(data stored in ACNUC7421 zone)

EMBL: FM200053

ID   FM200053; SV 1; circular; genomic DNA; STD; PRO; 4581797 BP.
AC   FM200053;
PR   Project:PRJEA30943;
DT   18-AUG-2008 (Rel. 96, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 7)
DE   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
DE   complete genome, strain AKU_12601
KW   complete genome.
OS   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
RN   [1]
RP   1-4581797
RA   Holt K.E.;
RT   ;
RL   Submitted (17-JUN-2008) to the INSDC.
RL   Holt K.E., Pathogen Sequencing Unit, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
RN   [2]
RX   DOI; 10.1186/1471-2164-10-36.
RX   PUBMED; 19159446.
RA   Holt K.E., Thomson N.R., Wain J., Langridge G.C., Hasan R., Bhutta Z.A.,
RA   Quail M.A., Norbertczak H., Walker D., Simmonds M., White B., Bason N.,
RA   Mungall K., Dougan G., Parkhill J.;
RT   "Pseudogene accumulation in the evolutionary histories of Salmonella
RT   enterica serovars Paratyphi A and Typhi";
RL   BMC Genomics 10:36-36(2009).
DR   MD5; 8977b3498beb9cf8f3cc125514ee22ef.
DR   BioSample; SAMEA1705953.
DR   EnsemblGenomes-Gn; EBG00000033485.
DR   EnsemblGenomes-Gn; EBG00000033486.
DR   EnsemblGenomes-Gn; EBG00000033487.
DR   EnsemblGenomes-Gn; EBG00000033488.
DR   EnsemblGenomes-Gn; EBG00000033489.
DR   EnsemblGenomes-Gn; EBG00000033490.
DR   EnsemblGenomes-Gn; EBG00000033491.
DR   EnsemblGenomes-Gn; EBG00000033492.
DR   EnsemblGenomes-Gn; EBG00000033493.
DR   EnsemblGenomes-Gn; EBG00000033494.
DR   EnsemblGenomes-Gn; EBG00000033495.
DR   EnsemblGenomes-Gn; EBG00000033496.
DR   EnsemblGenomes-Gn; EBG00000033497.
DR   EnsemblGenomes-Gn; EBG00000033498.
DR   EnsemblGenomes-Gn; EBG00000033499.
DR   EnsemblGenomes-Gn; EBG00000033500.
DR   EnsemblGenomes-Gn; EBG00000033501.
DR   EnsemblGenomes-Gn; EBG00000033502.
DR   EnsemblGenomes-Gn; EBG00000033503.
DR   EnsemblGenomes-Gn; EBG00000033504.
DR   EnsemblGenomes-Gn; EBG00000033505.
DR   EnsemblGenomes-Gn; EBG00000033506.
DR   EnsemblGenomes-Gn; EBG00000033507.
DR   EnsemblGenomes-Gn; EBG00000033508.
DR   EnsemblGenomes-Gn; EBG00000033509.
DR   EnsemblGenomes-Gn; EBG00000033510.
DR   EnsemblGenomes-Gn; EBG00000033511.
DR   EnsemblGenomes-Gn; EBG00000033512.
DR   EnsemblGenomes-Gn; EBG00000033513.
DR   EnsemblGenomes-Gn; EBG00000033514.
DR   EnsemblGenomes-Gn; EBG00000033515.
DR   EnsemblGenomes-Gn; EBG00000033516.
DR   EnsemblGenomes-Gn; EBG00000033517.
DR   EnsemblGenomes-Gn; EBG00000033518.
DR   EnsemblGenomes-Gn; EBG00000033519.
DR   EnsemblGenomes-Gn; EBG00000033520.
DR   EnsemblGenomes-Gn; EBG00000033521.
DR   EnsemblGenomes-Gn; EBG00000033522.
DR   EnsemblGenomes-Gn; EBG00000033523.
DR   EnsemblGenomes-Gn; EBG00000033524.
DR   EnsemblGenomes-Gn; EBG00000033525.
DR   EnsemblGenomes-Gn; EBG00000033526.
DR   EnsemblGenomes-Gn; EBG00000033527.
DR   EnsemblGenomes-Gn; EBG00000033528.
DR   EnsemblGenomes-Gn; EBG00000033529.
DR   EnsemblGenomes-Gn; EBG00000033530.
DR   EnsemblGenomes-Gn; EBG00000033531.
DR   EnsemblGenomes-Gn; EBG00000033532.
DR   EnsemblGenomes-Gn; EBG00000033533.
DR   EnsemblGenomes-Gn; EBG00000033534.
DR   EnsemblGenomes-Gn; EBG00000033535.
DR   EnsemblGenomes-Gn; EBG00000033536.
DR   EnsemblGenomes-Gn; EBG00000033537.
DR   EnsemblGenomes-Gn; EBG00000033538.
DR   EnsemblGenomes-Gn; EBG00000033539.
DR   EnsemblGenomes-Gn; EBG00000033540.
DR   EnsemblGenomes-Gn; EBG00000033541.
DR   EnsemblGenomes-Gn; EBG00000033542.
DR   EnsemblGenomes-Gn; EBG00000033543.
DR   EnsemblGenomes-Gn; EBG00000033544.
DR   EnsemblGenomes-Gn; EBG00000033545.
DR   EnsemblGenomes-Gn; EBG00000033546.
DR   EnsemblGenomes-Gn; EBG00000033547.
DR   EnsemblGenomes-Gn; EBG00000033548.
DR   EnsemblGenomes-Gn; EBG00000033549.
DR   EnsemblGenomes-Gn; EBG00000033550.
DR   EnsemblGenomes-Gn; EBG00000033551.
DR   EnsemblGenomes-Gn; EBG00000033552.
DR   EnsemblGenomes-Gn; EBG00000033553.
DR   EnsemblGenomes-Gn; EBG00000033554.
DR   EnsemblGenomes-Gn; EBG00000033555.
DR   EnsemblGenomes-Gn; EBG00000033556.
DR   EnsemblGenomes-Gn; EBG00000033557.
DR   EnsemblGenomes-Gn; EBG00000033558.
DR   EnsemblGenomes-Gn; EBG00000033559.
DR   EnsemblGenomes-Gn; EBG00000033560.
DR   EnsemblGenomes-Gn; EBG00000033561.
DR   EnsemblGenomes-Gn; EBG00000033562.
DR   EnsemblGenomes-Gn; EBG00000033563.
DR   EnsemblGenomes-Gn; EBG00000033564.
DR   EnsemblGenomes-Gn; EBG00000033565.
DR   EnsemblGenomes-Gn; EBG00000033566.
DR   EnsemblGenomes-Gn; EBG00000033567.
DR   EnsemblGenomes-Gn; EBG00000033568.
DR   EnsemblGenomes-Gn; EBG00000033569.
DR   EnsemblGenomes-Gn; EBG00000033570.
DR   EnsemblGenomes-Gn; EBG00000033571.
DR   EnsemblGenomes-Gn; EBG00000033572.
DR   EnsemblGenomes-Gn; EBG00000033573.
DR   EnsemblGenomes-Gn; EBG00000033574.
DR   EnsemblGenomes-Gn; EBG00000033575.
DR   EnsemblGenomes-Gn; EBG00000033576.
DR   EnsemblGenomes-Gn; EBG00000033577.
DR   EnsemblGenomes-Gn; EBG00000033578.
DR   EnsemblGenomes-Gn; EBG00000033579.
DR   EnsemblGenomes-Gn; EBG00000033580.
DR   EnsemblGenomes-Gn; EBG00000033581.
DR   EnsemblGenomes-Gn; EBG00000033582.
DR   EnsemblGenomes-Gn; EBG00001014901.
DR   EnsemblGenomes-Gn; EBG00001014902.
DR   EnsemblGenomes-Gn; EBG00001014904.
DR   EnsemblGenomes-Gn; EBG00001014905.
DR   EnsemblGenomes-Gn; EBG00001014906.
DR   EnsemblGenomes-Gn; EBG00001014907.
DR   EnsemblGenomes-Gn; EBG00001014908.
DR   EnsemblGenomes-Gn; EBG00001014909.
DR   EnsemblGenomes-Gn; EBG00001014910.
DR   EnsemblGenomes-Gn; EBG00001014911.
DR   EnsemblGenomes-Gn; EBG00001014912.
DR   EnsemblGenomes-Gn; EBG00001014913.
DR   EnsemblGenomes-Gn; EBG00001014914.
DR   EnsemblGenomes-Gn; EBG00001014915.
DR   EnsemblGenomes-Gn; EBG00001014916.
DR   EnsemblGenomes-Gn; EBG00001014917.
DR   EnsemblGenomes-Gn; EBG00001014918.
DR   EnsemblGenomes-Gn; EBG00001014919.
DR   EnsemblGenomes-Gn; EBG00001014920.
DR   EnsemblGenomes-Gn; EBG00001014921.
DR   EnsemblGenomes-Gn; EBG00001014922.
DR   EnsemblGenomes-Gn; EBG00001014923.
DR   EnsemblGenomes-Gn; EBG00001014924.
DR   EnsemblGenomes-Gn; EBG00001014925.
DR   EnsemblGenomes-Gn; EBG00001014926.
DR   EnsemblGenomes-Gn; EBG00001014927.
DR   EnsemblGenomes-Gn; EBG00001014928.
DR   EnsemblGenomes-Gn; EBG00001014929.
DR   EnsemblGenomes-Gn; EBG00001014930.
DR   EnsemblGenomes-Gn; EBG00001014931.
DR   EnsemblGenomes-Gn; EBG00001014932.
DR   EnsemblGenomes-Gn; EBG00001014933.
DR   EnsemblGenomes-Gn; EBG00001014934.
DR   EnsemblGenomes-Gn; EBG00001014935.
DR   EnsemblGenomes-Gn; EBG00001014936.
DR   EnsemblGenomes-Gn; EBG00001014937.
DR   EnsemblGenomes-Gn; EBG00001014938.
DR   EnsemblGenomes-Gn; EBG00001014939.
DR   EnsemblGenomes-Gn; EBG00001014940.
DR   EnsemblGenomes-Gn; EBG00001014941.
DR   EnsemblGenomes-Gn; EBG00001014942.
DR   EnsemblGenomes-Gn; EBG00001014943.
DR   EnsemblGenomes-Gn; EBG00001014944.
DR   EnsemblGenomes-Gn; EBG00001014945.
DR   EnsemblGenomes-Gn; EBG00001014946.
DR   EnsemblGenomes-Gn; EBG00001014948.
DR   EnsemblGenomes-Gn; EBG00001014949.
DR   EnsemblGenomes-Gn; EBG00001014950.
DR   EnsemblGenomes-Gn; EBG00001014951.
DR   EnsemblGenomes-Gn; EBG00001014952.
DR   EnsemblGenomes-Gn; EBG00001014953.
DR   EnsemblGenomes-Gn; EBG00001014954.
DR   EnsemblGenomes-Gn; EBG00001014955.
DR   EnsemblGenomes-Gn; EBG00001014957.
DR   EnsemblGenomes-Gn; EBG00001014958.
DR   EnsemblGenomes-Gn; EBG00001014959.
DR   EnsemblGenomes-Gn; EBG00001014960.
DR   EnsemblGenomes-Gn; EBG00001014961.
DR   EnsemblGenomes-Gn; EBG00001014962.
DR   EnsemblGenomes-Gn; EBG00001014963.
DR   EnsemblGenomes-Gn; EBG00001014964.
DR   EnsemblGenomes-Gn; EBG00001014965.
DR   EnsemblGenomes-Gn; EBG00001014966.
DR   EnsemblGenomes-Gn; EBG00001014967.
DR   EnsemblGenomes-Gn; EBG00001014968.
DR   EnsemblGenomes-Gn; EBG00001014969.
DR   EnsemblGenomes-Gn; EBG00001014970.
DR   EnsemblGenomes-Gn; EBG00001014971.
DR   EnsemblGenomes-Gn; EBG00001014972.
DR   EnsemblGenomes-Gn; EBG00001014973.
DR   EnsemblGenomes-Gn; EBG00001014974.
DR   EnsemblGenomes-Gn; EBG00001014976.
DR   EnsemblGenomes-Gn; EBG00001014977.
DR   EnsemblGenomes-Gn; EBG00001014978.
DR   EnsemblGenomes-Gn; EBG00001014980.
DR   EnsemblGenomes-Gn; EBG00001014981.
DR   EnsemblGenomes-Gn; EBG00001014982.
DR   EnsemblGenomes-Gn; EBG00001014983.
DR   EnsemblGenomes-Gn; EBG00001014984.
DR   EnsemblGenomes-Gn; EBG00001014985.
DR   EnsemblGenomes-Gn; EBG00001014986.
DR   EnsemblGenomes-Gn; EBG00001014987.
DR   EnsemblGenomes-Gn; EBG00001014988.
DR   EnsemblGenomes-Gn; EBG00001014989.
DR   EnsemblGenomes-Gn; EBG00001014990.
DR   EnsemblGenomes-Gn; EBG00001014991.
DR   EnsemblGenomes-Gn; EBG00001014992.
DR   EnsemblGenomes-Gn; EBG00001014993.
DR   EnsemblGenomes-Gn; EBG00001014995.
DR   EnsemblGenomes-Gn; EBG00001014996.
DR   EnsemblGenomes-Gn; EBG00001014997.
DR   EnsemblGenomes-Gn; EBG00001014998.
DR   EnsemblGenomes-Gn; EBG00001014999.
DR   EnsemblGenomes-Gn; EBG00001015000.
DR   EnsemblGenomes-Gn; EBG00001015001.
DR   EnsemblGenomes-Gn; EBG00001015003.
DR   EnsemblGenomes-Gn; EBG00001015004.
DR   EnsemblGenomes-Gn; EBG00001015005.
DR   EnsemblGenomes-Gn; EBG00001015006.
DR   EnsemblGenomes-Gn; EBG00001015007.
DR   EnsemblGenomes-Gn; EBG00001015008.
DR   EnsemblGenomes-Gn; EBG00001015010.
DR   EnsemblGenomes-Gn; EBG00001015012.
DR   EnsemblGenomes-Gn; EBG00001015013.
DR   EnsemblGenomes-Gn; EBG00001015014.
DR   EnsemblGenomes-Gn; EBG00001015015.
DR   EnsemblGenomes-Gn; EBG00001015016.
DR   EnsemblGenomes-Gn; EBG00001015017.
DR   EnsemblGenomes-Gn; EBG00001015019.
DR   EnsemblGenomes-Gn; EBG00001015021.
DR   EnsemblGenomes-Gn; EBG00001015022.
DR   EnsemblGenomes-Gn; EBG00001015024.
DR   EnsemblGenomes-Gn; EBG00001015025.
DR   EnsemblGenomes-Gn; EBG00001015026.
DR   EnsemblGenomes-Gn; EBG00001015027.
DR   EnsemblGenomes-Gn; EBG00001015028.
DR   EnsemblGenomes-Gn; EBG00001015029.
DR   EnsemblGenomes-Gn; EBG00001015030.
DR   EnsemblGenomes-Gn; EBG00001015031.
DR   EnsemblGenomes-Gn; EBG00001015032.
DR   EnsemblGenomes-Gn; EBG00001015033.
DR   EnsemblGenomes-Gn; EBG00001015034.
DR   EnsemblGenomes-Gn; EBG00001015035.
DR   EnsemblGenomes-Gn; EBG00001015036.
DR   EnsemblGenomes-Gn; EBG00001015038.
DR   EnsemblGenomes-Gn; EBG00001015039.
DR   EnsemblGenomes-Gn; EBG00001015040.
DR   EnsemblGenomes-Gn; EBG00001015041.
DR   EnsemblGenomes-Gn; EBG00001015042.
DR   EnsemblGenomes-Gn; EBG00001015043.
DR   EnsemblGenomes-Gn; EBG00001015044.
DR   EnsemblGenomes-Gn; EBG00001015045.
DR   EnsemblGenomes-Gn; EBG00001015046.
DR   EnsemblGenomes-Gn; EBG00001015047.
DR   EnsemblGenomes-Gn; EBG00001015048.
DR   EnsemblGenomes-Gn; EBG00001015049.
DR   EnsemblGenomes-Gn; EBG00001015050.
DR   EnsemblGenomes-Gn; EBG00001015051.
DR   EnsemblGenomes-Gn; EBG00001015052.
DR   EnsemblGenomes-Gn; EBG00001015053.
DR   EnsemblGenomes-Gn; EBG00001015054.
DR   EnsemblGenomes-Gn; EBG00001015055.
DR   EnsemblGenomes-Gn; EBG00001015056.
DR   EnsemblGenomes-Gn; EBG00001015057.
DR   EnsemblGenomes-Gn; EBG00001015058.
DR   EnsemblGenomes-Gn; EBG00001015060.
DR   EnsemblGenomes-Gn; EBG00001015061.
DR   EnsemblGenomes-Gn; EBG00001015062.
DR   EnsemblGenomes-Gn; EBG00001015063.
DR   EnsemblGenomes-Gn; EBG00001015064.
DR   EnsemblGenomes-Gn; EBG00001015065.
DR   EnsemblGenomes-Gn; EBG00001015066.
DR   EnsemblGenomes-Gn; EBG00001015067.
DR   EnsemblGenomes-Gn; EBG00001015068.
DR   EnsemblGenomes-Gn; EBG00001015069.
DR   EnsemblGenomes-Gn; EBG00001015070.
DR   EnsemblGenomes-Gn; EBG00001015071.
DR   EnsemblGenomes-Gn; EBG00001015072.
DR   EnsemblGenomes-Gn; EBG00001015073.
DR   EnsemblGenomes-Gn; EBG00001015074.
DR   EnsemblGenomes-Gn; EBG00001015075.
DR   EnsemblGenomes-Gn; EBG00001015077.
DR   EnsemblGenomes-Gn; EBG00001015079.
DR   EnsemblGenomes-Gn; EBG00001015081.
DR   EnsemblGenomes-Gn; EBG00001015083.
DR   EnsemblGenomes-Gn; EBG00001015084.
DR   EnsemblGenomes-Gn; EBG00001015085.
DR   EnsemblGenomes-Gn; EBG00001015087.
DR   EnsemblGenomes-Gn; EBG00001015089.
DR   EnsemblGenomes-Gn; EBG00001015091.
DR   EnsemblGenomes-Gn; EBG00001015093.
DR   EnsemblGenomes-Gn; EBG00001015095.
DR   EnsemblGenomes-Gn; EBG00001015097.
DR   EnsemblGenomes-Gn; EBG00001015099.
DR   EnsemblGenomes-Gn; EBG00001015100.
DR   EnsemblGenomes-Gn; EBG00001015101.
DR   EnsemblGenomes-Gn; EBG00001015102.
DR   EnsemblGenomes-Gn; EBG00001015105.
DR   EnsemblGenomes-Gn; EBG00001015107.
DR   EnsemblGenomes-Gn; EBG00001015109.
DR   EnsemblGenomes-Gn; EBG00001015111.
DR   EnsemblGenomes-Gn; EBG00001015113.
DR   EnsemblGenomes-Gn; EBG00001015115.
DR   EnsemblGenomes-Gn; EBG00001015117.
DR   EnsemblGenomes-Gn; EBG00001015119.
DR   EnsemblGenomes-Gn; EBG00001015120.
DR   EnsemblGenomes-Gn; EBG00001015121.
DR   EnsemblGenomes-Gn; EBG00001015122.
DR   EnsemblGenomes-Gn; EBG00001015123.
DR   EnsemblGenomes-Gn; EBG00001015124.
DR   EnsemblGenomes-Gn; EBG00001015125.
DR   EnsemblGenomes-Gn; EBG00001015126.
DR   EnsemblGenomes-Gn; EBG00001015127.
DR   EnsemblGenomes-Gn; EBG00001015128.
DR   EnsemblGenomes-Gn; EBG00001015129.
DR   EnsemblGenomes-Gn; EBG00001015131.
DR   EnsemblGenomes-Gn; EBG00001015132.
DR   EnsemblGenomes-Gn; EBG00001015133.
DR   EnsemblGenomes-Gn; EBG00001015134.
DR   EnsemblGenomes-Gn; EBG00001015135.
DR   EnsemblGenomes-Gn; EBG00001015136.
DR   EnsemblGenomes-Gn; EBG00001015137.
DR   EnsemblGenomes-Gn; EBG00001015139.
DR   EnsemblGenomes-Gn; EBG00001015140.
DR   EnsemblGenomes-Gn; EBG00001015141.
DR   EnsemblGenomes-Gn; EBG00001015142.
DR   EnsemblGenomes-Gn; EBG00001015143.
DR   EnsemblGenomes-Gn; EBG00001015144.
DR   EnsemblGenomes-Gn; EBG00001015145.
DR   EnsemblGenomes-Gn; EBG00001015146.
DR   EnsemblGenomes-Gn; EBG00001015147.
DR   EnsemblGenomes-Gn; EBG00001015148.
DR   EnsemblGenomes-Gn; EBG00001015149.
DR   EnsemblGenomes-Gn; EBG00001015150.
DR   EnsemblGenomes-Gn; EBG00001015151.
DR   EnsemblGenomes-Gn; EBG00001015152.
DR   EnsemblGenomes-Gn; EBG00001015153.
DR   EnsemblGenomes-Gn; EBG00001015154.
DR   EnsemblGenomes-Gn; EBG00001015155.
DR   EnsemblGenomes-Gn; EBG00001015156.
DR   EnsemblGenomes-Gn; EBG00001015157.
DR   EnsemblGenomes-Gn; EBG00001015158.
DR   EnsemblGenomes-Gn; EBG00001015159.
DR   EnsemblGenomes-Gn; EBG00001015160.
DR   EnsemblGenomes-Gn; EBG00001015161.
DR   EnsemblGenomes-Gn; EBG00001015162.
DR   EnsemblGenomes-Gn; EBG00001015163.
DR   EnsemblGenomes-Gn; EBG00001015164.
DR   EnsemblGenomes-Gn; EBG00001015165.
DR   EnsemblGenomes-Gn; EBG00001015166.
DR   EnsemblGenomes-Gn; EBG00001015167.
DR   EnsemblGenomes-Gn; EBG00001015168.
DR   EnsemblGenomes-Gn; EBG00001015169.
DR   EnsemblGenomes-Gn; EBG00001015170.
DR   EnsemblGenomes-Gn; SSPA0016a.
DR   EnsemblGenomes-Gn; SSPA0023a.
DR   EnsemblGenomes-Gn; SSPA0032a.
DR   EnsemblGenomes-Gn; SSPA0062a.
DR   EnsemblGenomes-Gn; SSPA0081a.
DR   EnsemblGenomes-Gn; SSPA0097.
DR   EnsemblGenomes-Gn; SSPA0192a.
DR   EnsemblGenomes-Gn; SSPA0196a.
DR   EnsemblGenomes-Gn; SSPA0198a.
DR   EnsemblGenomes-Gn; SSPA0255a.
DR   EnsemblGenomes-Gn; SSPA0280a.
DR   EnsemblGenomes-Gn; SSPA0291a.
DR   EnsemblGenomes-Gn; SSPA0317a.
DR   EnsemblGenomes-Gn; SSPA0329a.
DR   EnsemblGenomes-Gn; SSPA0331a.
DR   EnsemblGenomes-Gn; SSPA0331b.
DR   EnsemblGenomes-Gn; SSPA0335a.
DR   EnsemblGenomes-Gn; SSPA0349a.
DR   EnsemblGenomes-Gn; SSPA0363a.
DR   EnsemblGenomes-Gn; SSPA0418a.
DR   EnsemblGenomes-Gn; SSPA0429a.
DR   EnsemblGenomes-Gn; SSPA0431a.
DR   EnsemblGenomes-Gn; SSPA0431b.
DR   EnsemblGenomes-Gn; SSPA0434a.
DR   EnsemblGenomes-Gn; SSPA0539.
DR   EnsemblGenomes-Gn; SSPA0579a.
DR   EnsemblGenomes-Gn; SSPA0615a.
DR   EnsemblGenomes-Gn; SSPA0621a.
DR   EnsemblGenomes-Gn; SSPA0678a.
DR   EnsemblGenomes-Gn; SSPA0689.
DR   EnsemblGenomes-Gn; SSPA0708.
DR   EnsemblGenomes-Gn; SSPA0719a.
DR   EnsemblGenomes-Gn; SSPA0720a.
DR   EnsemblGenomes-Gn; SSPA0722a.
DR   EnsemblGenomes-Gn; SSPA0754a.
DR   EnsemblGenomes-Gn; SSPA0754b.
DR   EnsemblGenomes-Gn; SSPA0756a.
DR   EnsemblGenomes-Gn; SSPA0775.
