaggcg tctggtttca gatggatgca cgtgagcttg ggggatatga     10260
     aaatgcaatg atttcagcga tgcgttataa tccaagatat attttcctgg gtgagattcg     10320
     tagcgctaaa acagcgaaag aggccattcg ggctgcagtc aatgggcatc ttgtagtttc     10380
     aacaatacac ggaagctctg ttcagggggc tatttatgcc ttacagcaga tagcttctgc     10440
     tgagggagaa gcagatcttg ttcgcagcat cattgctgac gggctgttag gtatagttca     10500
     tcaggagtta cgttttacag aaaacggaca gcggtcactc agtgcaaaca ttttatgcaa     10560
     cgatggctct gcatctattt cttcaaaaat aagaagcggt aaactggagc ttttgagtag     10620
     tgaaattgag caacaacgaa ttatgttgag ccatggaaaa aacctgatta gctaaaatat     10680
     tatgcaagaa agtatatttc tattattggt ttttatatat gcggccacaa ttaccagttt     10740
     tatatggctc gctgtggaac gtcttcccca tcagttaaaa tgggtagaca atcctgtttc     10800
     tgatataaca atatggtctc cgggaagtaa atgtaataat tgtggtaaaa aaattcgttg     10860
     gtattatctt attcctgttt tggggtattt tttgtgtcgg ggggaatgtg gctattgtca     10920
     tgctaaagtt cccgtccggt atccacttac agagtttatc tgtggtgttt gcagtgttat     10980
     tatatttgta tttttgggag acagactgta tgatgcagta atagtttcgc tactttttct     11040
     ttgccttgtt tttcttgctc tgattgattt aagagagaac tggctaccag cttgtgttac     11100
     gtaccctcta ttttgggcag gtatgattac tccagggttt gcatccagcg atgataagat     11160
     tttcggtgca tttaccggtt ttttaataat gtatatttca atgaaactag ttagcgcctt     11220
     aagaaaggag gatgtttttg caggcggaga cattgctctg gctacagcgg ccggtgcatg     11280
     gttaggaata gataaaatgc ctttttttct tattttgtct tcatttatat ttattcttta     11340
     ctctcttcca gcaaggttaa gaggtcaggt ttttgttcct atgggaccag ctctttccgc     11400
     gtcatttttt atatgtttag tttatcatta attacaggtg ttgcagcatg tgttctcaat     11460
     gccagttctg tgaataatat tgagcctgca ctattactgt cagttatgac cgtcgaaggt     11520
     ggtaaacctg gtagtatatc cattaataag aatggaagcc atgatttagg tattatgcag     11580
     ataaataccc atgcatggtt aaaacttatc agtaagagtt tttttaacgg agatgagagg     11640
     tctgcttatg ccaaacttaa ggatgatgca tgttttaaca tatcagtagg ggcctggatc     11700
     ctccgcagat ctattatatt cgagggtggt aatttatggg aaggtgtggg ccgatatcat     11760
     tcggccacac cagagtataa atatagatat atagataaag taaagaatgt ctatggtcaa     11820
     ataacataca gccaatcaat acatcaaagg aatatgtaag taaaaattat ggttcgtcta     11880
     tgtttatatt gagaaataaa agaaaagagt caggtttgtc actgattgaa gcgtcattag     11940
     tgattatttt atctggcctg gttattgtgc ttgttcagtc agcaatttca aaaattatta     12000
     agtatgctgt tcatgaaaat gcactgcatg atgtttcgta tgtaatgtct tacattcagg     12060
     atacattaca gacatcatgc tatggaaaag aaaatattgt ttgtgatgga gtgataagtt     12120
     cagtaaaatc aaacgttaac tctggtaata aaataaaggt tgatgttaaa aaagacggaa     12180
     aatatgtatc tgtgtatatt ttatacaccc tgtcagggaa cgaatatttt ggcagaaatg     12240
     aagatttcgg tagcatgtta tttacgcatg taagcgctta ttctgggaga atggatagca     12300
     gtacaggagt tgtaagttcg gttctgggat ggtggaaagt aaattctgat gacacaattt     12360
     ttttaggtgg ggataataat aaaaatcttt tcttttacaa taatttccgg gtggatgttt     12420
     tatgataaga aaagaaagcg gcctttcatt aattgaagta atgattggcg tccttttttt     12480
     ttcgattgtt tctctttctg tatataacta ttacaacagg agcgcagaac aacattatat     12540
     gaataatgtc tctgtcgtta tgtgcagata tgctgatgct cttagctact atttacagga     12600
     tagcacagca accaatggta acggtagtgt atcattatct actctggttg cttctggata     12660
     tttgccacca atgcaagaaa cgtctggtgt tggagaatat gaaataaaaa tgtatgtcga     12720
     taagaataag aatggtctga tagcattata tggtggagag tattattcac ttacctctga     12780
     gaacataaaa aaatttctgg ggattcgtgg tgcatctgct aaagataata aaatcatatc     12840
     tgcaggtggg tattattcat tgcctgtatc tgactttaca ggttttcgca ctgttaattt     12900
     aagaggatta atgctcattc cttccattca gacatcaggg caaaattgtg acagaggtgg     12960
     atatgatttt tgaaggacgt cagcaaaagg gactgtcgct tattgaaata gcgatggtaa     13020
     ttattttgtc tgtggtattt atttctggcg ggagttatat tatatctctt ttcaaggttt     13080
     ttgctcaatc ttgtgttgta gcaacagata tgaattctgt cagaaatata atcatcagtt     13140
     cggatgttga atataaaact ggaaaatatg atgtatcatc cataacaaat gacaatcgat     13200
     ttaataaata tcaggtgtat tttggaaatg atggttatac tttaatatca ggaagttctc     13260
     ctgttagtgt ggatgtgttt tttattacct gctatttggc aaaatataac tgtgtatgga     13320
     ttctcaatac caacaataaa atatacgcga aacatatgtc tgctgttctc ccgttagagt     13380
     tattaagtgc atatggcctt aattattcag gagagagtgg tgtcacaggg cttctgttta     13440
     aacggtacta gttatgttat tcttctggtg tggttttttt tcattaattg tatccatttt     13500
     aaatatttcc atgggttata atgatcgcct attcctcgat gaacaaaacc gaattattaa     13560
     agaaaatata tatgtggatt atcttactgt taatgctgct gtcttgtctg aaatttgcac     13620
     aacagatgca ggcaagtgca aggataaaac gagtattctg tcggacgagc tttcagaatc     13680
     gctgaaagat aaattgtctg gatatgataa tagcattaca cctgaatttt gtattaacca     13740
     tgggaaggtt atagtctata caacttatca ttttaatatt agccgttata aagacagctc     13800
     attgttcaac ctttcagacg tgccgaatag cgacagatta gcttgttcaa taaatgataa     13860
     ttctggtatt gctattatca aaacattcaa caaaacggga tagcaccacc agaactgtaa     13920
     gttttttagg ctatgtccca taattgtttc atcaattaaa aatcacgccg ccatgacagc     13980
     aaatagtggt ggaaacccat gaaatcactt caaacaaatg aacaggtctc atgggtttta     14040
     ttaacataaa agccacaact tcccgccttc attgcgctcc cgacgacaat attaatagct     14100
     agaaaatgtt tagaacaatg gttcaatttc ctaaccatca agtgattaag tgtgtgattc     14160
     atagacatcg tttcactata atacctcact atgaacaggg aaattcagca gcggctacag     14220
     tgggtaaaac tctatgaaac gtccggtgat gcgggatttg tatgccgtcg ctgtggcatt     14280
     tctcggccca cattgcgtaa atggtggcgc agatatctgg ctcagggcat cgctggtctg     14340
     gaaagccaca gttgtcgccc caggcgttca ccatcaacga aaaccggcac ttgcgaagtc     14400
     gctctgattc tggagttacg ttctcagcga aatctgggtg caagacgtat tcaaagcgag     14460
     ttaaaacgac tcactggcaa tagcaacaat ccacaaagtc ctttgccaga atcaggttaa     14520
     acctgttgtt aaatttcggc gtgaagctga tttcattcgc tacgaacgcc ctgttcccgg     14580
     tgatcgggtt cagatggata cctgttaaat tggccccggc ttatatcagt acacatctgt     14640
     tgatgattgc actcgctaca gagtcctgag gctctactct cgtcgcacgg cggcaaactc     14700
     actggatttt attgattgtg ttattgaaga aatgcctttc ccgatacagc gctctcagac     14760
     agaccgggga agagaatttt ttgccgttaa agtgcaggaa agattaaaat aatacggcat     14820
     caagtttcgt ccaaataagc cagcgtcacc tcatcttaac ggaaaggttg aacgttccca     14880
     aaagacagac aaagcagagt cttacgctac cgtagatctt tctgctgatg acctgaagga     14940
     actgcaggca gaatggcagc attactataa ctgggaacgt cctcatagcg ctcacaacgg     15000
     taaaactccg atggaacgct actttgaact tgctgagaaa acaccatact ccgatgccgt     15060
     tcatgcaaag tatcagccca atgaagagca tatacaggaa cagaattaca agcttgaact     15120
     tgaactgaga aaattgaaac gatgtctatg aatcacacat attatgacat aatcacttgc     15180
     actgtcgcta ttattctggc gatttcaata aaggaacttg ctcgcgatct gtcattttct     15240
     gaaaatcttc atgctgcatt tcgattttcc ttctaagatc ataactcgca tacctgttct     15300
     ttttatgtat atccatatct atttttgtga cgagttcaaa ccacaatgtt ctcattcccc     15360
     atgccgcgtc atgaaacatt tccacaacgg cgttagttcg cagattgggc aaaagagatg     15420
     ctggaactgt tcgtccagga atgggggcga taactgatgt gatcctaccc acgtaatatg     15480
     gacacaggcc taagcgaggt tctggttttc aaattgttcc ggactgaggc cgccacacca     15540
     actgtgccgc cgccaccgat tgtaatcaca ttcgatataa ttaaacaccg ttgcccgcat     15600
     tatttcccgg ctgataaagt gttctccatg gatacattcc actttcagcg aatgaaagaa     15660
     gctttccacg caggcattat cgtagcagca accttttgcg ctcatacttc cacgcagatt     15720
     atgccgcttc agttgcgcct gataatctgc tgaacagtac tggcctccac ggtccgtgtg     15780
     aacgataacg ttccggggcc tcttacgccg ccacagcgcc atctgcaggg catcgcaggc     15840
     cagttgcgcc gtcatgcgtg gcgacattga ccagccaata acggcacgtg accacaggtc     15900
     aatgaccact gccagataca gccagccttc atctgtacgt aagtacgtga tgtctcctgc     15960
     ccacttctgg ttcgggccac tggcgtaaaa atcctgctcc aacagatttt ctgacacagg     16020
     caggccgtgt gcgcggtagc tgaccgggct gaacttccgg gaggcctttg ccctcagtcc     16080
     ctgacggcgc aggcttgccg ccacggtttt tacgttaaag gggtaaccct gagcacgcag     16140
     ttcatccgtc aggcgtgggg caccgtaacg ctgttttgac cgggtaaaag ccgcgaggac     16200
     aacgctgtcg cagtgttggc ggaactgctg acgcgtgctt atccttgtcc gccgctgaca     16260
     ccacgtatac cagccgctgc gggccacccg gagcacgcgg cacattgctt tgatgctgaa     16320
     ctcagcctga tgtttttcaa taaagacata cttcatttca ggcgcttcgc gaagtatgtc     16380
     gcggcctttt ggaggatagc cagctcttca tcccgttctg ccagctggcg tttgagacgt     16440
     gcaatctcgg tagacatctc cagttcacgt tcagaagacg tctgctgatt ttgctgttta     16500
     ctgcgccagt tgtagagctg tgattcatac aggctgagtt cacgggctgc ggcagtaaca     16560
     ccgatgcgtt cagcaagctt cagggcttca ctgcgaaatt caggcgaatg ctgtttacgg     16620
     ggttttttac tggttgatac tgtttttgtc atgtgagtca cctctgactg agaggttact     16680
     cacttagccg cgtgtccact attgctgggt aagatcaatc gtccgcatcc ccattttact     16740
     gtcttatatt attggcgctg gcaacgcaac gtatcgaacg taacaacctg accctccaca     16800
     cccacattaa gcggctggca cgtaaaacaa tctgcttctc gcgttccttg gaaatccacg     16860
     aaaaagtcat cggttccttc attgaaaagt acatgttcta ctgattggaa gcactaccct     16920
     gtagggttag tatgaatggt catattctgc cacactccga tttgcagccg ccaggctgcc     16980
     gtggatcctt agggcggtgc catattacga gataagatca agcaatgagt taagttataa     17040
     ctggggcctg aatatatagg ggggccacac cttgaaaaat atcagtaaat ttttaaaaaa     17100
     aaagcataaa agtattgatt tttacagagt ggcaataaaa aatcaatagg aaacaaacgc     17160
     gcatgaaggt ggttaatgct tacatctaaa aaagaaatgc agagttctga aaataaacaa     17220
     gaggagaatt tagcgttatt gttaactaat tacatttcat atcagaatat agttatattt     17280
     acggggggga atcagtttaa gataagaaac aagaaagaat tcaccgaata cacaatagaa     17340
     tccaactcct tgtttttttt agcaaaaaac actcattggg acatggaaat tgtcggaatc     17400
     gataatagta atccgtacag aaaaattata attgatgatg cattaattaa gttgctgcat     17460
     tcaatatcat ctgatgactc ttgttatgta aaaaaaaaaa tatttactgc gaacctcaat     17520
     gaaatgcaat tgaatatagt ttccaatata attacagaca taaaatactc aggcaacaac     17580
     aaaaaaatat ttaaaatatt gtatttatta tcttttttta atgattataa tgatatagtt     17640
     aatgtcatcc ttagtgcttc atctaagagc atcgtagaca gggttataaa agtaattgag     17700
     ttggatatat ccaaaaactg gaaactaggc gatgtcagta gttcaatgtt tatgagtgat     17760
     tcttgtctga gaaaacaatt aaacaaagag aacttaacct ttaaaaaaat catgttagat     17820
     ataaaaatga aacatgcttc tttattttta agaactactg ataaaaacat agatgaaata     17880
     tcttgtttgg ttgggtttaa ttccacatca tattttatta aggtatttaa ggaatattac     17940
     aacacaacac caaaaaaata taatggcgtt tattctatta cacaaggaac attgccataa     18000
     gtttttgtta gagatattta aaatcttatt tgcaatgagc actcgaaatg aagaacaatt     18060
     tgagagaaga gaaagaagta gtttttgatg gatgtatgaa tgtattgtca ttaccttcag     18120
     gatggaaagc aattacacct aaaaaaaaca atgccacatc ggagataata gtgcttttca     18180
     ttccacccaa ggcttcttat cacattatat taaaatataa taaaacaaaa cattgcgaat     18240
     tgtttttttc agaccacatc accggcgaac aagatattat atattcacaa aatgcttttt     18300
     tctcacatgt gattaatcat acaatagctt tagttgatgt tcttaataag aaaagttacg     18360
     caagcaatgt tataaaattt ttgataacga tggaaggagg cggtgatatt ctttctgaat     18420
     caaaaagagc accataggtt atcaagtaaa aaaatgatac atacactact ataaacaaag     18480
     gtaattatgg aaataagaga taaaaaggcg aagtacttgg aagaaaaagg gttttataga     18540
     cgagctgcag atcgctgggc agagataatg gtgcttttat ctagtgacgc tgagagaaaa     18600
     ttggcagctc aaaagcgtgc attctgcatt aataaatctc tacgtaataa tctgcaagca     18660
     gataactata gcgacataaa acaaggagtt tataaagcat ataagaaaat ggggcttgta     18720
     aatgaaaaaa tttttagaaa ctacaaggaa aattaaatta taacgtagat tgagtctaaa     18780
     taacagttcg gaatagtaga tctctcaggg gactcagtcc ggtttatgct agctggtcaa     18840
     tcgtcgcata tcaccaaccg gactgagcaa tgcagataat agcaccaatt cccagaacag     18900
     aacgacgcct gaagcagaaa acgttccata aaacaaagga caaaaagagc ctgtttaaga     18960
     ttctgtgtaa atgccttttc tcagaagtga ccgtccaggc ggtcaccaaa ctcgataata     19020
     aagcggctca ttgccattcg ccagtccttc aacggcatcg tccatttctg ggacgcagac     19080
     tggattgcca gccacacagg cgatgaggat atcgttcaga ccgcggtttt tcagttcagt     19140
     cagcacattg agccagaact tcgccccttc attttcggcc agccacatac cccgcagttc     19200
     tttctgacct tcgatattgc tgcccagtgc caggaacacc gatttgttga tgacgcgact     19260
     gtcctgccga actttcagga cgatacagtc aagataaaca atggggtaaa cagcatccag     19320
     tggtcggttt tgtcattcta caacctgctc catcacggca tcggtaacct ttgatatcag     19380
     tgccggtgaa acatctgcgt catacagttc tttgaacgca gcagctatct cacgggtggc     19440
     catccctttg gcatacaacg agaggatctg gttacccatc ccggtaatac gggtctgatt     19500
     tttctttacc agttgtggtt cgaaggtacc gtcacgatcg cgcggagtac gcagttccag     19560
     tggaccgtcg cctgtgataa cggtctttgt gggataaccg ttacgggtgt tagctcctag     19620
     tctggactga tttttctcat acccaagatg gtgtgtcatc tcagcattga gagcggcttc     19680
     aacgctgagc tttttcagca gccgatcaaa ctgactgagg tcttcagggg ttttgaggtt     19740
     tttggacagt tcgttagcca gtgcctgtaa ctgtttttcg tccataaatt aaccttcatt     19800
     tgatgctgga ttgaacatat caaaatcagg caattacaca aatctatgca caggctcttt     19860
     tgcaattgat cgcctcatgg gtaatggggc gctccatcgc gatattccaa tgattttcag     19920
     gaatatcact tcaatgctga cacggcagtt atctttatgt gtaatagccg tagactggag     19980
     tggctatccg tcctaggagc atcatgtcct tcgtgccagc cttctgtgtg acgggcgttc     20040
     cattccgtta ttgagtaagg ttgttccttc tgaaaaacaa aataatccat tgatacaatc     20100
     atgatttcct tgattccctt gctcaatccc tgccccccga tgccagagtt attattgtca     20160
     cggatgctgg atttcagagc acatggtttc accatattac ttctctgggc tgggatttta     20220
     ttggtcggat cagaaataac gttcagtatt gccttgataa cgcgcctgaa agatggttaa     20280
     aagtgtcgga ttgccctgaa tgtaaaacac cggaatatat gggggcagga aggctggtca     20340
     aagaaaggaa aaaaagtatc cgggggcatt tttacaccta taagaaatcg gtaaaagggc     20400
     gaaaaaagaa acgttcgaaa ggtcagcgcg gtttaaacaa aacagacaaa gaacagagca     20460
     aatcagcaaa agaagcctgg ttgatcttca gcagaacaaa tgacttcaga gcgcgagaaa     20520
     tcatcaagtt atacagtcgg cgaatgcaga tagagcaaaa ctttcgtgat gaaaagaacg     20580
     gacgcttcgg gtttggtctt cgggccagca aaagtcgttc aacagggaga attctggttc     20640
     tgagcctgct ggcaacgttg agcactatcg taatgtggtt actcggttat cacgctgaaa     20700
     ataaagggtt acaccagaaa tatcaggtta acagcattaa atccaggcgg gttatctcat     20760
     atctgacgtt agcgaagaat gttcttcgac actcgccatt tattttaaga cgaacagtac     20820
     tgagcacagt tctaaaccat ctggctagaa cctaccgaaa tatagtgctg gtttattagc     20880
     agtaattttg tgaggatccc tcagcccgga gggctgcatt acccaatatc aagagggctg     20940
     aaagccgagc agatgcggga actgctgaat ggtcactaca tcagccaccg taaaaacatc     21000
     ctcatcaccg gcccgacagg aagcggtaaa acctggatcg ccaatgttct tggcgaacag     21060
     gcttgtcgcc agaaaaacaa tgttcagtac tgacgtgcag gtcgcctgtt cgaaacgctg     21120
     gctcagggac gggtggatgg tagctggctt aatcaactca ggttactgca gaaaacagtg     21180