DR   EnsemblGenomes-Gn; SSPA0781a.
DR   EnsemblGenomes-Gn; SSPA0816a.
DR   EnsemblGenomes-Gn; SSPA0850a.
DR   EnsemblGenomes-Gn; SSPA0883a.
DR   EnsemblGenomes-Gn; SSPA0920a.
DR   EnsemblGenomes-Gn; SSPA0930a.
DR   EnsemblGenomes-Gn; SSPA0931a.
DR   EnsemblGenomes-Gn; SSPA0934.
DR   EnsemblGenomes-Gn; SSPA0934a.
DR   EnsemblGenomes-Gn; SSPA0934b.
DR   EnsemblGenomes-Gn; SSPA0943a.
DR   EnsemblGenomes-Gn; SSPA1003a.
DR   EnsemblGenomes-Gn; SSPA1014a.
DR   EnsemblGenomes-Gn; SSPA1029a.
DR   EnsemblGenomes-Gn; SSPA1072.
DR   EnsemblGenomes-Gn; SSPA1095a.
DR   EnsemblGenomes-Gn; SSPA1099a.
DR   EnsemblGenomes-Gn; SSPA1103.
DR   EnsemblGenomes-Gn; SSPA1104a.
DR   EnsemblGenomes-Gn; SSPA1104b.
DR   EnsemblGenomes-Gn; SSPA1120a.
DR   EnsemblGenomes-Gn; SSPA1125a.
DR   EnsemblGenomes-Gn; SSPA1127a.
DR   EnsemblGenomes-Gn; SSPA1138a.
DR   EnsemblGenomes-Gn; SSPA1171a.
DR   EnsemblGenomes-Gn; SSPA1173a.
DR   EnsemblGenomes-Gn; SSPA1197a.
DR   EnsemblGenomes-Gn; SSPA1204a.
DR   EnsemblGenomes-Gn; SSPA1214a.
DR   EnsemblGenomes-Gn; SSPA1220a.
DR   EnsemblGenomes-Gn; SSPA1226a.
DR   EnsemblGenomes-Gn; SSPA1268a.
DR   EnsemblGenomes-Gn; SSPA1273a.
DR   EnsemblGenomes-Gn; SSPA1282a.
DR   EnsemblGenomes-Gn; SSPA1290a.
DR   EnsemblGenomes-Gn; SSPA1290b.
DR   EnsemblGenomes-Gn; SSPA1290c.
DR   EnsemblGenomes-Gn; SSPA1365a.
DR   EnsemblGenomes-Gn; SSPA1367a.
DR   EnsemblGenomes-Gn; SSPA1376a.
DR   EnsemblGenomes-Gn; SSPA1376b.
DR   EnsemblGenomes-Gn; SSPA1447.
DR   EnsemblGenomes-Gn; SSPA1481a.
DR   EnsemblGenomes-Gn; SSPA1482a.
DR   EnsemblGenomes-Gn; SSPA1489a.
DR   EnsemblGenomes-Gn; SSPA1531a.
DR   EnsemblGenomes-Gn; SSPA1568a.
DR   EnsemblGenomes-Gn; SSPA1591a.
DR   EnsemblGenomes-Gn; SSPA1599a.
DR   EnsemblGenomes-Gn; SSPA1613a.
DR   EnsemblGenomes-Gn; SSPA1625a.
DR   EnsemblGenomes-Gn; SSPA1631a.
DR   EnsemblGenomes-Gn; SSPA1642a.
DR   EnsemblGenomes-Gn; SSPA1687a.
DR   EnsemblGenomes-Gn; SSPA1699a.
DR   EnsemblGenomes-Gn; SSPA1704a.
DR   EnsemblGenomes-Gn; SSPA1723a.
DR   EnsemblGenomes-Gn; SSPA1790a.
DR   EnsemblGenomes-Gn; SSPA1812.
DR   EnsemblGenomes-Gn; SSPA1820a.
DR   EnsemblGenomes-Gn; SSPA1829a.
DR   EnsemblGenomes-Gn; SSPA1885a.
DR   EnsemblGenomes-Gn; SSPA1928a.
DR   EnsemblGenomes-Gn; SSPA1960a.
DR   EnsemblGenomes-Gn; SSPA1969a.
DR   EnsemblGenomes-Gn; SSPA2014.
DR   EnsemblGenomes-Gn; SSPA2014a.
DR   EnsemblGenomes-Gn; SSPA2017a.
DR   EnsemblGenomes-Gn; SSPA2018.
DR   EnsemblGenomes-Gn; SSPA2018a.
DR   EnsemblGenomes-Gn; SSPA2018b.
DR   EnsemblGenomes-Gn; SSPA2039a.
DR   EnsemblGenomes-Gn; SSPA2045a.
DR   EnsemblGenomes-Gn; SSPA2064a.
DR   EnsemblGenomes-Gn; SSPA2185a.
DR   EnsemblGenomes-Gn; SSPA2202a.
DR   EnsemblGenomes-Gn; SSPA2208a.
DR   EnsemblGenomes-Gn; SSPA2209a.
DR   EnsemblGenomes-Gn; SSPA2289a.
DR   EnsemblGenomes-Gn; SSPA2298a.
DR   EnsemblGenomes-Gn; SSPA2299a.
DR   EnsemblGenomes-Gn; SSPA2301a.
DR   EnsemblGenomes-Gn; SSPA2303.
DR   EnsemblGenomes-Gn; SSPA2304.
DR   EnsemblGenomes-Gn; SSPA2304a.
DR   EnsemblGenomes-Gn; SSPA2312a.
DR   EnsemblGenomes-Gn; SSPA2330a.
DR   EnsemblGenomes-Gn; SSPA2428a.
DR   EnsemblGenomes-Gn; SSPA2449a.
DR   EnsemblGenomes-Gn; SSPA2455a.
DR   EnsemblGenomes-Gn; SSPA2486a.
DR   EnsemblGenomes-Gn; SSPA2493a.
DR   EnsemblGenomes-Gn; SSPA2575a.
DR   EnsemblGenomes-Gn; SSPA2575b.
DR   EnsemblGenomes-Gn; SSPA2603a.
DR   EnsemblGenomes-Gn; SSPA2609a.
DR   EnsemblGenomes-Gn; SSPA2609b.
DR   EnsemblGenomes-Gn; SSPA2613a.
DR   EnsemblGenomes-Gn; SSPA2632a.
DR   EnsemblGenomes-Gn; SSPA2701a.
DR   EnsemblGenomes-Gn; SSPA2777a.
DR   EnsemblGenomes-Gn; SSPA2777b.
DR   EnsemblGenomes-Gn; SSPA2780a.
DR   EnsemblGenomes-Gn; SSPA2781a.
DR   EnsemblGenomes-Gn; SSPA2807a.
DR   EnsemblGenomes-Gn; SSPA2836a.
DR   EnsemblGenomes-Gn; SSPA2899a.
DR   EnsemblGenomes-Gn; SSPA2911a.
DR   EnsemblGenomes-Gn; SSPA2936a.
DR   EnsemblGenomes-Gn; SSPA3009a.
DR   EnsemblGenomes-Gn; SSPA3038a.
DR   EnsemblGenomes-Gn; SSPA3104a.
DR   EnsemblGenomes-Gn; SSPA3121b.
DR   EnsemblGenomes-Gn; SSPA3132a.
DR   EnsemblGenomes-Gn; SSPA3170a.
DR   EnsemblGenomes-Gn; SSPA3202.
DR   EnsemblGenomes-Gn; SSPA3228.
DR   EnsemblGenomes-Gn; SSPA3229.
DR   EnsemblGenomes-Gn; SSPA3234a.
DR   EnsemblGenomes-Gn; SSPA3236a.
DR   EnsemblGenomes-Gn; SSPA3244a.
DR   EnsemblGenomes-Gn; SSPA3250a.
DR   EnsemblGenomes-Gn; SSPA3266a.
DR   EnsemblGenomes-Gn; SSPA3271a.
DR   EnsemblGenomes-Gn; SSPA3279.
DR   EnsemblGenomes-Gn; SSPA3287a.
DR   EnsemblGenomes-Gn; SSPA3303a.
DR   EnsemblGenomes-Gn; SSPA3306a.
DR   EnsemblGenomes-Gn; SSPA3362a.
DR   EnsemblGenomes-Gn; SSPA3365a.
DR   EnsemblGenomes-Gn; SSPA3367.
DR   EnsemblGenomes-Gn; SSPA3368.
DR   EnsemblGenomes-Gn; SSPA3388a.
DR   EnsemblGenomes-Gn; SSPA3397a.
DR   EnsemblGenomes-Gn; SSPA3397b.
DR   EnsemblGenomes-Gn; SSPA3397c.
DR   EnsemblGenomes-Gn; SSPA3419a.
DR   EnsemblGenomes-Gn; SSPA3524a.
DR   EnsemblGenomes-Gn; SSPA3558a.
DR   EnsemblGenomes-Gn; SSPA3581.
DR   EnsemblGenomes-Gn; SSPA3597a.
DR   EnsemblGenomes-Gn; SSPA3607a.
DR   EnsemblGenomes-Gn; SSPA3636a.
DR   EnsemblGenomes-Gn; SSPA3640.
DR   EnsemblGenomes-Gn; SSPA3653a.
DR   EnsemblGenomes-Gn; SSPA3674a.
DR   EnsemblGenomes-Gn; SSPA3732a.
DR   EnsemblGenomes-Gn; SSPA3798a.
DR   EnsemblGenomes-Gn; SSPA3828a.
DR   EnsemblGenomes-Gn; SSPA3828b.
DR   EnsemblGenomes-Gn; SSPA3867a.
DR   EnsemblGenomes-Gn; SSPA3888.
DR   EnsemblGenomes-Gn; SSPA3893.
DR   EnsemblGenomes-Gn; SSPA3916a.
DR   EnsemblGenomes-Gn; SSPA3934a.
DR   EnsemblGenomes-Gn; SSPA3954a.
DR   EnsemblGenomes-Gn; SSPA3989a.
DR   EnsemblGenomes-Gn; SSPA3989b.
DR   EnsemblGenomes-Gn; SSPA3995a.
DR   EnsemblGenomes-Gn; SSPA3995b.
DR   EnsemblGenomes-Gn; SSPA3998a.
DR   EnsemblGenomes-Gn; SSPA3999a.
DR   EnsemblGenomes-Gn; SSPA4008a.
DR   EnsemblGenomes-Gn; SSPA4028a.
DR   EnsemblGenomes-Gn; SSPA4091a.
DR   EnsemblGenomes-Tr; EBG00000033485-1.
DR   EnsemblGenomes-Tr; EBG00000033486-1.
DR   EnsemblGenomes-Tr; EBG00000033487-1.
DR   EnsemblGenomes-Tr; EBG00000033488-1.
DR   EnsemblGenomes-Tr; EBG00000033489-1.
DR   EnsemblGenomes-Tr; EBG00000033490-1.
DR   EnsemblGenomes-Tr; EBG00000033491-1.
DR   EnsemblGenomes-Tr; EBG00000033492-1.
DR   EnsemblGenomes-Tr; EBG00000033493-1.
DR   EnsemblGenomes-Tr; EBG00000033494-1.
DR   EnsemblGenomes-Tr; EBG00000033495-1.
DR   EnsemblGenomes-Tr; EBG00000033496-1.
DR   EnsemblGenomes-Tr; EBG00000033497-1.
DR   EnsemblGenomes-Tr; EBG00000033498-1.
DR   EnsemblGenomes-Tr; EBG00000033499-1.
DR   EnsemblGenomes-Tr; EBG00000033500-1.
DR   EnsemblGenomes-Tr; EBG00000033501-1.
DR   EnsemblGenomes-Tr; EBG00000033502-1.
DR   EnsemblGenomes-Tr; EBG00000033503-1.
DR   EnsemblGenomes-Tr; EBG00000033504-1.
DR   EnsemblGenomes-Tr; EBG00000033505-1.
DR   EnsemblGenomes-Tr; EBG00000033506-1.
DR   EnsemblGenomes-Tr; EBG00000033507-1.
DR   EnsemblGenomes-Tr; EBG00000033508-1.
DR   EnsemblGenomes-Tr; EBG00000033509-1.
DR   EnsemblGenomes-Tr; EBG00000033510-1.
DR   EnsemblGenomes-Tr; EBG00000033511-1.
DR   EnsemblGenomes-Tr; EBG00000033512-1.
DR   EnsemblGenomes-Tr; EBG00000033513-1.
DR   EnsemblGenomes-Tr; EBG00000033514-1.
DR   EnsemblGenomes-Tr; EBG00000033515-1.
DR   EnsemblGenomes-Tr; EBG00000033516-1.
DR   EnsemblGenomes-Tr; EBG00000033517-1.
DR   EnsemblGenomes-Tr; EBG00000033518-1.
DR   EnsemblGenomes-Tr; EBG00000033519-1.
DR   EnsemblGenomes-Tr; EBG00000033520-1.
DR   EnsemblGenomes-Tr; EBG00000033521-1.
DR   EnsemblGenomes-Tr; EBG00000033522-1.
DR   EnsemblGenomes-Tr; EBG00000033523-1.
DR   EnsemblGenomes-Tr; EBG00000033524-1.
DR   EnsemblGenomes-Tr; EBG00000033525-1.
DR   EnsemblGenomes-Tr; EBG00000033526-1.
DR   EnsemblGenomes-Tr; EBG00000033527-1.
DR   EnsemblGenomes-Tr; EBG00000033528-1.
DR   EnsemblGenomes-Tr; EBG00000033529-1.
DR   EnsemblGenomes-Tr; EBG00000033530-1.
DR   EnsemblGenomes-Tr; EBG00000033531-1.
DR   EnsemblGenomes-Tr; EBG00000033532-1.
DR   EnsemblGenomes-Tr; EBG00000033533-1.
DR   EnsemblGenomes-Tr; EBG00000033534-1.
DR   EnsemblGenomes-Tr; EBG00000033535-1.
DR   EnsemblGenomes-Tr; EBG00000033536-1.
DR   EnsemblGenomes-Tr; EBG00000033537-1.
DR   EnsemblGenomes-Tr; EBG00000033538-1.
DR   EnsemblGenomes-Tr; EBG00000033539-1.
DR   EnsemblGenomes-Tr; EBG00000033540-1.
DR   EnsemblGenomes-Tr; EBG00000033541-1.
DR   EnsemblGenomes-Tr; EBG00000033542-1.
DR   EnsemblGenomes-Tr; EBG00000033543-1.
DR   EnsemblGenomes-Tr; EBG00000033544-1.
DR   EnsemblGenomes-Tr; EBG00000033545-1.
DR   EnsemblGenomes-Tr; EBG00000033546-1.
DR   EnsemblGenomes-Tr; EBG00000033547-1.
DR   EnsemblGenomes-Tr; EBG00000033548-1.
DR   EnsemblGenomes-Tr; EBG00000033549-1.
DR   EnsemblGenomes-Tr; EBG00000033550-1.
DR   EnsemblGenomes-Tr; EBG00000033551-1.
DR   EnsemblGenomes-Tr; EBG00000033552-1.
DR   EnsemblGenomes-Tr; EBG00000033553-1.
DR   EnsemblGenomes-Tr; EBG00000033554-1.
DR   EnsemblGenomes-Tr; EBG00000033555-1.
DR   EnsemblGenomes-Tr; EBG00000033556-1.
DR   EnsemblGenomes-Tr; EBG00000033557-1.
DR   EnsemblGenomes-Tr; EBG00000033558-1.
DR   EnsemblGenomes-Tr; EBG00000033559-1.
DR   EnsemblGenomes-Tr; EBG00000033560-1.
DR   EnsemblGenomes-Tr; EBG00000033561-1.
DR   EnsemblGenomes-Tr; EBG00000033562-1.
DR   EnsemblGenomes-Tr; EBG00000033563-1.
DR   EnsemblGenomes-Tr; EBG00000033564-1.
DR   EnsemblGenomes-Tr; EBG00000033565-1.
DR   EnsemblGenomes-Tr; EBG00000033566-1.
DR   EnsemblGenomes-Tr; EBG00000033567-1.
DR   EnsemblGenomes-Tr; EBG00000033568-1.
DR   EnsemblGenomes-Tr; EBG00000033569-1.
DR   EnsemblGenomes-Tr; EBG00000033570-1.
DR   EnsemblGenomes-Tr; EBG00000033571-1.
DR   EnsemblGenomes-Tr; EBG00000033572-1.
DR   EnsemblGenomes-Tr; EBG00000033573-1.
DR   EnsemblGenomes-Tr; EBG00000033574-1.
DR   EnsemblGenomes-Tr; EBG00000033575-1.
DR   EnsemblGenomes-Tr; EBG00000033576-1.
DR   EnsemblGenomes-Tr; EBG00000033577-1.
DR   EnsemblGenomes-Tr; EBG00000033578-1.
DR   EnsemblGenomes-Tr; EBG00000033579-1.
DR   EnsemblGenomes-Tr; EBG00000033580-1.
DR   EnsemblGenomes-Tr; EBG00000033581-1.
DR   EnsemblGenomes-Tr; EBG00000033582-1.
DR   EnsemblGenomes-Tr; EBT00001539920.
DR   EnsemblGenomes-Tr; EBT00001539922.
DR   EnsemblGenomes-Tr; EBT00001539924.
DR   EnsemblGenomes-Tr; EBT00001539926.
DR   EnsemblGenomes-Tr; EBT00001539928.
DR   EnsemblGenomes-Tr; EBT00001539933.
DR   EnsemblGenomes-Tr; EBT00001539936.
DR   EnsemblGenomes-Tr; EBT00001539938.
DR   EnsemblGenomes-Tr; EBT00001539940.
DR   EnsemblGenomes-Tr; EBT00001539943.
DR   EnsemblGenomes-Tr; EBT00001539945.
DR   EnsemblGenomes-Tr; EBT00001539947.
DR   EnsemblGenomes-Tr; EBT00001539949.
DR   EnsemblGenomes-Tr; EBT00001539951.
DR   EnsemblGenomes-Tr; EBT00001539954.
DR   EnsemblGenomes-Tr; EBT00001539957.
DR   EnsemblGenomes-Tr; EBT00001539960.
DR   EnsemblGenomes-Tr; EBT00001539961.
DR   EnsemblGenomes-Tr; EBT00001539963.
DR   EnsemblGenomes-Tr; EBT00001539967.
DR   EnsemblGenomes-Tr; EBT00001539969.
DR   EnsemblGenomes-Tr; EBT00001539971.
DR   EnsemblGenomes-Tr; EBT00001539973.
DR   EnsemblGenomes-Tr; EBT00001539975.
DR   EnsemblGenomes-Tr; EBT00001539977.
DR   EnsemblGenomes-Tr; EBT00001539979.
DR   EnsemblGenomes-Tr; EBT00001539981.
DR   EnsemblGenomes-Tr; EBT00001539986.
DR   EnsemblGenomes-Tr; EBT00001539988.
DR   EnsemblGenomes-Tr; EBT00001539989.
DR   EnsemblGenomes-Tr; EBT00001539991.
DR   EnsemblGenomes-Tr; EBT00001539992.
DR   EnsemblGenomes-Tr; EBT00001539994.
DR   EnsemblGenomes-Tr; EBT00001539996.
DR   EnsemblGenomes-Tr; EBT00001539998.
DR   EnsemblGenomes-Tr; EBT00001539999.
DR   EnsemblGenomes-Tr; EBT00001540001.
DR   EnsemblGenomes-Tr; EBT00001540003.
DR   EnsemblGenomes-Tr; EBT00001540005.
DR   EnsemblGenomes-Tr; EBT00001540008.
DR   EnsemblGenomes-Tr; EBT00001540010.
DR   EnsemblGenomes-Tr; EBT00001540014.
DR   EnsemblGenomes-Tr; EBT00001540017.
DR   EnsemblGenomes-Tr; EBT00001540021.
DR   EnsemblGenomes-Tr; EBT00001540025.
DR   EnsemblGenomes-Tr; EBT00001540028.
DR   EnsemblGenomes-Tr; EBT00001540032.
DR   EnsemblGenomes-Tr; EBT00001540036.
DR   EnsemblGenomes-Tr; EBT00001540040.
DR   EnsemblGenomes-Tr; EBT00001540044.
DR   EnsemblGenomes-Tr; EBT00001540047.
DR   EnsemblGenomes-Tr; EBT00001540051.
DR   EnsemblGenomes-Tr; EBT00001540057.
DR   EnsemblGenomes-Tr; EBT00001540065.
DR   EnsemblGenomes-Tr; EBT00001540070.
DR   EnsemblGenomes-Tr; EBT00001540072.
DR   EnsemblGenomes-Tr; EBT00001540075.
DR   EnsemblGenomes-Tr; EBT00001540085.
DR   EnsemblGenomes-Tr; EBT00001540086.
DR   EnsemblGenomes-Tr; EBT00001540093.
DR   EnsemblGenomes-Tr; EBT00001540096.
DR   EnsemblGenomes-Tr; EBT00001540098.
DR   EnsemblGenomes-Tr; EBT00001540101.
DR   EnsemblGenomes-Tr; EBT00001540103.
DR   EnsemblGenomes-Tr; EBT00001540108.
DR   EnsemblGenomes-Tr; EBT00001540112.
DR   EnsemblGenomes-Tr; EBT00001540115.
DR   EnsemblGenomes-Tr; EBT00001540117.
DR   EnsemblGenomes-Tr; EBT00001540123.
DR   EnsemblGenomes-Tr; EBT00001540130.
DR   EnsemblGenomes-Tr; EBT00001540132.
DR   EnsemblGenomes-Tr; EBT00001540136.
DR   EnsemblGenomes-Tr; EBT00001540141.
DR   EnsemblGenomes-Tr; EBT00001540146.
DR   EnsemblGenomes-Tr; EBT00001540150.
DR   EnsemblGenomes-Tr; EBT00001540154.
DR   EnsemblGenomes-Tr; EBT00001540156.
DR   EnsemblGenomes-Tr; EBT00001540160.
DR   EnsemblGenomes-Tr; EBT00001540167.
DR   EnsemblGenomes-Tr; EBT00001540172.
DR   EnsemblGenomes-Tr; EBT00001540175.
DR   EnsemblGenomes-Tr; EBT00001540178.
DR   EnsemblGenomes-Tr; EBT00001540180.
DR   EnsemblGenomes-Tr; EBT00001540183.
DR   EnsemblGenomes-Tr; EBT00001540187.
DR   EnsemblGenomes-Tr; EBT00001540190.
DR   EnsemblGenomes-Tr; EBT00001540194.
DR   EnsemblGenomes-Tr; EBT00001540199.
DR   EnsemblGenomes-Tr; EBT00001540206.
DR   EnsemblGenomes-Tr; EBT00001540210.
DR   EnsemblGenomes-Tr; EBT00001540214.
DR   EnsemblGenomes-Tr; EBT00001540224.
DR   EnsemblGenomes-Tr; EBT00001540228.
DR   EnsemblGenomes-Tr; EBT00001540237.
DR   EnsemblGenomes-Tr; EBT00001540242.
DR   EnsemblGenomes-Tr; EBT00001540248.
DR   EnsemblGenomes-Tr; EBT00001540252.
DR   EnsemblGenomes-Tr; EBT00001540258.
DR   EnsemblGenomes-Tr; EBT00001540263.
DR   EnsemblGenomes-Tr; EBT00001540267.
DR   EnsemblGenomes-Tr; EBT00001540271.
DR   EnsemblGenomes-Tr; EBT00001540277.
DR   EnsemblGenomes-Tr; EBT00001540293.
DR   EnsemblGenomes-Tr; EBT00001540301.
DR   EnsemblGenomes-Tr; EBT00001540304.
DR   EnsemblGenomes-Tr; EBT00001540310.
DR   EnsemblGenomes-Tr; EBT00001540314.
DR   EnsemblGenomes-Tr; EBT00001540319.
DR   EnsemblGenomes-Tr; EBT00001540320.
DR   EnsemblGenomes-Tr; EBT00001540325.
DR   EnsemblGenomes-Tr; EBT00001540331.
DR   EnsemblGenomes-Tr; EBT00001540336.
DR   EnsemblGenomes-Tr; EBT00001540345.
DR   EnsemblGenomes-Tr; EBT00001540351.
DR   EnsemblGenomes-Tr; EBT00001540353.
DR   EnsemblGenomes-Tr; EBT00001540355.
DR   EnsemblGenomes-Tr; EBT00001540366.
DR   EnsemblGenomes-Tr; EBT00001540370.
DR   EnsemblGenomes-Tr; EBT00001540377.
DR   EnsemblGenomes-Tr; EBT00001540382.
DR   EnsemblGenomes-Tr; EBT00001540389.
DR   EnsemblGenomes-Tr; EBT00001540394.
DR   EnsemblGenomes-Tr; EBT00001540407.
DR   EnsemblGenomes-Tr; EBT00001540413.
DR   EnsemblGenomes-Tr; EBT00001540419.
DR   EnsemblGenomes-Tr; EBT00001540426.
DR   EnsemblGenomes-Tr; EBT00001540430.
DR   EnsemblGenomes-Tr; EBT00001540433.
DR   EnsemblGenomes-Tr; EBT00001540435.
DR   EnsemblGenomes-Tr; EBT00001540437.
DR   EnsemblGenomes-Tr; EBT00001540439.
DR   EnsemblGenomes-Tr; EBT00001540443.
DR   EnsemblGenomes-Tr; EBT00001540449.
DR   EnsemblGenomes-Tr; EBT00001540455.
DR   EnsemblGenomes-Tr; EBT00001540461.
DR   EnsemblGenomes-Tr; EBT00001540468.
DR   EnsemblGenomes-Tr; EBT00001540477.
DR   EnsemblGenomes-Tr; EBT00001540480.
DR   EnsemblGenomes-Tr; EBT00001540482.
DR   EnsemblGenomes-Tr; EBT00001540484.
DR   EnsemblGenomes-Tr; EBT00001540486.
DR   EnsemblGenomes-Tr; EBT00001540488.
DR   EnsemblGenomes-Tr; EBT00001540492.
DR   EnsemblGenomes-Tr; EBT00001540497.
DR   EnsemblGenomes-Tr; EBT00001540500.
DR   EnsemblGenomes-Tr; EBT00001540507.
DR   EnsemblGenomes-Tr; EBT00001540509.
DR   EnsemblGenomes-Tr; EBT00001540515.
DR   EnsemblGenomes-Tr; EBT00001540519.
DR   EnsemblGenomes-Tr; EBT00001540529.
DR   EnsemblGenomes-Tr; EBT00001540533.
DR   EnsemblGenomes-Tr; EBT00001540543.
DR   EnsemblGenomes-Tr; EBT00001540546.
DR   EnsemblGenomes-Tr; EBT00001540553.
DR   EnsemblGenomes-Tr; EBT00001540560.
DR   EnsemblGenomes-Tr; EBT00001540563.
DR   EnsemblGenomes-Tr; EBT00001540565.
DR   EnsemblGenomes-Tr; EBT00001540566.
DR   EnsemblGenomes-Tr; EBT00001540567.
DR   EnsemblGenomes-Tr; EBT00001540576.
DR   EnsemblGenomes-Tr; EBT00001540581.
DR   EnsemblGenomes-Tr; EBT00001540588.
DR   EnsemblGenomes-Tr; EBT00001540595.
DR   EnsemblGenomes-Tr; EBT00001540600.
DR   EnsemblGenomes-Tr; EBT00001540606.
DR   EnsemblGenomes-Tr; EBT00001540614.
DR   EnsemblGenomes-Tr; EBT00001540623.
DR   EnsemblGenomes-Tr; EBT00001540628.
DR   EnsemblGenomes-Tr; EBT00001540634.
DR   EnsemblGenomes-Tr; EBT00001540637.
DR   EnsemblGenomes-Tr; EBT00001540641.
DR   EnsemblGenomes-Tr; EBT00001540654.
DR   EnsemblGenomes-Tr; EBT00001540663.
DR   EnsemblGenomes-Tr; EBT00001540675.
DR   EnsemblGenomes-Tr; EBT00001540678.
DR   EnsemblGenomes-Tr; EBT00001540681.
DR   EnsemblGenomes-Tr; EBT00001540682.
DR   EnsemblGenomes-Tr; EBT00001540685.
DR   EnsemblGenomes-Tr; EBT00001540689.
DR   EnsemblGenomes-Tr; EBT00001540692.
DR   EnsemblGenomes-Tr; EBT00001540696.
DR   EnsemblGenomes-Tr; EBT00001540699.
DR   EnsemblGenomes-Tr; EBT00001540701.
DR   EnsemblGenomes-Tr; EBT00001540703.
DR   EnsemblGenomes-Tr; EBT00001540706.
DR   EnsemblGenomes-Tr; EBT00001540707.
DR   EnsemblGenomes-Tr; EBT00001540710.
DR   EnsemblGenomes-Tr; EBT00001540715.
DR   EnsemblGenomes-Tr; EBT00001540716.
DR   EnsemblGenomes-Tr; EBT00001540717.
DR   EnsemblGenomes-Tr; EBT00001540721.
DR   EnsemblGenomes-Tr; EBT00001540723.
DR   EnsemblGenomes-Tr; EBT00001540726.
DR   EnsemblGenomes-Tr; EBT00001540727.
DR   EnsemblGenomes-Tr; EBT00001540729.
DR   EnsemblGenomes-Tr; EBT00001540734.
DR   EnsemblGenomes-Tr; EBT00001540737.
DR   EnsemblGenomes-Tr; EBT00001540738.
DR   EnsemblGenomes-Tr; EBT00001540741.
DR   EnsemblGenomes-Tr; EBT00001540744.
DR   EnsemblGenomes-Tr; EBT00001540746.
DR   EnsemblGenomes-Tr; EBT00001540751.
DR   EnsemblGenomes-Tr; EBT00001540754.
DR   EnsemblGenomes-Tr; EBT00001540757.
DR   EnsemblGenomes-Tr; EBT00001540760.
DR   EnsemblGenomes-Tr; EBT00001540763.
DR   EnsemblGenomes-Tr; EBT00001540765.
DR   EnsemblGenomes-Tr; EBT00001540770.
DR   EnsemblGenomes-Tr; EBT00001540773.
DR   EnsemblGenomes-Tr; EBT00001540776.
DR   EnsemblGenomes-Tr; EBT00001540784.
DR   EnsemblGenomes-Tr; EBT00001540786.
DR   EnsemblGenomes-Tr; EBT00001540789.
DR   EnsemblGenomes-Tr; EBT00001540790.
DR   EnsemblGenomes-Tr; EBT00001540792.
DR   EnsemblGenomes-Tr; EBT00001540794.
DR   EnsemblGenomes-Tr; EBT00001540796.
DR   EnsemblGenomes-Tr; EBT00001540798.
DR   EnsemblGenomes-Tr; EBT00001540800.
DR   EnsemblGenomes-Tr; EBT00001540803.
DR   EnsemblGenomes-Tr; EBT00001540807.
DR   EnsemblGenomes-Tr; EBT00001540810.
DR   EnsemblGenomes-Tr; EBT00001540813.
DR   EnsemblGenomes-Tr; EBT00001540816.
DR   EnsemblGenomes-Tr; EBT00001540819.
DR   EnsemblGenomes-Tr; EBT00001540821.
DR   EnsemblGenomes-Tr; EBT00001540827.
DR   EnsemblGenomes-Tr; EBT00001540829.
DR   EnsemblGenomes-Tr; EBT00001540831.
DR   EnsemblGenomes-Tr; EBT00001540834.
DR   EnsemblGenomes-Tr; EBT00001540835.
DR   EnsemblGenomes-Tr; EBT00001540836.
DR   EnsemblGenomes-Tr; EBT00001540838.
DR   EnsemblGenomes-Tr; EBT00001540839.
DR   EnsemblGenomes-Tr; SSPA0016a.
DR   EnsemblGenomes-Tr; SSPA0023a.
DR   EnsemblGenomes-Tr; SSPA0032a.
DR   EnsemblGenomes-Tr; SSPA0062a.
DR   EnsemblGenomes-Tr; SSPA0081a.
DR   EnsemblGenomes-Tr; SSPA0097.
DR   EnsemblGenomes-Tr; SSPA0192a.
DR   EnsemblGenomes-Tr; SSPA0196a.
DR   EnsemblGenomes-Tr; SSPA0198a.
DR   EnsemblGenomes-Tr; SSPA0255a.
DR   EnsemblGenomes-Tr; SSPA0280a.
DR   EnsemblGenomes-Tr; SSPA0291a.
DR   EnsemblGenomes-Tr; SSPA0317a.
DR   EnsemblGenomes-Tr; SSPA0329a.
DR   EnsemblGenomes-Tr; SSPA0331a.
DR   EnsemblGenomes-Tr; SSPA0331b.
DR   EnsemblGenomes-Tr; SSPA0335a.
DR   EnsemblGenomes-Tr; SSPA0349a.
DR   EnsemblGenomes-Tr; SSPA0363a.
DR   EnsemblGenomes-Tr; SSPA0418a.
DR   EnsemblGenomes-Tr; SSPA0429a.
DR   EnsemblGenomes-Tr; SSPA0431a.
DR   EnsemblGenomes-Tr; SSPA0431b.
DR   EnsemblGenomes-Tr; SSPA0434a.
DR   EnsemblGenomes-Tr; SSPA0539.
DR   EnsemblGenomes-Tr; SSPA0579a.
DR   EnsemblGenomes-Tr; SSPA0615a.
DR   EnsemblGenomes-Tr; SSPA0621a.
DR   EnsemblGenomes-Tr; SSPA0678a.
DR   EnsemblGenomes-Tr; SSPA0689.
DR   EnsemblGenomes-Tr; SSPA0697.
DR   EnsemblGenomes-Tr; SSPA0708.
DR   EnsemblGenomes-Tr; SSPA0719a.
DR   EnsemblGenomes-Tr; SSPA0720a.
DR   EnsemblGenomes-Tr; SSPA0722a.
DR   EnsemblGenomes-Tr; SSPA0754a.
DR   EnsemblGenomes-Tr; SSPA0754b.
DR   EnsemblGenomes-Tr; SSPA0756a.
DR   EnsemblGenomes-Tr; SSPA0775.
DR   EnsemblGenomes-Tr; SSPA0781a.
DR   EnsemblGenomes-Tr; SSPA0816a.
DR   EnsemblGenomes-Tr; SSPA0850a.
DR   EnsemblGenomes-Tr; SSPA0883a.
DR   EnsemblGenomes-Tr; SSPA0920a.
DR   EnsemblGenomes-Tr; SSPA0930a.
DR   EnsemblGenomes-Tr; SSPA0931a.
DR   EnsemblGenomes-Tr; SSPA0934.
DR   EnsemblGenomes-Tr; SSPA0934a.
DR   EnsemblGenomes-Tr; SSPA0934b.
DR   EnsemblGenomes-Tr; SSPA0943a.
DR   EnsemblGenomes-Tr; SSPA1003a.
DR   EnsemblGenomes-Tr; SSPA1014a.
DR   EnsemblGenomes-Tr; SSPA1029a.
DR   EnsemblGenomes-Tr; SSPA1072.
DR   EnsemblGenomes-Tr; SSPA1095a.
DR   EnsemblGenomes-Tr; SSPA1099a.
DR   EnsemblGenomes-Tr; SSPA1103.
DR   EnsemblGenomes-Tr; SSPA1104a.
DR   EnsemblGenomes-Tr; SSPA1104b.
DR   EnsemblGenomes-Tr; SSPA1120a.
DR   EnsemblGenomes-Tr; SSPA1125a.
DR   EnsemblGenomes-Tr; SSPA1127a.
DR   EnsemblGenomes-Tr; SSPA1138a.
DR   EnsemblGenomes-Tr; SSPA1171a.
DR   EnsemblGenomes-Tr; SSPA1173a.
DR   EnsemblGenomes-Tr; SSPA1197a.
DR   EnsemblGenomes-Tr; SSPA1204a.
DR   EnsemblGenomes-Tr; SSPA1214a.
DR   EnsemblGenomes-Tr; SSPA1220a.
DR   EnsemblGenomes-Tr; SSPA1226a.
DR   EnsemblGenomes-Tr; SSPA1268a.
DR   EnsemblGenomes-Tr; SSPA1273a.
DR   EnsemblGenomes-Tr; SSPA1282a.
DR   EnsemblGenomes-Tr; SSPA1290a.
DR   EnsemblGenomes-Tr; SSPA1290b.
DR   EnsemblGenomes-Tr; SSPA1290c.
DR   EnsemblGenomes-Tr; SSPA1365a.
DR   EnsemblGenomes-Tr; SSPA1367a.
DR   EnsemblGenomes-Tr; SSPA1376a.
DR   EnsemblGenomes-Tr; SSPA1376b.
DR   EnsemblGenomes-Tr; SSPA1447.
DR   EnsemblGenomes-Tr; SSPA1481a.
DR   EnsemblGenomes-Tr; SSPA1482a.
DR   EnsemblGenomes-Tr; SSPA1489a.
DR   EnsemblGenomes-Tr; SSPA1531a.
DR   EnsemblGenomes-Tr; SSPA1568a.
DR   EnsemblGenomes-Tr; SSPA1591a.
DR   EnsemblGenomes-Tr; SSPA1599a.
DR   EnsemblGenomes-Tr; SSPA1613a.
DR   EnsemblGenomes-Tr; SSPA1625a.
DR   EnsemblGenomes-Tr; SSPA1631a.
DR   EnsemblGenomes-Tr; SSPA1642a.
DR   EnsemblGenomes-Tr; SSPA1687a.
DR   EnsemblGenomes-Tr; SSPA1699a.
DR   EnsemblGenomes-Tr; SSPA1704a.
DR   EnsemblGenomes-Tr; SSPA1723a.
DR   EnsemblGenomes-Tr; SSPA1790a.
DR   EnsemblGenomes-Tr; SSPA1812.
DR   EnsemblGenomes-Tr; SSPA1820a.
DR   EnsemblGenomes-Tr; SSPA1829a.
DR   EnsemblGenomes-Tr; SSPA1885a.
DR   EnsemblGenomes-Tr; SSPA1928a.
DR   EnsemblGenomes-Tr; SSPA1960a.
DR   EnsemblGenomes-Tr; SSPA1969a.
DR   EnsemblGenomes-Tr; SSPA2014.
DR   EnsemblGenomes-Tr; SSPA2014a.
DR   EnsemblGenomes-Tr; SSPA2017a.
DR   EnsemblGenomes-Tr; SSPA2018.
DR   EnsemblGenomes-Tr; SSPA2018a.
DR   EnsemblGenomes-Tr; SSPA2018b.
DR   EnsemblGenomes-Tr; SSPA2039a.
DR   EnsemblGenomes-Tr; SSPA2045a.
DR   EnsemblGenomes-Tr; SSPA2064a.
DR   EnsemblGenomes-Tr; SSPA2185a.
DR   EnsemblGenomes-Tr; SSPA2202a.
DR   EnsemblGenomes-Tr; SSPA2208a.
DR   EnsemblGenomes-Tr; SSPA2209a.
DR   EnsemblGenomes-Tr; SSPA2289a.
DR   EnsemblGenomes-Tr; SSPA2298a.
DR   EnsemblGenomes-Tr; SSPA2299a.
DR   EnsemblGenomes-Tr; SSPA2301a.
DR   EnsemblGenomes-Tr; SSPA2303.
DR   EnsemblGenomes-Tr; SSPA2304.
DR   EnsemblGenomes-Tr; SSPA2304a.
DR   EnsemblGenomes-Tr; SSPA2312a.
DR   EnsemblGenomes-Tr; SSPA2330a.
DR   EnsemblGenomes-Tr; SSPA2428a.
DR   EnsemblGenomes-Tr; SSPA2449a.
DR   EnsemblGenomes-Tr; SSPA2455a.
DR   EnsemblGenomes-Tr; SSPA2486a.
DR   EnsemblGenomes-Tr; SSPA2493a.
DR   EnsemblGenomes-Tr; SSPA2575a.
DR   EnsemblGenomes-Tr; SSPA2575b.
DR   EnsemblGenomes-Tr; SSPA2603a.
DR   EnsemblGenomes-Tr; SSPA2609a.
DR   EnsemblGenomes-Tr; SSPA2609b.
DR   EnsemblGenomes-Tr; SSPA2613a.
DR   EnsemblGenomes-Tr; SSPA2632a.
DR   EnsemblGenomes-Tr; SSPA2701a.
DR   EnsemblGenomes-Tr; SSPA2777a.
DR   EnsemblGenomes-Tr; SSPA2777b.
DR   EnsemblGenomes-Tr; SSPA2780a.
DR   EnsemblGenomes-Tr; SSPA2781a.
DR   EnsemblGenomes-Tr; SSPA2807a.
DR   EnsemblGenomes-Tr; SSPA2836a.
DR   EnsemblGenomes-Tr; SSPA2899a.
DR   EnsemblGenomes-Tr; SSPA2911a.
DR   EnsemblGenomes-Tr; SSPA2936a.
DR   EnsemblGenomes-Tr; SSPA3009a.
DR   EnsemblGenomes-Tr; SSPA3038a.
DR   EnsemblGenomes-Tr; SSPA3104a.
DR   EnsemblGenomes-Tr; SSPA3121b.
DR   EnsemblGenomes-Tr; SSPA3132a.
DR   EnsemblGenomes-Tr; SSPA3170a.
DR   EnsemblGenomes-Tr; SSPA3202.
DR   EnsemblGenomes-Tr; SSPA3228.
DR   EnsemblGenomes-Tr; SSPA3229.
DR   EnsemblGenomes-Tr; SSPA3234a.
DR   EnsemblGenomes-Tr; SSPA3236a.
DR   EnsemblGenomes-Tr; SSPA3244a.
DR   EnsemblGenomes-Tr; SSPA3250a.
DR   EnsemblGenomes-Tr; SSPA3266a.
DR   EnsemblGenomes-Tr; SSPA3271a.
DR   EnsemblGenomes-Tr; SSPA3279.
DR   EnsemblGenomes-Tr; SSPA3287a.
DR   EnsemblGenomes-Tr; SSPA3303a.
DR   EnsemblGenomes-Tr; SSPA3306a.
DR   EnsemblGenomes-Tr; SSPA3362a.
DR   EnsemblGenomes-Tr; SSPA3365a.
DR   EnsemblGenomes-Tr; SSPA3367.
DR   EnsemblGenomes-Tr; SSPA3368.
DR   EnsemblGenomes-Tr; SSPA3388a.
DR   EnsemblGenomes-Tr; SSPA3397a.
DR   EnsemblGenomes-Tr; SSPA3397b.
DR   EnsemblGenomes-Tr; SSPA3397c.
DR   EnsemblGenomes-Tr; SSPA3419a.
DR   EnsemblGenomes-Tr; SSPA3524a.
DR   EnsemblGenomes-Tr; SSPA3558a.
DR   EnsemblGenomes-Tr; SSPA3581.
DR   EnsemblGenomes-Tr; SSPA3597a.
DR   EnsemblGenomes-Tr; SSPA3607a.
DR   EnsemblGenomes-Tr; SSPA3636a.
DR   EnsemblGenomes-Tr; SSPA3640.
DR   EnsemblGenomes-Tr; SSPA3653a.
DR   EnsemblGenomes-Tr; SSPA3674a.
DR   EnsemblGenomes-Tr; SSPA3732a.
DR   EnsemblGenomes-Tr; SSPA3798a.
DR   EnsemblGenomes-Tr; SSPA3828a.
DR   EnsemblGenomes-Tr; SSPA3828b.
DR   EnsemblGenomes-Tr; SSPA3867a.
DR   EnsemblGenomes-Tr; SSPA3888.
DR   EnsemblGenomes-Tr; SSPA3893.
DR   EnsemblGenomes-Tr; SSPA3916a.
DR   EnsemblGenomes-Tr; SSPA3934a.
DR   EnsemblGenomes-Tr; SSPA3954a.
DR   EnsemblGenomes-Tr; SSPA3989a.
DR   EnsemblGenomes-Tr; SSPA3989b.
DR   EnsemblGenomes-Tr; SSPA3995a.
DR   EnsemblGenomes-Tr; SSPA3995b.
DR   EnsemblGenomes-Tr; SSPA3998a.
DR   EnsemblGenomes-Tr; SSPA3999a.
DR   EnsemblGenomes-Tr; SSPA4008a.
DR   EnsemblGenomes-Tr; SSPA4028a.
DR   EnsemblGenomes-Tr; SSPA4091a.
DR   EuropePMC; PMC2577856; 18714091.
DR   EuropePMC; PMC2658671; 19159446.
DR   EuropePMC; PMC2722999; 19497932.
DR   EuropePMC; PMC2884544; 20388197.
DR   EuropePMC; PMC2886058; 20492644.
DR   EuropePMC; PMC3098285; 21625519.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3907412; 24498453.
DR   EuropePMC; PMC5933809; 29684021.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01389; isrF.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; FM200053.
DR   SILVA-SSU; FM200053.