     gtgttaatcc tggatgatct ggagcctctg acaaaccagc agtgcaatga cctgctagag     21240
     atcgtggaag acagatacga acaaagcagt accatcgtga taagccaatt ccccgtagat     21300
     aaatggtacg gactgatgga aaacccgacg acagccaacg caatcctaga caggctggta     21360
     cataacgcac acagactggt actgtagggt gaatcaatga ggaaaaagaa accggtaatg     21420
     gaagaggtgg aaaaaacagg gtaaaagaaa gatgataagt taacgcttgg agtgatcgaa     21480
     cgggatgcaa atcactgatc gatgttccat gcgaataagt gatcgatcat gtcggaatat     21540
     gcaaaaaccc gaaatcacca gttgccacat tgaacggcgc tggtgatttc gggttcgtca     21600
     ctttatggat accatcaacc cattccccgg agaaagtatg ggctggctaa agtgtagcgg     21660
     cattaagagc agttatttag tattttaatg agtatcgaat ctttatattt gcatcattcc     21720
     gttgttggtc cgccttctga caagctgtgt tggcagaaga aacgtcgtta gcggttccta     21780
     ttttgttact acctagatat atatcaggtt tttgataata catggtcccc atattcatac     21840
     tggcatattt gacacaggtg ggaatgttgc tggtttgaac ttcaataaca tagtatctgc     21900
     tacttgatac agcccaaatt tgaattcccc tgccattctc gtcgacaagc tgtgtggtgc     21960
     catccccttg atttatagta ggtattcctg tttttagaga tacagcttta ataaagttgc     22020
     ctatgttacc gtcaaaagca gaagcgttgc tcgcaatgaa tccattagtg gcagcaataa     22080
     tagtttgcaa tctggatatg ccatcattta cttttttatt ctcaattgaa ttgttataaa     22140
     aataaaggac tgcagcaatt actacagctg ataaagctaa aaccattgct gattctatta     22200
     gtgacagacc tttttctctt gatttatgtt tttgggttga tgtttttttg ctcattgctt     22260
     tgcatatagt ttagtggaat aaattctata attgagcata tctcatttgt agataaaaca     22320
     gagcaaaaaa ataagtaaag atatataaaa aagtgaactg aaccgccccg gttttcctgg     22380
     agagtgtttt atctggcgag taggcaacct gacggctgcg gcttgtcata gtctgaaact     22440
     accgctataa aaacagacca tatcattgtc tttcaggtgg ttatatggcc cgctcagccc     22500
     cccggttgca atggcgggtg gttccctgtg caggcggacc tgacaatgaa gccggactgt     22560
     tttttcccga cttcggcagt gccgcagatt actgtatgga gaaagatatt ccgtacctgt     22620
     ttgaagaaga tgccaccggc aattatgaaa caaccgtatg gatagtcggt gagcccgacg     22680
     gtaatgtcac catgatcccc atgccctgga aaaatttcct gtccgtgtgc acgatacatc     22740
     cctttatctg tcctgagtac ggctcctcgc atctgccccc ctgcataatt catgcttccc     22800
     cgttttgccg atatttttca gcagggaaac cgctggctaa actggctgga gaagcagccg     22860
     gaaggttcag tgcgtccggt agtcattgaa acggtgacaa aaatcatggc gtgcgggacc     22920
     acgctgatgg gctacaccca gtggtgctgt tcatcaccgg actgttgcca tacaaagaag     22980
     gtctgcttcc ggtgctcctg cccacactgt ggggtgaagg ttggcgcgca gtggatacag     23040
     tatctgctga gtctggttcc cgactgcccg tggcagcata ttgtgttcac gcttccctgc     23100
     cagtactggt ccctggtgtt ccacaaccgg tgattactgg cagatgtgga gccggggata     23160
     ttcacggtaa tccacacatg gggccgggac cagcagtggc atccacatat ccatttatcg     23220
     acaacggccg gtggtgtgac gtcaggtcac acctggaaaa accttcattt ttacgcccgt     23280
     aaggtgacat gtggcgctac cggataacgc ggttactgtc acggaaatac ccggagctgg     23340
     tgataccgga tgggctggca gcagaaggaa gcagtaaacg ggacaggaat cgcttcctgg     23400
     acatacatta ccgccgtggc tggaatgtca acgtatcccg ggtgatggat aacgccacac     23460
     atgtggcggt gtactcaggc tcttacctga aaaagccgcc ggtaccgatg agccggctgg     23520
     agcactatgc cagtcaggat gaaatcgggc tgctttataa cagccaccgt acaaaacggg     23580
     aagaatacct gttgatgagt ggtgatgagt tcatggaaag gttctcctgg catgtggcgg     23640
     ataagggggg gccgcatggt gaggttctac gggttcctga gtccggcgaa acgccggttg     23700
     ctggaagaag tggtgtacgt cataacagaa acagtgagaa aaacggcgag gcaaatcacc     23760
     ttgagaggga tttaccagcg gttactgaag gttgacccgc tgaagtgcgt gctgtgtgga     23820
     agtcagatgc gttttacggg gctgaagcgg ggataccgtc tgacagagct ggtagtgatg     23880
     catgagcccc tggcccggat gcggtggtgc ggctgagagc cgcagagagg aagttgcgtt     23940
     cattttacgg gaaatggagc aaaaaaccat cactgatacc tagtatcaat caatgtcagc     24000
     aataataagt ggcgataccg attacgtgac gttctggtcg tgctgaataa acattcgtta     24060
     ttcggaattt ttttaatctt tttcggattt aaattcctat tgatgaacct ccttattgag     24120
     agagtttaag aaacaatgtt tgcgcctggc tttttgatgg cttaaaacca tggtgaatat     24180
     aaaactgttt tgcgttttcc gtaagtgcat gaaccataat tgcacgcaca cctgtatttt     24240
     cggccactct gtaacaacga caaaccgcat catgcagtaa atccgcacca agtcctttac     24300
     cacggaatga cgcatcaaca gccaggcgtg caagtataat gacagggatg gggtcaggca     24360
     tattgcgccg aagattgcct gtagcttctg tatggttgac acagccagta gccagtgagt     24420
     aaaaaccgac tatttgttgt gttcctttcc tacatacaac aaaagtccgg gtagctccga     24480
     gagcctgatt ttttagcccc ttctgcttta accagtcatc aagaacagct tcaccgctga     24540
     caaattcagc gacctgatga aatgaggata aaaaactata gatattcaca ttgttgataa     24600
     aaatagtgat tatgatactt ttgacttccg taatattatt tttgaacatt acaccaatga     24660
     gatgtttata agctttgata atcaaggagg atttgttata tcaatattaa ataatgctac     24720
     aagtgaaacg gcaaatatta atgtgctccg aaaaaacatg acttctttag atagtagtgg     24780
     ttcattaata tatttgcctg gtggtgatgt ttatcatatt tcagatatct ataaaatgtc     24840
     cagaggtaga aaattgttta aattaaatgt agaaaagaaa cctgacattg atgatatcat     24900
     caacgtggct attttagaaa cttcttatct acaaataaaa aaaccaataa tgatgatagt     24960
     gattatattt tatgtttaga cacccctaac ctctcatctt acacattgaa ctttaatgac     25020
     ttgtctggat acatatcaag tttatgggat aatattaggg gtagttttac tccttttcat     25080
     aataatactg taaacatcgc ccctaatgaa aaaaatatat ttccctaatc ggatttgata     25140
     agttgtcatt caatattgat gtttttagac aagcattaga ggtaaaaaat aagaatagtt     25200
     acaagataag taaatttaca tgggaaacgt atggtgatat cgttgtatca cctgaagata     25260
     gaatttctca tctggagtta gatgggttta attatttttc acaccccgag ttagatactc     25320
     caatatctga ctcattttca tatttatatg ataattttca gatcgttgat agtgatgtgc     25380
     atattaagct tcttcatctc aacagagaaa caaagcaaat aacaccacat cgtattattc     25440
     ttaaaagata ctttatagac tcatttgcta aaacaagtat cactgacaga gaaaagaata     25500
     tatatcctgt gatttgtgat tcacctgatc acttcacaag cgacatatat aggcatccat     25560
     ttagaatagt tctcgggaat aagtcattgt atccatcaga agaacttgta aaattcataa     25620
     gcacctcaaa agaatattta agcaatatgg atatgattaa caatgttatt gttcctcaaa     25680
     aaacaacaaa gaaaaacaaa ttatccatag ttagtttaaa tagcaatatc aaaaatgata     25740
     ttgtattgtc cggagtaatg accggaacat caaagatttt tcatctaaat aattcaggtg     25800
     atttattgtt aacaacctca aaaactcatg gtggtggggt tgtggttatt tttaaagatt     25860
     ttataaataa ctggtggaaa tataatctta ctttaataac agttcctatt gataataaat     25920
     tgtcagacaa taggataaat ataaccccaa tggggataaa gatacaggaa acagtcaatg     25980
     gaaatgacag gttgtttttt taccctactc cattaaaaaa tggaagtttt atcttgcata     26040
     atccacttta ctctaactca ttcccttctt tatattcaca tgaattattt gatttgattg     26100
     aagcatatag aaatccaacg tattcgtatt tacagaacaa tattatcaat agatatatac     26160
     atactgtttc tgagtatact ggaaaagacg gtgttgccaa tatgtcatta tctatatatg     26220
     catactcgac atgtcgtttc tggtcaaaag aaagtgtggc tgtaggagat acaataaaat     26280
     tgtctaatta tgagcatgtt gagtttagct ttaattcatt tagtaaggat tactttcgtg     26340
     aacaaaatag tgatatatat aaaatatttt ttaaaattgc ttcttcgagt aattcggttg     26400
     ttgtggataa aaatacgctc actcaaaaaa acctcctcga aaacaataca tttttcagta     26460
     ttacaggtat agatgagtct ctctatgaaa agcatataat ctttatcact cttaaggtta     26520
     ttgtcccctc aaaaaagtag cgctgatttc ctgtatgcgg aatttgctga ctaatcttac     26580
     ccagcgcaga cgttccaaag gccacgacat acttcgcgaa acgcctgaaa tgaattatgt     26640
     ctttattgaa ctgatttcag catcaagaca atgtaccgcg cgctcagggg gagggggccg     26700
     catcggctgg tatatgtggt gtcagtggcg gataaggata agtacacgtc ggcagttccg     26760
     tcagcactgc gacagcgttg tcctcgttgc ttttacccgg tcatgcacaa cgcctgatgg     26820
     atgaactgcg tgcccaaggt taccatttta aagtaaaaac cgtgacggaa agcctgcgcc     26880
     gtcacggact gagggcaaaa gcatcctgga atttcagtcc ggtctgttac tgcgcacaca     26940
     gccagcctgt gtcagaaaat ctgctggagc aggattttta cgccagtggc ccgaaccaga     27000
     agtgggcggg agacatcacg tattgtgtgc ccggagttca gggcgagcat ggaggctcaa     27060
     atgaaccacg agtctgtctg gaatattgaa ccggtaactc tctcctttga tattcagcgt     27120
     ggttgagtga tgtagtgtag cagccggtcc aggatcgctg ttgccagcac gtgatctccg     27180
     aacatttctc cccagtctgc gaaccctttg tttgacgtca gtatgatgct cgctttttca     27240
     tatcgagggt tcagtcgccg gaagaacagg ctggcttcct ctctgttcat cggcagatag     27300
     cctatttcat ccaggatcaa cacccgggca taactcagtt gttgtagctg acgctccagc     27360
     caggactcca taccgcgctg atgcctgtcg ttccattcct gctgttgcgc tatgcacagg     27420
     acccggtagt tcagctcttt tttagctgcc tgttccagca ggctttcaac gtgataactc     27480
     agatgctcca ttttcaggcg actcagcagg atttccagct catgcatcac aacagctcct     27540
     cataggcaca tcagtggtcg atgttccacc tgactgacct gctgccagag cggggcgtga     27600
     tgctccagca ctgtctgcca gccagacgat gccgaacaga ggcgatgtga ggccaccagt     27660
     ttctcattac tgtagatccg caactcgtca tccagcgata ttcgtatcga taccggctga     27720
     ccacacagcg cttcgggaac gctgtaacga ttaccgccaa cctcgatata gctgtcccag     27780
     gacatatggc ggatgtcgaa gtaactggta tcgaagtccg tatccggtaa cggctgcaga     27840
     tgttcctgct ccagcgcgaa gcgctgttcc ggcgtttctt tgaactggcg aagctcccgt     27900
     ttgtcagcca catcggctat ccattgctcc agttgttgat tgacatgagt gaagctgtcg     27960
     aacctgtggt accggacgaa gaagttctcc ttgaggtatt tcaccatccg ctcaacctta     28020
     ccttttgttc tggccctgcg tggacggcat gcccgtggtg tcacgaacgg tgcaatagtg     28080
     atccacaccc aactcctgaa atcagatcca gggggtaatc tgctctcctg attcaggaga     28140
     gtttatggtc acttttgaga cagttatgga aattaaaatc ctgcacaagc agggaatgag     28200
     tagccgggcg attgccagag aactggggat ctcccgcaat accgttaaac gttatttgca     28260
     ggcaaaatct gagccgccaa aatatacgct gcgacctgct gttgcttcac tcctggatga     28320
     ataccgggat tatattcgtc aacgcatcgc cgatgctcat ccttacaaaa tcccggcaac     28380
     ggtaatcgct cgcgagatca gagaccaggg atatcgtggc ggaatgacca ttctcaggag     28440
     caggagcctg ccgttcggtt cgaaactgaa cccggacgac agatgcaggt tgactggggc     28500
     actatgcgta atggtcgctc accgcttcac gtgttcattg ctgttctcgg atacagccga     28560
     atgctgtaca tcgaattcac tgacaatatg cgttatgaca cgctggagac ctgccatcgt     28620
     aatgcgttcc gcttctttgg tggtgtgccg cgcgaagtgt tgtatgacaa tatgaaaact     28680
     gtggttctgc aacgtgacgc atatcagacc ggtcagcacc ggttccatcc ttcgctgtgg     28740
     cagttcggca aggagatggg cttctctccc cgactgtgtc gccccttcag ggcacagact     28800
     aaaggtaagg tggaacggat ggtgcagtac acccgtaaca gtttttacat cccactaatg     28860
     actcgcctgc gcccgatggg gatcactgtc gatgttgaaa cagccaaccg ccacggtctg     28920
     cgctggctgc acgatgtcgc taaccaacga aagcatgaaa caatccaggc ccgtccctgc     28980
     gatcgctggc tcgaagagca gcagtccatg ctggcactgc ctccggagaa aaaagagtat     29040
     gacgtgcatc ttgatgaaaa tctggtgaac ttcgacaaac accccctgca tcatccactc     29100
     tccatctacg actcattctg cagaggagtg gcgtgatgat ggaactgcaa tattaacgac     29160
     tgatggtgct cgccgggcag ttgcaactgg aaagccttat aagcgcagcg cctgcgctgt     29220
     cacaacaggc agtagaccag gaatggagtt atatggactt cctggagcat ctgcttcatg     29280
     aagaaaaact ggcacgtcat caacgtaaac aggcgatgta tacccgaatg gcagccttcc     29340
     cggcggtgaa aacgttcgaa gagtatgact tcacattcgc caccggagca ccgcagaagc     29400
     aacatgagtt gagtctgtgc tgttacgagt attgtcataa aacatgtctc tccgttccag     29460
     tttgtctgat gatataaatc ccccgggact catcccggca ggtaaaatca tactctcaac     29520
     aaaacttttc ttctcctgcc tcaggcgagt ccacagagaa aataacaatt ctgagagtta     29580
     tctgcgggaa aggttattta tatgttacta tctcattctc tcactggcga gattataaac     29640
     gttactacgt tctcgttttc ctaccgcaac aaccgcaata attaacatat cgtcaatcac     29700
     ctgataaacc agacgaaatc ccgatgcacg tagtttaatt ttgtagcagt cctttagccc     29760
     tcttagtttt gccgacggta tatgaggatt ttcgctgcat ttttttagtt ttttcacaaa     29820
     ctgttgttga atggtcttat ccagtttcag ccattccttg agcgcatcat ccctgaattt     29880
     taccgtataa gtcataaata actgtccagg tccacatcat gcagtggctg attgctgcgt     29940
     tcagtaacca gtttcaccag ttcctggtca tccagagcat caagcatcct ttcatacagt     30000
     tcagcaggca cacagtagaa tgccggctga ttccggttaa gaatggcgac agggtaacca     30060
     tctccggcac tgactgtagc cataggattt tttttcagtt cactgacact tgcactggtg     30120
     tcagacagaa tgatgttagg cataacgcac ctttgagact gtttaacaag tcttaacgat     30180
     atccctgaaa cgaccactta acaagtcttt attactcaca cttttgcaaa tgcattaaat     30240
     gctgcttgta ttattctgat gccgcgccag cggcatggaa ggcggcacgc tgtggttaca     30300
     tgtgataccg gagtaaaacc gccgaagccc ggcgtaagcc ggtactgatt gatagatttc     30360
     accttaccca tccccagccc tgccagacca tacccgcttt cagccatgag agagcttctg     30420
     tgcgcgatcg gagtggtccc gacgagggtt tacccgaagt cggggcgtat ctccgcgtta     30480
     gcgggccgtc agggccgctt acgagcgtgt attcaatatg tccagccaga acactgacag     30540
     ccatgatgga gcatagttac aacattcata attaaaagcg actctgttcc ggccctttgg     30600
     gccggggcgg cggcgctttt cagttatgag gaggggcttt gcggtttcag ttctgcgcgg     30660
     aaccggggtt tttccggagt ctatgtttga atgttgtaac taaattggct ccgatcgggg     30720
     cccgccgctt gcggtgggag gtgcatatct gtctgtccac aggacaggca gtgaataggt     30780
     ttttttttaa atgaatgtaa ttaggtagtt taaaggagat ataaacaggt gtttaaaaga     30840
     tacattgcac cctgtaaggc tgacggctgg cgctttatga catgaacggt tgtaacctta     30900
     tggggaagtc ccttgcagtt aaatgtggat aagcaaaatc ccccgtctgt gaggcgtgtt     30960
     ttgtatcaaa aacagggggg accggatgca ccagaaggtg aatgatgagg ttgttttttg     31020
     tatgtagtac tgattttttg tgcactggcg ggcttcaggc gtgcagatgc ctccggtgcg     31080
     ggccggatta ttcagaggag gtcactttca gggggaagct gtggccagcc ggctgtaatt     31140
     gcggttacgt gacagaatca tgcgctcctt cacacgacgt tccacttcgc gttttaccgc     31200
     ctcacgattg gcagtgaagc gcccttccga gatttcacgc gtcagctgcc gtttcaccag     31260
     ggtgacgata tcctgacgtt ccctgttcgc atcacgacgc gcacgggcac gttttattcc     31320
     acggtactta agctctgtct ggtaactgcg gaaacgctca cgcacaaaac gccaggcttt     31380
     cgctatcagt tcatccatac ccagtgcatc cagtccctgc ttcttgcgct gtctgttttc     31440
     ccattccaca cgactgcggc gtgcggaagc caccgccacc tcagacacat cgagagcggc     31500
     aaacagtgcc ggtgtgaacg tgatgtcggt cggaatgtag cacccgataa gcgggtcata     31560
     ttccgtctgg taggtaatca accccagctc tgacaggaac gtcagggcac gggtggcacg     31620
     agtgatggag agttttcctg caccggactc tgtcgccagt ccgcactcaa tggccagcgt     31680
     ggtgatggag cactggacgc ggttggccag cggatcatag tgaaaacaga gcccctgcag     31740
     cagcgcatca atggcccggc gacgcagtac cggtggcatg cgccgacgca gaccacgcga     31800
     acgggcatgc gccacatgaa tggcgaaatc aaaacgggag gtgaagccca ccgccttttc     31860
     catcagtttt tcgcagaact tcagcgttcc ggcaccttta cggggtgtaa acaccggatt     31920
     cgggttcttt acctggcggt aatacgtttg ttgaagatca gtcacaccat cctgcactta     31980
     caatgcgcag aaggagtgag cacagaaaga agtcttgaac ttttccgggc atatagctat     32040
     actccccgca tagctgaatt gttggctata cggtttttag atggccccgg taatctttct     32100
     gtactcgcca aagttaaaga agattatcgg ggtttttgct tttctggctc ctgtacatcc     32160