FH   Key             Location/Qualifiers
FT   source          1..4581797
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Paratyphi A str. AKU_12601"
FT                   /sub_species="enterica"
FT                   /strain="AKU12601"
FT                   /mol_type="genomic DNA"
FT                   /country="Pakistan:Karachi"
FT                   /serovar="Paratyphi A"
FT                   /db_xref="taxon:554290"
FT   CDS_pept        229..294
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="SSPA0001"
FT                   /product="thr operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58108"
FT                   /db_xref="GOA:B5BLG7"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLG7"
FT                   /protein_id="CAR58108.1"
FT                   /translation="MNRISTTTITTITITTGNGAG"
FT   CDS_pept        376..2838
FT                   /transl_table=11
FT                   /locus_tag="SSPA0002"
FT                   /product="aspartokinase I/homoserine dehydrogenase I"
FT                   /note="similar to Salmonella typhi CT18 aspartokinase
FT                   I/homoserine dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58109"
FT                   /protein_id="CAR58109.1"
FT                   ALSWKLGV"
FT   CDS_pept        2840..3769
FT                   /transl_table=11
FT                   /locus_tag="SSPA0003"
FT                   /product="homoserine kinase"
FT                   /note="similar to Salmonella typhi CT18 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58110"
FT                   /db_xref="GOA:B5BLG9"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLG9"
FT                   /protein_id="CAR58110.1"
FT   CDS_pept        3773..5059
FT                   /transl_table=11
FT                   /locus_tag="SSPA0004"
FT                   /product="threonine synthase"
FT                   /note="similar to Salmonella typhi CT18 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58111"
FT                   /protein_id="CAR58111.1"
FT   CDS_pept        complement(5153..5926)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58112"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLH1"
FT                   /protein_id="CAR58112.1"
FT   CDS_pept        complement(6005..7435)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0005a"
FT                   /product="Putative amino-acid transport protein"
FT                   /note="pseudogene in Paratyphi A strain ATCC9150 (SPA0006)
FT                   due to single base deletion"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0005a"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58113"
FT                   /protein_id="CAR58113.1"
FT                   PDIEPQLAPDTWDATSRD"
FT   variation       6084..6085
FT                   /replace="gg"
FT                   /note="deletion in Paratyphi A strain ATCC9150 (SPA0006)"
FT   CDS_pept        7704..8657
FT                   /transl_table=11
FT                   /locus_tag="SSPA0006"
FT                   /product="transaldolase B"
FT                   /note="similar to Salmonella typhi CT18 transaldolase B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58114"
FT                   /protein_id="CAR58114.1"
FT   CDS_pept        8768..9358
FT                   /transl_table=11
FT                   /locus_tag="SSPA0007"
FT                   /product="molybdopterin biosynthesis Mog protein"
FT                   /note="similar to Salmonella typhi CT18 molybdopterin
FT                   biosynthesis Mog protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58115"
FT                   /protein_id="CAR58115.1"
FT   CDS_pept        complement(9415..9981)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58116"
FT                   /protein_id="CAR58116.1"
FT   CDS_pept        complement(10131..10844)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58117"
FT                   /protein_id="CAR58117.1"
FT                   LQIACLRRMMAAVQA"
FT   CDS_pept        complement(10880..11284)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58118"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLH7"
FT                   /protein_id="CAR58118.1"
FT   CDS_pept        11634..13550
FT                   /transl_table=11
FT                   /locus_tag="SSPA0011"
FT                   /product="DnaK protein (heat shock protein 70)"
FT                   /note="similar to Salmonella typhi CT18 DnaK protein (heat
FT                   shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58119"
FT                   /db_xref="GOA:B5BLH8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLH8"
FT                   /protein_id="CAR58119.1"
FT                   DKK"
FT   CDS_pept        13636..14763
FT                   /transl_table=11
FT                   /locus_tag="SSPA0012"
FT                   /product="DnaJ protein"
FT                   /note="similar to Salmonella typhi CT18 DnaJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58120"
FT                   /db_xref="GOA:B5BLH9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLH9"
FT                   /protein_id="CAR58120.1"
FT   CDS_pept        15047..15994
FT                   /transl_table=11
FT                   /locus_tag="SSPA0013"
FT                   /product="putative regulatory protein"
FT                   /note="similar to Salmonella typhi CT18 putative regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58121"
FT                   /protein_id="CAR58121.1"
FT   CDS_pept        16121..16465
FT                   /transl_table=11
FT                   /locus_tag="SSPA0014"
FT                   /product="putative phage protein"
FT                   /note="similar to Salmonella typhi CT18 putative phage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58122"
FT                   /protein_id="CAR58122.1"
FT                   KKIIEGNNSD"
FT   CDS_pept        complement(16526..17059)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58123"
FT                   /protein_id="CAR58123.1"
FT                   NEQFIYGWIKNRVT"
FT   CDS_pept        complement(17076..17519)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0016"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58124"
FT                   /protein_id="CAR58124.1"
FT   CDS_pept        17900..19999
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0016a"
FT                   /product="putative chitinase (pseudogene)"
FT   CDS_pept        20031..23087
FT                   /transl_table=11
FT                   /locus_tag="SSPA0017"
FT                   /product="putative hydroxymethyltransferase"
FT                   /note="similar to Salmonella typhimurium putative
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58126"
FT                   /protein_id="CAR58126.1"
FT   CDS_pept        23368..24072
FT                   /transl_table=11
FT                   /locus_tag="SSPA0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58127"
FT                   /protein_id="CAR58127.1"
FT                   RLTALGKLPVAY"
FT   CDS_pept        24502..25044
FT                   /transl_table=11
FT                   /locus_tag="SSPA0019"
FT                   /product="fimbrial subunit"
FT                   /note="similar to Salmonella typhi CT18 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58128"
FT                   /protein_id="CAR58128.1"
FT                   ATAGNVTATATFSMVYS"
FT   CDS_pept        25145..25831
FT                   /transl_table=11
FT                   /locus_tag="SSPA0020"
FT                   /product="fimbrial chaperone"
FT                   /note="similar to Salmonella typhi CT18 fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58129"
FT                   /protein_id="CAR58129.1"
FT                   RVCPAS"
FT   CDS_pept        25836..28457
FT                   /transl_table=11
FT                   /locus_tag="SSPA0021"
FT                   /product="fimbrial usher"
FT                   /note="similar to Salmonella typhimurium fimbrial usher"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58130"
FT                   /protein_id="CAR58130.1"
FT                   CH"
FT   CDS_pept        28458..29465
FT                   /transl_table=11
FT                   /locus_tag="SSPA0022"
FT                   /product="fimbrial subunit"
FT                   /note="similar to Salmonella typhi CT18 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58131"
FT                   /protein_id="CAR58131.1"
FT   CDS_pept        29466..30011
FT                   /transl_table=11
FT                   /locus_tag="SSPA0023"
FT                   /product="fimbrial subunit"
FT                   /note="similar to Salmonella typhi CT18 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58132"
FT                   /protein_id="CAR58132.1"
FT                   TVTSGNATAVMYFDMQYE"
FT   CDS_pept        30027..30545
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="bcfF"
FT                   /locus_tag="SSPA0023a"
FT                   /product="fimbrial subunit (pseudogene)"
FT   CDS_pept        30538..31242
FT                   /transl_table=11
FT                   /locus_tag="SSPA0024"
FT                   /product="fimbrial chaperone"
FT                   /note="similar to Salmonella typhi CT18 fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58134"
FT                   /protein_id="CAR58134.1"
FT                   MTAQTVDLTRIH"
FT   CDS_pept        31307..32152
FT                   /transl_table=11
FT                   /locus_tag="SSPA0025"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58135"
FT                   /protein_id="CAR58135.1"
FT                   "
FT   CDS_pept        32191..32478
FT                   /transl_table=11
FT                   /locus_tag="SSPA0026"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58136"
FT                   /protein_id="CAR58136.1"
FT   CDS_pept        complement(32578..33027)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0027"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58137"
FT                   /protein_id="CAR58137.1"
FT   CDS_pept        33397..34392
FT                   /transl_table=11
FT                   /locus_tag="SSPA0028"
FT                   /product="putative transcriptional regulator (lysR family)"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator (lysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58138"
FT                   /protein_id="CAR58138.1"
FT   CDS_pept        complement(34409..34846)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0029"
FT                   /product="putative transcription regulator"
FT                   /note="similar to Salmonella typhimurium putative
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58139"
FT                   /protein_id="CAR58139.1"
FT   CDS_pept        35369..37087
FT                   /transl_table=11
FT                   /locus_tag="SSPA0030"
FT                   /product="possible sulfatase"
FT                   /note="similar to Salmonella typhi CT18 possible sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58140"
FT                   /protein_id="CAR58140.1"
FT   CDS_pept        complement(37133..38704)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0031"
FT                   /product="putative secreted 5'-nucleotidase"
FT                   /note="similar to Salmonella typhi CT18 putative secreted
FT                   5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58141"
FT                   /protein_id="CAR58141.1"
FT                   VDDISK"
FT   CDS_pept        complement(38803..39564)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0032"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58142"
FT                   /protein_id="CAR58142.1"
FT   CDS_pept        40158..41630
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0032a"
FT                   /product="putative secreted sulfatase (pseudogene)"
FT   CDS_pept        41732..42919
FT                   /transl_table=11
FT                   /locus_tag="SSPA0033"
FT                   /product="possible sulfatase regulatory protein"
FT                   /note="similar to Salmonella typhi CT18 possible sulfatase
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58144"
FT                   /protein_id="CAR58144.1"
FT   CDS_pept        42944..44191
FT                   /transl_table=11
FT                   /locus_tag="SSPA0034"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58145"
FT                   /protein_id="CAR58145.1"
FT                   VAVLDYLKFEYNASCN"
FT   CDS_pept        44318..46033
FT                   /transl_table=11
FT                   /locus_tag="SSPA0035"
FT                   /product="possible sulfatase"
FT                   /note="similar to Salmonella typhi CT18 possible sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58146"
FT                   /protein_id="CAR58146.1"
FT   CDS_pept        46196..47362
FT                   /transl_table=11
FT                   /locus_tag="SSPA0036"
FT                   /product="Na(+)/H(+) antiporter 1"
FT                   /note="similar to Salmonella typhi CT18 Na(+)/H(+)
FT                   antiporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58147"
FT                   /protein_id="CAR58147.1"
FT   CDS_pept        47424..48323
FT                   /transl_table=11
FT                   /locus_tag="SSPA0037"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="similar to Salmonella typhi CT18 transcriptional
FT                   activator protein NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58148"
FT                   /protein_id="CAR58148.1"
FT                   PAVQRICNADYSALFKLQ"
FT   CDS_pept        complement(48402..50432)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0038"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="similar to Salmonella typhi CT18 putative glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58149"
FT                   /protein_id="CAR58149.1"
FT   CDS_pept        complement(50457..51830)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0039"
FT                   /product="putative transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58150"
FT                   /protein_id="CAR58150.1"
FT   CDS_pept        complement(52286..52549)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0040"
FT                   /product="30S ribosomal protein S20"
FT                   /note="similar to Salmonella typhi CT18 30S ribosomal
FT                   protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58151"
FT                   /db_xref="GOA:B5BLK7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLK7"
FT                   /protein_id="CAR58151.1"
FT   CDS_pept        52655..52870
FT                   /transl_table=11
FT                   /locus_tag="SSPA0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58152"
FT                   /protein_id="CAR58152.1"
FT   CDS_pept        52878..53816
FT                   /transl_table=11
FT                   /locus_tag="SSPA0042"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="similar to Salmonella typhi CT18 riboflavin
FT                   biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58153"
FT                   /protein_id="CAR58153.1"
FT   CDS_pept        53861..56695
FT                   /transl_table=11
FT                   /locus_tag="SSPA0043"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="similar to Salmonella typhi CT18 isoleucyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58154"
FT                   /db_xref="GOA:B5BLL0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLL0"
FT                   /protein_id="CAR58154.1"
FT                   VSNIAGNGEQRKFA"
FT   CDS_pept        56695..57195
FT                   /transl_table=11
FT                   /locus_tag="SSPA0044"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="similar to Salmonella typhi CT18 lipoprotein signal
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58155"
FT                   /db_xref="GOA:B5BLL1"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLL1"
FT                   /protein_id="CAR58155.1"
FT                   EQA"
FT   CDS_pept        57350..57799
FT                   /transl_table=11
FT                   /locus_tag="SSPA0045"
FT                   /product="probable FkbB-type 16 kD peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /note="similar to Salmonella typhi Ty2 probable FkbB-type
FT                   16 kD peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58156"
FT                   /protein_id="CAR58156.1"
FT   CDS_pept        57802..58752
FT                   /transl_table=11
FT                   /locus_tag="SSPA0046"
FT                   /product="LytB protein"
FT                   /note="similar to Salmonella typhi CT18 LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58157"
FT                   /db_xref="GOA:B5BLL3"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLL3"
FT                   /protein_id="CAR58157.1"
FT   CDS_pept        58952..60154
FT                   /transl_table=11
FT                   /locus_tag="SSPA0047"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58158"
FT                   /protein_id="CAR58158.1"
FT                   Q"
FT   CDS_pept        60170..61084
FT                   /transl_table=11
FT                   /locus_tag="SSPA0048"
FT                   /product="putative nucleoside hydrolase (IUNH family)"
FT                   /note="similar to Salmonella typhi Ty2 putative nucleoside
FT                   hydrolase (IUNH family)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58159"
FT                   /db_xref="GOA:B5BLL5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLL5"
FT                   /protein_id="CAR58159.1"
FT   CDS_pept        complement(61106..61792)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0049"
FT                   /product="transcriptional regulatory protein citb"
FT                   /note="similar to Salmonella typhi CT18 transcriptional
FT                   regulatory protein citb"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58160"
FT                   /protein_id="CAR58160.1"
FT                   LYRGKV"
FT   CDS_pept        complement(61794..63413)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0050"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 sensor kinase cita"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58161"
FT                   /protein_id="CAR58161.1"
FT   CDS_pept        complement(63548..64831)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0051"
FT                   /product="oxaloacetate decarboxylase beta chain"
FT                   /note="similar to Salmonella typhi CT18 oxaloacetate
FT                   decarboxylase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58162"
FT                   /protein_id="CAR58162.1"
FT   CDS_pept        complement(64844..66610)
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="SSPA0052"
FT                   /product="oxaloacetate decarboxylase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58163"
FT                   /protein_id="CAR58163.1"
FT                   AVSVGDPLMTLA"
FT   CDS_pept        complement(66626..66865)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0054"
FT                   /product="oxaloacetate decarboxylase gamma chain"
FT                   /note="similar to Salmonella typhi CT18 oxaloacetate
FT                   decarboxylase gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58164"
FT                   /protein_id="CAR58164.1"
FT   CDS_pept        complement(67024..68364)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0055"
FT                   /product="citrate-sodium symporter"
FT                   /note="similar to Salmonella typhi CT18 citrate-sodium
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58165"
FT                   /protein_id="CAR58165.1"
FT   CDS_pept        68609..69652
FT                   /transl_table=11
FT                   /locus_tag="SSPA0056"
FT                   /product="[citrate (PRO-3S)-lyase] ligase"
FT                   /note="similar to Salmonella typhi Ty2 [citrate
FT                   (PRO-3S)-lyase] ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58166"
FT                   /protein_id="CAR58166.1"
FT                   ARHTETI"
FT   CDS_pept        69682..69975
FT                   /transl_table=11
FT                   /locus_tag="SSPA0057"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /note="similar to Salmonella typhi Ty2 citrate lyase acyl
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58167"
FT                   /protein_id="CAR58167.1"
FT   CDS_pept        69972..70841
FT                   /transl_table=11
FT                   /locus_tag="SSPA0058"
FT                   /product="citrate lyase beta chain"
FT                   /note="similar to Salmonella typhi Ty2 citrate lyase beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58168"
FT                   /protein_id="CAR58168.1"
FT                   LSASGIRD"
FT   CDS_pept        70852..72372
FT                   /transl_table=11
FT                   /locus_tag="SSPA0059"
FT                   /product="citrate lyase alpha chain"
FT                   /note="similar to Salmonella typhi Ty2 citrate lyase alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58169"
FT                   /protein_id="CAR58169.1"
FT   CDS_pept        72372..72923
FT                   /transl_table=11
FT                   /locus_tag="SSPA0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi Ty2 citx protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58170"
FT                   /protein_id="CAR58170.1"
FT   CDS_pept        72901..73809
FT                   /transl_table=11
FT                   /locus_tag="SSPA0061"
FT                   /product="CitG protein"
FT                   /note="similar to Salmonella typhi Ty2 CitG protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58171"
FT                   /protein_id="CAR58171.1"
FT   CDS_pept        73989..74810
FT                   /transl_table=11
FT                   /locus_tag="SSPA0062"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="similar to Salmonella typhi CT18 dihydrodipicolinate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58172"
FT                   /db_xref="GOA:B5BL41"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL41"
FT                   /protein_id="CAR58172.1"
FT   CDS_pept        74965..75205
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0062a"
FT                   /product="hypothetical protein (pseudogene)"
FT   CDS_pept        75671..76819
FT                   /transl_table=11
FT                   /locus_tag="SSPA0063"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /note="similar to Salmonella typhi CT18 carbamoyl-phosphate
FT                   synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58174"
FT                   /protein_id="CAR58174.1"
FT   CDS_pept        76838..80065
FT                   /transl_table=11
FT                   /locus_tag="SSPA0064"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /note="similar to Salmonella typhi CT18 carbamoyl-phosphate
FT                   synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58175"
FT                   /protein_id="CAR58175.1"
FT   CDS_pept        80339..80734
FT                   /transl_table=11
FT                   /locus_tag="SSPA0065"
FT                   /product="transcriptional activator CaiF"
FT                   /note="similar to Salmonella typhi CT18 transcriptional
FT                   activator CaiF"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58176"
FT                   /protein_id="CAR58176.1"
FT   CDS_pept        complement(80812..81408)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0066"
FT                   /product="carnitine operon protein CaiE"
FT                   /note="similar to Salmonella typhi CT18 carnitine operon
FT                   protein CaiE"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58177"
FT                   /db_xref="GOA:B5BL53"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL53"
FT                   /protein_id="CAR58177.1"
FT   CDS_pept        complement(81519..82304)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0067"
FT                   /product="carnitine racemase"
FT                   /note="similar to Salmonella typhi CT18 carnitine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58178"
FT                   /db_xref="GOA:B5BL54"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL54"
FT                   /protein_id="CAR58178.1"
FT   CDS_pept        complement(82358..83911)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0068"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /note="similar to Salmonella typhi CT18 probable
FT                   crotonobetaine/carnitine-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58179"
FT                   /db_xref="GOA:B5BL55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL55"
FT                   /protein_id="CAR58179.1"
FT                   "
FT   CDS_pept        complement(83974..85191)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0069"
FT                   /product="L-carnitine dehydratase"
FT                   /note="similar to Salmonella typhi CT18 L-carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58180"
FT                   /db_xref="GOA:B5BL56"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL56"
FT                   /protein_id="CAR58180.1"
FT                   LAKVED"
FT   CDS_pept        complement(85303..86445)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0070"
FT                   /product="probable carnitine operon oxidoreductase CaiA"
FT                   /note="similar to Salmonella typhi CT18 probable carnitine
FT                   operon oxidoreductase CaiA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58181"
FT                   /db_xref="GOA:B5BL57"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL57"
FT                   /protein_id="CAR58181.1"
FT   CDS_pept        complement(86480..87997)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0071"
FT                   /product="probable carnitine transporter"
FT                   /note="similar to Salmonella typhi CT18 probable carnitine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58182"
FT                   /db_xref="GOA:B5BL58"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL58"
FT                   /protein_id="CAR58182.1"
FT   CDS_pept        88487..89257
FT                   /transl_table=11
FT                   /locus_tag="SSPA0072"
FT                   /product="FixA protein"
FT                   /note="similar to Salmonella typhi CT18 FixA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58183"
FT                   /db_xref="GOA:B5BL59"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL59"
FT                   /protein_id="CAR58183.1"
FT   CDS_pept        89273..90214
FT                   /transl_table=11
FT                   /locus_tag="SSPA0073"
FT                   /product="FixB protein"
FT                   /note="similar to Salmonella typhi CT18 FixB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58184"
FT                   /db_xref="GOA:B5BL14"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL14"
FT                   /protein_id="CAR58184.1"
FT   CDS_pept        90264..91550
FT                   /transl_table=11
FT                   /locus_tag="SSPA0074"
FT                   /product="FixC protein"
FT                   /note="similar to Salmonella typhi CT18 FixC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58185"
FT                   /protein_id="CAR58185.1"
FT   CDS_pept        91547..91834
FT                   /transl_table=11
FT                   /locus_tag="SSPA0075"
FT                   /product="ferredoxin like protein FixX"
FT                   /note="similar to Salmonella typhi CT18 ferredoxin like
FT                   protein FixX"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58186"
FT                   /protein_id="CAR58186.1"
FT   CDS_pept        91982..93322
FT                   /transl_table=11
FT                   /locus_tag="SSPA0076"
FT                   /product="putative metabolite transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative metabolite
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58187"
FT                   /protein_id="CAR58187.1"
FT   CDS_pept        93411..93641
FT                   /transl_table=11
FT                   /locus_tag="SSPA0077"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58188"
FT                   /protein_id="CAR58188.1"
FT   CDS_pept        93913..94335
FT                   /transl_table=11
FT                   /locus_tag="SSPA0078"
FT                   /product="probable secreted protein"
FT                   /note="similar to Salmonella typhi CT18 probable secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58189"
FT                   /protein_id="CAR58189.1"
FT   CDS_pept        complement(94559..94849)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0079"
FT                   /product="probable secreted protein"
FT                   /note="similar to Salmonella typhi CT18 probable secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58190"
FT                   /protein_id="CAR58190.1"
FT   CDS_pept        95059..95253
FT                   /transl_table=11
FT                   /locus_tag="SSPA0080"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58191"
FT                   /protein_id="CAR58191.1"
FT   CDS_pept        95747..97636
FT                   /transl_table=11
FT                   /locus_tag="SSPA0081"
FT                   /product="putative sulfatase"
FT                   /note="similar to Salmonella typhimurium putative
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58192"
FT                   /protein_id="CAR58192.1"
FT   CDS_pept        98190..98721
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yabF"
FT                   /locus_tag="SSPA0081a"
FT                   /product="putative NAD(P)H oxidoreductase (pseudogene)"
FT   CDS_pept        98714..100576
FT                   /transl_table=11
FT                   /locus_tag="SSPA0082"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefC"
FT                   /note="similar to Salmonella typhi CT18
FT                   glutathione-regulated potassium-efflux system protein KefC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58194"
FT                   /db_xref="GOA:B5BL23"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL23"
FT                   /protein_id="CAR58194.1"
FT   CDS_pept        100775..101254
FT                   /transl_table=11
FT                   /locus_tag="SSPA0084"
FT                   /product="dihydrofolate reductase type I"
FT                   /note="similar to Salmonella typhi CT18 dihydrofolate
FT                   reductase type I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58195"
FT                   /protein_id="CAR58195.1"
FT   CDS_pept        complement(101360..102208)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0085"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /note="similar to Salmonella typhi CT18
FT                   bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58196"
FT                   /db_xref="GOA:B5BL25"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL25"
FT                   /protein_id="CAR58196.1"
FT                   A"
FT   CDS_pept        complement(102219..102596)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0086"
FT                   /product="CorD protein"
FT                   /note="similar to Salmonella typhi CT18 CorD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58197"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL26"
FT                   /protein_id="CAR58197.1"
FT   CDS_pept        complement(102599..103420)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0087"
FT                   /product="dimethyladenosine transferase"
FT                   /note="similar to Salmonella typhi CT18 dimethyladenosine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58198"
FT                   /db_xref="GOA:B5BL27"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL27"
FT                   /protein_id="CAR58198.1"
FT   CDS_pept        complement(103417..104406)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0088"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /note="similar to Salmonella typhi CT18 pyridoxal phosphate
FT                   biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58199"
FT                   /protein_id="CAR58199.1"
FT   CDS_pept        complement(104406..105692)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0089"
FT                   /product="survival protein SurA precursor"
FT                   /note="similar to Salmonella typhi CT18 survival protein
FT                   SurA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58200"
FT                   /protein_id="CAR58200.1"
FT   CDS_pept        complement(105746..108100)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0090"
FT                   /product="organic solvent tolerance protein precursor"
FT                   /note="similar to Salmonella typhi CT18 organic solvent
FT                   tolerance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58201"
FT                   /protein_id="CAR58201.1"
FT   CDS_pept        108354..109166
FT                   /transl_table=11
FT                   /locus_tag="SSPA0091"
FT                   /product="DnaJ-like protein"
FT                   /note="similar to Salmonella typhi CT18 DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58202"
FT                   /protein_id="CAR58202.1"
FT   CDS_pept        complement(109261..109920)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0092"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /note="similar to Salmonella typhi CT18 ribosomal large
FT                   subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58203"
FT                   /protein_id="CAR58203.1"
FT   CDS_pept        complement(109932..112838)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0093"
FT                   /product="probable ATP-dependent helicase HepA"
FT                   /note="similar to Salmonella typhi CT18 probable
FT                   ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58204"
FT                   /db_xref="GOA:B5BL33"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL33"
FT                   /protein_id="CAR58204.1"
FT   CDS_pept        complement(113012..115363)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0094"
FT                   /product="DNA polymerase II"
FT                   /note="similar to Salmonella typhi CT18 DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58205"
FT                   /protein_id="CAR58205.1"
FT   CDS_pept        complement(join(115407..115625,117441..117845))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0097"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /note="similar to |17229308|ref|NP_485856.1| hypothetical
FT                   protein [Nostoc sp. PCC 7120]"
FT   CDS_pept        complement(115703..116143)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0095"
FT                   /product="putative IS element transposase"
FT                   /note="similar to Salmonella typhi CT18 putative IS element
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58207"
FT                   /protein_id="CAR58207.1"
FT   CDS_pept        116163..117371
FT                   /transl_table=11
FT                   /locus_tag="SSPA0096"
FT                   /product="putative IS element transposase"
FT                   /note="similar to Salmonella typhi CT18 putative IS element
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58208"
FT                   /protein_id="CAR58208.1"
FT                   TRR"
FT   CDS_pept        118363..118782
FT                   /transl_table=11
FT                   /locus_tag="SSPA0098"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58209"
FT                   /protein_id="CAR58209.1"
FT   CDS_pept        complement(118788..119483)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0099"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="similar to Salmonella typhi CT18
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58210"
FT                   /protein_id="CAR58210.1"
FT                   HGAKAYYGQ"
FT   CDS_pept        complement(119624..121126)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0100"
FT                   /product="L-arabinose isomerase"
FT                   /note="similar to Salmonella typhi CT18 L-arabinose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58211"
FT                   /db_xref="GOA:B5BL43"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL43"
FT                   /protein_id="CAR58211.1"
FT   CDS_pept        complement(121137..122846)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0101"
FT                   /product="L-ribulokinase"
FT                   /note="similar to Salmonella typhi CT18 L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58212"
FT                   /db_xref="GOA:B5BL44"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL44"
FT                   /protein_id="CAR58212.1"
FT   CDS_pept        123187..124032
FT                   /transl_table=11
FT                   /locus_tag="SSPA0102"
FT                   /product="arabinose operon regulatory protein"
FT                   /note="similar to Salmonella typhi CT18 arabinose operon
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58213"
FT                   /protein_id="CAR58213.1"
FT                   "
FT   CDS_pept        124151..124918
FT                   /transl_table=11
FT                   /locus_tag="SSPA0103"
FT                   /product="DedA family integral membrane protein"
FT                   /note="similar to Salmonella typhi CT18 DedA family
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58214"
FT                   /protein_id="CAR58214.1"
FT   CDS_pept        complement(124957..125664)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0104"
FT                   /product="hypothetical ABC transporter"
FT                   /note="similar to Salmonella typhi CT18 hypothetical ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58215"
FT                   /protein_id="CAR58215.1"
FT                   SASALLGIKSHIL"
FT   CDS_pept        complement(125648..127255)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0105"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /note="similar to Salmonella typhi CT18 putative ABC
FT                   transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58216"
FT                   /protein_id="CAR58216.1"
FT                   FTLFTLIEKLPGRHAKTD"
FT   CDS_pept        complement(127231..128097)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0106"
FT                   /product="thiamine-binding periplasmic protein precursor"
FT                   /note="similar to Salmonella typhi CT18 thiamine-binding
FT                   periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58217"
FT                   /protein_id="CAR58217.1"
FT                   WQRAVSR"
FT   CDS_pept        complement(128392..130050)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0107"
FT                   /product="putative ABC transporter periplasmic solute
FT                   binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative ABC
FT                   transporter periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58218"
FT                   /protein_id="CAR58218.1"
FT   CDS_pept        complement(130601..131206)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0108"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /note="similar to Salmonella typhi CT18 3-isopropylmalate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58219"
FT                   /db_xref="GOA:B5BLB2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLB2"
FT                   /protein_id="CAR58219.1"
FT   CDS_pept        complement(131217..132617)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0109"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /note="similar to Salmonella typhi CT18 3-isopropylmalate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58220"
FT                   /db_xref="GOA:B5BLB3"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLB3"
FT                   /protein_id="CAR58220.1"
FT                   FADIRSIK"
FT   CDS_pept        complement(132620..133711)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0110"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 3-isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58221"
FT                   /protein_id="CAR58221.1"
FT   CDS_pept        complement(133711..135282)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0111"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="similar to Salmonella typhi CT18 2-isopropylmalate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58222"
FT                   /db_xref="GOA:B5BLB5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLB5"
FT                   /protein_id="CAR58222.1"
FT                   NNKETV"
FT   CDS_pept        complement(135370..135456)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0112"
FT                   /product="leu operon leader peptide"
FT                   /note="similar to Salmonella typhi CT18 leu operon leader
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58223"
FT                   /protein_id="CAR58223.1"
FT                   /translation="MSHIVRFTGLLLLNAFIVRGRPVGGIQH"
FT   CDS_pept        136113..137057
FT                   /transl_table=11
FT                   /locus_tag="SSPA0113"
FT                   /product="probable activator protein in leuABCD operon"
FT                   /note="similar to Salmonella typhi CT18 probable activator
FT                   protein in leuABCD operon"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58224"
FT                   /protein_id="CAR58224.1"
FT   CDS_pept        137385..139103
FT                   /transl_table=11
FT                   /locus_tag="SSPA0114"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /note="similar to Salmonella typhi CT18 acetolactate
FT                   synthase isozyme III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58225"
FT                   /protein_id="CAR58225.1"
FT   CDS_pept        139103..139597
FT                   /transl_table=11
FT                   /locus_tag="SSPA0115"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /note="similar to Salmonella typhi CT18 acetolactate
FT                   synthase isozyme III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58226"
FT                   /protein_id="CAR58226.1"
FT                   R"
FT   CDS_pept        139881..140885
FT                   /transl_table=11
FT                   /locus_tag="SSPA0116"
FT                   /product="fructose repressor"
FT                   /note="similar to Salmonella typhi CT18 fructose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58227"
FT                   /protein_id="CAR58227.1"
FT   CDS_pept        141491..141949
FT                   /transl_table=11
FT                   /locus_tag="SSPA0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58228"
FT                   /db_xref="GOA:B5BLG3"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLG3"
FT                   /protein_id="CAR58228.1"
FT   CDS_pept        141951..142892
FT                   /transl_table=11
FT                   /locus_tag="SSPA0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58229"
FT                   /db_xref="GOA:B5BLG4"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLG4"
FT                   /protein_id="CAR58229.1"
FT   CDS_pept        142889..143254
FT                   /transl_table=11
FT                   /locus_tag="SSPA0119"
FT                   /product="cell division protein FtsL"
FT                   /note="similar to Salmonella typhi CT18 cell division
FT                   protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58230"
FT                   /protein_id="CAR58230.1"
FT                   LQMQHVDPSQENIVVQK"
FT   CDS_pept        143270..145036
FT                   /transl_table=11
FT                   /locus_tag="SSPA0120"
FT                   /product="penicillin-binding protein 3 precursor"
FT                   /note="similar to Salmonella typhi CT18 penicillin-binding
FT                   protein 3 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58231"
FT                   /protein_id="CAR58231.1"
FT                   VINQGEGTGGRS"
FT   CDS_pept        145023..146510
FT                   /transl_table=11
FT                   /locus_tag="SSPA0121"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia
FT                   minopim ligase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia minopim
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58232"
FT                   /protein_id="CAR58232.1"
FT   CDS_pept        146507..147865
FT                   /transl_table=11
FT                   /locus_tag="SSPA0122"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diami
FT                   nopimelate--D-alan alanyl ligase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diami
FT                   nopimelate--D-alan alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58233"
FT                   /protein_id="CAR58233.1"
FT   CDS_pept        147859..148941
FT                   /transl_table=11
FT                   /locus_tag="SSPA0123"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   phospho-N-acetylmuramoyl-pentapeptide- transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58234"
FT                   /db_xref="GOA:B5BLB9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLB9"
FT                   /protein_id="CAR58234.1"
FT   CDS_pept        148944..150260
FT                   /transl_table=11
FT                   /locus_tag="SSPA0124"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine:D-glutamate
FT                   ligase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58235"
FT                   /protein_id="CAR58235.1"
FT   CDS_pept        150350..151504
FT                   /transl_table=11
FT                   /locus_tag="SSPA0125"
FT                   /product="cell division protein FtsW"
FT                   /note="similar to Salmonella typhi CT18 cell division
FT                   protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58236"
FT                   /protein_id="CAR58236.1"
FT   CDS_pept        151501..152568
FT                   /transl_table=11
FT                   /locus_tag="SSPA0126"
FT                   /product="UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-N-acetylglucosamine:N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58237"
FT                   /db_xref="GOA:B5BLC2"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLC2"
FT                   /protein_id="CAR58237.1"
FT                   ATERVASEVSRVART"
FT   CDS_pept        152687..154162
FT                   /transl_table=11
FT                   /locus_tag="SSPA0127"
FT                   /product="UDP-N-acetylmuramate:alanine ligase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-N-acetylmuramate:alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58238"
FT                   /db_xref="GOA:B5BLC3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLC3"
FT                   /protein_id="CAR58238.1"
FT   CDS_pept        154155..155075
FT                   /transl_table=11
FT                   /locus_tag="SSPA0128"
FT                   /product="D-alanine:D-alanine ligase B"
FT                   /note="similar to Salmonella typhi CT18 D-alanine:D-alanine
FT                   ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58239"
FT                   /db_xref="GOA:B5BLC4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLC4"
FT                   /protein_id="CAR58239.1"
FT   CDS_pept        155077..155907
FT                   /transl_table=11
FT                   /locus_tag="SSPA0129"
FT                   /product="cell division protein FtsQ"
FT                   /note="similar to Salmonella typhi CT18 cell division
FT                   protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58240"
FT                   /protein_id="CAR58240.1"
FT   CDS_pept        155904..157166
FT                   /transl_table=11
FT                   /locus_tag="SSPA0130"
FT                   /product="cell division protein FtsA"
FT                   /note="similar to Salmonella typhi CT18 cell division
FT                   protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58241"
FT                   /protein_id="CAR58241.1"
FT   CDS_pept        157227..158378
FT                   /transl_table=11
FT                   /locus_tag="SSPA0131"
FT                   /product="cell division protein FtsZ"
FT                   /note="similar to Salmonella typhi CT18 cell division
FT                   protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58242"
FT                   /protein_id="CAR58242.1"
FT   CDS_pept        158479..159396
FT                   /transl_table=11
FT                   /locus_tag="SSPA0132"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58243"
FT                   /db_xref="GOA:B5BLC8"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLC8"
FT                   /protein_id="CAR58243.1"
FT   CDS_pept        159744..160172
FT                   /transl_table=11
FT                   /locus_tag="SSPA0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58244"
FT                   /protein_id="CAR58244.1"
FT   CDS_pept        160234..162939
FT                   /transl_table=11
FT                   /locus_tag="SSPA0134"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="similar to Salmonella typhi CT18 preprotein
FT                   translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58245"
FT                   /db_xref="GOA:B5BLD0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLD0"
FT                   /protein_id="CAR58245.1"
FT   CDS_pept        163091..163486
FT                   /transl_table=11
FT                   /locus_tag="SSPA0135"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /note="similar to Salmonella typhi CT18
FT                   7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58246"
FT                   /protein_id="CAR58246.1"
FT   CDS_pept        complement(163520..164509)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0136"
FT                   /product="putative aldo/keto reductase"
FT                   /note="similar to Salmonella typhi CT18 putative aldo/keto
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58247"
FT                   /protein_id="CAR58247.1"
FT   CDS_pept        164595..165536
FT                   /transl_table=11
FT                   /locus_tag="SSPA0137"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="similar to Salmonella typhi Ty2 putative LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58248"
FT                   /protein_id="CAR58248.1"
FT   CDS_pept        complement(165533..165724)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58249"
FT                   /db_xref="GOA:B5BLD4"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLD4"
FT                   /protein_id="CAR58249.1"
FT                   RIASSGDPSDSDDWSEER"
FT   CDS_pept        complement(165734..166477)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58250"
FT                   /db_xref="GOA:B5BLD5"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLD5"
FT                   /protein_id="CAR58250.1"
FT   CDS_pept        complement(166477..167097)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58251"
FT                   /protein_id="CAR58251.1"
FT   CDS_pept        167323..168366
FT                   /transl_table=11
FT                   /locus_tag="SSPA0141"
FT                   /product="GMP reductase"
FT                   /note="similar to Salmonella typhi CT18 GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58252"
FT                   /db_xref="GOA:B5BLD7"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLD7"
FT                   /protein_id="CAR58252.1"
FT                   NRIFNSL"
FT   CDS_pept        complement(168397..169599)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0142"
FT                   /product="protein transport protein HofC"
FT                   /note="similar to Salmonella typhi CT18 protein transport
FT                   protein HofC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58253"
FT                   /protein_id="CAR58253.1"
FT                   G"
FT   CDS_pept        complement(169589..170974)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0143"
FT                   /product="protein transport protein HofB"
FT                   /note="similar to Salmonella typhi CT18 protein transport
FT                   protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58254"
FT                   /protein_id="CAR58254.1"
FT                   HER"
FT   CDS_pept        complement(170984..171421)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0144"
FT                   /product="prepilin peptidase dependent protein D precursor"
FT                   /note="similar to Salmonella typhi CT18 prepilin peptidase
FT                   dependent protein D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58255"
FT                   /protein_id="CAR58255.1"
FT   CDS_pept        complement(171643..172389)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0145"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /note="similar to Salmonella typhi CT18
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58256"
FT                   /protein_id="CAR58256.1"
FT   CDS_pept        172624..173187
FT                   /transl_table=11
FT                   /locus_tag="SSPA0146"
FT                   /product="AmpD protein (anhydro-N-acetylmuramyl-tripeptide
FT                   amidase)"
FT                   /note="similar to Salmonella typhi CT18 AmpD protein
FT                   (anhydro-N-acetylmuramyl-tripeptide amidase)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58257"
FT                   /protein_id="CAR58257.1"
FT   CDS_pept        173184..174038
FT                   /transl_table=11
FT                   /locus_tag="SSPA0147"
FT                   /product="AmpE protein"
FT                   /note="similar to Salmonella typhi CT18 AmpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58258"
FT                   /protein_id="CAR58258.1"
FT                   ALV"
FT   CDS_pept        complement(174130..175080)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0148"
FT                   /product="putatuve glycosysl hydrolase"
FT                   /note="similar to Salmonella typhi CT18 putatuve glycosysl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58259"
FT                   /protein_id="CAR58259.1"
FT   CDS_pept        complement(175080..176486)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0149"
FT                   /product="putative symporter"
FT                   /note="similar to Salmonella typhi CT18 putative symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58260"
FT                   /protein_id="CAR58260.1"
FT                   LNAAESVRKA"
FT   CDS_pept        complement(176650..178020)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0150"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="similar to Salmonella typhi CT18 aromatic amino acid
FT                   transport protein AroP"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58261"
FT                   /protein_id="CAR58261.1"
FT   CDS_pept        178586..179350
FT                   /transl_table=11
FT                   /locus_tag="SSPA0151"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /note="similar to Salmonella typhi CT18 pyruvate
FT                   dehydrogenase complex repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58262"
FT                   /protein_id="CAR58262.1"
FT   CDS_pept        179510..182173
FT                   /transl_table=11
FT                   /locus_tag="SSPA0152"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /note="similar to Salmonella typhi CT18 pyruvate
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58263"
FT                   /protein_id="CAR58263.1"
FT                   ITKFNIDADKVNPRLA"
FT   CDS_pept        182188..184077
FT                   /transl_table=11
FT                   /locus_tag="SSPA0153"
FT                   /product="dihydrolipoamide acetyltransferase component (E2)
FT                   of pyruvate dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 dihydrolipoamide
FT                   acetyltransferase component (E2) of pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58264"
FT                   /protein_id="CAR58264.1"
FT   CDS_pept        184279..185703
FT                   /transl_table=11
FT                   /locus_tag="SSPA0154"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 dihydrolipoamide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58265"
FT                   /protein_id="CAR58265.1"
FT                   FEGSITDLPNPKAKKK"
FT   CDS_pept        185992..186276
FT                   /transl_table=11
FT                   /locus_tag="SSPA0155"
FT                   /product="probable secreted protein"
FT                   /note="similar to Salmonella typhi CT18 probable secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58266"
FT                   /protein_id="CAR58266.1"
FT   CDS_pept        complement(186314..187105)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0156"
FT                   /product="probable secreted protein"
FT                   /note="similar to Salmonella typhi CT18 probable secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58267"
FT                   /protein_id="CAR58267.1"
FT   CDS_pept        complement(187118..188746)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0157"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58268"
FT                   /protein_id="CAR58268.1"
FT   CDS_pept        189135..191732
FT                   /transl_table=11
FT                   /locus_tag="SSPA0158"
FT                   /product="aconitate hydratase 2 (citrate hydro-lyase 2)"
FT                   /note="similar to Salmonella typhi CT18 aconitate hydratase
FT                   2 (citrate hydro-lyase 2)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58269"
FT                   /protein_id="CAR58269.1"
FT   CDS_pept        191920..192282
FT                   /transl_table=11
FT                   /locus_tag="SSPA0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58270"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BLF5"
FT                   /protein_id="CAR58270.1"
FT                   DFLRVVAAYREFVSKA"
FT   CDS_pept        192517..193470
FT                   /transl_table=11
FT                   /locus_tag="SSPA0160"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="similar to Salmonella typhi CT18
FT                   2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58271"
FT                   /protein_id="CAR58271.1"
FT   CDS_pept        193467..194738
FT                   /transl_table=11
FT                   /locus_tag="SSPA0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58272"
FT                   /protein_id="CAR58272.1"
FT   CDS_pept        194728..195711
FT                   /transl_table=11
FT                   /locus_tag="SSPA0162"
FT                   /product="PdxA-like protein"
FT                   /note="similar to Salmonella typhi CT18 PdxA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58273"
FT                   /protein_id="CAR58273.1"
FT   CDS_pept        195721..196488
FT                   /transl_table=11
FT                   /locus_tag="SSPA0163"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58274"
FT                   /protein_id="CAR58274.1"
FT   CDS_pept        complement(196518..197312)
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="SSPA0164"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58275"
FT                   /db_xref="GOA:B5BL96"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL96"
FT                   /protein_id="CAR58275.1"
FT   CDS_pept        complement(197333..198193)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0165"
FT                   /product="spermidine synthase"
FT                   /note="similar to Salmonella typhi CT18 spermidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58276"
FT                   /db_xref="GOA:B5BL97"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL97"
FT                   /protein_id="CAR58276.1"
FT                   ALSAQ"
FT   CDS_pept        complement(198300..198647)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58277"
FT                   /protein_id="CAR58277.1"
FT                   RDSLSLLAYVK"
FT   CDS_pept        198849..200459
FT                   /transl_table=11
FT                   /locus_tag="SSPA0167"
FT                   /product="possible multicopper oxidase precursor"
FT                   /note="similar to Salmonella typhi Ty2 possible multicopper
FT                   oxidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58278"
FT                   /protein_id="CAR58278.1"
FT   CDS_pept        complement(200537..202927)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0168"
FT                   /product="glucose dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 glucose
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58279"
FT                   /protein_id="CAR58279.1"
FT   CDS_pept        203133..203669
FT                   /transl_table=11
FT                   /locus_tag="SSPA0169"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 hypoxanthine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58280"
FT                   /protein_id="CAR58280.1"
FT                   YRHLPYVGKVVLLDE"
FT   CDS_pept        complement(203727..204389)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0170"
FT                   /product="carbonic anhydrase"
FT                   /note="similar to Salmonella typhi CT18 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58281"
FT                   /protein_id="CAR58281.1"
FT   CDS_pept        204498..205424
FT                   /transl_table=11
FT                   /locus_tag="SSPA0171"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58282"
FT                   /protein_id="CAR58282.1"
FT   CDS_pept        205421..206191
FT                   /transl_table=11
FT                   /locus_tag="SSPA0172"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="similar to Salmonella typhi CT18 ABC transporter
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58283"
FT                   /protein_id="CAR58283.1"
FT   CDS_pept        206296..206736
FT                   /transl_table=11
FT                   /locus_tag="SSPA0173"
FT                   /product="putative PTS system IIA component"
FT                   /note="similar to Salmonella typhi CT18 putative PTS system
FT                   IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58284"
FT                   /protein_id="CAR58284.1"
FT   CDS_pept        206804..208027
FT                   /transl_table=11
FT                   /locus_tag="SSPA0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58285"
FT                   /protein_id="CAR58285.1"
FT                   LIVNQPQG"
FT   CDS_pept        complement(208029..209090)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0175"
FT                   /product="putative fimbrial protein"
FT                   /note="similar to Salmonella typhi CT18 putative fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58286"
FT                   /protein_id="CAR58286.1"
FT                   IFGSSVTFQVTYE"
FT   CDS_pept        complement(209102..209662)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0176"
FT                   /product="putative fimbrial protein"
FT                   /note="similar to Salmonella typhi CT18 putative fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58287"
FT                   /protein_id="CAR58287.1"
FT   CDS_pept        complement(209720..210277)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0177"
FT                   /product="putative fimbrial protein"
FT                   /note="similar to Salmonella typhi CT18 putative fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58288"
FT                   /protein_id="CAR58288.1"
FT   CDS_pept        complement(210304..210876)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0178"
FT                   /product="putative fimbrial protein"
FT                   /note="similar to Salmonella typhi CT18 putative fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58289"
FT                   /protein_id="CAR58289.1"
FT   CDS_pept        complement(210911..213508)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0179"
FT                   /product="outer membrane usher protein"
FT                   /note="similar to Salmonella typhimurium outer membrane
FT                   usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58290"
FT                   /protein_id="CAR58290.1"
FT   CDS_pept        complement(213576..214328)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0180"
FT                   /product="putative fimbriae; chaparone"
FT                   /note="similar to Salmonella typhimurium putative fimbriae;
FT                   chaparone"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58291"
FT                   /protein_id="CAR58291.1"
FT   CDS_pept        complement(214415..215020)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0181"
FT                   /product="major fimbrial subunit"
FT                   /note="similar to |24528001|emb|CAD33728.1| putative
FT                   F17-like fimbrial subunit [Escherichia coli]"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58292"
FT                   /protein_id="CAR58292.1"
FT   CDS_pept        complement(215297..215677)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0182"
FT                   /product="aspartate 1-decarboxylase"
FT                   /note="similar to Salmonella typhi CT18 aspartate
FT                   1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58293"
FT                   /db_xref="GOA:B5BL63"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL63"
FT                   /protein_id="CAR58293.1"
FT   CDS_pept        complement(215772..216626)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0183"
FT                   /product="pantoate:beta-alanine ligase"
FT                   /note="similar to Salmonella typhi CT18
FT                   pantoate:beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58294"
FT                   /db_xref="GOA:B5BL64"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL64"
FT                   /protein_id="CAR58294.1"
FT                   LAQ"
FT   CDS_pept        complement(216752..217543)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0184"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58295"
FT                   /db_xref="GOA:B5BL65"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL65"
FT                   /protein_id="CAR58295.1"
FT   CDS_pept        complement(217664..218143)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0185"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridi
FT                   ne pyrophosphokinase"
FT                   /note="similar to Salmonella typhi CT18
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58296"
FT                   /protein_id="CAR58296.1"
FT   CDS_pept        complement(218140..219558)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0186"
FT                   /product="poly(A) polymerase"
FT                   /note="similar to Salmonella typhi CT18 poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58297"
FT                   /protein_id="CAR58297.1"
FT                   SRPRKRAPRREGTV"
FT   CDS_pept        complement(219699..220595)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0187"
FT                   /product="glutamyl-tRNA synthetase-related protein"
FT                   /note="similar to Salmonella typhi CT18 glutamyl-tRNA
FT                   synthetase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58298"
FT                   /db_xref="GOA:B5BL68"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL68"
FT                   /protein_id="CAR58298.1"
FT                   AVPTSANVNPAFSNASR"
FT   CDS_pept        complement(220664..221119)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0188"
FT                   /product="dosage-dependent dnaK suppressor protein"
FT                   /note="similar to Salmonella typhi CT18 dosage-dependent
FT                   dnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58299"
FT                   /protein_id="CAR58299.1"
FT   CDS_pept        complement(221296..222000)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0189"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="similar to Salmonella typhi CT18 sugar fermentation
FT                   stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58300"
FT                   /db_xref="GOA:B5BL70"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL70"
FT                   /protein_id="CAR58300.1"
FT                   KMELNEPVPITL"
FT   CDS_pept        complement(222017..222547)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0190"
FT                   /product="2'-5' RNA ligase"
FT                   /note="similar to Salmonella typhi CT18 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58301"
FT                   /protein_id="CAR58301.1"
FT                   TRYAELQRWTLSE"
FT   CDS_pept        222575..225049
FT                   /transl_table=11
FT                   /locus_tag="SSPA0191"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="similar to Salmonella typhi CT18 ATP-dependent
FT                   helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58302"
FT                   /protein_id="CAR58302.1"