     acatcagaac cagttccctg ccaccttatg gcgtggccag ccataaaatt ccttaaacga     32220
     tcagcaatct atcacgcaca ccagaaacag gcaagaatgt gatgtcgcta catttcagtt     32280
     agctaaaagc actcttctgc tttatcagtt cggcaatcat ctcagcctga gtaacaccct     32340
     cagcttcaca catctcctgc aattgcgctt ttaacgcagc aggaataaac actctgagtt     32400
     ctttatgtgt ggctcgtttt cttgccaggg atgcctgctg acgttctgca agcgtcagag     32460
     gattaccttt tctgtatgct cgctttgtac ctgatgagga agtcactgca ttttctgtct     32520
     gcgacatctc gcctcctcaa ttctcaaaca gggatcgttt cgcagaggat actacagttt     32580
     tttgaaatca gcgacttgaa agttgtgacg atgatctgtg ttggcgcaca aatcatgtct     32640
     gattacgacc gtttaatgtg attttgataa tgaaatgact gaaaagatgg aaatgcctta     32700
     acctgtgtgc cggccccggg cgggaccggc tgtttctggc atgtcgggtg tctgcccctg     32760
     aaatacctca cacttccgga aagcggggac ttccgtcccc gcccggcagc ttacttccgt     32820
     gcttcgtagg ccagagttac ctgcaccact gtatttcccc tgtgaatatt cagctcacat     32880
     aaccgttccc tgaatatcag taaaaaacac aacaccgtgg cgcacacggc gagcaccccg     32940
     ataagggcat atttcgtcat aaactttgac ctctctgcaa ggactgtctc ttatacacaa     33000
     atccccaccc ggggatttgt gatgtctgtc agtctgcttt agggggactc tttccatccg     33060
     gtagtttcct tcctccccgg cagcgatttt ttgaactttt tcctcacctg ttgatcttct     33120
     cttatatttc attttcttcg ggtctgttat ggtactttct gattgttatt catgggctaa     33180
     cgagcagttt ggacatgccc gtctcggtga tccgcgtcgt acacgacgcc ttgtgtcact     33240
     ggcctcttct ctcgctcagc atgcaggtct ttctattgtg aaatcatccc agtccactgc     33300
     tcaggttgaa ggtgcgtacc gcctgatacg taacccgtct gtgtccccgc aagccattgc     33360
     cgaagccgga tttaccgcca ctgtaagggc atgtgaggct catccgctgc tcctcgcgct     33420
     ggaagacacc accaccatta acttcagtca cagtacggca tctgatgacc tggggaatac     33480
     caccactaac ccgaagacgc gcgggctgct ggctcactct gtcctgatgt acgcccccga     33540
     cagcgccctg ccagtcggtc ttatcgaaca gcagcgctgg agtcgtgcca cggacaccta     33600
     cggtgttaag caccagcgaa aagaacgtcc ctatgaagaa aaagaaagtt accgctggca     33660
     gcaggcttcg gagcgcatgg ccgaacggct gggggagata cagaaacggg taatcactgt     33720
     ctgtgaccgg gaagcggata tctggcatta cctgcattat aaagtcagcc acgggcagcg     33780
     cttcgtggtg cgtgcagcac agaatcgccg gctggaagaa gcacccggca agctcttcga     33840
     actgccggaa gtcctggcaa ccgcgggaag ccacacgctg aatgtgatgc aaaaaggcgg     33900
     gcgggcagcc cgccaggccc ggatgttcat cagttacagc gaagtcagca taaaaaatcc     33960
     cgacaacagc ggccaggcgc tcccgctcac gtatgtctgt tgccgggagc aggcagagga     34020
     cggcgcctgc tggcatctgc tgacgtcaga aaaagtggcg agtgccgccg atgcgcgacg     34080
     tatcgtcagc cattacgagc gacgctggct gatagaggaa taccacaagg cgtggaaaag     34140
     tggtggtaca tgtgtggaat cgctgcgaat gcagacccgg gataacctcg agcgcatggt     34200
     ggttatcaag gcgtttatcg cggtgcgggt gctgggcctg cggcagggcg gtatcagtga     34260
     agaaacacaa aatgacagct gtgagaaaat actgacgccg acagagtgga aactgctgtg     34320
     ggttaagctg gaaggaaaac cgcttccgtc acagatgccg acactgaaat gggcctgtct     34380
     gaaactggcg aaactggggc gatggcatga cagcaaacgc accggtcgcc ccggttgggt     34440
     agtcatgtgg gatggctggt tcagacttca ggatatggtt gagggttacc tggtgatgaa     34500
     gtctcttgat caggagatct gatcaagaga caggtcatac agagggcgct tttattattc     34560
     tgccaggatc gcccgcagct catccttgat ccggttctgt ctgcgcacct tttccaagcg     34620
     cgcctgcgca tactgttctt cttcctgtgt gatatgttct gtcacatagc cttctgtatc     34680
     atagcggcag gcaccggctt tcatggcgcc aagatagctt tctgaacggg tgatggcctt     34740
     cagtgccctg cgcagttttt tatgagagag cgggatattc cgctgagaca cctcatccag     34800
     taaaacttcc cggataccac aggcaagaag ccggggcgtg ttaccgtcaa acaatcccgg     34860
     ccaccagggt ttcagagtgt tcaccgcctc atccagtgag ggcagcgtca gataaatgga     34920
     cagcgcctgt ctggcctgtg ctttcttcgc cgccagctct gcttcccggg cagccttctc     34980
     cgccagtttc tgctttttca ccttccattt tggtggcgtg gtgacattga tgatggtttt     35040
     ccggctccgg gtcggtgttt ccccttccgt tttccgtttc agtgtcagta ccggtcgttt     35100
     ctgctctgtc atgattgccc tgacctttgt gaaaatatgt cctccaggtc gttgaaacta     35160
     ctcactatga tattaagctg acctcaacga cctctgacat attaataccg acaattaaag     35220
     atgtttttta aaccattgcg tctgtactgc cgccacacgt tcaaaaaacg cgccttcata     35280
     aatatcataa tggcatgcgt cagcttcctc gtataattcc ttagtaccag aagcaacagc     35340
     atcatataag gctcttccct gttctggtgg attaacacta tcctggccgg caataacaac     35400
     caaaactggg cactgtactt tggctgcgct ctctgccggt ttatattgca acgtctccat     35460
     aaccgtaagg aaaggtattt ttatatccat ttcaggatac tgacctttta ccttctcgaa     35520
     gaataccttt gattcattat cactcagtac ccgggtaacc cccacaaaca tctctttccc     35580
     ggtatttttt ttcttttctg ccattttatt cagcgtggac agaaaagaag ctttctccag     35640
     ttcattcatt tctccggtaa ccagaacctc accgtcagca aaagccagct ggctgacaat     35700
     acttttcact cttttatcct gcgcagctgc attgaataca tgacacccac ccagcgatgt     35760
     tccccataat cctatacgct gattatcaat acatacctgc ttttctgccc aattgataac     35820
     tgaaataata tcttcggtct gcattgccgg aaccagacga cctcgttccc cttcactctc     35880
     accgaatcca cgataatcaa aagtaatcgt tgcaaacccg gcttctgtaa acgcattcgc     35940
     aaaggaaggc agcagaacat tccggatacc gcaaaatcca tggcataaga gaatcaaagg     36000
     atgttttata tttccttccg ggacacgaaa tgtcagggca ataccttcag ggagtttgtg     36060
     atccgtaatt ttcataaata tcctgtgtta tgttgtttat taataagcag aatcagcgcc     36120
     agcatcatac cagtcacaca gccagaacgc ccagcacagt aagatgacag gcatagaacg     36180
     tcgggaaaaa atccccgtac cagaaacggg gtagtgattt ccctgtacag gacaccagac     36240
     caacagtcag caccgtcatc acaaggccgg ccaccgccgc tgcatcactg gtggcaaggt     36300
     taagcgccgg aataacagcc agcaggcagg cgaccagcgc cagacgttcc attctgtctt     36360
     ccgcccggta cagcctgtgg ctgactgcca gcatcagcag cccggcaatg ccgtaactgg     36420
     tgccggagaa aggcaaccac attgccagaa gcaacatggt ctctgcggaa cgccaccagg     36480
     tgcgcgtttc acaccatgtc agcacctgtg ccgcaactgc aaaggcaaac aggatattcc     36540
     cctcatacca gggaaagccg gccagataat atgcgaactg ggcaatcacc gcccatcccc     36600
     acagccggtt aatggcctcc tgccggatat gcgtatgacg ggacagattc agcccccaca     36660
     ccagggcaaa cagcggaaag gccccacgcc cgaccagaaa catccacgac tggtccagat     36720
     gcagaatgcg gtttgcatgg tccagaacca tcagcaccag tgccaccgtt ttgatgatat     36780
     cccgctgtcc gggtgaccag accagcaacg actgcaacca ggtatcggtc cgggcagcca     36840
     gtgaatcatt acgtgttgtg ttcgtgttat ccgttgtcat cagcgtttat cttcctgtgt     36900
     cagtctccgc ccagggtttt ctctttctgc aggtcacgaa ccatatcccg ctccatctgc     36960
     tgcagtcgct cctgcagcag attttcccgg gcaacctccc ggaccgcttc ccgcacccgt     37020
     tgtggttcac gcagtacact ctccggcagc gcggcttccc gttcagatat ggcagaccgg     37080
     tcacgctcca gcccggcaat atccctgaca gcctgctctg ttttgccgtc cggcaggtca     37140
     ggtttgttct ctgccatttt acggacaatt tcatccgcac ggcgttccgt ttcacggcgg     37200
     atggcctctt cagcctgccg ctgtgccagt acctctgccg tgaccggttc gccatttccg     37260
     gctcccggct gaacgctgtt gtccgggata tccccccaca cgcgaccacc ggtgatggta     37320
     ccgggattcc acggacgacc ttcaccggcg attcttacca ccacaccgct gtcaggatta     37380
     tcacgggcaa tccggacacc atcctgcata ttatcagcca gcaggctctc tccgttacgg     37440
     ctgccctgca gggccacgaa ctgcgcatcc ccgctgcctt tctcccggcc ttcaccactg     37500
     aagccccgca gcccgtttcc gtcatccgtg gtcagcgggt tcagccagat accagctgac     37560
     ttgccgttac ggtcaaaagc cggcagtgcc acatacggct gcggatattt gcgcccgggt     37620
     gcaataaacc gtgcaggact gtctcccccg gccagccctg cctgacggag aacggcacgg     37680
     ccggccacca cgtcccgcag ctcccgcgcc gtactgaaca gccgctctgc attcatgacc     37740
     tcccggtccg atttcggctc tagcacatcg tgggcagttc ctttctgtac ggcattgtta     37800
     atggcatccg tccagccctg acggttatcg gtatacacct gcacatgctg cttcatacgc     37860
     gacagggcca cgtaggctga ctcaaagccg gccatctgtt tccggttacc ttccgtgcct     37920
     tcaagcgcaa tggcaaaggt ttcacttgcc ccctgcgcac cgtgggcggt gatggcatag     37980
     gccaggtcaa tatgttgctc tgcccgctcc tgaccggggc gaatcacccg ggtctgctgt     38040
     ccgtccgaca gcgtgacact gtcaccggaa accgctgtca ccgtccagac gctgttggcc     38100
     acataaccgc gctcccggtc actcttcgtg aagcgcatcc ggtcaccggt tcccacccgg     38160
     atggtgtccg gagtgtacag tgtgacgcct tcagccaccg cctcccgggg cgaaatcagc     38220
     cgcgtgttac cttccgcatc ctgcagggtt atcagcccgt catccttgct gataccggca     38280
     atccggtgat acacattatc caccagggca agtgcgtccc gatgtgtctc ccaggtggag     38340
     agacgacgca actccccgtc gcgtatattc gctgtgttca ggacaggcac catgacctgc     38400
     tcttttccca gctcaccggc cttttcccgt gcatcatgaa tcatgctgtt cagtacgcgc     38460
     cggtcctcat tcagatgcgt gacaatcagc gtctgctccc gtgcttccgg cgtcctgccg     38520
     gtataatcgc ggacaatggc ttcatacagt gtcatgggaa tatccggaaa agcctcacct     38580
     ttcagcatcg ccttctgctg cgcttctgcc agtttcgctt cctggctgtg actgaactcc     38640
     gtcacggagt gctccggtac ccatgcgccc tcctgacgtg gcacctgaga cggtttcaca     38700
     ctctcaagcc cggacagtgc cctttccaca tcccggttaa tcaggctgta taccgcctcc     38760
     cgcagctccg gcgtctggcg cacaatctcc ttcatgatgg ccacatcggc agcactgcgc     38820
     gtctgctgga gacggaaagg ctgaccgggc gcgatggcct gcaactggtc cgtgtcacca     38880
     ctggccacgg cacgaccgcc accggccgca atcagggcgt atgcccgtgc catgtcggta     38940
     ttgcccacca tagagctctc atcgagcagg aacagcgtgt tgctgaaatt cggcgtttct     39000
     ccgctgcgct gcagcagctg cgtgtcatgc agaaaggacg ccagcgtctg tgcatccacg     39060
     ccggcgctgc gcatctcacc gaccgcacgg tgcgtgggcc ccagccccac gacacgggga     39120
     cgttcactct ccggcagcat gttcacggct gacatcaccg cccggaactg tgtggtctta     39180
     cccacaccgg catagccctg caccaccgtg aaacggtcgg acgtttccag tatcatgcgg     39240
     gtagcggcac gctgtcctga tgtcagtttc tccatgagtt cgccaggtac tctctccatc     39300
     agtggcgtga ccgcctcctt accttcgaga atatggcgaa gaatgctctt ttctgcctca     39360
     tacgacgcac gggaaaccag caggcctgtg ccatagcctt ttgccacatc cacatacagt     39420
     aaatcaccgc gttttatctg cgcattgatt tcccctccca gttcagtaaa actggttcct     39480
     tctgcagcaa acgacttcgc ctctgtcagc aggtccacca tgctgaaggc caggttttta     39540
     ctttccacca caggaagcgc cagatgaata gcctgctgtg ccggcgtgtg aagcccggtt     39600
     ttctgcagac tgatagcggt ttccagcaat gtctcaccgg cacgcgcctt tatctgctca     39660
     gaaaccaccg taaaggaggg atggcgggca agtttttccg cagtacgggt ttcatccagt     39720
     gaggaataca gccggacatc acgaccgctg cgggccagac cgttcagggt ggcgttgtcc     39780
     attgccatct gtgtgacgga ggcaaaaacc ttcgcactgt cgctgacgga atgcccgggc     39840
     gtttccaccc agccgttctc cagcttcagt gccataaatg gtgaatcgct cacaggcagg     39900
     gaggccggtt cagcccgccc cggcacaaca accgtcatcg catcttcact gacggatgcc     39960
     acctgcaggc ggtcaccgcc ggagacgcgg agtccgggaa ttttccctgt caccctcagt     40020
     cgctcgccgt ctgccaccgg cattttttcc ggccggaaca gcgaccagct gctgtccagg     40080
     gaggaaatac gcaccacctg cgtttcaccc tgcgcatccc gcagggtcag gctgttactc     40140
     tgcgccgtca cccggtcgat aacatagcgg tcatgactgc gtgtctccgg gttccactgc     40200
     tccatcacca tccccggacg gtacatatcc cgcagataac ggctccggct gtccagccag     40260
     accggcgaca gggcggtcat ggttacctcc gggcgtccga gcacgccctg tgttttcagc     40320
     tcactgcgaa tggcctgtgt cagtatggcc tgttcccgta ccccgctgac ctgtgccacg     40380
     ctctcttctc cggctttcac gctggcagca aaatctcctg ccagccgggc atagcggaca     40440
     ttacggtccg gttcactgat gatggtggcc ggccgctgtt ctcccccctg ccagcgatat     40500
     gtgttcaccc cggcatcttt catggccatc agtgcactgc ctgtaccggt tcgctgcccg     40560
     ctgtcggtta tcaggacctg tacgttatga cgtgcggcac cgtccagcag ggttaacgtc     40620
     tctttcaggg agagtttttc gccctggtca acgataacag tattgcccgg cgtgaaggcc     40680
     atgccctcct gcagctgacg acgtccggtt atcagctcac cggacagccg ttcatcctgc     40740
     ttcaggttca tctgcgagcg acggtcagcg gcgataatct gcacctcccg cccctgctcc     40800
     cgggccatca tgaccagctc cgccacccgc tcacgctgcc cggctgcacc gccctgcccg     40860
     gacacaatag ccagcgacgg gcgatcctgt gccagaacac tgaccgcatc gctgtaaccg     40920
     gccgtccggg ggacactttt ctccggatgt acggtcaccc ggttctgttt catgatgtca     40980
     cgactgagtg cccggactga cagctcatcg agcacatgaa tcccggacgt gaacagcccc     41040
     ttctcacgat cgagggggat aagctgctca cggctgatgg cctcatcgat accggcgcgt     41100
     gcccgttcaa tcacaccatt ttccggcggc agtatgccga ccgttctggc cagcacgtcc     41160
     gtgtacgtaa actgcacttt gcgttcactt aatccggcaa tggcctgtgt caccgcctgc     41220
     tgcacatccg gcccgtcctg tgaagcgggt ccgggcgtct gcgtgcgggt ctccgcccgt     41280
     tggtccgccg cgtcacgata cgcccggatg tcgaacccgg tttccttcag cgtctgcatc     41340
     cattcagcca ttctgacttc aggatcgacg tgctgtttgg attttcgcgt atccagtgcc     41400
     gccacatccc gggatttcag cgaggcgtct tccccgacgg cctcccggat agcctgtgag     41460
     cgtccggaga aggcctccac cggtacgccc ggcatctccc acataccgtg cttaccaacc     41520
     acttccgttt catagcccag cgcctcaacc tgctctttca gtttttcccg gtagagcctg     41580
     ccgaaggcaa tctgattagc gtacacattc tcaatgaacc ccgttttccc cactttgtca     41640
     ctgctcagtg tcttccactc gccgttatgc tgcgtgacat tggccactac cgcatgtgtg     41700
     tgtaactgtg gttcctgatc gcgactggtg tcgtggttaa acagtgccat caccagatta     41760
     ccggtcagca ccgtttctga ctgtccgtcc gtcataaccc gtgtggaagc cagcgcctcc     41820
     acctgacgga cagcaaaatc cacggcctgg ttatgtgcat caataagacg tttatcaccg     41880
     cctaacatgg ccatcacgga gacacttttg ggggcggaga aggtcaggtc gtagccggga     41940
     cgatgcttat tactgccatc ctgcatgcgg cttaaatccg ctccgtccgg cagcttcccc     42000
     tccagaagac gggtaaaaac atccttatcg acgctgccct gcagccccag ctgttcagcc     42060
     cccctgccgg cccagcgttc tcccatgctg cccagcacat agtaattatc cttgtcggta     42120
     taatagttac cggcacttcc ggccgatctg acctgcgcga tactcatcat aaacgtatat     42180
     ccctttgaca tatcccggta tcaatcccac aatggatata cacaagacat atccacataa     42240
     ggaggcaaat aatggaaacc accgtatttt tcagcaaccg cagccaggcg gtcagactgc     42300
     caaaagcggt tgcattgccg gaaaacgtaa aacgcgttga agtgattgct gtcggacgaa     42360
     ccagaatcat tacgccagcc ggagagacat gggacgaatg gttcgacgga cacaacgtca     42420
     gcgccgattt tatggataac agggaacagc ccggcatgca ggaaagggag tcattctgat     42480
     gctgaagttt atgctcgata ccaacatctg cattttcacg ataaagaaca aacccgccag     42540
     cgtcagggag cgttttaacc tgaaccaggg gagaatgtgt atcagttcgg tcaccctgat     42600
     ggagctgata tatggtgcag aaaaaagcca gatgcctgaa cgtaatctcg ctgtgatcga     42660
     gggatttgtt tcccgcattg atgttctgga ttacgacgct gccgcagcca cacacagcgg     42720
     ccagataaga gcagaacttg cccgtcaggg acgccctgtc gggccatttg atcaaatgat     42780
     cgcaggtcat gcccgcagtc ggggactgat tattgtgact aataacaccc gggaatttga     42840
     acgtgtggac ggtctgagaa ttgaagactg gagctgacct gttcatcaga aatcatctcc     42900
     cggctcaaca tcctccccgc gctcccgatg cacattgatg ttcacctctt cacgacgctg     42960
     catcttctgc tggatatccg gattctgctc ccgttgccat gcctcataaa cggccatatc     43020
     caccacttca ccggattcac tgatcccggg tggcagttgc tgttccatct cttcttccgg     43080
     tttcattttc agctcctgct cgatcccccc tgccggaaca ttcacacctg catctgactt     43140