FT                   NTAPTRRTKKYS"
FT   CDS_pept        225190..227712
FT                   /transl_table=11
FT                   /locus_tag="SSPA0192"
FT                   /product="penicillin-binding protein 1b; peptidoglycan
FT                   synthetase"
FT                   /note="similar to Salmonella typhi CT18 penicillin-binding
FT                   protein 1b; peptidoglycan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58303"
FT                   /protein_id="CAR58303.1"
FT   CDS_pept        228005..230232
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SSPA0192a"
FT                   /product="ferrichrome-iron receptor precursor (pseudogene)"
FT   CDS_pept        230281..231078
FT                   /transl_table=11
FT                   /locus_tag="SSPA0193"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /note="similar to Salmonella typhi CT18 ferrichrome
FT                   transport ATP-binding protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58305"
FT                   /protein_id="CAR58305.1"
FT   CDS_pept        231078..231968
FT                   /transl_table=11
FT                   /locus_tag="SSPA0194"
FT                   /product="ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /note="similar to Salmonella typhi CT18 ferrichrome-binding
FT                   periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58306"
FT                   /protein_id="CAR58306.1"
FT                   MHFVRILNNVLGGKA"
FT   CDS_pept        231965..234022
FT                   /transl_table=11
FT                   /locus_tag="SSPA0195"
FT                   /product="ferrichrome transport protein FhuB precursor"
FT                   /note="similar to Salmonella typhi CT18 ferrichrome
FT                   transport protein FhuB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58307"
FT                   /protein_id="CAR58307.1"
FT   CDS_pept        234963..235523
FT                   /transl_table=11
FT                   /gene="stfA"
FT                   /locus_tag="SSPA0196"
FT                   /product="putative fimbrial subunit"
FT                   /note="similar to Salmonella typhimurium putative fimbrial
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58308"
FT                   /protein_id="CAR58308.1"
FT   CDS_pept        235609..238266
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="stfC"
FT                   /locus_tag="SSPA0196a"
FT                   /product="putative fimbrial outer membrane usher
FT                   (pseudogene)"
FT   CDS_pept        238284..239036
FT                   /transl_table=11
FT                   /locus_tag="SSPA0197"
FT                   /product="putative periplasmic fimbrial chaperone"
FT                   /note="similar to Salmonella typhimurium putative
FT                   periplasmic fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58310"
FT                   /protein_id="CAR58310.1"
FT   CDS_pept        239100..239567
FT                   /transl_table=11
FT                   /locus_tag="SSPA0198"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="similar to Salmonella typhimurium putaive minor
FT                   fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58311"
FT                   /protein_id="CAR58311.1"
FT   CDS_pept        239564..240040
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0198a"
FT                   /product="putative minor fimbrial subunit (pseudogene)"
FT   CDS_pept        240040..240570
FT                   /transl_table=11
FT                   /locus_tag="SSPA0199"
FT                   /product="putative minor fimbrial subunit; putative
FT                   adhesin"
FT                   /note="similar to Salmonella typhimurium putative minor
FT                   fimbrial subunit; putative adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58313"
FT                   /protein_id="CAR58313.1"
FT                   RFSASALATFEYL"
FT   CDS_pept        240570..241415
FT                   /transl_table=11
FT                   /locus_tag="SSPA0200"
FT                   /product="hypothetical protein"
FT                   /note="similar to |7388520|sp|P76498|YFCO_ECOLI
FT                   Hypothetical protein yfcO precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58314"
FT                   /protein_id="CAR58314.1"
FT                   "
FT   CDS_pept        complement(241523..242803)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0201"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="similar to Salmonella typhi CT18
FT                   glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58315"
FT                   /db_xref="GOA:B5BL82"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL82"
FT                   /protein_id="CAR58315.1"
FT   CDS_pept        242973..244394
FT                   /transl_table=11
FT                   /locus_tag="SSPA0202"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58316"
FT                   /db_xref="GOA:B5BL83"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL83"
FT                   /protein_id="CAR58316.1"
FT                   EQAAKNQNAPAGENT"
FT   CDS_pept        244431..244820
FT                   /transl_table=11
FT                   /locus_tag="SSPA0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58317"
FT                   /protein_id="CAR58317.1"
FT   CDS_pept        complement(244921..245544)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0204"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58318"
FT                   /protein_id="CAR58318.1"
FT   CDS_pept        complement(245581..246381)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0205"
FT                   /product="cobalamin periplasmic binding protein"
FT                   /note="similar to Salmonella typhi CT18 cobalamin
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58319"
FT                   /protein_id="CAR58319.1"
FT   CDS_pept        complement(246374..247072)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0206"
FT                   /product="MTA/SAH nucleosidase"
FT                   /note="similar to Salmonella typhi Ty2 MTA/SAH
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58320"
FT                   /db_xref="GOA:B5BL87"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL87"
FT                   /protein_id="CAR58320.1"
FT                   ETLVQKLAHG"
FT   CDS_pept        247157..248674
FT                   /transl_table=11
FT                   /locus_tag="SSPA0207"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="similar to Salmonella typhi CT18
FT                   deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58321"
FT                   /db_xref="GOA:B5BL88"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL88"
FT                   /protein_id="CAR58321.1"
FT   CDS_pept        248804..250231
FT                   /transl_table=11
FT                   /locus_tag="SSPA0208"
FT                   /product="protease DO precursor; heat shock protein HtrA"
FT                   /note="similar to Salmonella typhi CT18 protease DO
FT                   precursor; heat shock protein HtrA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58322"
FT                   /protein_id="CAR58322.1"
FT                   LALNIQRGDSSIYLLMQ"
FT   CDS_pept        250384..251541
FT                   /transl_table=11
FT                   /locus_tag="SSPA0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi Ty2 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58323"
FT                   /protein_id="CAR58323.1"
FT   CDS_pept        complement(251630..252016)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58324"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL91"
FT                   /protein_id="CAR58324.1"
FT   CDS_pept        252263..253564
FT                   /transl_table=11
FT                   /locus_tag="SSPA0211"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to Salmonella typhimurium putative inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58325"
FT                   /protein_id="CAR58325.1"
FT   CDS_pept        complement(253601..254425)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0212"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58326"
FT                   /db_xref="GOA:B5BL93"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL93"
FT                   /protein_id="CAR58326.1"
FT   CDS_pept        complement(254455..257127)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0213"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /note="similar to Salmonella typhi CT18 [protein-PII]
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58327"
FT                   /db_xref="GOA:B5BL94"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BL94"
FT                   /protein_id="CAR58327.1"
FT   CDS_pept        complement(257240..258034)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0214"
FT                   /product="methionine aminopeptidase"
FT                   /note="similar to Salmonella typhi CT18 methionine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58328"
FT                   /protein_id="CAR58328.1"
FT   misc_RNA        258318..258456
FT                   /product="t44; sRNA gene"
FT   CDS_pept        258485..259210
FT                   /transl_table=11
FT                   /locus_tag="SSPA0215"
FT                   /product="30S ribosomal protein S2"
FT                   /note="similar to Salmonella typhi CT18 30S ribosomal
FT                   protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58329"
FT                   /db_xref="GOA:B5BAM6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAM6"
FT                   /protein_id="CAR58329.1"
FT   CDS_pept        259468..260319
FT                   /transl_table=11
FT                   /locus_tag="SSPA0216"
FT                   /product="elongation factor Ts"
FT                   /note="similar to Salmonella typhi CT18 elongation factor
FT                   Ts"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58330"
FT                   /db_xref="GOA:B5BAM7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAM7"
FT                   /protein_id="CAR58330.1"
FT                   QS"
FT   CDS_pept        260464..261189
FT                   /transl_table=11
FT                   /locus_tag="SSPA0217"
FT                   /product="uridine 5'-monophosphate kinase"
FT                   /note="similar to Salmonella typhi CT18 uridine
FT                   5'-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58331"
FT                   /protein_id="CAR58331.1"
FT   CDS_pept        261336..261893
FT                   /transl_table=11
FT                   /locus_tag="SSPA0218"
FT                   /product="ribosome recycling factor"
FT                   /note="similar to Salmonella typhi CT18 ribosome recycling
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58332"
FT                   /db_xref="GOA:B5BAM9"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAM9"
FT                   /protein_id="CAR58332.1"
FT   CDS_pept        262035..263231
FT                   /transl_table=11
FT                   /locus_tag="SSPA0219"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /note="similar to Salmonella typhi CT18 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58333"
FT                   /protein_id="CAR58333.1"
FT   CDS_pept        263544..264302
FT                   /transl_table=11
FT                   /locus_tag="SSPA0220"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /note="similar to Salmonella typhi CT18 undecaprenyl
FT                   pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58334"
FT                   /protein_id="CAR58334.1"
FT   CDS_pept        264315..265172
FT                   /transl_table=11
FT                   /locus_tag="SSPA0221"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="similar to Salmonella typhi CT18 phosphatidate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58335"
FT                   /protein_id="CAR58335.1"
FT                   FRTL"
FT   CDS_pept        265184..266536
FT                   /transl_table=11
FT                   /locus_tag="SSPA0222"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58336"
FT                   /protein_id="CAR58336.1"
FT   CDS_pept        266568..268979
FT                   /transl_table=11
FT                   /locus_tag="SSPA0223"
FT                   /product="outer membrane protein precursor"
FT                   /note="similar to Salmonella typhi CT18 outer membrane
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58337"
FT                   /db_xref="GOA:B5BAN4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAN4"
FT                   /protein_id="CAR58337.1"
FT   CDS_pept        269102..269587
FT                   /transl_table=11
FT                   /locus_tag="SSPA0224"
FT                   /product="outer membrane protein OmpH precursor"
FT                   /note="similar to Salmonella typhi Ty2 outer membrane
FT                   protein OmpH precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58338"
FT                   /protein_id="CAR58338.1"
FT   CDS_pept        269591..270616
FT                   /transl_table=11
FT                   /locus_tag="SSPA0225"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58339"
FT                   /protein_id="CAR58339.1"
FT                   D"
FT   CDS_pept        270722..271177
FT                   /transl_table=11
FT                   /locus_tag="SSPA0226"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydrase"
FT                   /note="similar to Salmonella typhi CT18
FT                   (3R)-hydroxymyristol acyl carrier protein dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58340"
FT                   /db_xref="GOA:B5BAN7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAN7"
FT                   /protein_id="CAR58340.1"
FT   CDS_pept        271181..271969
FT                   /transl_table=11
FT                   /locus_tag="SSPA0227"
FT                   /product="acyl-[acyl-carrier-protein]:UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   acyl-[acyl-carrier-protein]:UDP-N- acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58341"
FT                   /db_xref="GOA:B5BAN8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAN8"
FT                   /protein_id="CAR58341.1"
FT   CDS_pept        271969..273117
FT                   /transl_table=11
FT                   /locus_tag="SSPA0228"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /note="similar to Salmonella typhi CT18
FT                   lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58342"
FT                   /db_xref="GOA:B5BAN9"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAN9"
FT                   /protein_id="CAR58342.1"
FT   CDS_pept        273114..273710
FT                   /transl_table=11
FT                   /locus_tag="SSPA0229"
FT                   /product="ribonuclease HII"
FT                   /note="similar to Salmonella typhi CT18 ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58343"
FT                   /db_xref="GOA:B5BAP0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAP0"
FT                   /protein_id="CAR58343.1"
FT   CDS_pept        273734..277216
FT                   /transl_table=11
FT                   /locus_tag="SSPA0230"
FT                   /product="DNA polymerase III, alpha chain"
FT                   /note="similar to Salmonella typhi CT18 DNA polymerase III,
FT                   alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58344"
FT                   /protein_id="CAR58344.1"
FT   CDS_pept        277229..278188
FT                   /transl_table=11
FT                   /locus_tag="SSPA0231"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /note="similar to Salmonella typhi CT18 acetyl-coenzyme A
FT                   carboxylase carboxyl transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58345"
FT                   /db_xref="GOA:B5BAP2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAP2"
FT                   /protein_id="CAR58345.1"
FT   CDS_pept        278367..280130
FT                   /transl_table=11
FT                   /locus_tag="SSPA0232"
FT                   /product="putative secreted chitinase"
FT                   /note="similar to Salmonella typhi CT18 putative secreted
FT                   chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58346"
FT                   /protein_id="CAR58346.1"
FT                   GIAWADAWNAL"
FT   CDS_pept        280206..282347
FT                   /transl_table=11
FT                   /locus_tag="SSPA0233"
FT                   /product="lysine decarboxylase"
FT                   /note="similar to Salmonella typhi CT18 lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58347"
FT                   /protein_id="CAR58347.1"
FT   CDS_pept        282403..282792
FT                   /transl_table=11
FT                   /locus_tag="SSPA0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58348"
FT                   /protein_id="CAR58348.1"
FT   CDS_pept        282936..284147
FT                   /transl_table=11
FT                   /locus_tag="SSPA0235"
FT                   /product="cell cycle protein MesJ"
FT                   /note="similar to Salmonella typhi CT18 cell cycle protein
FT                   MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58349"
FT                   /protein_id="CAR58349.1"
FT                   VWHA"
FT   CDS_pept        complement(284231..284485)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0236"
FT                   /product="ROF protein"
FT                   /note="similar to Salmonella typhi CT18 ROF protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58350"
FT                   /protein_id="CAR58350.1"
FT   CDS_pept        complement(284478..284696)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58351"
FT                   /protein_id="CAR58351.1"
FT   CDS_pept        284876..285421
FT                   /transl_table=11
FT                   /locus_tag="SSPA0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58352"
FT                   /protein_id="CAR58352.1"
FT                   SDARNNLEIQLTAWQQPS"
FT   CDS_pept        285418..285840
FT                   /transl_table=11
FT                   /locus_tag="SSPA0239"
FT                   /product="putative release factor"
FT                   /note="similar to Salmonella typhi CT18 putative release
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58353"
FT                   /protein_id="CAR58353.1"
FT   CDS_pept        285872..286573
FT                   /transl_table=11
FT                   /locus_tag="SSPA0240"
FT                   /product="copper homeostasis protein CutF precursor"
FT                   /note="similar to Salmonella typhi Ty2 copper homeostasis
FT                   protein CutF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58354"
FT                   /protein_id="CAR58354.1"
FT                   VKFAPGKDCTH"
FT   CDS_pept        complement(286647..288365)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0241"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="similar to Salmonella typhi CT18 prolyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58355"
FT                   /db_xref="GOA:B5BAQ2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAQ2"
FT                   /protein_id="CAR58355.1"
FT   CDS_pept        complement(288476..289183)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58356"
FT                   /protein_id="CAR58356.1"
FT                   VNTGFEVFALEPR"
FT   CDS_pept        complement(289180..289584)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0243"
FT                   /product="RcsF protein"
FT                   /note="similar to Salmonella typhi CT18 RcsF protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58357"
FT                   /protein_id="CAR58357.1"
FT   CDS_pept        complement(289703..290518)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0244"
FT                   /product="putative lipoprotein precursor"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58358"
FT                   /protein_id="CAR58358.1"
FT   CDS_pept        complement(290557..291195)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0245"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="similar to Salmonella typhi CT18 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58359"
FT                   /protein_id="CAR58359.1"
FT   CDS_pept        complement(291203..292234)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0246"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58360"
FT                   /protein_id="CAR58360.1"
FT                   GYV"
FT   CDS_pept        292424..292990
FT                   /transl_table=11
FT                   /locus_tag="SSPA0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58361"
FT                   /protein_id="CAR58361.1"
FT   rRNA            293362..294907
FT                   /gene="rrsH"
FT                   /product="16S ribosomal RNA"
FT   tRNA            294972..295045
FT                   /gene="ileV"
FT                   /product="tRNA-Ile"
FT   tRNA            295158..295230
FT                   /gene="alaV"
FT                   /product="tRNA-Ala"
FT   rRNA            295417..298320
FT                   /gene="rrlH"
FT                   /product="23S ribosomal RNA"
FT   rRNA            298416..298537
FT                   /gene="rrfH"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        298958..299413
FT                   /transl_table=11
FT                   /locus_tag="SSPA0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58362"
FT                   /protein_id="CAR58362.1"
FT   CDS_pept        299517..300818
FT                   /transl_table=11
FT                   /locus_tag="SSPA0249"
FT                   /product="alpha-ketoglutarate permease"
FT                   /note="similar to Salmonella typhi CT18 alpha-ketoglutarate
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58363"
FT                   /protein_id="CAR58363.1"
FT   CDS_pept        complement(300815..301138)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58364"
FT                   /protein_id="CAR58364.1"
FT                   ARY"
FT   CDS_pept        complement(301183..302538)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0251"
FT                   /product="CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   CDP-diacylglycerol-serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58365"
FT                   /protein_id="CAR58365.1"
FT   CDS_pept        complement(302653..305313)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0252"
FT                   /product="putative acyl-CoA synthetase"
FT                   /note="similar to Salmonella typhi CT18 putative acyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58366"
FT                   /protein_id="CAR58366.1"
FT                   GIVGLTLNLAKCDES"
FT   CDS_pept        complement(305367..306047)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58367"
FT                   /protein_id="CAR58367.1"
FT                   NVTA"
FT   CDS_pept        complement(306120..306539)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0254"
FT                   /product="thioredoxin 2"
FT                   /note="similar to Salmonella typhi Ty2 thioredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58368"
FT                   /protein_id="CAR58368.1"
FT   CDS_pept        306559..306724
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0255a"
FT                   /product="hypothetical protein (pseudogene)"
FT   CDS_pept        306743..307780
FT                   /transl_table=11
FT                   /locus_tag="SSPA0255"
FT                   /product="putative RNA methyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative RNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58370"
FT                   /protein_id="CAR58370.1"
FT                   RQNKA"
FT   CDS_pept        complement(307896..308585)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0256"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="similar to Salmonella typhi CT18 uracil-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58371"
FT                   /db_xref="GOA:B5BAR7"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAR7"
FT                   /protein_id="CAR58371.1"
FT                   VLPAESE"
FT   CDS_pept        308904..309287
FT                   /transl_table=11
FT                   /locus_tag="SSPA0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58372"
FT                   /db_xref="GOA:B5BAR8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAR8"
FT                   /protein_id="CAR58372.1"
FT   CDS_pept        complement(309349..309936)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0258"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58373"
FT                   /protein_id="CAR58373.1"
FT   CDS_pept        309994..310938
FT                   /transl_table=11
FT                   /locus_tag="SSPA0259"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="similar to Salmonella typhimurium putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58374"
FT                   /protein_id="CAR58374.1"
FT   CDS_pept        complement(310956..312290)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0260"
FT                   /product="ATP-dependent RNA helicase SrmB"
FT                   /note="similar to Salmonella typhi CT18 ATP-dependent RNA
FT                   helicase SrmB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58375"
FT                   /protein_id="CAR58375.1"
FT   CDS_pept        312420..313157
FT                   /transl_table=11
FT                   /locus_tag="SSPA0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58376"
FT                   /db_xref="GOA:B5BAS2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAS2"
FT                   /protein_id="CAR58376.1"
FT   CDS_pept        complement(313142..314761)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0262"
FT                   /product="L-aspartate oxidase (quinolinate synthetase B)."
FT                   /note="similar to Salmonella typhi CT18 L-aspartate oxidase
FT                   (quinolinate synthetase B)."
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58377"
FT                   /protein_id="CAR58377.1"
FT   CDS_pept        315189..315764
FT                   /transl_table=11
FT                   /locus_tag="SSPA0263"
FT                   /product="RNA polymerase sigma-E factor (sigma-24)"
FT                   /note="similar to Salmonella typhi CT18 RNA polymerase
FT                   sigma-E factor (sigma-24)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58378"
FT                   /protein_id="CAR58378.1"
FT   CDS_pept        315796..316446
FT                   /transl_table=11
FT                   /locus_tag="SSPA0264"
FT                   /product="sigma-E factor negative regulatory protein"
FT                   /note="similar to Salmonella typhi CT18 sigma-E factor
FT                   negative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58379"
FT                   /protein_id="CAR58379.1"
FT   CDS_pept        316446..317402
FT                   /transl_table=11
FT                   /locus_tag="SSPA0265"
FT                   /product="sigma-E factor regulatory protein RseB precursor"
FT                   /note="similar to Salmonella typhi CT18 sigma-E factor
FT                   regulatory protein RseB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58380"
FT                   /protein_id="CAR58380.1"
FT   CDS_pept        317399..317878
FT                   /transl_table=11
FT                   /locus_tag="SSPA0266"
FT                   /product="sigma-E factor regulatory protein RseC"
FT                   /note="similar to Salmonella typhi CT18 sigma-E factor
FT                   regulatory protein RseC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58381"
FT                   /protein_id="CAR58381.1"
FT   CDS_pept        318130..319929
FT                   /transl_table=11
FT                   /locus_tag="SSPA0267"
FT                   /product="GTP-binding protein LepA"
FT                   /note="similar to Salmonella typhi CT18 GTP-binding protein
FT                   LepA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58382"
FT                   /db_xref="GOA:B5BAS8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAS8"
FT                   /protein_id="CAR58382.1"
FT   CDS_pept        319946..320920
FT                   /transl_table=11
FT                   /locus_tag="SSPA0268"
FT                   /product="signal peptidase I"
FT                   /note="similar to Salmonella typhi CT18 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58383"
FT                   /protein_id="CAR58383.1"
FT   CDS_pept        321194..321874
FT                   /transl_table=11
FT                   /locus_tag="SSPA0269"
FT                   /product="ribonuclease III"
FT                   /note="similar to Salmonella typhi CT18 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58384"
FT                   /db_xref="GOA:B5BAT0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAT0"
FT                   /protein_id="CAR58384.1"
FT                   LELE"
FT   CDS_pept        321871..322776
FT                   /transl_table=11
FT                   /locus_tag="SSPA0270"
FT                   /product="GTP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58385"
FT                   /db_xref="GOA:B5BAT1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAT1"
FT                   /protein_id="CAR58385.1"
FT   CDS_pept        322788..323516
FT                   /transl_table=11
FT                   /locus_tag="SSPA0271"
FT                   /product="DNA repair protein RecO"
FT                   /note="similar to Salmonella typhi CT18 DNA repair protein
FT                   RecO"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58386"
FT                   /db_xref="GOA:B5BAT2"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAT2"
FT                   /protein_id="CAR58386.1"
FT   CDS_pept        323528..324259
FT                   /transl_table=11
FT                   /locus_tag="SSPA0272"
FT                   /product="putative pyridoxal phosphate biosynthetic
FT                   protein"
FT                   /note="similar to Salmonella typhi CT18 putative pyridoxal
FT                   phosphate biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58387"
FT                   /protein_id="CAR58387.1"
FT   CDS_pept        324259..324639
FT                   /transl_table=11
FT                   /locus_tag="SSPA0273"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /note="similar to Salmonella typhi CT18 holo-[acyl-carrier
FT                   protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58388"
FT                   /db_xref="GOA:B5BAT4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAT4"
FT                   /protein_id="CAR58388.1"
FT   CDS_pept        complement(324751..325011)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0274"
FT                   /product="putative ferredoxin"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58389"
FT                   /protein_id="CAR58389.1"
FT   CDS_pept        complement(325049..325975)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0275"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58390"
FT                   /protein_id="CAR58390.1"
FT   CDS_pept        326089..327285
FT                   /transl_table=11
FT                   /locus_tag="SSPA0276"
FT                   /product="putative transmembrane transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58391"
FT                   /protein_id="CAR58391.1"
FT   CDS_pept        327358..328224
FT                   /transl_table=11
FT                   /locus_tag="SSPA0277"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58392"
FT                   /protein_id="CAR58392.1"
FT                   IHAKEAQ"
FT   CDS_pept        complement(328263..329111)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0278"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58393"
FT                   /protein_id="CAR58393.1"
FT                   V"
FT   CDS_pept        329227..330120
FT                   /transl_table=11
FT                   /locus_tag="SSPA0279"
FT                   /product="putative phophosugar binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   phophosugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58394"
FT                   /db_xref="GOA:B5BAU0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAU0"
FT                   /protein_id="CAR58394.1"
FT                   EKLAAHQGFLRAALEH"
FT   CDS_pept        330131..331492
FT                   /transl_table=11
FT                   /locus_tag="SSPA0280"
FT                   /product="putative PTS system IIBC component"
FT                   /note="similar to Salmonella typhi CT18 putative PTS system
FT                   IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58395"
FT                   /protein_id="CAR58395.1"
FT   CDS_pept        331496..332131
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yfhB"
FT                   /locus_tag="SSPA0280a"
FT                   /product="putative membrane protein (pseudogene)"
FT   CDS_pept        332156..332707
FT                   /transl_table=11
FT                   /locus_tag="SSPA0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58397"
FT                   /protein_id="CAR58397.1"
FT   CDS_pept        complement(332758..334302)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0282"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58398"
FT                   /protein_id="CAR58398.1"
FT   CDS_pept        complement(334303..334533)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0283"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to Salmonella typhimurium putative
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58399"
FT                   /protein_id="CAR58399.1"
FT   CDS_pept        334558..338445
FT                   /transl_table=11
FT                   /locus_tag="SSPA0284"
FT                   /product="phosphoribosylformylglycineamide synthetase"
FT                   /note="similar to Salmonella typhi Ty2
FT                   phosphoribosylformylglycineamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58400"
FT                   /protein_id="CAR58400.1"
FT                   RIFRNARKQLG"
FT   misc_RNA        338852..339000
FT                   /locus_tag="SSPA0284a"
FT                   /product="tke1; sRNA gene"
FT   CDS_pept        339230..340525
FT                   /transl_table=11
FT                   /locus_tag="SSPA0285"
FT                   /product="putative sensor kinase protein"
FT                   /note="similar to Salmonella typhi CT18 putative sensor
FT                   kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58401"
FT                   /protein_id="CAR58401.1"
FT   CDS_pept        340527..341291