     cttatcgttg atggcaggag acaccggctg ttgcggctgt tcagcctgag tcacgtcttc     43200
     tccggaaaca acctccggga catccggttc gaagaggctg gccatctgac gaccttctgc     43260
     ttcccttgcg gcaagtacgg cactcagacg gttctccatt tccgggttga tgtcacgcgg     43320
     aataaactcc ggagcgacct tcggtcgtgt ctgatatttc agggagagtt ttactgccgg     43380
     atacggtccg ggcagggtga cataacaggt cagatccggc agagactgaa tgtcggaata     43440
     actgaccagc gtctgacgct ccatatcctt accggtcgat accccgtcac gtaccggatc     43500
     agcaccgtag gaatactgct cgctggcttt caggtgctct ttctcaccaa tttcaccggc     43560
     agcgaactct gcaatcttat ggctgggaga acggaaaaag gcacgggtgt tcatgacgtc     43620
     aaacagcgtg gcagccgctt tctcaccgta gatatcttcc agctgggcat aggactggat     43680
     accaaacaca taacagccac cgaacttacg ggcttccggc aggatctcca ccaggtccgg     43740
     cagtttgtgt aacgtgggta actcgtcaca gaaaaaccac acacgacggt tacggttttc     43800
     tcccattgcc agcagaccac gaatagcaat ggacagccac atggagatca ccggcttcag     43860
     ggaggcatgg gtgtcggcgt tcgacgaaat aaacagccag ccgtttttct gatcttcccg     43920
     gacaccacgc atccagtcac ggatggtgaa gggctcaccg ttatgctcaa tcccctgcag     43980
     gtaacggatg gctttcacgt agttggtcag cacagcacgg atggatatgg ccgttttctc     44040
     gattttctct tccaccaggt tggccgccgg tgaattacgc aggaaggtac gcagcttttc     44100
     aattttgatg gaaagcagtg tgtccaccag tttgctgtag ctgcggttgg ggtcattacg     44160
     catcaggtat gccgcttccg caaaaatggt acgtcctgaa ccctgccaga acgggtcctc     44220
     ttttgtcccc atcgggatca gagtatttgc ggtattatca aaatctggct gtgtcaggca     44280
     ctccttccac aaatcccagg cagcacagcg tgcatccagc ggattcagga ttttatcgat     44340
     ggagggatca tagtaacttt taacaaattc ccccgaacgg tcataaatca ccaccatatc     44400
     accacgctga cgggcgtagt tggccagacg acggataacc tccgacttac cggccccgac     44460
     agtgccgtgc agacagaagt tctggatttc agaatcccgg ataatcggca gatcgccaat     44520
     ccggatatcg gaatccttgc catctttttt cagcatccta gccacctctt tcggattgtc     44580
     agtcagctga cgaccacctg tgatttcatt ttcgctctgt tgtttaccct gacgccccag     44640
     aatccaggag acaacaaaga aggtgatcag gcagataacc agggccacga cagacgccag     44700
     aacgaatgcc gaccataact gctcaccgca ccagatcata tatttatcat gcagtacctg     44760
     agccgcgttc atccggaagg ttttgccgta atactggatc tcatagaccg gctgggacct     44820
     gattaaatcc cgcatgcctt ccagcgtggt gcaccaccag taaatgcagc cattcacaaa     44880
     cgtctgccag cttattttta cccataaaac cagaccaact aggatccaga aaaaaataaa     44940
     caggcagtaa agtatgatat tggcgatctg actgaacatg cggatacgca tggacgcaat     45000
     ctgaccgccc tgggtcatat cctttgcgtt aaaactcatg atgatcttcc gaagaaaaaa     45060
     agtcagtcgg actgattatt aatgatgaaa agattaataa ccgttaaatt ccggcttcgc     45120
     cggcaacact tcacggtcgc acaaagaatt tgcacaaccg ctcagtgttt tcatatttat     45180
     ttcggaaacg ccggggagaa ataaaattta ttttatttct ttccggggtt ggacaacgag     45240
     caaagcgagg cgtcagtcag gaggccggtc agaccagcct ccggaagata atcagagaat     45300
     atttgcgatt gatttggcca gctggtcttc gagaacaggc ttcgcctctt caaatttcag     45360
     gttaaccttg ttcgcactgg agaccacacg ggtctgatat ttatgctggt tacctgtttc     45420
     agtactggtc tgaattttcg cacctgaagt gccctgacgc agggcggcaa cattatctgt     45480
     tgtcaccgtt gtcttagtac gctctgcaat ctgcacatcc gtgatcatgg tatagttcac     45540
     atcttccacc atcgcatctg cagccatacc caccagacca gcagcaaggc ccacaccgag     45600
     tgtggcaccg gcagaattgg aattatatcc ggtaataccg gcacctaacg ctgcaccaac     45660
     agctgcgcct tcataaccac ggttcagcca tccctgagac tcccgcagat ccatcttatc     45720
     ggccttcagc acattcgcct gaatccagta gtaggcttta tccggagaag tcaccacctg     45780
     ataccctttt gctttcacag catcagcaat tttgccctgc agcccactca tgtctttatc     45840
     agaggtgttt ttgatctgca gaaataccgt gcgttcgctg gcgggttcaa gccagatggt     45900
     ctcactcatc tgggtcttca cctcaaggtt acgcttcttg attgctgtgc tcatcgcacc     45960
     acaccctgaa agggccagag tggaactgac cagtgcaacc atcatcaatt tttttgtttt     46020
     catccaaaat atccttttaa ctaacagact cttttttgaa cagccctatt actgaggcta     46080
     tagctgagag attataacga tttatgtcta tagcataaat aaagaaaaag attataaaca     46140
     aagcaattaa taaaaactca tataagagtg tatgggcaaa tgaaaccatt gaaaaagcaa     46200
     tcaaaaatga caagatataa gttttgttct tatcatacat aaaagatata actttcgact     46260
     catctctgaa tttttcaggg atagcaagat acaacatcat tccattagta atggcaacaa     46320
     aaaggataaa acccattacg ccactaaaac atatatcaaa tccggcatct cggatatcaa     46380
     ctttatctgc cagcaaacga agaaatgttg gccataataa aacccataaa aacacatacc     46440
     cccctggctt tatgacctgt aataatggcg ggatattaac cccctctaca gagagtacat     46500
     cctttagttt ctgtgtctcc atttttatat catagtgagt gatcataatg gccccttcag     46560
     tcgttccttt ttaccatcaa tcattttttt cacagcctct cctgatggct caggtattat     46620
     cttttgactt tctcgctctt cattatattt attattctga gataatgctt ctgttttatg     46680
     gtgattctgc agttcagaat actgtcctct tacaatattt tcctcgccat gtatgctgtt     46740
     ctgagtatca cctatattcc ctttatattc tgtgaccata ttatcaacct gatgttttac     46800
     atcattacgg atattactgt cctgtgttct ttgatcaata atggcctgat gcccctgatg     46860
     gtcagcaata atattctggc tgccaccacc cgaaggtacg ctctccattc ttttaccaat     46920
     atcgccacgg gattcacgcc aggcattatc aacaccaggt tgtacctgtt cttgcacaaa     46980
     agaccatgcc atcgcccgac ggcgttctgc aatctccggt gaactggtgt ttgtcagaat     47040
     agcttctgca tcctgcggcg cgtgtttcat cacatactgt gcaaactgtt gcgacaggtc     47100
     ttcactcatc tgcccactca tgctttcagt acgggatgcc atttcagcat attcatggct     47160
     gcgggtcata ttcgtcgtgt actggtcgta actctgtttc gctgagttca gggctgcaga     47220
     caactggtcc acgcggaaat cggcattatt gtcagtatgg cttccggatt cactgacttt     47280
     gcgactggta aagtaatcgc tggcctcttt aaagtcctta ctggctctag cgtcaatatc     47340
     atggcgagca tcatgggaag ccctgctgcc actactggct tcatgtgagt ccagatcact     47400
     accgtcaata ctggctcgcc caccaacctt agcgccaaca tcaacacgca caccaaaaag     47460
     gctgggcttt gcatctaatc cggcatgagc atcaccatac aatccagctg atgcagtcgt     47520
     acttctcgat gccagttctc ttgtcgcctg ctcattactg atattatgcg ccttcgcata     47580
     gctttccact gcactgcgca tacggctgga catcatggag tcctgagcac tcatcgtgct     47640
     gtcagcacca ccggtgacag aatcactgct cccccggtta gaaccaaact gactgagcgt     47700
     gttccaggca ctggcaatac tgctgctgaa cccatgcagg gcactttctg ctctgttcga     47760
     tgcttcccgg gccatttcct gttgtgccgc cgcaatctga cgcgttgcat tgatgccgac     47820
     cggtaaccgg gacatcgctc cgcttgcatc catcaccata ttaccgtcac gggtctgtgt     47880
     ggcggttgcg ccactgccgg tctggtacat catctgacca aacgacgtgg tgctgttggt     47940
     gctccagctg aagccgttca cgttctccgt ctgcatgttg ccgtaggagt aattaccgtc     48000
     aaccacactg cctgctgcac tggcggtcgg gctgatagca gaggaagcga aatggctgta     48060
     cacactggaa aatcctgccc cgagccccct gaccatcatc caggataatg gcgggatcat     48120
     catggaaaga tacccggcag tggaagccag atcggagtat ttcagctgta tctgtgaaat     48180
     ttccgagagc accaccggtg caccattctg cttcgcataa aatgtcatgg cgctgttcag     48240
     aatggcgtac aacattggcc atgactgcaa ccacatcagg gcaaacacat agcctttcag     48300
     gacggacagc gtcagtttgt tgaagacagc cgccagtacc aggagcggga aaataccgat     48360
     ggcgatcccc gtcaggatgg tctgcgtcat gggcagtgtc cgcatcgcca catgaccgat     48420
     ggagacatgt gccagacgtt gcttctccat cgatgatgtg gtggccagat tcaccaggct     48480
     ggccgaatca ccattacgtg cggcataact ggtgatcccc tccttcagcg cattgatggt     48540
     gacattctgg cggatgatct ggctggctga tttacttgag ccatagaagt aactgtaact     48600
     gtcgccaatc agcgtactga acaacaggtt cggatcaggg cgtccaccaa atagctgctg     48660
     ggcataataa tgccatgttt ttccgccact ctgtgtgtcc agattcagct tgtctttcag     48720
     cgaaaccgac gcgtccttac aggtcacgaa attattattg ctgtcataaa cgccccgcag     48780
     cggactgggg cgggaaaaaa tcagcgtgta aggatcagcg gaggccatca gttcctccag     48840
     cgtgtatttg tggttcaggt aaatatcccc catcacgcag ttctgcacat aatcctggaa     48900
     aagattggcg atttccggat tacgggacaa aaagtcggtg ctttttgata ccagttctgc     48960
     gccaaacagc atccccgttt tgctgtaggt gacactgtcc ggttgcgtga agatcatctc     49020
     gtaactggcc accattgcat gcccgatacg ggtcgtcagt gaaagtggca tcgccagtcc     49080
     gaccggcaca ttatccaccc ggtgaatttt gaccaggtca ctgttatcaa taatctgcac     49140
     cgatgtgcgg acattaacca gcaggctgat aagcacaaac acggccaccc agcccagcaa     49200
     atccatcacg ttgtgccgct gtacccacat tacggccacc gctagaacag acaatgtgag     49260
     cgcaattttt tcaatggaat cccacgtccg ggtccccata aaggcggcaa tggcattcag     49320
     gttattccgc aaccactcac caccggcaat cacataaact tcattcacag tgtgctccct     49380
     ccgaagtgat agttgttctg gtaacgactg agcatgcggg cggaaagctg ctgacgcatg     49440
     tagctcatct gacgatcgac aaccagcagc gcatcctgct gtacctgcac ctgtgactga     49500
     aacgccgcaa tctgccgggt ggcatcattc atgttgtcgt taatatgctc tataaccgct     49560
     tcgtcataat ttcccgtggc caccatcgcc cgggcctgct gtatcagctc ctgaatgtac     49620
     tgcagcagga tgtcgtaacc gatatagtcc gtcagctggt aaatcatgct gttggaaacg     49680
     ccgagcatct gcgggtcaac cagatatttg aagacgggga tggtggtact ggaaataaaa     49740
     cctttttcct tgtcatccag aggcgtgtca ctgaccactt tgttctgaat gctggccaga     49800
     agtttagtaa tctgagactt cagtgcatta tcccggctga tggtcaccgg tgtgtcagcc     49860
     accactttca ggcatttatc agaatcgttg cagtgataaa tttttgctgt gccgccttcc     49920
     atcatggctc ggataattga gcggtcagag gttctggctg acagcggtgt gatttcgccg     49980
     ttgggaccaa acaccagtga gccggtcagc gtcatcacaa actctttcag ctctttgttg     50040
     ccgtcaaaca ttctgttttt ggaaagcgca ttccacatga tgttaatgtt tttggtcacc     50100
     cgctccttat ccttgtcgct ggctttatcc ctgacgctgt cagatttacc gccaacggta     50160
     catccctgcc gggaagccgc ccagtcagca aaaatattgc tctcaccggc aatgtcctga     50220
     cagactttct gctgggacac ctgcgtccgg gggaaaagcc cgccgataat cccctgtgcc     50280
     gcctgacagg aactgaggtt catactgtta atgtcgcttg ccattttctg cacgaagtct     50340
     tttgcggttt ttatttccgg caccgttgtc tgcagggcaa ggtcaaaaaa gtaaccggca     50400
     gcattactca taatctgctt aacaaaacgc tgcagctgct cgccattaat aaaactgaac     50460
     gaaccgagat aagcgtcgat gccgccacat ccggcattga tatccggcag cgtcatggaa     50520
     atcagctgaa catttttgac ctgagtacgg gcatacaggg agccgccgta agcatagccg     50580
     gcagcctgcc cctgccagac gcccggctgt gtggtattgg aggcgaagcc cagcttgtta     50640
     aagaactgat tcatgtcgct gttcacatcc gctgacgctg caggcgtcag cgtcagtaag     50700
     gcggcacaaa gaataaaaag aggcttaatg cgaaacatta ttgctgccct cccttaatgt     50760
     gttctcccgg cgcatacggc gtttcagcag gagtatcatg atatttctgc ctgataatgc     50820
     acataaaggc agcagataac ccgcaacaaa aaaaaccgga tgccagcgcc cataacgtac     50880
     acggaatggc atacatcagg atgttccaca tataacgtaa gttatttaac tcagggtcag     50940
     ctttccacga atcaatacag gtatcaaaaa taatattcat aactgtccat aaaacaattc     51000
     cggcagtcag gaataccaga gataatccag catacctgtc agtaattctg gaaatgtatt     51060
     tataatctcg ttctgtactt ctgattttga gttcaggatt atttttattt tctctcatta     51120
     taagttccct ctgatatttt cgatgattca ttcagaccag tcatgcggct gtaatatatt     51180
     tcagacaccg aaatccatcc cacaattgcc cccacaaaaa acacaacaga aacagaaaag     51240
     gtaagactca gcgaaacgac aatttctaca gggctggcgg gataaaaaag cccctgacgg     51300
     ataaagggga tattcaggct gacaattatt cccgtcacga tgccggatat tccggcaatg     51360
     agtaacacca cctgcttatt tcgcaccttt ttttcctccg tacatctgca gaacggtatc     51420
     catccgcgcc ataaaaccgg cggcatccgt tgccccctgt aaaagcggta atgcctcaag     51480
     cgtgttgacg ttgaccagga aggtggtcgg tgtggccacc gggatattag ggaagaaggt     51540
     ctgcatcacc tccggtggca ccggcaatgc ctccggaaag gcggtatccc cctgaccatc     51600
     cagggtgtag ggaaaaacgg aaaagccgta ctgctgtgcc agctgtttca gtaccgggtc     51660
     aaactggtga cagtaagggc aatgcccctg cataaacagc accaccttcc agtcggccag     51720
     gttaacctgc ctgccgttgc tgaggcggaa ccagcgggga gccggctttt ctgtcctggc     51780
     tgatgtgtct gctgccggtt gtgcaggctg cgcggccatg ccctgcggat tccagagtcg     51840
     ttcaatttca tcccgggtgg aggcctgcac acctgtgacc atcatcaaca aaatgaccgg     51900
     cagtaattta gtgagagaca tgtccgccct cctgctgctc tgccatcatg gcctgttgcc     51960
     tggcttccag tgcctcacgc tcttcccggc tgacacgggc aatccatgca tccagcacct     52020
     ggtatgcgcc gaacagcaca aggatggccg caatcagctc cgccagaaaa aaagccatcc     52080
     agggtttgct gtaaacaaga cgggcgacga tatgaaacca gacacccagg gaaaataccc     52140
     acattcccgt aatatcaagc cggggtaaag agaatctgcg tttacttatc atgttaaact     52200
     ccggttatta tttacatgag agtattcatg tctgtaatat tcgcgtttgt gtgatattaa     52260
     tcagaggtac aaatggaaaa gcgatctttt aaagaaaaac tggaaataat cagaaacata     52320
     ataagagagt cgttactggg aaatgcggca attattgcgc tgatatatgc agcatcacat     52380
     tcattaccgg tcaatgactt ccctgactat cttgtaataa gtttattaag tatcgcagca     52440
     ggcatcgttg tattatggtt attttcaatt atctatattt atttttgtga gctattcaga     52500
     agccactgga ttgcggtatg gtttatcata tggtcttcag taatcaacct cattattttg     52560
     tatggttttt atgaccgttt tatatgactt agcctgtcat aaaccccctt ataaaaaacc     52620
     acatcactcc ggaccatacc gatgacaaca caatacagat aaatattctt ctgaacctgt     52680
     cgaagctcgt aacgtccggt aatgcggccg caactattga aacaaccagt gctgcgccct     52740
     gactcataat tgcaccacac agaaaccaga gactggcggt aagcacatat aaacacgcga     52800
     tattaataac aaggaaaacc agtgagctca ggagaaacat tttcctgtca ttacgctcag     52860
     aaaagaaata accggcaata atgacaaata ttaacagaac aacacctgta aacattttca     52920
     aataatcttc actcataaat caaattcgcg attaaaaatt gggtttaaaa tcttcagaaa     52980
     cgttcaggaa ctgttttgcc aggtcgtcct gcgaaataaa gccgtatgat aacgggcgaa     53040
     cactgccctg tttcgggtca accagcatca tggccgggaa atatttcacg ccgaggcgct     53100
     gcgcctgccc ctggtcagtc cgggaatccg gcaacagcgg attaatcacg ccatccacgg     53160
     aaacgggaat aacactcaga ccatacgtat cccggaagcc attaatgacc tgcaccagtt     53220
     gcccgtcgat ggggtcctgc ccccggtaaa aaaacatgat gccgtagtgt tcagccagtt     53280
     tcgcaatggc ctgtcgctgc tgcgcctggt ctgctgccag ctggttccgt accgtgccgt     53340
     tgtaatggct gtactgcagg ttatagtcca gttcaggatg tgccagcatg gcctttctgg     53400
     cgctcatggt gaaaagcccg gcctgctgag tccagtaatt ttgcagccgg aaatatttca     53460
     caaaattatc cacgccggga tacagaatgg cttcgtacag cgcccgcttt gttgccgtct     53520
     gcagtgcggc cagtttctgc ataatatccg gttcctgacg gggggctgca ggtacaggtt     53580
     tattttcttt ttccttcgga tttattttct cgttatacca ctgccagcct gcatcttttc     53640
     ctgacgccgg aaaaataaag cagcagagta acagtggcag taatgcttta ttcatcttca     53700
     ttcctttcat cactttttct ttcatcaggt ttctgcaggt cagtcagggc agaaaaacaa     53760
     aaatacagaa taaacaggag cacaccggag taaaggataa cgaaagcagc ggcaagcatc     53820
     ccgtctgccg tggtttcttt taccgtatcc cacgaccaga taattaccgg agaaatgaca     53880
     atcgctgtaa tcaaaagccg gataagaaaa tcaataaaac ggttcgacgt gaatatgact     53940
     ttcatcattt cccccggtta ttttcccata ccttactgtc ctgcctgttt cagctggtca     54000
     gcaatctgct ctttcacttt ctgcgtcaga acgccactgt ccgggatttt ctggttattc     54060
     atcaggtctt cgtagaagtt agtgaaatcc agtctgttga actgaatttt ctgcagctca     54120
     tcaaccgtaa tcccccgaca gtcaggatgc ttcgcactac caaaactgat acgcaactga     54180
     ccgttgcgcc cctgctgctg gactatctgc gccagcttcg aatcaaactg acagtagctg     54240
     cgttttttct ccagacagac acccagcact ttcttcgaac agaactcccc gacgctgacg     54300
     gtcagtttgt ttgattttgc tttagccagg gccttttcat cactgctgca tttggccagc     54360
     ccgatatcct gtccccagcc gctgtcctta cagcagttgc tgtatccggc tgcagccttc     54420
     ttacaaaatt tcgcctgacc ggtgaaagca cggacatcca ccccgttcag cgccgcaaca     54480
     tccttacctg ctgcggccag tgccgccagc tgagaaacgg cttcggcaaa atcattactc     54540
     tgcccgctct gagccttatc gcattcgcca tcgagacaga atacgtctcc cccacagacc     54600
     atcactttcc cggatgtttt tgactcacag gagtacgtgg catattcatg cagacaggca     54660
     ccttcttcgg agtaaaaggc acactggtgt gacaccaggg tacaggcagg attgtcggtg     54720
     taggtctgac aggttccctt gtctgctgac tgcgtgacat acgtgtcccg gtatgcccag     54780
     cagctctggt acatgctgta tgactgaccg tctttcacca gcgtcctgtt cccgccagcc     54840
     tccgtacatt ctgtttttgt cagtttcccc agctccttgc tgaacgggca gctttcagac     54900
     cagacaacat acggggtgta cgaggctttt tttaccctga caaccagacg cagcttcatt     54960
     gccgtatgac gtttgaattt tgtattcccg acccggacgg ggtgagatga cgtaaaggcc     55020
     acaccggcag tcagtgtttt ctgtactggt gtaaatgagg catctgctga gtatttggca     55080
     ttccagctca gtggggttcc cagtactgta attgtcatag gtacactctt ctgcaagtaa     55140
     gtacgactcc agctgtaatg cgcatcgaca atttcaccgg taacgggaga ggtaatggag     55200
     acaacatact gaccattcac ttcacgtgca ggtagctgac tcatttcata ctccagcgtc     55260
     cgggtttccc atgtggtact cccctgcagc tccatacggg cagttcgtgt gcagtactgc     55320
     tccacctgta aatcccgctc acaggtgtaa ttcgtgtatt cactcctgct aatctcctgc     55380
     gcactgcact gctgcccggt gtttcccaca atgctgtcag cccggttcac cacatccctg     55440
     ccggtctgga taaacggtgc atccggtgaa agaatgtctt tcggcttgtt catgaatgac     55500
     tctgtaatgg tttttccggt ttcaccggtc gcccattccg tggtgccgtc atttttcagg     55560
     ccgccatccc cgccggcagt cacgccatcg taatattttg tctcgtccgg attcgcgtta     55620
     tagccgggga tactctcctg tggcttaaag ccctgaatac tgctgcttcc ctgccctttg     55680
     atctggtgag caaaatcaga accggcccgg taatcactgt tgctgtcagc ctgtgccatg     55740
     ccggcaacca gagccagtat cagaggtaaa atacgtttca tttcccggaa tctcctttcc     55800
     ctgccagtaa atcatgagcc acctgccggc agtcacccgt ggcggccact ttctccagcg     55860
     cctggctgac ccgcaggttt ccccggatga tgtcgtatcc ctgactgcag aacaccacca     55920
     gtgcccgtac agtgcgaatg ccgtactgtg aaaacagcgt cgggtcgatc tgaacaccat     55980
     cagtcgcgcc gtctttcacc agggacaaca cagcttcagc ggtggtcttc aggtcattgt     56040
     tcaccatgcc ccgcagtgtg gccggaatac cgtagtgccg ggtttcgccc agcattcgtt     56100
     tcagcccctc ttcgggaatg gaaaacgaca caaaatacag agcaccctgc cggggtttcc     56160
     cgtcctgcga agcctgctgt ttacgaacca gctcatccag aaaatggtta tctgaacgct     56220
     gaagggggtt ttccagcacc tgtttctccg cccaggcttt cagctgatgg tcaggttttt     56280
     cacgcagttg tctgcttaaa ttttcctgct gtttcaggaa ctggcggttt tcaggagtgt     56340
     tcacgttttc tgacgccata accgccccgt tcagcatcat cagcagtgct gccagagatt     56400
     tcatactcag cttcatcatt cacctcacag gaagacacag ttacgtttac gccacatcag     56460
     gtagccgaag tttttctttg tattgggcgg atttttcccg gtttcccagc gggtcacact     56520
     gcgcccgaac gggtggcact gtccgctgtc cgggtacata ttcaccatct ggtaacgcca     56580
     gcgttctttg ggcaggattg gggacggata ttcattacag acggcgttat ttttcccgat     56640
     ggtttccata atcatgccct gacggtgcag cttgaacgcc atgcgttcac tgaccagcag     56700
     ggaggactgc aacggactgg actcattact cacccagcca ttgaacgggt acatacttcc     56760
     ctgcgaaccg gcacaccaga acagagcatc gatgggcatg ttaaaggcgc tggcaatggc     56820
     atctgcagca caggccccct gtgctatcgg attggcaaag atgacggctt ccggattgag     56880
     aatggtggcc aggctgctgt ccgtccaggt ggggtcgatt tcagaaagat aagcgatatc     56940
     caggtcacca ccttccagac agcccagcga tgtgatgatg ttaagccagt acgtcagcgg     57000
     gtatttgtac cagtgaacgt gatagaacgc cccgttcacc tgcttctcat cttttttcgc     57060
     cgttccctgt gccgttttac caaaagccgg caggctgaag cccaggttca ccatacatcc     57120
     cggtgaccgg gtgacgtccg tcagcgccat cggctcccag taaccaatgg ccagtccgat     57180
     acgcctgaac agcggcggcg gtgccggaca aatctgaatg ggcatcgacg ggttcgccgt     57240
     gtcggggacc ttaccctgac tgactttgat actgcccagc gagagcggga aaatacagct     57300
     ccagcagata tccgtgatcg ggtttacaaa acgcccctca caggcagaat ccgcagacgc     57360
     tgcagggaca tgaccggcga gaaggaataa tatcagcagc cacaggcttc gcttcatttt     57420
     ctgccctcct ctgccggaat aaattccacc ttcaggaagc gatcgccggg aacggcgctc     57480
     acccgtgccg gtacctgatc gatgccgagg cgctggcaga gcacaccgtt ctggtcaaag     57540
     taaacacggc tgtccagcgc tttctgcatc tccgggatac tgccctgcac caggataatt     57600
     ttgctctcca gtgtgggcgg cgtctggcgt ttcatccagg ccacctgcgc cggatcatcg     57660
     ccattgatga aatacagcgt ctggttaaaa ggaacatact gcagcggatt catcacttca     57720
     ccctgacggg caaacacccg cccttcgtta tcccggatat ccgcagccag tctgacggac     57780
     gggtcaaaca accggctgcc gtatttctcc gtgcgtccga taccgggcac ggcagggggc     57840
     cgcagactgt tgcggatcac ccgctcctta aaggcatcca ttttccggcc catctcaccg     57900
     gactgctcca gtaccgtcag gcgctgcatg atcaccgtca gcatgtccag ctcctttacc     57960
     ggccacagat cgccccaggt gccaagatcg gcggcggcca cactctgccc ccataccagc     58020
     agggcaatca gcccccggca tctcatggtt ccgccctcat tcgccgggca atatcctgct     58080
     ggatttcccg ggtgatatcc ggtgccccct gtaccacagc aggcgacacc agaatgaccg     58140
     cgtggtgttt ctgctgccac gcctgcaggc tggcttccag tgccgtgtta aaacgcgctg     58200
     aaagggcttt tgactgtact tctgacagtt gtttctgact ggcgctgtca aaaaacgcat     58260
     ccacggtctg tttcatgttg aaggcggcag tcaccggtgc gttcagtctg acaatgccgt     58320
     aactgatggc tgcgttcagt aacaccattg ccaggcatcc cggcaccgtc caccaccagt     58380
     ggctgcatcg gggggctgta acgtcagtcg ttttttgcgt tgtggtcatg caacactcct     58440
     gtatttctca tgttcttcca gccaggcttc cagcgaagcc atctccggcc ctgacttctt     58500
     ccacgccagc tgccacaccg cctcatgaat actcagcccc tctttacgtt tctgctgcac     58560
     aaactcaaaa tccgggccgt cagagctgta catggcgcgg cttaacgggt ccacaaacag     58620
     acgatgccag gaggaatggt tttccacctg cagcaggaag gagctgaacc actggtctct     58680
     ggccgcacca aacttaccaa tcatgtcgcg ctgcagtggc tggaactggt ccggatacag     58740
     ctggttgtat ttcgcgaact ccttcgcact ctgtttgagg ataattttgt aggaggagtt     58800
     accccatgcc gcgcgggcag cactggaggc cttatcagag tcaaagtcga cgatgttctg     58860
     tgtgatggtg atataggcac cggtatgacg gcgggccgta cggtagcctt tctcaataaa     58920
     ttcaccgacc ttgtgatttt tgaagtccag cagacgccag ccttcatcaa taacgttcag     58980
     tttcttgagg ttacgcggtg tgcggtacat cctgttctcg atgtagataa tcagggagaa     59040
     catcaccgca accagcagtg acggacggtc ttccagtccg cccagctcca gcaccaccat     59100
     ttttgcgtca tcccgcaggg acggctcatc agagttaaaa tactggccgt aagtgccgtt     59160
     ggcagtgtac tggtcaagca gcacaatcat ttcgtccaga cggctgcgga tagtcggtga     59220
     ctcggcatac tgctcgctgt cactggcgtt tttcaggaaa tccaccacgt catcaatacg     59280
     tgctctgttc tctttggcca gccaggaggc tctgaccgcc tgcaacagca gaccttcatg     59340
     cacttcatcc aggttaccgt tggggctggc catcactgac aactggtcac ggacacgctc     59400
     cgctgactgg tcaatatcgg tgatgttcgc aaacgggtta aaacgcaggg tttcaccgtc     59460
     cagatacacc ccgcccatgt tctcacacag agacttgtag ccatccccca tgtcgaacac     59520
     cacggcaaag cctccggagt ccagcacgct gcggataagt ggctgtatca gcccggtttt     59580
     accggccccg gaggtgccac agaccgccat gttgtagttg gtgttattca tcccccggaa     59640
     gaaaatatcg ataaacgcca gctggttacg gtaggtgggt gccagcagac ctgccggtgt     59700
     cagggggtta tccgccacta acggcatcag gttggcaaca ttaaagctct ctgcgcgctg     59760
     aaccactccg gcctctttca gctgtttaaa cagtcctttc ccggccataa agggcaggca     59820
     ggtcaggaaa ttgcgcatgt ggttaaagcg cggtgaaatc agctcaaaac cgtttttacg     59880
     aaagctgttc aggatgtcct gctccacttc cagcgccgtt tcattattgt ccttgcagaa     59940
     tgctgtgatg ttgaggaagt aggacaccac ggaggactga ccggagccca gccgctgacg     60000
     cagttccccc cactccttcg cctctttctc cacggacgga aaccatttgg cataggaggt     60060
     cttcgacttt ttctccaggt ccatgtactt caggttggct tcgctgtggg ttttcacctg     60120
     gtcttccacc accagagtca gcgtcaggat gaacggacag gagatggaca gttccgagtt     60180
     cagcaggttg ctgtagttgt cggccatgtt ccacaggaag gcgatttccg ggttacgggc     60240
     cagatggaaa ttcaggatgc gggccgtgct gttcctgccg ttctcacgta ggcccagcgt     60300
     caggtaatca gcccggactt tcagatcaaa actgtcctcc acacactgat aattcagatc     60360
     agaatacggg tccagctgac gtcttttcgg gtacagggag tccgggttat ggttaatcat     60420
     cttcccgaca atatcgataa aggcctgtgc atccaccgtc tgtgtggtga tactggcccc     60480
     ctgtaacgac gtccggatga ttttcaccag gttttccatt tccagaatgt cggcccggct     60540
     ttttttcttc gaaggagaac agtacgagat aaacacccgg taatggcgca gggtcagggg     60600
     cagattcatc ccctccggca gcggaaactg tgtcgctgcc gctttcatat aataggcccg     60660
     ggtaatggcg ttaaaccgtt cagcctgttc acctgaccag gagaactcac gcagcccgta     60720
     ttcaatcctg tcaccaacca gctgactgga catcagatgg atacacaacg gaataccgcg     60780
     cggcagtttg gtgcgcagca tgtgatcgag ggcctccaca atggactcat tcgccccatt     60840
     gatgggaatg gcttccagca taaagcccat cgtggtgtca ttcatgaaca gaccggattc     60900
     ctggttgtaa tcacggtacg gcagcagacg gctgaactgc gggaagctca tttcgcccag     60960
     aacttcattg gcctttgcgg attcgtcagg cagtttcagt gctgtgacga gggagttaac     61020
     cgcctgagtg acggcctcaa gtgggttatt cacatgaatt ccttagttga aaaataaagc     61080
     gagaaatgcg gtagccatga agggaatacc tgtaattaac gcgccatttc ccggcgcata     61140
     tacaaagatt tctgttttct gaatatccac tcatgttcat ccggaattaa atcactatgt     61200
     tctgcgactg acttatgcat aatgttttct ctgtctttcc tgatacgcct gacattcaac     61260
     gcacaacgtc acaccgggaa atattttccg ccgggcttcc ggaataggat ttccgcatgc     61320
     ttcacagaga taaacaggaa taccatgagc atttattttc tggcgtatcc ggtttattcc     61380
     tgtcatggtc agttgttctg tcactgaata tgcttcatcg gcttcatcac tcacggaata     61440
     ttcctcccga catgttctga cacgctaccg cccatccctt ttcacgcaca gggcactcgt     61500
     tttacaggca gattttgaat acagaaagcc cgccggcatt gccggctgat atacaacttc     61560
     agggccagtt aattaatacg tggttttccc cacgcagacg gtttaataac aaaaaacacg     61620
     ctggatggct gatgataaac atcctggtta tcaatataag gcgctatcca taatgctgcc     61680
     gtctgctcac ccgttcttag cggacgagga ggtgttaccg gcgtaactga actgaccgga     61740
     acaaccgttt tcacttcccg ggcagcggta aacagcgggc gaggtgccag cagtttctgc     61800
     tccggatgtg ctgtcaccgc aggtctgctg ccggacggag tggtcgcggt gacggtctgc     61860
     accggcattg tccggaagtt cccttcagcc aggcgcggca gtgatgccgc aaccggcttt     61920
     gcttctgagg actgctccag ttttttggcc ttctcattgg cctgctccat cgtcatacag     61980
     gtatcggatg tggtggcgtt acactcaaat tccgtactgg ttccggcaca gccggaaagt     62040
     aataaggtcc ccagcagagg aataaagaaa gaaatctgtt tcattgtccc tcacctttct     62100
     catcgcagtt cacaaaatcc ttcttcaaat ccctgaccgt acaggttttt acaatgtcag     62160
     gattttcaaa aaccgtactc cgtgatgatt tataaacata tgccacaatg cgtttcccac     62220
     ccgcatcagg ttctggtgca ctgacttcac ataacggagg tgttattccg gactcataca     62280
     gcaccggata atttattttt ttgacgctgc catcagaaac cagcttattc atcgaagggc     62340
     tccttatatt tctgaataat tctatcgatt agttctttca ccggaacaga ttttccgcca     62400
     ccggattgtc cggcaaccac aatatgcccc ggagaagaaa ataaactcat cgacataccc     62460
     ttcttcatca caccgacagc agtcatatta aaattgtccg gcaatgactc agaaccgaat     62520
     ttctccggtg caggaagtac gattcttgtg gcgcagttac tgagaacagc atgcataaaa     62580
     tcatctgaca cggtttgacc cggcacagag agggctgtaa taacattaat attacgcatg     62640
     ttcattttta tctccgttgt ttctgtttgt tctgtcatga ggaagataaa cagggcattt     62700
     cctgattttt cccggcaggg aagcgtcttc cgtataaact tccttcagat gttcatctgc     62760
     ggttaccacc cggatacatt tcatttttcc gggtcgcacc ggatatttcc cggtgatcgc     62820
     tgccagcgag acatacatca gtgccagtgt tgcccataat gcggtgacca gttgcatcag     62880
     tgaccggtca gtctccctga cataatctgc agcatcagcc gcgcggtaat ggcagatatc     62940
     ctgtatttct gatctgcctg aagaatcaga ggaagaaaac cagcattcac tgaccgggaa     63000
     ctgtccggca ggtgctgttt gtcttacgaa gttaatctcc ttaaccagta atttccccgg     63060
     cgtggtgttg tccttccata aaacaaacag agccatcagg gccattgtgg ccagtggcag     63120
     aatgacggtg tacttcagac accagaacag tcctcgcaga acccgggcga caacataccg     63180
     ggcggcatgg cacgcctgac gggacgacat attatttgcc atcgttgccc cctccctggc     63240
     tgccggacat aaactgctgc ggattcaggt tgcccagctg cttcagcatc tggtcagtat     63300
     taaagccgtt aagatgactt tcagccgatg gcggaacagg aaccggactt tccggattgt     63360
     cttcttccgc tctgctctgc gtgcgttcca gcgccatctc ttccacggtt ttcagctgga     63420
     agccgtcctg gaacaccact gtcacttcgt tgcccgcacc aatcggtatc accgggtgat     63480
     actgttcggc acgtttgatg tagtagtcac tgagcgtctg tgcggctttc gatgcgccgc     63540
     caccgatacc cattttcagg acatcaccag ccccgtaagc ggctgtggca cccagcccga     63600
     cagccggctg ggaggcgcgc tccattccct gaccgatacc gtcaacaaat cccgcgcccc     63660
     atgcccagcc gaggattttg ccgttacgca tcaccacttc gcccttgata ccgtttttac     63720
     cccggaagct gacatgcccc ttaatcggca tatcaatagt tttgccgtcc ttcaggcaac     63780
     tgatattgcg ggtgcgtaca atggcacgct cactggacac atccccccag gcttccagac     63840
     ccacaaaaca tcccgttgcg tcatacgtct tgctgttcgg catttccacc aggccggtga     63900
     tacgcagctg catcggcacc gtggattcat taccggtgac agaggcattg gcatccgccc     63960
     cttcaatcag catggctttc gcaaaacttc ctgacggaat gtacggcagt gatggtccct     64020
     gttttccctc attacgggta aacaccttac gctgtatccg gttaggcacc ggcacagact     64080
     ggtacgtcac ctgtggtggt ggcgtgacac cattcccggg ataaaacgcc gtcggcggtg     64140
     gaacagcaac gctgccctgc ggcgggaagg atacgggggt gtttcctggc tgtggttcgc     64200
     cttccgggcc gggcggtgag gcaggcatct gcggtacagg ctcaccggtc gccgtgacgg     64260
     gattagcacc cagggctttt acctgctctg ccagggcggc attgtcctgt cccaactttt     64320
     caatacgacg ctggtcatca ccgcgctgtt tgttcagaac atccagctca cgacggattt     64380
     cctcatactg cttctgcatc tgcgctgccg tcacctgcat ctcggtggtg gcatgctgac     64440
     gcaccttgtc atcaaaggtc gtatccacca caccggtcat atccggcaca ggctcctgtt     64500
     cagccacggt ttcaccgtta ccggacatgt ccacatcaga cagatacagt gccccaccaa     64560
     tcgcggaggc tgtaccgaca accacaatcc ccagccacag gtactgcttg cgtttcacaa     64620
     tggtattgat actggccatc agttgccctc cccgtcacgg atgacataca catccatgcg     64680
     cgcacctgcc agtaactggc tggcaggctg gctgaacatc acggcacggg ttcccggctg     64740
     ccagaagtca ctttcccgga tattcagggc agacagcgtt ttattttcca cggcaaagcg     64800
     gaccatcttc aggtgattcc cagtccatac ggcatctgcc actgaagaca gccccgccgg     64860
     ggcctgcagg gtttcctttg tcactgggac ctgataccag cctgcgggta attttccgcc     64920
     acggacggcc tggctgatgg tcacaagcag ggattcgtaa ggcgtggacg tttcccacgc     64980
     accggcttct tctccggttc cgcgcaggtc actgaccagc tgaatggtac gccccgcgcc     65040
     ttcacgggga acggcctgaa tggaaagatt cagaccacgt tctgtttcca gaatgaacgt     65100