FT                   /transl_table=11
FT                   /locus_tag="SSPA0286"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58402"
FT                   /protein_id="CAR58402.1"
FT   CDS_pept        341288..342625
FT                   /transl_table=11
FT                   /locus_tag="SSPA0287"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58403"
FT                   /protein_id="CAR58403.1"
FT   CDS_pept        342702..343040
FT                   /transl_table=11
FT                   /locus_tag="SSPA0288"
FT                   /product="nitrogen regulatory protein p-II"
FT                   /note="similar to Salmonella typhi CT18 nitrogen regulatory
FT                   protein p-II"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58404"
FT                   /protein_id="CAR58404.1"
FT                   GEEDDAAI"
FT   CDS_pept        complement(343089..344549)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0289"
FT                   /product="putative transmembrane transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58405"
FT                   /protein_id="CAR58405.1"
FT   CDS_pept        complement(344605..346749)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0290"
FT                   /product="lysine decarboxylase"
FT                   /note="similar to Salmonella typhi CT18 lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58406"
FT                   /protein_id="CAR58406.1"
FT   CDS_pept        complement(346832..348163)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0291"
FT                   /product="probable cadaverine/lysine antiporter"
FT                   /note="similar to Salmonella typhi CT18 probable
FT                   cadaverine/lysine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58407"
FT                   /protein_id="CAR58407.1"
FT   CDS_pept        complement(348524..350067)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="cadC"
FT                   /locus_tag="SSPA0291a"
FT                   /product="transcriptional activator cadC (pseudogene)"
FT   CDS_pept        complement(350249..351439)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0292"
FT                   /product="flavohemoprotein (haemoglobin-like protein)"
FT                   /note="similar to Salmonella typhi CT18 flavohemoprotein
FT                   (haemoglobin-like protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58409"
FT                   /protein_id="CAR58409.1"
FT   CDS_pept        351764..353017
FT                   /transl_table=11
FT                   /locus_tag="SSPA0293"
FT                   /product="serine hydroxymethyltransferase"
FT                   /note="similar to Salmonella typhi CT18 serine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58410"
FT                   /db_xref="GOA:B5BAV4"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAV4"
FT                   /protein_id="CAR58410.1"
FT                   ERVKAKVLDICARFPVYA"
FT   CDS_pept        353213..354352
FT                   /transl_table=11
FT                   /locus_tag="SSPA0294"
FT                   /product="putative 3-phenylpropionate permease"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   3-phenylpropionate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58411"
FT                   /protein_id="CAR58411.1"
FT   CDS_pept        complement(354347..355624)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0295"
FT                   /product="stationary phase inducible protein CsiE"
FT                   /note="similar to Salmonella typhi CT18 stationary phase
FT                   inducible protein CsiE"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58412"
FT                   /protein_id="CAR58412.1"
FT   CDS_pept        355750..356388
FT                   /transl_table=11
FT                   /locus_tag="SSPA0296"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58413"
FT                   /protein_id="CAR58413.1"
FT   CDS_pept        356379..357365
FT                   /transl_table=11
FT                   /locus_tag="SSPA0297"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to Salmonella typhimurium putative inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58414"
FT                   /protein_id="CAR58414.1"
FT   CDS_pept        complement(357366..358379)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0298"
FT                   /product="anaerobic sulfite reductase subunit C"
FT                   /note="similar to Salmonella typhi CT18 anaerobic sulfite
FT                   reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58415"
FT                   /protein_id="CAR58415.1"
FT   CDS_pept        complement(358390..359208)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0299"
FT                   /product="anaerobic sulfite reductase subunit B"
FT                   /note="similar to Salmonella typhi CT18 anaerobic sulfite
FT                   reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58416"
FT                   /protein_id="CAR58416.1"
FT   CDS_pept        complement(359212..360255)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0300"
FT                   /product="anaerobic sulfite reductase subunit A"
FT                   /note="similar to Salmonella typhi CT18 anaerobic sulfite
FT                   reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58417"
FT                   /protein_id="CAR58417.1"
FT                   QALAEEA"
FT   CDS_pept        complement(360437..361315)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0301"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58418"
FT                   /protein_id="CAR58418.1"
FT                   IKFIQTALSAK"
FT   CDS_pept        complement(361460..362263)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0302"
FT                   /product="extragenic suppressor protein SuhB"
FT                   /note="similar to Salmonella typhi CT18 extragenic
FT                   suppressor protein SuhB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58419"
FT                   /protein_id="CAR58419.1"
FT   CDS_pept        362382..363113
FT                   /transl_table=11
FT                   /locus_tag="SSPA0303"
FT                   /product="putative RNA methyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative RNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58420"
FT                   /protein_id="CAR58420.1"
FT   CDS_pept        363291..363785
FT                   /transl_table=11
FT                   /locus_tag="SSPA0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58421"
FT                   /db_xref="GOA:B5BAW5"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAW5"
FT                   /protein_id="CAR58421.1"
FT                   A"
FT   CDS_pept        363966..365180
FT                   /transl_table=11
FT                   /locus_tag="SSPA0305"
FT                   /product="putative L-cysteine desulfurase"
FT                   /note="similar to Salmonella typhi CT18 putative L-cysteine
FT                   desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58422"
FT                   /db_xref="GOA:B5BAW6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAW6"
FT                   /protein_id="CAR58422.1"
FT                   EWAHH"
FT   CDS_pept        365208..365594
FT                   /transl_table=11
FT                   /locus_tag="SSPA0306"
FT                   /product="NifU-like protein"
FT                   /note="similar to Salmonella typhi CT18 NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58423"
FT                   /protein_id="CAR58423.1"
FT   CDS_pept        365623..365946
FT                   /transl_table=11
FT                   /locus_tag="SSPA0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58424"
FT                   /db_xref="GOA:B5BAW8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAW8"
FT                   /protein_id="CAR58424.1"
FT                   FHV"
FT   CDS_pept        366143..366658
FT                   /transl_table=11
FT                   /locus_tag="SSPA0308"
FT                   /product="chaperone protein HscB"
FT                   /note="similar to Salmonella typhi Ty2 chaperone protein
FT                   HscB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58425"
FT                   /db_xref="GOA:B5BAW9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAW9"
FT                   /protein_id="CAR58425.1"
FT                   LEEKLLDF"
FT   CDS_pept        366671..368521
FT                   /transl_table=11
FT                   /locus_tag="SSPA0309"
FT                   /product="chaperone protein HscA"
FT                   /note="similar to Salmonella typhi CT18 chaperone protein
FT                   HscA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58426"
FT                   /db_xref="GOA:B5BAX0"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAX0"
FT                   /protein_id="CAR58426.1"
FT   CDS_pept        368523..368858
FT                   /transl_table=11
FT                   /locus_tag="SSPA0310"
FT                   /product="ferredoxin"
FT                   /note="similar to Salmonella typhi CT18 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58427"
FT                   /protein_id="CAR58427.1"
FT                   INHAREH"
FT   CDS_pept        368870..369070
FT                   /transl_table=11
FT                   /locus_tag="SSPA0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58428"
FT                   /protein_id="CAR58428.1"
FT   CDS_pept        369124..370407
FT                   /transl_table=11
FT                   /locus_tag="SSPA0312"
FT                   /product="peptidase B"
FT                   /note="similar to Salmonella typhi Ty2 peptidase B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58429"
FT                   /protein_id="CAR58429.1"
FT   CDS_pept        370508..371293
FT                   /transl_table=11
FT                   /locus_tag="SSPA0313"
FT                   /product="SseB protein"
FT                   /note="similar to Salmonella typhi CT18 SseB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58430"
FT                   /protein_id="CAR58430.1"
FT   CDS_pept        complement(371862..372530)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0314"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58431"
FT                   /protein_id="CAR58431.1"
FT                   "
FT   CDS_pept        complement(372776..373618)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0315"
FT                   /product="putative thiosulfate sulfurtransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58432"
FT                   /protein_id="CAR58432.1"
FT   CDS_pept        373827..378761
FT                   /transl_table=11
FT                   /locus_tag="SSPA0316"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58433"
FT                   /protein_id="CAR58433.1"
FT                   LLIVTP"
FT   CDS_pept        378762..381077
FT                   /transl_table=11
FT                   /locus_tag="SSPA0317"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="similar to Salmonella typhi CT18 penicillin-binding
FT                   protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58434"
FT                   /protein_id="CAR58434.1"
FT                   VVMDESGQVAAVNFELIR"
FT   CDS_pept        381207..383612
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0317a"
FT                   /product="putative anaerobic reductase component
FT                   (pseudogene)"
FT   CDS_pept        383609..384238
FT                   /transl_table=11
FT                   /locus_tag="SSPA0318"
FT                   /product="putative anaerobic reductase component"
FT                   /note="similar to Salmonella typhi CT18 putative anaerobic
FT                   reductase component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58436"
FT                   /protein_id="CAR58436.1"
FT   CDS_pept        384231..385040
FT                   /transl_table=11
FT                   /locus_tag="SSPA0319"
FT                   /product="putative anaerobic reductase component"
FT                   /note="similar to Salmonella typhi CT18 putative anaerobic
FT                   reductase component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58437"
FT                   /protein_id="CAR58437.1"
FT   CDS_pept        385040..385903
FT                   /transl_table=11
FT                   /locus_tag="SSPA0320"
FT                   /product="putative polyferredoxin"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58438"
FT                   /protein_id="CAR58438.1"
FT                   EFAVRL"
FT   CDS_pept        386024..386455
FT                   /transl_table=11
FT                   /locus_tag="SSPA0321"
FT                   /product="nucleoside diphosphate kinase (ndk)"
FT                   /note="similar to Salmonella typhi CT18 nucleoside
FT                   diphosphate kinase (ndk)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58439"
FT                   /db_xref="GOA:B5BAY2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAY2"
FT                   /protein_id="CAR58439.1"
FT   CDS_pept        386662..387828
FT                   /transl_table=11
FT                   /locus_tag="SSPA0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58440"
FT                   /db_xref="GOA:B5BAY3"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAY3"
FT                   /protein_id="CAR58440.1"
FT   CDS_pept        388120..389124
FT                   /transl_table=11
FT                   /locus_tag="SSPA0323"
FT                   /product="putative DNA-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58441"
FT                   /db_xref="GOA:B5BAY4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023690"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAY4"
FT                   /protein_id="CAR58441.1"
FT   CDS_pept        389151..390269
FT                   /transl_table=11
FT                   /locus_tag="SSPA0324"
FT                   /product="GcpE protein (protein E)"
FT                   /note="similar to Salmonella typhi CT18 GcpE protein
FT                   (protein E)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58442"
FT                   /db_xref="GOA:B5BAY5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAY5"
FT                   /protein_id="CAR58442.1"
FT   CDS_pept        390380..391654
FT                   /transl_table=11
FT                   /locus_tag="SSPA0325"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="similar to Salmonella typhi CT18 histidyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58443"
FT                   /db_xref="GOA:B5BAY6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAY6"
FT                   /protein_id="CAR58443.1"
FT   CDS_pept        391668..392288
FT                   /transl_table=11
FT                   /locus_tag="SSPA0326"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58444"
FT                   /protein_id="CAR58444.1"
FT   CDS_pept        392299..393477
FT                   /transl_table=11
FT                   /locus_tag="SSPA0327"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58445"
FT                   /protein_id="CAR58445.1"
FT   CDS_pept        393594..395066
FT                   /transl_table=11
FT                   /locus_tag="SSPA0328"
FT                   /product="putative GTP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58446"
FT                   /db_xref="GOA:B5BAY9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAY9"
FT                   /protein_id="CAR58446.1"
FT   CDS_pept        395155..395376
FT                   /transl_table=11
FT                   /locus_tag="SSPA0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58447"
FT                   /protein_id="CAR58447.1"
FT   CDS_pept        395722..397877
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sinH"
FT                   /locus_tag="SSPA0329a"
FT                   /product="putative intimin (pseudogene)"
FT   CDS_pept        397935..398900
FT                   /transl_table=11
FT                   /locus_tag="SSPA0330"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58449"
FT                   /protein_id="CAR58449.1"
FT   CDS_pept        399020..405412
FT                   /transl_table=11
FT                   /locus_tag="SSPA0331"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi Ty2 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58450"
FT                   /protein_id="CAR58450.1"
FT   CDS_pept        405524..412788
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ratB"
FT                   /locus_tag="SSPA0331a"
FT                   /product="putative lipoprotein (pseudogene)"
FT   CDS_pept        413546..418654
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="shdA"
FT                   /locus_tag="SSPA0331b"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT   CDS_pept        complement(418816..420165)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0332"
FT                   /product="exodeoxyribonuclease large subunit"
FT                   /note="similar to Salmonella typhi CT18
FT                   exodeoxyribonuclease large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58453"
FT                   /db_xref="GOA:B5BAZ3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAZ3"
FT                   /protein_id="CAR58453.1"
FT   CDS_pept        420326..421792
FT                   /transl_table=11
FT                   /locus_tag="SSPA0333"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18
FT                   inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58454"
FT                   /protein_id="CAR58454.1"
FT   CDS_pept        421862..423439
FT                   /transl_table=11
FT                   /locus_tag="SSPA0334"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /note="similar to Salmonella typhi CT18 GMP synthase
FT                   (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58455"
FT                   /db_xref="GOA:B5BAZ5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BAZ5"
FT                   /protein_id="CAR58455.1"
FT                   PPATIEWE"
FT   CDS_pept        423527..423685
FT                   /transl_table=11
FT                   /locus_tag="SSPA0335"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58456"
FT                   /protein_id="CAR58456.1"
FT                   MTGIEVY"
FT   CDS_pept        complement(423762..424449)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0335a"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT   CDS_pept        complement(424678..425217)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0336"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58458"
FT                   /protein_id="CAR58458.1"
FT                   QSEGKAREEKASGWFN"
FT   CDS_pept        complement(425233..425748)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0337"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="similar to Salmonella typhimurium putative outer
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58459"
FT                   /protein_id="CAR58459.1"
FT                   NTKCPEKS"
FT   CDS_pept        426052..426291
FT                   /transl_table=11
FT                   /locus_tag="SSPA0338"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58460"
FT                   /protein_id="CAR58460.1"
FT   CDS_pept        426362..426499
FT                   /transl_table=11
FT                   /locus_tag="SSPA0339"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58461"
FT                   /protein_id="CAR58461.1"
FT                   "
FT   CDS_pept        426596..428809
FT                   /transl_table=11
FT                   /locus_tag="SSPA0340"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58462"
FT                   /protein_id="CAR58462.1"
FT   CDS_pept        complement(428845..430386)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0341"
FT                   /product="exopolyphosphatase"
FT                   /note="similar to Salmonella typhi CT18 exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58463"
FT                   /protein_id="CAR58463.1"
FT   CDS_pept        complement(430391..432457)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0342"
FT                   /product="polyphosphate kinase"
FT                   /note="similar to Salmonella typhi CT18 polyphosphate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58464"
FT                   /protein_id="CAR58464.1"
FT   CDS_pept        complement(432646..433284)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0343"
FT                   /product="phosphoribosylglycinamidine myltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   phosphoribosylglycinamidine myltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58465"
FT                   /protein_id="CAR58465.1"
FT   CDS_pept        complement(433284..434321)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0344"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="similar to Salmonella typhi CT18
FT                   phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58466"
FT                   /db_xref="GOA:B5BB05"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB05"
FT                   /protein_id="CAR58466.1"
FT                   RVVIE"
FT   CDS_pept        434734..435360
FT                   /transl_table=11
FT                   /locus_tag="SSPA0345"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58467"
FT                   /db_xref="GOA:B5BB06"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB06"
FT                   /protein_id="CAR58467.1"
FT   CDS_pept        435448..436737
FT                   /transl_table=11
FT                   /locus_tag="SSPA0346"
FT                   /product="uracil permease (uracil transporter)"
FT                   /note="similar to Salmonella typhi CT18 uracil permease
FT                   (uracil transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58468"
FT                   /protein_id="CAR58468.1"
FT   CDS_pept        436808..437533
FT                   /transl_table=11
FT                   /locus_tag="SSPA0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58469"
FT                   /db_xref="GOA:B5BB08"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR022864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB08"
FT                   /protein_id="CAR58469.1"
FT   CDS_pept        complement(437560..437919)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0348"
FT                   /product="putative arsenate reductase"
FT                   /note="similar to Salmonella typhi Ty2 putative arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58470"
FT                   /protein_id="CAR58470.1"
FT                   ARIGRPPEQVLDILG"
FT   CDS_pept        complement(437959..439422)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0349"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58471"
FT                   /protein_id="CAR58471.1"
FT   CDS_pept        439630..440698
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0349a"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT   CDS_pept        441038..442162
FT                   /transl_table=11
FT                   /locus_tag="SSPA0350"
FT                   /product="hypothetical protein"
FT                   /note="similar to |16124105|ref|NP_407418.1| putative
FT                   regulatory protein [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58473"
FT                   /protein_id="CAR58473.1"
FT   CDS_pept        442230..443498
FT                   /transl_table=11
FT                   /locus_tag="SSPA0351"
FT                   /product="putative permease"
FT                   /note="similar to Salmonella typhi CT18 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58474"
FT                   /protein_id="CAR58474.1"
FT   CDS_pept        443504..444643
FT                   /transl_table=11
FT                   /locus_tag="SSPA0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58475"
FT                   /protein_id="CAR58475.1"
FT   CDS_pept        complement(444690..445160)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0353"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="similar to Salmonella typhi CT18 bacterioferritin
FT                   comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58476"
FT                   /protein_id="CAR58476.1"
FT   CDS_pept        complement(445160..445732)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0354"
FT                   /product="glycine cleavage system transcriptional
FT                   repressor"
FT                   /note="similar to Salmonella typhi CT18 glycine cleavage
FT                   system transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58477"
FT                   /protein_id="CAR58477.1"
FT   CDS_pept        445878..446756
FT                   /transl_table=11
FT                   /locus_tag="SSPA0355"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="similar to Salmonella typhi CT18 dihydrodipicolinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58478"
FT                   /db_xref="GOA:B5BB16"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB16"
FT                   /protein_id="CAR58478.1"
FT                   VKAALQHAGLL"
FT   CDS_pept        446773..447807
FT                   /transl_table=11
FT                   /locus_tag="SSPA0356"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58479"
FT                   /protein_id="CAR58479.1"
FT                   AFNK"
FT   CDS_pept        447982..448695
FT                   /transl_table=11
FT                   /locus_tag="SSPA0357"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="similar to Salmonella typhi CT18
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58480"
FT                   /db_xref="GOA:B5BB18"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB18"
FT                   /protein_id="CAR58480.1"
FT                   EAYEAVAHRLGVKLD"
FT   CDS_pept        448826..449689
FT                   /transl_table=11
FT                   /locus_tag="SSPA0358"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58481"
FT                   /protein_id="CAR58481.1"
FT                   TFGKNF"
FT   CDS_pept        449705..451723
FT                   /transl_table=11
FT                   /locus_tag="SSPA0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58482"
FT                   /protein_id="CAR58482.1"
FT   CDS_pept        complement(451750..451950)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0360"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58483"
FT                   /db_xref="GOA:B5BB21"
FT                   /db_xref="InterPro:IPR020910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB21"
FT                   /protein_id="CAR58483.1"
FT   CDS_pept        complement(451978..453105)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0361"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="similar to Salmonella typhi CT18
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58484"
FT                   /db_xref="GOA:B5BB22"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB22"
FT                   /protein_id="CAR58484.1"
FT   CDS_pept        complement(453109..453465)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58485"
FT                   /protein_id="CAR58485.1"
FT                   GFSESRYQQFFDEV"
FT   CDS_pept        complement(454039..457152)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0363"
FT                   /product="putative efflux pump"
FT                   /note="similar to Salmonella typhi CT18 putative efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58486"
FT                   /protein_id="CAR58486.1"
FT   CDS_pept        complement(457337..459039)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="narQ"
FT                   /locus_tag="SSPA0363a"
FT                   /product="nitrate/nitrite sensor protein NarQ (pseudogene)"
FT   CDS_pept        459225..461186
FT                   /transl_table=11
FT                   /locus_tag="SSPA0364"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58488"
FT                   /protein_id="CAR58488.1"
FT                   AMAEGRHAAQGILDWLAK"
FT   CDS_pept        complement(461634..462932)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0365"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58489"
FT                   /db_xref="GOA:B5BB26"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB26"
FT                   /protein_id="CAR58489.1"
FT   CDS_pept        463136..463711
FT                   /transl_table=11
FT                   /locus_tag="SSPA0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58490"
FT                   /protein_id="CAR58490.1"
FT   CDS_pept        463836..464879
FT                   /transl_table=11
FT                   /locus_tag="SSPA0367"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58491"
FT                   /protein_id="CAR58491.1"
FT                   PTLWITR"
FT   CDS_pept        465007..465237
FT                   /transl_table=11
FT                   /locus_tag="SSPA0368"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58492"
FT                   /protein_id="CAR58492.1"
FT   CDS_pept        complement(465300..467300)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0369"
FT                   /product="transketolase 2"
FT                   /note="similar to Salmonella typhi CT18 transketolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58493"
FT                   /protein_id="CAR58493.1"
FT   CDS_pept        complement(467320..468270)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0370"
FT                   /product="transaldolase A"
FT                   /note="similar to Salmonella typhi CT18 transaldolase A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58494"
FT                   /protein_id="CAR58494.1"
FT   CDS_pept        468542..470821
FT                   /transl_table=11
FT                   /locus_tag="SSPA0371"
FT                   /product="NADP-dependent malate dehydrogenase
FT                   (decarboxylating)"
FT                   /note="similar to Salmonella typhi CT18 NADP-dependent
FT                   malate dehydrogenase (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58495"
FT                   /protein_id="CAR58495.1"
FT                   AQTTPL"
FT   CDS_pept        471239..471574
FT                   /transl_table=11
FT                   /locus_tag="SSPA0372"
FT                   /product="putative ethanolamine utilization protein EutS"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ethanolamine utilization protein EutS"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58496"
FT                   /protein_id="CAR58496.1"
FT                   LCELTKS"
FT   CDS_pept        471587..472066
FT                   /transl_table=11
FT                   /locus_tag="SSPA0373"
FT                   /product="putative ethanolamine utilization protein"
FT                   /note="similar to Salmonella typhimurium putative
FT                   ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58497"
FT                   /protein_id="CAR58497.1"
FT   CDS_pept        472044..472733
FT                   /transl_table=11
FT                   /locus_tag="SSPA0374"
FT                   /product="putative ethanolamine utilization protein"
FT                   /note="similar to Salmonella typhimurium putative
FT                   ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58498"
FT                   /protein_id="CAR58498.1"
FT                   PANWQSV"
FT   CDS_pept        472730..473533
FT                   /transl_table=11
FT                   /locus_tag="SSPA0375"
FT                   /product="putative cobalamin adenosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative cobalamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58499"
FT                   /protein_id="CAR58499.1"
FT   CDS_pept        473530..474546
FT                   /transl_table=11
FT                   /locus_tag="SSPA0376"
FT                   /product="putative phosphate acyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58500"
FT                   /protein_id="CAR58500.1"
FT   CDS_pept        474587..474877
FT                   /transl_table=11
FT                   /locus_tag="SSPA0377"
FT                   /product="putative ethanolamine utilization protein EutN"
FT                   /note="similar to Salmonella typhi Ty2 putative
FT                   ethanolamine utilization protein EutN"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58501"
FT                   /protein_id="CAR58501.1"
FT   CDS_pept        474930..475277
FT                   /transl_table=11
FT                   /locus_tag="SSPA0378"
FT                   /product="putative ethanolamine utilization protein EutN"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ethanolamine utilization protein EutN"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58502"
FT                   /protein_id="CAR58502.1"
FT                   VVAGGKVVFHK"
FT   CDS_pept        475289..476692
FT                   /transl_table=11
FT                   /locus_tag="SSPA0379"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 putative aldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58503"
FT                   /protein_id="CAR58503.1"
FT                   VLVDAFRIV"
FT   CDS_pept        476703..477542
FT                   /transl_table=11
FT                   /locus_tag="SSPA0380"
FT                   /product="putative ethanolamine utilization protein EutJ"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ethanolamine utilization protein EutJ"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58504"
FT                   /protein_id="CAR58504.1"
FT   CDS_pept        477532..478719
FT                   /transl_table=11
FT                   /locus_tag="SSPA0381"
FT                   /product="putative alchohol dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 putative alchohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58505"
FT                   /protein_id="CAR58505.1"
FT   CDS_pept        478839..480065
FT                   /transl_table=11
FT                   /locus_tag="SSPA0382"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58506"
FT                   /protein_id="CAR58506.1"
FT                   VKTEAEAQS"
FT   CDS_pept        480062..481285
FT                   /transl_table=11
FT                   /locus_tag="SSPA0383"
FT                   /product="putative ethanolamine utilization protein EutA"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ethanolamine utilization protein EutA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58507"
FT                   /protein_id="CAR58507.1"
FT                   VKSLAFPS"
FT   CDS_pept        481297..482658
FT                   /transl_table=11
FT                   /locus_tag="SSPA0384"
FT                   /product="ethanolamine ammonia-lyase heavy chain"
FT                   /note="similar to Salmonella typhi CT18 ethanolamine