     aaagggcttt ttgttgacgg tggcaaccac cacaccgccg gaggcggtct gctcattatt     65160
     ggtcagggca ccatccagac tgttcacggc gataatccgg tcaccgggaa cggtaaacag     65220
     attcgggctg gtattgctga tggcaatact ggcctgacca ccgttcacca ttggcaccac     65280
     ggtgggggcc agcgtaccgt ttgcggccat cacgctgcag gaaaaaaaca ggctgccgaa     65340
     tattattgcc gtattatttt ttctcatcgt ctgtttcccc gaaattatcc agccaggtca     65400
     ccccgttttc ccgcttcaga ataaggatgt aatgtttgat atcagtgaaa ggttttgaat     65460
     caccaatcca ggttttaagc acacctcgaa tttccacacg gccatactga ggccagacac     65520
     gaacactggt ctggaaaaag gctgagttca cgttatcgtt tttaatacgc ttcgcttctt     65580
     cagccagaat aactttcatc tggttctgtg cgcccgggcg gatatattgc agaagcgcct     65640
     gatgtgaggc atcgacggtt tctgatgaaa cattcagacg gagggcaata aatgacagcg     65700
     ccatctgctg taaataagag gcgtcggcac tgttctgtga cacggcaaag ggggcattaa     65760
     atgccattgg cgtcacggca gtgcgttgct cattctgaag acggtagtta ttcaccccct     65820
     gaatgacgtt aacagagagg ctgagaacaa taagcactga cataaatata aaggcgatgg     65880
     ccattacacg actggtactt aaacgggcac cgtgttccat ataacaatcc tggtatcagt     65940
     tctatttaat ccactgccgg aaacacgaat cgggaacatt atgaaaaata ccgcgcagca     66000
     gggctgttgg catataccag taaatcaggt cacgtaacca ggaactgccc cgcccttttt     66060
     tcagtttttt aatcccgaaa taaaccagaa ccgctgcacc aataccgaac agatatttcg     66120
     atgttgtgat accccagcca atacagattg ctgcggggat cagttcatcc agtggcaggc     66180
     caaaccagcg gctctggttg gtcagtgttt ccgggaaacg atatttctta agtttattct     66240
     cgtctcccga catcgtttta tttcctgtca gaggccaacg acggccatac ccacagcaat     66300
     aaatacagag atgatggcaa aaccggccag gaacttgacg tttttggtca tcatgtacat     66360
     gacagcaccg accagaactt cagccagaac aacccattta acaacactgg agtctttacc     66420
     gaaggtcgcc ttaaccgtgg tgttaccgct tgccatcagg tcctgaccac tgctgccggc     66480
     ggccatcgcc agctgcggga agaacatcat cagaacagca gccgggatca ctgcgcgagc     66540
     caggcgaagc atattcagac gagtgaattt agaaaaaaac gacttctttt tgacgggcgc     66600
     agaagcaccc tgaacactta aaacggcgtc catatgattc ctctgtttaa tattgataga     66660
     taaaaactaa agttctttaa atgttgactc gctctcttcg gtcacctccc tgaatatttc     66720
     ttcgttatag aaatcaggaa accgtttcag atgatctctg agacggatct ggacttctat     66780
     cgttttactt cttccactac gatttttggc cttaataagt cggttatttg tatcttcatc     66840
     aagatacacc gagaccgttc tgcttatacc gcctctcgcg ttacgcctcc tcactaaatt     66900
     cacctctgtt tcccgactaa taaaattatg attgcacaga aatcgtcgaa aaaaaaacac     66960
     gccaaaattg gcgtgcctta tttaacattc atttaacatc ataaaattca cgaattatac     67020
     ttaatagcga atctatttct cctttataga tacatgacac tctgaataaa tcaaagtgtt     67080
     caaaaaactc ttttattttc cgtttaactg gtttaattcg atcctcagat gctctgtctg     67140
     taatacccaa ttctctggca attgttgcgt gaccaacacc cagcatataa aaagagaaaa     67200
     caaccaatgt tcctggagaa agatcattcc atatcgttaa ttgaccagaa gtatttgtat     67260
     tacttacact ctgatttaac gcaaaaaatg gataatcagg aaacggatta atttgccata     67320
     aaacaacaga ttcgtcatta taaaaagaaa cattctccat ccttatctga tagatttcgc     67380
     catgaaaatt aaaacgacga caaaatgcag agccatgtcc aagagcctgg cattccagtt     67440
     caagtgatga aagaaaaatt tcaacctgca gacgtatata actctctccg gataaaggtt     67500
     tatcttctct ggaaaagagt tcaataaaag ccccattggc ataaaggatt ttccggtttt     67560
     tgttacggac acaaaccgga acgggagaat ttctgtagat attctgaacg ttaaggatgt     67620
     atttatttac agattgactg ttaagtggcc tttctctacg atccagcgca cacataggaa     67680
     cctccactaa ggattctatg gacagtcgat gcagggagtt acagctccct gcatcggcaa     67740
     ttttcagttt caatttttaa cgtggtatta accacgtaat taatatacta attatctgac     67800
     gtattgtcat ctttttgaat cataaaaatt cttatatttg aaccaactca aacttcattt     67860
     tcatttattc atcatcattt tttgggaaaa accggtccat ctcaacagac actttctctc     67920
     tgatatcgtc aaccatactg gcatattcaa acttcgggtt tccggataca tgaggactga     67980
     gagactcaat acctaaaatc tttgccaccg ttgactgtgt ttttacaaca cattcaagaa     68040
     gaagtttatt aaactctgtc tggttaaatg cagactcttt acgctccatc tgagcgtcat     68100
     atacacggag ccctaattca agaagcattg aagcagttcc tgaaaggctt atatctttat     68160
     ctcttgctcc ctcctgacga cgcttttcaa caatcatgtt aattttttca tgaacctcat     68220
     tactgatata cagatttact ctggccataa gacagtacct tttagattct gaaataagag     68280
     ttttatttta tctactcata gtatggtctg aaaaaagaag agcaccccta gcagcgcccc     68340
     taggggcata ctataaaaaa acgcacggcg ctgctagggg cggccctaat atatccaaat     68400
     gtttttcatg aaaattgtca gcactgaccc taacaagggt cgtcataggg tcgctatagg     68460
     gtcgctatag ggtcgtcaac gaccctattt aataatgtaa aataaattaa aatacattat     68520
     ttagaacata aactaatgat ttaaaaaaca aatcagcaaa aacttgtttt tgcgtggggt     68580
     gtggtgcttt tggtggtgag aaccaccaac ctgttgagcc tttttgtgga gtgggttaaa     68640
     ttatttacgg ataaagtcac cagaggtgga aaaatgaaaa aatggatgtt agccatctgc     68700
     ctgatgttta taaatgagat ctgccatgcc actgattgct ttgatcttgc aggccgggat     68760
     tacaaaatag atcctgattt actgagagca atatcatgga aagaatcccg ttaccgggtt     68820
     aatgccatcg gtattaatcc ggtaacggga tatggcagcg gactgatgca ggtagattcc     68880
     cagcatttta acgaactggc ccgctatgga attaagccgg aacatctgac aacagatccc     68940
     tgcatgaaca tttataccgg tgcttattat ctggcaatag cctttaaaaa atggggcgtc     69000
     tcctgggagg ccgttggtgc atacaatgcc ggattcagga agaccgaacg ccagaaccag     69060
     agacgtcttg cctacgcatc agatgtttac cggatttata ccgggataaa aagcagtaaa     69120
     ggtatccaga ttccggccac gaagaaatca cttccggaaa ttaacagcgt gcagaacaat     69180
     taatcttaca gacattgtca gataccggtt atgccgcaaa agcggcatgg aaggccacac     69240
     acaaaaatat catatgagtg acaatactca ctggccgaag ccccgcaaag cgggaaccca     69300
     tcttatatat actcggtaac tgcgcagcct cctgctagac catttttcgc gggcacaata     69360
     tttacagaca accggaaagc cagttgatgg aattgaggta tatcagacga cacagcgatg     69420
     ccgaagaatg ataatataag taaagccccg aaaatttttc ggggctttac ttatattatc     69480
     atgacttcca ctttctgaac tgttcggcaa tcacccataa cgccttgttg attcttatat     69540
     caccatcaat acctgtaatg gctcttgtcc tggtattttt cccggaggca cttcgccccg     69600
     ataatccacc ttttatcata ttctcctgaa cccgctgcca ggttgtccag agatcgttct     69660
     gtttatcctc ccaacgacgg ggagtaatta tctgttcagg cgtcactggc gttttatttt     69720
     catcttcata cctgaccatc agcgcggctc tgccaaataa atgttgctcg tcactgttaa     69780
     gatgaatttc tttcatcgcc tccatattat cagtgacctt atcaaagata ccgagtactt     69840
     catacgctcc ctcgataacc tgcccggcaa tatcaccttt atgtggaacg cggatttcgc     69900
     caaaattatt tccgcacacc aggccatttg tgcagacaaa acgaaaaatt ccggggatca     69960
     tctgataact ggatgaacca tcatgtgaat taagcaggat aatttcagga acttcctgac     70020
     cgttaatatg cccttccctg cgaagacgta acatatgttt actgtattcg cgacgtccca     70080
     aatcacgaac ccgactctga caggcaaaga atggctggaa accttcatca cgtaacttat     70140
     tgatgatatt gatcgttgga atatacgtat aacgttcact ccgggactca tgtttatcac     70200
     cggaaaatac cgaaggcacg aactgcatta attcatcatc cgttaaagga cgttcacggc     70260
     ggatggaatt ataccgacca aaacgggaag ctaatcgcat aacagctact cctttatgaa     70320
     agaataaatt taataaaaaa tttttccgct taatatcatc cctcctggtc accattaaca     70380
     agattgcaac aatcaggagg aatattcatc acatccggtc agcagatcgc ccggatatcg     70440
     aagccggcac gcttaatctg acgcaggaac tgtttgaagt gatcggcttc cgcaatgttg     70500
     atatggcgga actgcgtatc cacaccccgg ctgagcgcgt agctatagct gaaggccatc     70560
     ttttccgggt ggcttttgcg atattttttc agctcagtca ggctgctgaa ttccaggacg     70620
     tcccactctt ccccggtgtt tttttcttcc cggcaacaag aagcatgtac gacgcggtgt     70680
     taacgtggat atttcgggta ctcatcctgc tttctcctct ctctggtttt cagcccccat     70740
     catcttttga gtttcgggag ccgcggtttt gacgttttgc ggggacctgc cttttgttcc     70800
     ctccggtatt caccatcacc tttttgagaa ccttcgccgc aaggggcatc actgccacgg     70860
     ccagaaacga ctgtccgggg gcaggggctt aaacaggtga atggcaccgg acagaacaac     70920
     gggcagggac ccgccgcaac gacgtgaagc gcggtttgcg aaacggcgtt gccccttaca     70980
     tcccggcggc cttttgccgg gatgccggga gcgcaggcca cggcgcgaca gaggcggctc     71040
     gaccggaacg gtcgctgcaa gcccggggtt tcgcgtcagg gatggaagcc cgccagggcg     71100
     gagacagctt cgctggctcc gttcacgaca gcccgccccg cagggggacg cccggaaaag     71160
     gcataagcag gagaacaaca aaacaggcag taatcagaac agcagaaaaa agaagaacag     71220
     tagcaggaac aacaacatca tcagtaacag acaaatgaca ggtctgaaaa gacagaagcc     71280
     cacagcagaa cgtccgcgta atgaaagggg cggcgcgtca gcgcggcccc tttcagcgcc     71340
     accggcgcgc ggtcttttcc cggcgcgggc agacgggcat taatcctccc gcctgccctg     71400
     tgtcatcagg ctcgcagacg aataatcatc gtcggaacac gggtataagc aaacgtgccg     71460
     cacggcagca cctcgcggac atcagaaaac ggtaacagct tctcctgctg gcgcggcccg     71520
     ttgagacaga cggcgaccag cacgcccccc ggacgcaacc tgtctcttga tcagatctcc     71580
     tgatcaagag acttcatcac caggtaaccc tcaaccatat cctgaagtct gaaccagcca     71640
     tcccacatga ctacccaacc ggggcgaccg gtgcgtttgc tgtcatgcca tcgccccagt     71700
     ttcgccagtt tcagacaggc ccatttcagt gtcggcatct gtgacggaag cggttttcct     71760
     tccagcttaa cccacagcag tttccactct gtcggcgtca gtattttctc acagctgtca     71820
     ttttgtgttt cttcactgat accgccctgc cgcaggccca gcacccgcac cgcgataaac     71880
     gccttgataa ccaccatgcg ctcgaggtta tcccgggtct gcattcgcag cgattccaca     71940
     catgtaccac cacttttcca cgccttgtgg tattcctcta tcagccagcg tcgctcgtaa     72000
     tggctgacga tacgtcgcgc atcggcggca ctcgccactt tttctgacgt cagcagatgc     72060
     cagcaggcgc cgtcctctgc ctgctcccgg caacagacat acgtgagcgg gagcgcctgg     72120
     ccgctgttgt cgggattttt tatgctgact tcgctgtaac tgatgaacat ccgggcctgg     72180
     cgggctgccc gcccgccttt ttgcatcaca ttcagcgtgt ggcttcccgc ggttgccagg     72240
     acttccggca gttcgaagag cttgccgggt gcttcttcca gccggcgatt ctgtgctgca     72300
     cgcaccacga agcgctgccc gtggctgact ttataatgca ggtaatgcca gatatccgct     72360
     tcccggtcac agacagtgat tacccgtttc tgtatctccc ccagccgttc ggccatgcgc     72420
     tccgaagcct gctgccagcg gtaactttct ttttcttcat agggacgttc ttttcgctgg     72480
     tgcttaacac cgtaggtgtc cgtggcacga ctccagcgct gctgttcgat aagaccgact     72540
     ggcagggcgc tgtcgggggc gtacatcagg acagagtgag ccagcagccc gcgcgtcttc     72600
     gggttagtgg tggtattccc caggtcatca gatgccgtac tgtgactgaa gttaatggtg     72660
     gtggtgtctt ccagcgcgag gagcagcgga tgagcctcac atgcccttac agtggcggta     72720
     aatccggctt cggcaatggc ttgcggggac acagacgggt tacgtatcag gcggtacgca     72780
     ccttcaacct gagcagtgga ctgggatgat ttcacaatag aaagacctgc atgctgagcg     72840
     agagaagagg ccagtgacac aaggcgtcgt gtacgacgcg gatcaccgag acgggcatgt     72900
     ccaaactgct cgttagccca tgaataacaa tcagaaagta ccataacaga cccgaagaaa     72960
     atgaaatata agagaagatc aacaggtgag gaaaaagttc aaaaaatcgc tgccggggag     73020
     gaaggaaact accggatgga aagagtcccc ctaaagcaga ctgacagaca tcacaaatcc     73080
     ccgggtgggg atttgtgtat aagagacagg acgcaacagg gaaaaggccc gcaggatatg     73140
     ccggatatcc tgcccgtgac tgaacggcgg attcatgata atccggctgt aatactgcac     73200
     cggctgccat tccatgaagt cgccacactg taccctgaca ccgttaaaat tttcccgcag     73260
     ataccggacc agcccgctgt taatctccac cgcatcacac atggcccccg gcgcggtatc     73320
     ccgaatagcc cgcagtatgg ccccggtgcc ggcagagggt tccagaatgt gatctcggtt     73380
     gctgatctcc gccagcgtca ccaggcgctc acagaccggg gcaggtgtca caaaaagctg     73440
     agattcagcc cggattttag caaccggcgc gacgttatcc agccttgcgc gcatcaaccg     73500
     gatacgttct cttaactgac tgtgcatgtc attatctccg tcataccccg gggcttttcc     73560
     ccggggataa gccttatttc tgcgggattt ccgtaatttt catgtcggtg atatacacat     73620
     tcaccaggcg gaaattattg tccattgtgc ggcggtagcg gtatgccccg tggtcttctg     73680
     cttctgccac actgcgcaca gccttacagt cccggggcag ggcggcccac tgcgcctttg     73740
     tcatttcccg gaaaccttcc cccggatagt tgactaccgg cggacgcttc gcggcctgac     73800
     tggcgacggc agcctcttct gccgatggtg ctttgtagtc cgtgatgcga tcgggcgtca     73860
     ctttcatcgt gccgctgtac ccgaggaaac tgtaatttgg cgttgtgact gaactcaccg     73920
     ccccgttgct tttgttcacg cggatgatgc tcagccactc gccccggctg aaaacctgtc     73980
     cgcccggctc aaaatcctgt gtccgggtaa ccacgccgcc gctttcgtcc agcatggcac     74040
     gctcatagat caggcggttc tgatagtggt taacccagcg ttgctgatgc tgaatctgcc     74100
     gttcatgaca gcggatcgca atttcgcggg cctgctccgt ggtgatgatg tcatcatcca     74160
     gggccgacca taacgatcga cttccttcat actggctttt ttctgccggg cgcggatacg     74220
     tatccagcgg gaaacaggca ctgatacggt catgactact gatgagtttt gccatattca     74280
     gatccagcga ttcagcccgc cacatcgtca gatatttctg cgactgcgcg atggtctttt     74340
     cagccttgcg caaatcagct tcgatttttt tgatacgacg ccagcgaacg tccggacgtt     74400
     ctttatactt cgcgtgaatc agtgccgacc gcgcccgttc ttcccagtat tccgcacgtt     74460
     caaagagcat cacggcacgt ttcatgccgt tttcaatacg ctgcgcatca cgacgggcgc     74520
     ggcgttcgct gtgatgcccc acaagaatgg gctgaccggg cgggatcatc gcggccagtc     74580
     tttccacttc atcaagtacc tgtgcggatt cactggcccg ctttccgctg tatccggtaa     74640
     accgctccgc ccgtgcttcc tgacgttcag cgagcgtgct gtcttcatcc tcaatctctc     74700
     cggcaagtga gaggagcacg tcttccctgc ccggtgtcca ggctggcgcg acaaacagcg     74760
     cctgttttgg tgcccagcga aaaccagcat catgcacttt tttatacgtc tccgggtcaa     74820
     gacgtgacac ggcatacagg cgcagtttgt tgtcatccgg tgagtaggtc gcgcggtaca     74880
     tctgcacagg gctggcggct tccggggcgg tcatggtgat tgcagctaat gtcataaaat     74940
     gttctccttc cgtctgttgc cgcccctcgc ggggcggctc acctcatcag ttaaaagcgc     75000
     gtttcagttc gagtgtgcgg agcacctgcc cgaaagccgt gtttttcatg gcggggatgt     75060
     gtacaccacg cccccggtga aaactccggg ctatgtgtcg cccgaaggct ttcagcacgg     75120
     gggcaatttc cggcgtgggg atgtcttcgc gtctgaaacg gggatgacgg cggggcttta     75180
     cagccgctgc ggaaggtgaa acaatgactt acagtcataa atggattcct tatgacaaat     75240
     tggttaacaa tgccgtcaaa attggtcgca caattcttac ggcgtggatt aagcaggtcc     75300
     ctgacctgct tttttcatat ctgcatctga ctctttccgg tgttttcctc cttctgttcc     75360
     tgcgttctca ttacctgtca gccggatgac tgacagaaca aataaatgcg tattgccgga     75420
     gcctgaaata aatcctgatt tttaaagaac atcacccgtt gagtttcggg agccgcggtt     75480
     ttgacgtttc gcgggaacct gctgctgtat tcactgtggt atgaacttca cccgtttgag     75540
     aaccttcgcc gcaaggggca tcactgccac ggcctgacgc acctgtcctg ggcagaacgc     75600
     aaaatttttt accgggtttt gggtaaaaaa ttttgtgggc tgttcattta ccctggacag     75660
     tcagtgcggc aggttgtggc tgtatcagcc cccggcgaca gggactcata cgggtgtgtg     75720
     gcacccggca ggcaatgagc agggccccgc cgcaacgacg gagagcgcgt gcgcgaaacg     75780
     gcgttgcccc ttacatcccg gcggtctttt gtcgggatgc cgggagcgca ggccacggcg     75840
     cgacagaggc ggcgcgaccg gaacggtcgc tgcaaaccag ggtttcgcgt cagggataga     75900
     agcccgccag ggcggagaca gctccgctgg ctccgttcac gacagcccgc cccgccaggg     75960
     ggacgcccgg aaaagccata aacaggagag gaacggaaag aagaggaaga ggaaaagaag     76020
     aagaacaata acaagcacgg taaccacaga aaaataacat cagaaaaaaa acattccgga     76080
     cacatcacaa acaggaaggg taacgggcga cgcgtcagcg tggcccgctt cccttccggc     76140
     aggcgtcagc ctgccagggg ttttcgcgcg ggctgacagg cggcctccac cgcctgccct     76200
     gtatcacctg tttctgctgc cctgaaggat gtactgaccg ccgaggaata cagcctgctg     76260
     attcgccaca aaatcgcaga tttcatcaac aatctgcgcc gtggtgagcg gtttctgccc     76320
     catttcacga cgtcgtgcat taatcacagc tttgtaatta cgcagaattt cgcgggtttc     76380
     cgtgctgata ttcattaccc gttctccccg tccagcgcct gacgcatcac ccgcataatc     76440
     tcacgttctt ccctgacaaa tgcgtcaccg tcgcccccgt tctcgctccc gacagcatgg     76500
     aggcgataaa tttcactacc agccatcacc atcacttttt ccagcagcac cgcagggact     76560
     gttacaagac ggtttacgcg cttttcctcc atcagttcat tgacaatatc ggaaacaact     76620
     ctgtcacatg cgccatatac aaaagcatcg tccagccgct gcatgacggt ttccagctca     76680
     tcgtctgtca gactccagtc ctgggctatg tgacgcacat caccacgggt cagcaccacg     76740
     gcaaaaacgc attcactgtc cggcacgtct gtatccagta catcgcggat gatctcttta     76800
     acagtacagt acatgttctc gtctccttta caggggcggc attgccgccc cgtccgttaa     76860
     tcagtccagt gccgcgtaaa tcgcgttgca ttcagggtga aattcgatgt gacgccacaa     76920
     ctgcgcatca cgcatccggt aaagctgagt cagccccgca tcaccgctgt cgtggtacag     76980
     ccacaactga cggttaatca caagggaagt cagaatgaca cctgcggcat cagcactcac     77040
     ggtacggtca aaccagtttg caccgttcac catgtggaaa cggtcgccat ccggcatcat     77100
     gtaaccgcca ccgtccggca ggcggatgaa gtgccagaat ccgccttcat attccggcat     77160
     catttttttc gccagcgcgt atacagacgc ttcggcatac agaaaatcct gaccaaacag     77220
     gtaaggcaga aaagacagac ggtcgcactc ttcaacgttc agagtgacag atttcgcata     77280
     ttgcatgatg ttttcctccg ttgttcacat attccgcgac accgggcggt gccgtgcctc     77340
     cataaaagcc gggcgataag gcggggatgc aggggcgcaa gggaagccgc agcctgacgc     77400
     acacggctga cgggagttgg agggtgagac cgcgaaatct gagcgggtga acgaccggaa     77460
     aatcacggca gacgggaaga agggaccggg tgaccgcagc ggcaaagcgt acccttgcat     77520
     ccccgccagc ccggctaaga tggaggcacg gcaccgcccg cacacgacac ggcggccaca     77580
     gagctgaaaa cccacaaggc catgccccgc atggccgggt aaagcggagc cggcggcgac     77640
     ttccttgtat aattatccca cacagaacag attggttctg tagttaacac tggggcaaag     77700
     caggccggcg acttcctttg gccagtgagc cagtcaaaaa gataattgcc gctttgcctc     77760
     tcttttcagt gtatgaccga agggtatctg tggccccgta catcggtgag cctgaatttg     77820
     caaggtaggt cagctgaact aaccgaggaa aagctatgac tgtgtacatt ggaattgata     77880
     ttgccagaaa gaagtttgat gcagctgaac tctgtgacgg ggcttacagg tgtaagacat     77940
     ttgaaaacac ccctgctgga tttacagcgc tatacgactg gcttaaagcg ggcagcattc     78000
     cggacattca tgtatgtctt gaagcaacag gcaactatgg tactgccctc gctacttttc     78060
     tgtacgaaaa gaatctgaaa gtgagcgtag ttaatcccgc aagaatcaag ggattcgcgg     78120
     cttctgaact tacccgaacc aaaaccgaca aagctgactc cagactgatt gcacgctttt     78180
     gtaaagccgc gcagccagat ccatggagac ctgtgcccgc ccccgtcaga aaacttcagg     78240
     ctctagtgag acgtatcggt gcgctgaacg gcatgctcag aatggaatgc aaccgtcgtg     78300
     aaaatgcaga tattgacgct caggaatcgg ttgaacgcat gatcaaccat ttaaagatgg     78360
     agcttgaatc ggtgcgccgg gcaataaaag agcatatcag taatgttcct gagctgaaaa     78420
     aacagaacga cctcctgctg tctattccgg gtattggcac tgtttcagcc agcctgatac     78480
     tgtccttcat ggccagtaaa gagttcacaa aagctaagga agtgaccgct tttctggggc     78540
     tcaatccccg ccatcaccag tccggaacgt cggttagggt gaagtggcac actgaatttg     78600
     gccacctgaa cagaggtgat atgctcacct cagaacaaca caggtgctcc aatgaaaaaa     78660
     agaaatttca gcgcagagtt taaacgcgaa tccgctcaac tggttgttga ccagaactac     78720
     acggtggcag atgccgccaa agctatggat gttggccttt ccacaatgac aagatgggtc     78780
     aaacaactgc gtgatgagcg tcagggcaaa acaccaaaag cctctccgat aacaccagaa     78840
     caaatcgaaa tacgtgagct gaggaaaaag ctacaacgca ttgaaatgga gaatgaaata     78900
     ttaaaaaagg ctactgtaga ttcaatctgt caatgcaaca cccctttcaa ttatctcttt     78960
     cggtgttttg aacttcagtg tctttctcgg tctgttgttt agctgagcag caaccagatc     79020
     tagttcatgt tgagtatatt gggcaagaca tatcttttta ggaaagtact gccgaattag     79080
     cccatttgtg ttctcatttg ttccccgctg ccaaggactc tgaggatcgc agaagtaaac     79140
     tttaacgccg gtgctgacag taaattctag atgtctggcc agttccattc ctctgtccca     79200
     tgtcagtgat tttctgagtt ctgacggtaa actcaggaat ttgtcggtaa gagcctgatt     79260
     tactgagaca gaatctttgc ccctgagtct gaggatgatc gtataacgtg attttcggtc     79320
     tacaagtgtg gctatatgag agttttttgt acctgagact aaatcgccct cccaatgccc     79380
     cagagagcgt ctgttatcga tatttcggga acgttcgtga attggtgttc cgttcactat     79440
     gttaatcgta cctctttcgc ctttgcgggt atgacgcctg ccatggcgaa ggctatgcga     79500
     ccgtcgcaga tgctgtatat tcaggtggtg tagcgcttca cggctacgaa agtacagcgt     79560
     tttataaatt gtctcaggtg atattcgcag cgttttttga cgtggttttg ttcgccttaa     79620
     ccatcctgat atttgctctg gagaccattt catctccagc ttttccagaa caagctttcg     79680
     caatggtaaa ttttgatcca gtaagcacgg ttttggcctt ttcgccattc tgttggctcg     79740
     gttattagca tcaacagctt tgtaatagcg tctgccccga ttacgctgaa cttcacgtga     79800
     gatcgtcgaa ggactgcgat tcagctcagt agctatcgca cgaatgctca ttttggctga     79860
     caaaccagct cgtatctcct cgcgctcaga cagtgtcagg tgagctacag cccgcttacg     79920
     ctcatggggt tttatgccgc cagtatccct taacatagtg aagatcgttc cgggttttga     79980
     acccaggata ttcgctattt cactgaagcc tgttccgttc ttccatagtt caaaaacaga     80040
     ggctttttcc tctgctgtaa atgttcgtct cattcaaaaa acctccgcaa ccccatgttt     80100
     tcacataact gttgcgttga ccaattgaat ctacaaccgc gctcttgatg tcagactccc     80160
     tgaacagttc tcgataatcg ggaaactcag agcgcattat cctgtggcca cactctgcca     80220
     tgtgttcggg gttcatcgca gcagctacag atactggaaa aaccgtcctg aaaaaccaga     80280
     cggcagacgg gctgtattac gcagtcaggt acttgagcta catggcatca gccacggttc     80340
     ggccggagca agaagcattg ccacaatggc aacccggaga ggctaccaga tgggacgctg     80400
     gcttgctggc aggctcatga aagagctggg gctggtcagc tgtcagcagc cgactcaccg     80460
     gtataaacgt ggtggtcatg aacatgttgc tatccctaac taccttgaac ggcagttcgc     80520
     cgtgaccgag ccaaatcagg tgtggtgcgg tgatgtgacc tatatctgga cgggtaagcg     80580
     ctgggcgtac ctcgccgttg ttctcgacct gttcgcaaga aaaccagtgg gctgggccat     80640
     gtcgttctcg ccggacagca ggctcaccat gaaagcgctg gaaatggcat gggaaacccg     80700
     tggtaaaccc ggcggggtga tgttccacag cgatagtaat aatgccggta tcagttttta     80760
     tcatcactct gtttgctgtt taaccagact ggtgtgatta ctgatgcagt gaagaccttc     80820
     ccgcatcctg actcacacag cgatcgaccc tttgtgtcct gccctggacc tgtcggttgc     80880
     cggaagcgcc ttcatgcgag gcgtctcctc accgatgcgc gtgactcaag aagggcctga     80940
     cggtttgtct cgttactgtc ctgtccgggt tatctgtctg gagattcaac tctgtttcct     81000
     cacaggagct ctgttatggc aggtaaagtt acggaaaccg ctgttgtggg tggcgtggat     81060
     acacataaag atctgcacgt tgccgctgtc gtagatcaga acaataaagt tctggggacc     81120
     cagtttttct ccacaacacg gcaaggttac cggcagatgc tggcatggat gacttcgttt     81180
     ggggcattaa agcgaattgg tgttgagtgt acaggcacct atggatcagg tctgcttcgc     81240
     tatttacaga atgccgggtt agacgttctt gaggtgactg cgccagatcg gatggagcga     81300
     cgcaaacggg gtaaaagtga cacgattgat gctgaatgtg ccgctcacgc cgcattctcc     81360
     ggaataagaa ccgtcacacc caaaacgcgc aatggcatga ttgagtctct gcgggtatta     81420
     aaaacttgcc gaaaaacagc aatatcagcc cgcagagtcg ctctccagat tatccattcc     81480
     aatattatct ctgccccgga tgaattacgt gaacagctca gaaatatgac gcgcatgcag     81540
     ctcatcagga ctctgggatc ctggcggcct gatgccagtg aataccgcaa tgttaccaac     81600
     gtttatcgta tttcattaaa gtcccttgcc cgacgctatc tcgagttaca tgacgaaatc     81660
     gctgatttgg atgtcatgat tgcggcaatt gtcgatgagc tggcgcctga actgattaaa     81720
     cgtaatgcta ttggatacga aagcgcttcg cagttgctga tcacggcagg agacaatccc     81780
     caacgattaa gatcagaatc aggttttgcg gcactgtgtg gtgtcagccc tgttcccgta     81840
     tcttcaggaa aaacgaatcg ttatcgactt aaccggggtg gagatcgtgc tgcaaatagt     81900
     gcacttcaca tcattgccat cggacgtttg cgaactgacg ataaaacgaa ggaatatgtc     81960
     gccagacgag tagcggaagg gcatacaaaa atggaagcaa tacgctgcct gaagcgctat     82020
     atctcacgcg aagtttatac attactgcgt aatcaaaaca ggcagatcaa cagcatcccg     82080
     ataacggctt gactcttaga agggcgtcca gggtagtcat tatacgagca ggcagttccg     82140
     gcagttattg tggcgatacc agatcacgca gagtatgagc cggcgcggaa actgctggga     82200
     taacagccca atggaacgct tcttcaggag tctgaagaac gaatggatgc cggtggtggg     82260
     ttacgtaagc ttcagcgagg cagctcacgc cataacggac tatatcgttg gatattacag     82320
     cgcactaaga ccgcacgaat ataatggtgg gttaccccca aacgaatcgg aaaatcgata     82380
     ctggaaaaac tctaacgcgg tggccagttt ttgttgacca cttcacttcc gaaagaaaag     82440
     cacctgaccg gcaagatttt tactcagcgc attgagcgca ataacctgac gctgagaacc     82500
     agaatcaaac ggctggcccg caaaacgctc tgtttttcac gttctattga gcttcatgaa     82560
     aaagtcatcg gggcattcat ggaaaaatgc atgttctact aattggatgc atcaccgttg     82620
     aaatcacaat aacgattttt ttgtaaatat gctctcacat atgtaggaat agactaggtt     82680
     ggcattgaaa cacatctatc atgaccataa taaagtaatt ttttgatatg tttatagttt     82740
     tatattaatt aaaacatatc taaaattgat agttttaaaa ttgcaaaatc catattttgt     82800
     ttgtaatgtt taatctgatt atattgagtg gcgtttatta tgaaaaataa atcaggtaat     82860
     tcttattata gagaagcggt cgatattcat agctcacttg agctttcatt tatattgcat     82920
     aaatatcatt tgcgtgtaga tgagaagaaa tctcgaaatg tattcagcgc catacgtgat     82980
     gagctcatcc ttgatgggga ttcacgacaa aacttagcta ctttctgtca aacatggatt     83040
     gatgatgaaa tccgtgagtt gcttaattta tctattgata gaaacatgat ttataaagat     83100
     gaatatccac aaatggcgga acctgaaggt cgctgtgtgc gtatgctttc cgattcgtgg     83160
     agtttccccg attcgcgaca caccttaggt tgctcaacca ttggttcatc tgaagctgct     83220
     atgctcggcc gcttggcgtt aaaatggcag tggtgtaaaa aacgcgaagt acaaggtaaa     83280
     tcaaccgaac ctgatttgcg gtcctgtgca aatatgctgg cataaattct gccgttactg     83340
     tgatgtgaaa ttgcgtaaaa tttcacttta tgatcatcgc ctgataatga atgctgaaga     83400
     ggttttgaag catgtcgatg aaaacactat tggtgtcgtt acgactttag gtattacttg     83460
     tttttatttt tgtaaagcag attgcgttag tgtttttaag ataagtgtca agttaatatt     83520
     agtttttata tttatatcgt aattatatgt ttctatttta aaaatattcg agagtataaa     83580
     aatgtcgaat gctaatatcg cacccaaaag taagaaaatg acagtgggga cactcgctat     83640
     catgaatata actgctgtag taagtctacg atttatacct tctgaagcag aatacggctt     83700
     aggtgccatt ttttactata cctttgctgc aattatgttt ttagtacctg ttgcctttgt     83760
     tgcggctgag ctagctacaa catatccaca aaaagggggg gcatttcgat ggataggaga     83820
     agcatttggg gctcgctggg gttttgtagg aatgcttatg acctggctac aagtcatccc     83880
     ctactttcca acagtactga catttggtgc agtctcggtt gcatttattg atgttgatat     83940
     gggggtggca gaatcaattg ccagtaataa atggtatatt ttatttttcg tactatttgt     84000
     ttactgggga gctatttgtg ttgcattacg tggcgttggt attttctcgc aggtatctaa     84060
     gtggtgcggt attataggga caattattcc agctattatc cttgttattc ttggtttctc     84120
     ctatctgtgg ttcagcggta aaccagcggt gatcccatta ggttggggtg atcttttccc     84180
     taatatagct aacttccaga atattgttct tgccgccagc atatttcttg cttatgcagg     84240
     gatggaaatg aatgcggtcc atgttaacga tttagataat ccaactaaaa aatacccaat     84300
     tgcaattacc atcgcttcta taggtactat tgcaatattc ctgctcagta ctttaggggt     84360
     cgcctttatt attcctacag ataaaattag tctaactcaa agtttgttgg ttgcctacga     84420
     tatgctgttc gaatgggctg gagtgccatg gcttggctct gtgatggcat ttatgctagc     84480
     aattggcgta ctgggtgggg tggttacttg gattgcaggg cctaatacag gtgtattagc     84540
     gatcgcgaaa gctggttatt tacctaagtt tttccaaaaa accaatcgtc atggaatggg     84600
     gcaccatctg atgtttgtac aaggtataat tgtctcagtt ctttctgtta cttttgtgat     84660
     aatgccttca gttcaagcag cttttcagat tttatcacag ttaacagtta tgctctattt     84720
     agttatgtat atgctcatgt tcgctggtgc tatctatcta cgacattctc aacctgataa     84780
     aaaacgccca tatcgagccc ctgctttatt cttctgggca acacttggat tcttagggtc     84840
     ttttctggct tttgtattaa gttttattcc gcccgagcaa atcccaactg gtagtccaac     84900
     cagctatgtt ctttatttgt tagtattagt tgccctattt ttattaattc caatattaat     84960
     ttacgccttc cgaaaatctg actggaaaga tccaaactct gatttcgaac cattttcttg     85020
     ggaaaaaaga actagtaatt aaattttcaa taagctacaa aagatgaggt taaatatgtt     85080
     tagtgctgaa tctccaattg gtgtaataga ctcaggtgta ggtggattga catcggtaaa     85140
     ggaaataatt aatttgcttc ctggcgaaga tattatctat tgtggagata atacgaatgc     85200
     accttatggc aaccgttctg ccgatgatat catcagtttg actaaaaaaa tgctgacttt     85260
     tttacagtca aggaatgtca aactagttgc tgttgcatgt aatactatat cctcaacttt     85320
     ggaatccgaa gaatacagcg gatatgctaa gagctttccg tttcctatct tatccatcat     85380
     tgaacctgca gtagaagatg tgattcgcca gcagtataaa aatgtgggta ttatcgctac     85440
     cgagtttact attaaaacgg ggtgtcacaa agagctaata aaaaaattga acccaacaat     85500
     aaatatattt ggagaaccaa gcaaaaatct tgcaatgtta attgaggaag gtaatcttaa     85560
     tgctcctgca atattgaatg atatcaaaaa acatgttaac catttaattt ccctccatcc     85620
     agtaaatgaa attattctcg gctgtactca ctatccaatt gttcagaatt tatttgaagc     85680
     agttgcaccg gatataaaat ttattaatcc tgcacatgat caggctatct ctattaaaaa     85740
     tcacttggga cagctaaatt tattaaactc ctcaaatata ggaactttgc aaataaatac     85800
     tagtggaagt atggagatct acaaaacggt actaggggaa ttgagcatta cgaaacctca     85860
     tacattcagt atcaggcagt tttaaattta tccggtgcac cgtaaaaccc cgtccttctg     85920
     aactgcaccc caaaagttgg acaccaactg agtaaggtgc attttatggg caaacccagt     85980
     tacatactgg gtagtgcatc caattagtag aacatgtgtt tttcgataaa cgctccgatc     86040
     actttttcgt ggatctcaac tgagcgtgag aagcagattg ttttacgacc caaccgctta     86100
     atgcgggtgc gtagcgtcag attattacgc tcaatgcatt gggtgaatat tttgccggtc     86160
     agatgcttat tcttcggcac ctcccggcca tagctgcccc agtcatcgct ggtcagcatg     86220
     ccgatgttga agggtgtaag cagtgccagt agctcccggc acgtttgatc ggttcgggga     86280
     ccaaaagtgt aggccagtac accgcctgtt ttggtgttgt acgcgtacca gatccagtgt     86340
     tgccgggctt tactgccaac gtagctccat tgctcatcaa gctcgcagat aaacgccaca     86400
     tcagcatggg taacaggcga agaagttatt cgctttggcg cgagtttttt aaagtccgga     86460
     tgacggtgtt actaccaatt ttcagtgtcc tggcggtatc gcgaaccccg gcaccattaa     86520
     aggccatttc agtgatcagc tctttcatac ccggcttacg tgcttgataa gtataagtga     86580
     gctgaaacac acggtggcag tcacggcagc gaagtctgtc acggccttta gggttctgac     86640
     catggcggta aacctgagct gactgacaac ggggacaatg aatattaact ctggccatga     86700
     gataacctca aaaacccgta ttatacatca gattcaacta attagaggca tcacctatcc     86760
     agcattatat aacatactaa caataactaa attataataa tcacaactta taatcaaata     86820
     ataaacgcat aaaatcaaca atgatttttt ctggttatat ttatctaaaa aacggaatat     86880
     tatgtaacct attattttct aagcgtaaat ttattatgtg gtcagactaa caaacttgcg     86940
     taccacccga agaatatgcg aaaatttaag tattctttct ttttttattt tttcattttc     87000
     tcttttcttc tctttccggt tctcttcttt tctggttttg gttttttcct ttttattttt     87060
     attctttctt cagggttgtg ctaaaacacc aaaacatttt tcaccacaaa agcatccaat     87120
     catcttgcca gaccaatcac cttaaccgga tacactgccg gatataatcc cactaacacc     87180
     cagccacccc gcaccattcc tgataactac cgtattcagg aagttgagcc ctactcaatt     87240
     gatgaaatgt tcattgattt gcgggggata aatcattgca tctctccgga ggcttttggt     87300
     catcagctca gggaacaggt aaagagctgg acaggactca ccatgggggt gggcattgcg     87360
     cctacaaaaa cgctggctaa aagtgcacag tgggcaacaa agcaatggcc acagttttcc     87420
     ggtgtggtcg cgctgacggc agaaaaccgt aattggatct tgaagctact ggggctgcag     87480
     ccagttggtg aggtctgggg agtaggacgc agactgacgg aaaagctgaa tgcgctgggt     87540
     attaacacag cactgcaact ggcgcaggct aacacggcat tcatccggaa aaacttcagc     87600
     gtcattcttg agcgtacggt acgcgaactc aacggcgagt ccagcatatc cctggaagaa     87660
     gcaccaccgg caaaacagca gattgtctgt agtcgcagtt ttggtgaacg aatcacagac     87720
     aaagatgcca tgcaccaggc tgttgttcag tatgcagagc gggccgcaga gaaactacgt     87780
     ggggagcgtc agtattgtcg gcaggtgacg acatttgtac ggacatcccc ctttgcagta     87840
     aaagaaccct gttacagcaa tgccgctgtg gaaaagcttt cattgccaca caggacagcc     87900
     ggggcattat tgccgccgca tgcagagcct taaaccatgt ctggcgtgaa gggtaccgct     87960
     atatgaaggc aggagtcatg ctggctgatt tcgcaccatc gggtatagcg cagccgggat     88020
     tatttgatga aatccagccc cgtaaaaaca gtgaaaagtt aatgaaaaca ctcgatgaac     88080
     tgaaccagtc gggaaaaggg aaagtgtggt ttgcggggcg aggaaccgcc cctgaatggc     88140
     aaatgaaacg ggaaatgcta tcgccttcgt atacaacaca atggactgag atccccattg     88200
     cttcattctg atatatcaga ataatttttt cattttaaga cgcacatcat tcattgcctc     88260
     ctgcaccgaa tcagtagcag aaggaggcat tttttcaaca gattgcgaag caccgagttc     88320
     agtcaacaca gctctgatat cggcctgaga aggcttccat ccagtcgtct gactgagtaa     88380
     ggttacaacc tgatctgctg aaaactcctc gctcaaaatg gctgtcagca atacaggcag     88440
     gcgaggatca agttggtgta acgccattcc agaaataaat gcattccgga acagctcacc     88500
     acgctcagaa cgcggaacgg actctatcgc ttccaaagtt tgaaagtctg cagctttttc     88560
     cggatgcaga taaagtgtgt attttttcct tttccgttca tcgtccacaa tattactcct     88620
     ctttgaaagc cgcgatagct tcaaccagtg ctgtctgtgg cgactccatc atcactactt     88680
     tttgcccaag atggtgccat gccgttttta tcgaatcata gatcaacggg gccccaccac     88740
     cgacaacata aacacgattc acatgatgga aatcaccgag ctcattgact acttgctccc     88800
     ccaaactggc aatagccccc tcaatggtat taaggaccag atcagttttt gtttcgtcat     88860
     ttataacctg ccgaacaaag tccgggtcat tacgacgttt aatcaattca tctgcaacga     88920
     ggaaactggt atcactggat gccatgcgca atgcactcat tgcagctttc gtaactgaag     88980
     acacaccaat gccagaatta ccatgaatgg cacttacaga gtcaaattga ccaacgataa     89040
     caccaacatc aagcgtagtg ccgccaatat caactaccag cgatttttcg aactgaccaa     89100
     ctttatccac gaccagacga gaaaacacag ctggcaatga ttcaggcatc acatcaacgt     89160
     gttcaatggt gaaaacatcg cctttattaa ggcgaatcgg cctcattaaa ttctcaattt     89220
     tacgctgaat gttgagttca tttttttgac actctttcgt atagaactca ctgataggca     89280
     aagtcactgt caatgataca ggctgaggcg ctaatccact attcagtaaa gcgtgatgca     89340
     cagctaacag gttaacctcc gtatattgat actcaatatg agtcgtaaga atagattggt     89400
     tgctaacttc atcatacgtg tattttttac catccagttc atagttaaat gtctggcgaa     89460
     ttcctaaccc gtcaaccttc catccatgac gaaatgagtt ttgcgacaac gacttacaga     89520
     ttttcccatt atcattccat gccaacttga ttgttgttga accatcatcg cagtatacgt     89580
     tcatctatag ccccttaaat actcaatctg agtaaatcac tgtttctagt tgcaaggtaa     89640
     tactcaattt gagcactatc atagttatga aatcacaaaa cacaagtatt atttattaca     89700
     tcacatgaca cacttcatat ttcatacttc ataaatatga atacatattg acacctcagg     89760
     ttaccgtgtc aaaatatcat catacttcac acatcacatt tatgaggttg caatgattac     89820
     tgtagttggt gggaacaaag gtggttcagg gaaaactacc attgcatcaa acctggctat     89880
     tgctctcgca aataaaggaa gggaagtctg cctgttaaac ggagatctac aacgaacagc     89940
     cgcaaaacat catgcggaac gagaagctgc aggactgtta ccagcaataa cccttgttga     90000
     gaaatttgat aacctgacac aaacactaca ggctctgaat gaaaagttcg atgatgtaat     90060
     agtggatgtc gcaggaagaa actcaaagga attcataacg agtggagttg tcgcacatca     90120
     aataattgcg ccactacagt gttctcaacc agatctggat actcttacag aactagaaca     90180
     acagatagac gcaatgcgta accttaaccc ggaacttaag gtttattgtt tacaaagtat     90240
     ggcaacaacc aatccggttt tgaggggaaa tgagagaaaa gaattccttg aatatcttga     90300
     agaattccca acaattcaag tccttgattc agttatttgt ttcagaaaag tctatcgcga     90360
     ttgcatgagc aacggcaccg gtgtagtaga aacgaacaat acagcagcca aagcagaaat     90420
     tgaacattta atgaatgagg tatttggccc atggtgaaga aacccagcca gcaagcatta     90480
     aacagagctg cagttacggt agaacaagca gaggctctgg ctcagcgcct tgcggataaa     90540
     ccatacggcg cgccggaaaa acccgaacca gaaaaacaat gtcggacgac aatctctctt     90600
     ggtgaaagca tgcttgtcac aatagaagat ctggcattga ggaataaacg caatggtaaa     90660
     gatccaaaaa atgtaagtgc catcgtcaga gtagcccttg agcaatactt aaaaacacta     90720
     acgtaataat caataagtta ttacttatga aatcacactt gtgaattcat actgtttaag     90780
     cacccttgca tacaagagat cacatattgc agtggtctct ttttttacag aataaatcac     90840
     aattcataat tatgatttat gaattatgcg tgtctgtttt tcagcattgt gaccgcatcg     90900
     gactcaggca tcgaaaactg cacccggtgc cgtgcagcca catccagcgc aaataccttc     90960
     gtgtagacct ccgttgagct gatggactta tgccccatca ggctctgcag gaccttcagt     91020
     ggtataccgg catacagcat gtgcatcgca taggaatggc ggaacgtatg tggcgtgacc     91080
     gggacagaga acgtcacacc gtcagtagca gcagcggcaa ccgcctcccc aatccaggtc     91140
     ctgaccgttc tgtccgtcac ttcccagatc cgcgctttct ctgtcctgcc tgttcgttta     91200
     ttacgccgtt ccagaggaat tttcagtgtt gccaccatcg tctgcagctg actgacgtac     91260
     caggagtcgg agagcggaac cagccggtga gtctgctgtc cggcaggcgt tcttcctgcc     91320
     gtcctggcgg ctttttcggt ccgctgcttc agagtggcca gctgcacaaa cggatacgga     91380
     ggcgcgagcg aaaaatctcc ccgcgtcagc gccagtgctt cattaatgcg cgcaccggtg     91440
     ttccacagtg tggccagcag catcttgcgg cgcagatccg ggacgtaatg gagcagggca     91500
     ctcacttccg gagccagcag atatttcggc agttcatcat gaaccatcga catctggcga     91560
     agtgccagag ctgccggata atcaatgaca acaggaagtt gtggagactg tccggcagaa     91620
     tacactgccg gtaccctggc tgcagactgg ctgtgtataa cggagcctga catttatatt     91680
     ccccagaaca tcaggttaat ggcgtttttg atgtcatttt cgcggtgact gagatcagcc     91740
     acttcttccc cgataacgga gaccggcaca ctggccatat cggtggtcat catgcgccag     91800
     ctttcatccc cgacatgcac caccgggtaa agctcacggg agactttgtc tgacagcagg     91860
     cgggcactgg ccagggggat caccatccgt cgcccgggcg tgtcaataat gtcactctga     91920
     acatccacaa acagacgata acggctctct cttttatagg tgtaaacctt aaactgcatt     91980
     tcaccagtcc ctgttctcat cggcaaaaga gccgttcatt tcaataaacc gggcgacctc     92040
     aaccatccct tcctgatttt ccactttcca gcgttcggca cgcagacgac gggcttcatt     92100
     ctgcatggtt gtgcttacca gaccggagat attgacatca tatgccttga gcaattgata     92160
     gctgtcgctg tcaactgtca ctgtaatacg ctgcttcata gcacacctct ttttgacata     92220
     cttcgggtat gcatataagt atatattatt atgatgcaaa aatcagcgcg taaatacaca     92280
     tactgttatc ttacttttag taagccttat ttattttacc ttgcgttatg ttaaccaata     92340
     aaaatcaaaa tctgacttat aaaaacaaac cgtaattatc gcattcccgt ttccgtcaga     92400
     tccgactttc atgaatatca caactttccg gaagtgtacc acgctgtgaa aatcatcata     92460
     tcactgtttt ccgcccctgc gcggcgcatc ataggtcagg gagatgacac aatatatagt     92520
     gtcattagca gctaaattaa gcactacatg ttgtgctgac gggagatggc gctgtgcggc     92580
     gagagaggaa gatccgtgac tgacagaaat cggatctatg agagaagata atggtatatt     92640
     tgcttattat gcaattaaaa ataactatta ttgccatatt tgcactattg ctataaatgc     92700
     actaataata aggttctatt gccaaaaaca atcatctgga gatatttgcc attcactctc     92760
     atccataacc tgttaaaagc ggctcgggtt cagatcaatt atttattaac cggtgatgga     92820
     taaaatgaaa ccggaacgag atatccctaa tataaatgaa attatgcgta gccttcgggc     92880
     attcatcagc gactgaataa aggtatcaag gaatgtatcc cgtatttgag aatggctcat     92940
     gctgggtcaa ggtcgatttt caccttcata cccgtgcaga caaagaattt cgctatgccg     93000
     gcgaatccga cagatatatt cgcgattacg tcaatgccct caaagcggcg gaagtgagcg     93060
     tgggcgtgat caccaatcac aataaattcg atcccggcga gtttaaagta ttgcggaaag     93120
     ccgcgcgccg tgaaggtatg gacctgcttc ccggcgtgga gctgtccgtt aatgatggcc     93180
     aggccggcgt gcacacgctc gtggtgtttg ctgatgagtg gtttatcaat ccacagcaga     93240
     cgaaccatat tgaaagtttc cttacggcca cgtttgcggg cgttgataat tttgagaatg     93300
     aaaatgcccg ttcaacagaa aatatcacac agaccatcca gcgccttgac cggtatgaaa     93360
     gggattactt cattgtattt gctcacgtgg aggcccaaaa cgggttatgg ggcgggctga     93420
     gcccaggccg gatcggggag ctttttgata atgaccttgt ccgccggcgc gtgacgggat     93480
     ttcagaaggt gatgacccac gacctgcggg tcaaaattaa ggacgtgctc ggtgagcgct     93540
     atcctgccga agtccaggga tgcgatgcca aaacgctgga tcacattggt gccagaaaag     93600
     tcgccagcta tctgaagctg ggggattaca gttttgaagc cgtccgcttt gcgctgcagg     93660
     attttccgca tcgcgtcagc ggagagaaac cggccctgac ccacagccat atccgccaga     93720
     tagcattcga gggcgccggt tcgctcggtg gaaccgtggt gaaattatct ccagaactga     93780
     acaccctgat agggatccgc ggcagcggca aatcctccat ccttgaaggg atccgatatg     93840
     ccctggacat tccgtttggc gagaaggcct ctgaccgcga ctacaaagaa aatctggtca     93900
     gtaatttact gaaaagcgga gggaaaatta ccgttgatgc cgtgtgccgt cacggacggg     93960
     cctatcagat agttcgcatt ttcggtcagg agccgcaggt catttttgac ggccaggtcc     94020
     ggcacggggt ggcgctacgg gaaacggttc tgcataagcc agtgtatttt ggccagaaag     94080
     atctgtccaa taccggtgcc ggatttgaac acgatctgat agaaaaactg gtcggtgagc     94140
     gtctggctcc cgtacgagag aaaatccggc agcagaatgc ggtcgtgctc gacaggttag     94200
     tccagcttcg ccgtctgaaa acatcgggag aagcgctctc cgaatggcag gcgaaagaga     94260
     aggatgcgca gttccgcctg cgcttctatg cccagcatgg catggaagaa aaactggagc     94320
     gtcagaccac cttcgggcgg gatgagcgct atctcagcag cagcacttcc ctggcaagcc     94380
     gagcgctgga cagtctgcag gacggaatca gggagactct ggacgggctg aaacaggagc     94440
     agaaacatga gtcagcacat aaccaggcgg atattgatga ttatcgtgag ggatatgacc     94500
     gctttacgac tcatctcagc tccctgaaca ccattgtcga cggtgcccgc cagatcctag     94560
     atgagctcaa cgttaagcag caggccttcc tgcagaaaaa gcaggcgctg acggaggaat     94620
     ttgccgaaat agaacgtggc cttgcagaag agctgcggct agccggggtg gaaaaagcag     94680
     atcccgccga cttcctgaag ctgaaagccg ggctggaagt tgcggaacaa aaaatagccg     94740
     agttgacccg ggctgaaagc agccagacgt tactggagaa gagtctgaca gaagcgctaa     94800
     accgattgtc tgaactgtgg gtggaagagt atcaggaaat tgaagccgtg ctggctgcca     94860
     tcaaccaggc agattcgccc ctgaagatcg tgccgtcctt tgcgagcgat aaaaaagcca     94920
     tgctggccgt tctgaaagaa gcctgtactg gcagccggtt gagggaaagt acctaccaga     94980
     ccgtggttga cagcttcagt aactttggcg agctctggct gaacagggat aaactccccg     95040
     ggattatcaa tagctctgcg gagacgttca gcatgtatct ggagcagcag atagaatcgc     95100
     ttattgtctg gcagatcccg aatacctaca tcattgaatt ccggggcaaa ccactggaac     95160
     aacactcatt gggtcaacgc gcatccgcat taatgctgtt tgtcctgaat cagcaggaca     95220
     atgatgtggt gatcatcgat caacccgaag acgacctgga caatcagacg atttatgacg     95280
     acgtgattaa aatcatcagg gcgatgaaac cccgcacgca atttatcttt gccactcaca     95340
     atgccaatat tccggtgctc ggagatgcag aaaatgtctg tgcctgtgaa tattcagacg     95400
     gaaagatcca gattgtcggc ggaggcgtgg atgcccctct tgtacaacag cacattattt     95460
     cggtaatgga aggagggcgg gaagccttcg agcgacgcag ggaagtttac ggctcatggc     95520
     tcagtaaaac ctgataccat catgcttact gagcatacag aaaaagccgc aaatgcggct     95580
     ttttaatttt ctgattatac cttttttggt tcttcgatgg aaaagaaaga aattacacag     95640
     gcctgacata tccatatgcc agacatcttc acattcaaag catatgcata tactgagcat     95700
     agccatacag gccgcccggt cagggggaaa taatgagaac tgtatccatt tttaaaaacg     95760
     gcaataaccg cgccatccat ctgccccgcg atttggattt tgagcgggtg agagagctgg     95820
     agatcgtccg cgaaggagac agcatcatcc tgcgtcccgt ccagccgaac tggggctcat     95880
     tcgcgcagct cgaaaaagcc gatccggatt ttatggcgga gcgcgagaat gttgtcagcg     95940
     acgaaggtcg atttgacctg tgaacaaaac gtatatgctc gacacctgta tctgctcgtt     96000
     catcatgcgc aagcagccgg aaactgtgct gaagcgcctt gagcaggcgg cgtgtttagt     96060
     caccgcattg tggtctcggc cattacttac tctgaaatgc gcttcggtgc ctccggtccg     96120
     aaggcctccc cgcgtcacgt gcaactggtt gataaattct gcccgtgcct cgatgccatc     96180
     ctgtcttggg accgcgccgc ggtggacggc accacggata ttaaagtggc actgcgccag     96240
     gccgggacgc cgatcggcca gaacgatacg gcgattgccg ggcctgaagc tggaaaactg     96300
     ggtaaattaa catcgcccac actctgaagg acgtgggttc cggcttaaac aggcggactg     96360
     actgccccaa tcctccacac gcaagcacgg catgccccgc cgctaaaatg ttacgagcgc     96420
     cgtttacatc ggcattcgct gtatgaccac agccagcacc tgaccaccac gccagagctg     96480
     cttatactca agctggcagc gcatttcata ccagccctga tccagtatcg aacggtttaa     96540
     atctgatttt tattcgtcat ttacttcgaa caatacttca atagattttg tcgggtagaa     96600
     gagcgaatca cagttttctt cctttaactg tataaaaccc agtcgaaggt agaatttttt     96660
     ggcgttatcg ttcagcgcct ccacgaacat tccgtgtata cccacagcct gcgaggcctg     96720
     atacacgact ttcatcgcat gggtaacaag tgtttctcca tatccctggt gatgaatgct     96780
     tttatcaatt gccagacggc ccaaaatcac gctcggcaca tttttgtagg gcacacgctt     96840
     ttgttgtgtt ttgctgggga gaagtatttt ctcaaagcaa ctgcctgaca gggtgtagta     96900
     ccccatgaca cgtggtctat cctctctcgt cacgagcaga taaccccgta aaaccttact     96960
     actgtgctga cgttgcagat gatcggtgag aaaagtattc agatactctt ctccacaatc     97020
     gaagttgctt aattgatatt caacttcctc tgaaaaaatc tcaatcctta aaccgtccat     97080
     ttattactcc agttcccgga gacggttagt ggcgcgtttc agccggtcat ttggtgctgg     97140
     cggattagtg attgcatcca taaccagatt ccaggactcc tcattgagga gcaggcgacg     97200
     gtgctgatca ataacttcag cagcacgtgc tgaggcggta ctgaccatga actgcgaaat     97260
     ggactggtta gtcattgctg cagcttcttc gatcatgtgt ttgtcgtctt catttaatct     97320
     cagatcgatg cgctgcttct tcagtgctga catggttttt ctccctgacc actcttaatt     97380
     ctgaaagaac ggtcagcttt gttaagttcg ggccttaagg cgataacatt tatccaggcc     97440
     ggtcatggtg atactttgat agtgagtacg gaaaaatacc gtacaaacat aatagagtta     97500
     tggtatgcag gtttcaacca caagttggtt atgaatccgg gtatagcacg taaaggtata     97560
     gtgagaagac tctcgacgct aatctgagca ggctcagact atctttggcg ggtctgatct     97620
     taagaagtca ttattaaact gcactacgta accaccgtat tatggatctg cgagcaattc     97680
     aggtacggca tactctacat tgagggctga accatcagtg ctcgccgcag tccggtgacc     97740
     gggctaaagc ccgcgaaccg gcgaggaagc gcaataacac agaagctgaa ggaagcaggt     97800
     acgcactgta gtcgcggcaa gtgatcactg aagaactatc tgaattgcct tgctgctcag     97860
     caggttatcc acatatacat tcattcgatc cagcaataag atccttaaag cgatccctgt     97920
     aagatccaaa gaagatcccg acatctctga aggccgcgcc agcactgagc ctggagca       97978
//

If you have problems or comments...

PBIL Back to PBIL home page