FT                   ammonia-lyase heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58508"
FT                   /protein_id="CAR58508.1"
FT   CDS_pept        482677..483573
FT                   /transl_table=11
FT                   /locus_tag="SSPA0385"
FT                   /product="ethanolamine ammonia-lyase light chain"
FT                   /note="similar to Salmonella typhi CT18 ethanolamine
FT                   ammonia-lyase light chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58509"
FT                   /db_xref="GOA:B5BB46"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB46"
FT                   /protein_id="CAR58509.1"
FT                   LAKRMLEQKASGINMTR"
FT   CDS_pept        483583..484242
FT                   /transl_table=11
FT                   /locus_tag="SSPA0386"
FT                   /product="ethanolamine utilization protein EutL"
FT                   /note="similar to Salmonella typhi CT18 ethanolamine
FT                   utilization protein EutL"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58510"
FT                   /protein_id="CAR58510.1"
FT   CDS_pept        484255..484749
FT                   /transl_table=11
FT                   /locus_tag="SSPA0387"
FT                   /product="ethanolamine utilization protein EutK"
FT                   /note="similar to Salmonella typhi CT18 ethanolamine
FT                   utilization protein EutK"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58511"
FT                   /protein_id="CAR58511.1"
FT                   N"
FT   CDS_pept        484797..485849
FT                   /transl_table=11
FT                   /locus_tag="SSPA0388"
FT                   /product="ethanolamine operon transcriptional regulator"
FT                   /note="similar to Salmonella typhi Ty2 ethanolamine operon
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58512"
FT                   /protein_id="CAR58512.1"
FT                   TLHQRMRQWA"
FT   CDS_pept        complement(486048..486974)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0389"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="similar to Salmonella typhi CT18 coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58513"
FT                   /db_xref="GOA:B5BB50"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB50"
FT                   /protein_id="CAR58513.1"
FT   CDS_pept        complement(486977..487846)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0390"
FT                   /product="probable N-acetylmuramoyl-L-alanine amidase"
FT                   /note="similar to Salmonella typhi CT18 probable
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58514"
FT                   /protein_id="CAR58514.1"
FT                   QKAHTKKR"
FT   CDS_pept        488059..488484
FT                   /transl_table=11
FT                   /locus_tag="SSPA0391"
FT                   /product="putative acetyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58515"
FT                   /protein_id="CAR58515.1"
FT   CDS_pept        488471..488920
FT                   /transl_table=11
FT                   /locus_tag="SSPA0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58516"
FT                   /protein_id="CAR58516.1"
FT   CDS_pept        488982..489557
FT                   /transl_table=11
FT                   /locus_tag="SSPA0393"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58517"
FT                   /protein_id="CAR58517.1"
FT   CDS_pept        489652..490551
FT                   /transl_table=11
FT                   /locus_tag="SSPA0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58518"
FT                   /protein_id="CAR58518.1"
FT                   PVTGGYYFAPSLDRLLAL"
FT   CDS_pept        490789..491580
FT                   /transl_table=11
FT                   /locus_tag="SSPA0395"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to Salmonella typhi Ty2 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58519"
FT                   /protein_id="CAR58519.1"
FT   CDS_pept        491738..492754
FT                   /transl_table=11
FT                   /locus_tag="SSPA0396"
FT                   /product="thiosulphate-binding protein precursor"
FT                   /note="similar to Salmonella typhi CT18
FT                   thiosulphate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58520"
FT                   /protein_id="CAR58520.1"
FT   CDS_pept        492754..493587
FT                   /transl_table=11
FT                   /locus_tag="SSPA0397"
FT                   /product="sulphate transport system permease protein CysT"
FT                   /note="similar to Salmonella typhi CT18 sulphate transport
FT                   system permease protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58521"
FT                   /protein_id="CAR58521.1"
FT   CDS_pept        493587..494462
FT                   /transl_table=11
FT                   /locus_tag="SSPA0398"
FT                   /product="sulphate transport system permease protein CysW"
FT                   /note="similar to Salmonella typhi CT18 sulphate transport
FT                   system permease protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58522"
FT                   /protein_id="CAR58522.1"
FT                   RAQQEENHEH"
FT   CDS_pept        494452..495546
FT                   /transl_table=11
FT                   /locus_tag="SSPA0399"
FT                   /product="sulphate transport ATP-binding protein CysA"
FT                   /note="similar to Salmonella typhi CT18 sulphate transport
FT                   ATP-binding protein CysA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58523"
FT                   /protein_id="CAR58523.1"
FT   CDS_pept        495667..496578
FT                   /transl_table=11
FT                   /locus_tag="SSPA0400"
FT                   /product="cysteine synthase B"
FT                   /note="similar to Salmonella typhi CT18 cysteine synthase
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58524"
FT                   /protein_id="CAR58524.1"
FT   CDS_pept        complement(496611..496988)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0401"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58525"
FT                   /protein_id="CAR58525.1"
FT   CDS_pept        complement(497047..497688)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0402"
FT                   /product="putative GMP synthase-glutamine amidotransferase
FT                   domain"
FT                   /note="similar to Salmonella typhimurium putative GMP
FT                   synthase - glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58526"
FT                   /protein_id="CAR58526.1"
FT   CDS_pept        complement(497703..498995)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0403"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58527"
FT                   /protein_id="CAR58527.1"
FT   CDS_pept        499078..499944
FT                   /transl_table=11
FT                   /locus_tag="SSPA0404"
FT                   /product="pyridoxine kinase"
FT                   /note="similar to Salmonella typhi CT18 pyridoxine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58528"
FT                   /protein_id="CAR58528.1"
FT                   PPAGEAR"
FT   CDS_pept        complement(500343..500852)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0405"
FT                   /product="pts system, glucose-specific IIA component"
FT                   /note="similar to Salmonella typhi CT18 pts
FT                   system,glucose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58529"
FT                   /protein_id="CAR58529.1"
FT                   VIRIKK"
FT   CDS_pept        complement(500893..502620)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0406"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi Ty2 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58530"
FT                   /protein_id="CAR58530.1"
FT   CDS_pept        complement(502669..502926)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0407"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="similar to Salmonella typhi CT18 phosphocarrier
FT                   protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58531"
FT                   /protein_id="CAR58531.1"
FT   CDS_pept        complement(503310..504281)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0408"
FT                   /product="cysteine synthase A"
FT                   /note="similar to Salmonella typhi CT18 cysteine synthase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58532"
FT                   /protein_id="CAR58532.1"
FT   CDS_pept        complement(504593..505354)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0409"
FT                   /product="putative sulfate transport protein CysZ"
FT                   /note="similar to Salmonella typhi CT18 putative sulfate
FT                   transport protein CysZ"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58533"
FT                   /db_xref="GOA:B5BB70"
FT                   /db_xref="InterPro:IPR022985"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB70"
FT                   /protein_id="CAR58533.1"
FT   CDS_pept        505586..506572
FT                   /transl_table=11
FT                   /locus_tag="SSPA0410"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58534"
FT                   /db_xref="GOA:B5BB71"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB71"
FT                   /protein_id="CAR58534.1"
FT   CDS_pept        506644..508659
FT                   /transl_table=11
FT                   /locus_tag="SSPA0411"
FT                   /product="DNA ligase"
FT                   /note="similar to Salmonella typhi Ty2 DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58535"
FT                   /db_xref="GOA:B5BB72"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB72"
FT                   /protein_id="CAR58535.1"
FT   CDS_pept        508652..508879
FT                   /transl_table=11
FT                   /locus_tag="SSPA0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58536"
FT                   /protein_id="CAR58536.1"
FT   CDS_pept        complement(508876..509874)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0413"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58537"
FT                   /protein_id="CAR58537.1"
FT   CDS_pept        509964..510890
FT                   /transl_table=11
FT                   /locus_tag="SSPA0414"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58538"
FT                   /protein_id="CAR58538.1"
FT   tRNA            complement(511085..511157)
FT                   /gene="lysV"
FT                   /product="tRNA-Lys"
FT   tRNA            complement(511165..511237)
FT                   /gene="valY"
FT                   /product="tRNA-Val"
FT   tRNA            complement(511282..511354)
FT                   /gene="valX"
FT                   /product="tRNA-Val"
FT   tRNA            complement(511403..511475)
FT                   /gene="valU"
FT                   /product="tRNA-Val"
FT   CDS_pept        511734..513149
FT                   /transl_table=11
FT                   /locus_tag="SSPA0415"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="similar to Salmonella typhi CT18 glutamyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58539"
FT                   /db_xref="GOA:B5BB76"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB76"
FT                   /protein_id="CAR58539.1"
FT                   KALGFIAERESQQ"
FT   CDS_pept        complement(513203..513595)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58540"
FT                   /protein_id="CAR58540.1"
FT   CDS_pept        complement(513597..513959)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58541"
FT                   /protein_id="CAR58541.1"
FT                   EGITGLLQRLGIRDSK"
FT   tRNA            514181..514253
FT                   /gene="alaX"
FT                   /product="tRNA-Ala"
FT   CDS_pept        514447..516636
FT                   /transl_table=11
FT                   /locus_tag="SSPA0418"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58542"
FT                   /protein_id="CAR58542.1"
FT   CDS_pept        516689..517713
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="SSPA0418a"
FT                   /product="nucleoside permease NupC (pseudogene)"
FT   CDS_pept        518056..519297
FT                   /transl_table=11
FT                   /locus_tag="SSPA0419"
FT                   /product="manganese transport protein MntH"
FT                   /note="similar to Salmonella typhi CT18 manganese transport
FT                   protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58544"
FT                   /db_xref="GOA:B5BB80"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB80"
FT                   /protein_id="CAR58544.1"
FT                   LNIWLLVGTVMGLS"
FT   CDS_pept        complement(519358..519684)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58545"
FT                   /protein_id="CAR58545.1"
FT                   KHHH"
FT   CDS_pept        complement(519798..520796)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0421"
FT                   /product="putative ion-channel protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ion-channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58546"
FT                   /protein_id="CAR58546.1"
FT   CDS_pept        520976..522628
FT                   /transl_table=11
FT                   /locus_tag="SSPA0422"
FT                   /product="putative decarboxylase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58547"
FT                   /protein_id="CAR58547.1"
FT   CDS_pept        complement(522648..523883)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0423"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58548"
FT                   /db_xref="GOA:B5BB84"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR022969"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB84"
FT                   /protein_id="CAR58548.1"
FT                   GKPLLAANRHEP"
FT   CDS_pept        524087..525052
FT                   /transl_table=11
FT                   /locus_tag="SSPA0424"
FT                   /product="glucokinase"
FT                   /note="similar to Salmonella typhi CT18 glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58549"
FT                   /db_xref="GOA:B5BB85"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BB85"
FT                   /protein_id="CAR58549.1"
FT   CDS_pept        525775..527013
FT                   /transl_table=11
FT                   /locus_tag="SSPA0425"
FT                   /product="putative aminotransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58550"
FT                   /protein_id="CAR58550.1"
FT                   LPSHPKPVEASTE"
FT   CDS_pept        complement(527537..528457)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0426"
FT                   /product="putative acyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58551"
FT                   /protein_id="CAR58551.1"
FT   CDS_pept        528978..529220
FT                   /transl_table=11
FT                   /locus_tag="SSPA0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58552"
FT                   /protein_id="CAR58552.1"
FT   CDS_pept        complement(529458..530849)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0428"
FT                   /product="phosphoglycerate transporter protein"
FT                   /note="similar to Salmonella typhi CT18 phosphoglycerate
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58553"
FT                   /protein_id="CAR58553.1"
FT                   LADAQ"
FT   CDS_pept        531285..532478
FT                   /transl_table=11
FT                   /locus_tag="SSPA0429"
FT                   /product="phosphoglycerate transport regulatory protein
FT                   PgtC precursor"
FT                   /note="similar to Salmonella typhi CT18 phosphoglycerate
FT                   transport regulatory protein PgtC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58554"
FT                   /protein_id="CAR58554.1"
FT   CDS_pept        532475..534482
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pgtB"
FT                   /locus_tag="SSPA0429a"
FT                   /product="phosphoglycerate transport system sensor protein
FT                   PgtB (pseudogene)"
FT   CDS_pept        534472..535719
FT                   /transl_table=11
FT                   /locus_tag="SSPA0430"
FT                   /product="phosphoglycerate transport system transcriptional
FT                   regulatory protein PgtA"
FT                   /note="similar to Salmonella typhi CT18 phosphoglycerate
FT                   transport system transcriptional regulatory protein PgtA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58556"
FT                   /protein_id="CAR58556.1"
FT                   YLRMKKYGLSKEHYKF"
FT   CDS_pept        535987..536925
FT                   /transl_table=11
FT                   /locus_tag="SSPA0431"
FT                   /product="outer membrane protease E"
FT                   /note="similar to Salmonella typhi CT18 outer membrane
FT                   protease E"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58557"
FT                   /protein_id="CAR58557.1"
FT   CDS_pept        537147..537388
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0431a"
FT                   /product="putative bacteriophage tail protein (pseudogene)"
FT   CDS_pept        537789..538336
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0431b"
FT                   /product="putative transposase (pseudogene)"
FT   CDS_pept        complement(538406..540328)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0432"
FT                   /product="putative lipopolysaccharide modification
FT                   acyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipopolysaccharide modification acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58560"
FT                   /protein_id="CAR58560.1"
FT                   NKIIK"
FT   CDS_pept        complement(540345..540599)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0433"
FT                   /product="bactoprenol glucosyl transferase"
FT                   /note="similar to Salmonella typhi CT18 bactoprenol
FT                   glucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58561"
FT                   /protein_id="CAR58561.1"
FT   CDS_pept        complement(540568..540957)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0434"
FT                   /product="bactoprenol-linked glucose transferase"
FT                   /note="similar to Salmonella typhi Ty2 bactoprenol-linked
FT                   glucose transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58562"
FT                   /protein_id="CAR58562.1"
FT   CDS_pept        541607..541900
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0434a"
FT                   /product="putative transposase (fragment)"
FT                   /note="similar to E. coli transposase Q8VR47_ECOLX
FT                   N-terminal"
FT   CDS_pept        complement(542200..543141)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0435"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58564"
FT                   /protein_id="CAR58564.1"
FT   CDS_pept        543430..544185
FT                   /transl_table=11
FT                   /locus_tag="SSPA0436"
FT                   /product="VacJ lipoprotein precursor"
FT                   /note="similar to Salmonella typhi CT18 VacJ lipoprotein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58565"
FT                   /protein_id="CAR58565.1"
FT   CDS_pept        complement(544246..545559)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0437"
FT                   /product="long-chain fatty acid transport protein
FT                   precursor"
FT                   /note="similar to Salmonella typhi CT18 long-chain fatty
FT                   acid transport protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58566"
FT                   /protein_id="CAR58566.1"
FT   CDS_pept        545924..546208
FT                   /transl_table=11
FT                   /locus_tag="SSPA0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58567"
FT                   /protein_id="CAR58567.1"
FT   CDS_pept        546385..547695
FT                   /transl_table=11
FT                   /locus_tag="SSPA0439"
FT                   /product="putative 3-ketoacyl-CoA thiolase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   3-ketoacyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58568"
FT                   /db_xref="GOA:B5BBA0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BBA0"
FT                   /protein_id="CAR58568.1"
FT   CDS_pept        547695..549842
FT                   /transl_table=11
FT                   /locus_tag="SSPA0440"
FT                   /product="putative fatty acid oxidation complex alpha
FT                   subunit"
FT                   /note="similar to Salmonella typhi CT18 putative fatty acid
FT                   oxidation complex alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58569"
FT                   /db_xref="GOA:B5BBA1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012802"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BBA1"
FT                   /protein_id="CAR58569.1"
FT   CDS_pept        550051..550536
FT                   /transl_table=11
FT                   /locus_tag="SSPA0441"
FT                   /product="phosphohistidine phosphatase"
FT                   /note="similar to Salmonella typhi CT18 phosphohistidine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58570"
FT                   /protein_id="CAR58570.1"
FT   CDS_pept        complement(550636..551187)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58571"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BBA3"
FT                   /protein_id="CAR58571.1"
FT   CDS_pept        551353..552285
FT                   /transl_table=11
FT                   /locus_tag="SSPA0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58572"
FT                   /protein_id="CAR58572.1"
FT   CDS_pept        552321..553406
FT                   /transl_table=11
FT                   /locus_tag="SSPA0444"
FT                   /product="chorismate synthase"
FT                   /note="similar to Salmonella typhi CT18 chorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58573"
FT                   /db_xref="GOA:B5BBA5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BBA5"
FT                   /protein_id="CAR58573.1"
FT   CDS_pept        553410..554234
FT                   /transl_table=11
FT                   /locus_tag="SSPA0445"
FT                   /product="penicillin-insensitive murein endopeptidase
FT                   precursor"
FT                   /note="similar to Salmonella typhi CT18
FT                   penicillin-insensitive murein endopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58574"
FT                   /db_xref="GOA:B5BBA6"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BBA6"
FT                   /protein_id="CAR58574.1"
FT   CDS_pept        554234..555043
FT                   /transl_table=11
FT                   /locus_tag="SSPA0446"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58575"
FT                   /protein_id="CAR58575.1"
FT   CDS_pept        555043..555591
FT                   /transl_table=11
FT                   /locus_tag="SSPA0447"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to Salmonella typhimurium putative
FT                   cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58576"
FT                   /protein_id="CAR58576.1"
FT   CDS_pept        555624..555899
FT                   /transl_table=11
FT                   /locus_tag="SSPA0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58577"
FT                   /protein_id="CAR58577.1"
FT   CDS_pept        complement(555947..558007)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58578"
FT                   /protein_id="CAR58578.1"
FT   CDS_pept        558107..559321
FT                   /transl_table=11
FT                   /locus_tag="SSPA0450"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /note="similar to Salmonella typhi CT18
FT                   3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58579"
FT                   /protein_id="CAR58579.1"
FT                   VMRKL"
FT   CDS_pept        559419..560075
FT                   /transl_table=11
FT                   /locus_tag="SSPA0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58580"
FT                   /protein_id="CAR58580.1"
FT   CDS_pept        complement(560142..560660)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0452"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58581"
FT                   /protein_id="CAR58581.1"
FT                   KVAPEYKKH"
FT   CDS_pept        complement(560660..561028)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0453"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58582"
FT                   /protein_id="CAR58582.1"
FT                   AGPGYRAARPSYTIYRKN"
FT   CDS_pept        complement(561197..561445)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0454"
FT                   /product="putative DNA-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58583"
FT                   /protein_id="CAR58583.1"
FT   CDS_pept        561618..561992
FT                   /transl_table=11
FT                   /locus_tag="SSPA0455"
FT                   /product="putative bacteriophage protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58584"
FT                   /protein_id="CAR58584.1"
FT   CDS_pept        562172..563350
FT                   /transl_table=11
FT                   /locus_tag="SSPA0456"
FT                   /product="putative transmembrane transporter"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transmembrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58585"
FT                   /protein_id="CAR58585.1"
FT   CDS_pept        complement(563347..564348)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0457"
FT                   /product="Div protein"
FT                   /note="similar to Salmonella typhi Ty2 Div protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58586"
FT                   /protein_id="CAR58586.1"
FT   CDS_pept        564452..565588
FT                   /transl_table=11
FT                   /locus_tag="SSPA0458"
FT                   /product="erythronate-4-phosphate dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18
FT                   erythronate-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58587"
FT                   /db_xref="GOA:B5BCH6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCH6"
FT                   /protein_id="CAR58587.1"
FT   CDS_pept        565656..566669
FT                   /transl_table=11
FT                   /locus_tag="SSPA0459"
FT                   /product="putative semialdehyde dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58588"
FT                   /protein_id="CAR58588.1"
FT   CDS_pept        566669..567481
FT                   /transl_table=11
FT                   /locus_tag="SSPA0460"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="similar to Salmonella typhi CT18 tRNA pseudouridine
FT                   synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58589"
FT                   /db_xref="GOA:B5BCH8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCH8"
FT                   /protein_id="CAR58589.1"
FT   CDS_pept        567530..568189
FT                   /transl_table=11
FT                   /locus_tag="SSPA0461"
FT                   /product="DedA protein (dsg-1 protein)"
FT                   /note="similar to Salmonella typhi CT18 DedA protein (dsg-1
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58590"
FT                   /protein_id="CAR58590.1"
FT   CDS_pept        568339..569253
FT                   /transl_table=11
FT                   /locus_tag="SSPA0462"
FT                   /product="acetyl-CoA carboxylase beta subunit"
FT                   /note="similar to Salmonella typhi CT18 acetyl-CoA
FT                   carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58591"
FT                   /db_xref="GOA:B5BCI0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCI0"
FT                   /protein_id="CAR58591.1"
FT   CDS_pept        569321..570589
FT                   /transl_table=11
FT                   /locus_tag="SSPA0463"
FT                   /product="folylpolyglutamate synthase"
FT                   /note="similar to Salmonella typhi CT18 folylpolyglutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58592"
FT                   /protein_id="CAR58592.1"
FT   CDS_pept        570579..571253
FT                   /transl_table=11
FT                   /locus_tag="SSPA0464"
FT                   /product="DedD protein"
FT                   /note="similar to Salmonella typhi CT18 DedD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58593"
FT                   /protein_id="CAR58593.1"
FT                   PN"
FT   CDS_pept        571564..572052
FT                   /transl_table=11
FT                   /locus_tag="SSPA0465"
FT                   /product="colicin V production protein (DedE protein)"
FT                   /note="similar to Salmonella typhi CT18 colicin V
FT                   production protein (DedE protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58594"
FT                   /protein_id="CAR58594.1"
FT   CDS_pept        572090..573607
FT                   /transl_table=11
FT                   /locus_tag="SSPA0466"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58595"
FT                   /protein_id="CAR58595.1"
FT   CDS_pept        complement(573643..575070)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0467"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58596"
FT                   /protein_id="CAR58596.1"
FT                   LQYKVQKYAIRFGVVRN"
FT   CDS_pept        575281..576678
FT                   /transl_table=11
FT                   /locus_tag="SSPA0468"
FT                   /product="putative amino acid decarboxylase"
FT                   /note="similar to Salmonella typhi CT18 putative amino acid
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58597"
FT                   /protein_id="CAR58597.1"
FT                   MVKYDIY"
FT   CDS_pept        576769..578190
FT                   /transl_table=11
FT                   /locus_tag="SSPA0469"
FT                   /product="putative amino acid transporter"
FT                   /note="similar to Salmonella typhi CT18 putative amino acid
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58598"
FT                   /protein_id="CAR58598.1"
FT                   RAQKRNARLSMAGGK"
FT   CDS_pept        578192..579295
FT                   /transl_table=11
FT                   /locus_tag="SSPA0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58599"
FT                   /protein_id="CAR58599.1"
FT   CDS_pept        579359..580765
FT                   /transl_table=11
FT                   /locus_tag="SSPA0471"
FT                   /product="putative amino acid permease"
FT                   /note="similar to Salmonella typhi CT18 putative amino acid
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58600"
FT                   /protein_id="CAR58600.1"
FT                   TLSRLRNTVG"
FT   CDS_pept        580792..581361
FT                   /transl_table=11
FT                   /locus_tag="SSPA0472"
FT                   /product="putative decarboxylase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58601"
FT                   /protein_id="CAR58601.1"
FT   CDS_pept        581650..582432
FT                   /transl_table=11
FT                   /locus_tag="SSPA0473"
FT                   /product="lysine-arginine-ornithine-binding periplasmic
FT                   protein precursor"
FT                   /note="similar to Salmonella typhi CT18
FT                   lysine-arginine-ornithine-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58602"
FT                   /protein_id="CAR58602.1"
FT   CDS_pept        582670..583452
FT                   /transl_table=11
FT                   /locus_tag="SSPA0474"
FT                   /product="histidine-binding periplasmic protein"
FT                   /note="similar to Salmonella typhi CT18 histidine-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58603"
FT                   /protein_id="CAR58603.1"
FT   CDS_pept        583635..584321
FT                   /transl_table=11
FT                   /locus_tag="SSPA0475"
FT                   /product="histidine transport system permease protein"
FT                   /note="similar to Salmonella typhi CT18 histidine transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58604"
FT                   /protein_id="CAR58604.1"
FT                   VKRADL"
FT   CDS_pept        584318..585025
FT                   /transl_table=11
FT                   /locus_tag="SSPA0476"
FT                   /product="histidine transport system permease"
FT                   /note="similar to Salmonella typhi CT18 histidine transport
FT                   system permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58605"
FT                   /protein_id="CAR58605.1"
FT                   RAERRWLQHVSSK"
FT   CDS_pept        585039..585812
FT                   /transl_table=11
FT                   /locus_tag="SSPA0477"
FT                   /product="histidine transport ATP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 histidine transport
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58606"
FT                   /protein_id="CAR58606.1"
FT   CDS_pept        complement(585864..586757)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58607"
FT                   /protein_id="CAR58607.1"
FT                   AFRWYDLEEALADVIR"
FT   CDS_pept        complement(586883..587530)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0479"
FT                   /product="putative glutathione-S transferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   glutathione-S transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58608"
FT                   /protein_id="CAR58608.1"
FT   CDS_pept        587673..588317
FT                   /transl_table=11
FT                   /locus_tag="SSPA0480"
FT                   /product="putative glutathione-S transferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   glutathione-S transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58609"
FT                   /protein_id="CAR58609.1"
FT   CDS_pept        588373..588924
FT                   /transl_table=11
FT                   /locus_tag="SSPA0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58610"
FT                   /protein_id="CAR58610.1"
FT   CDS_pept        588981..589535
FT                   /transl_table=11
FT                   /locus_tag="SSPA0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58611"
FT                   /protein_id="CAR58611.1"
FT   CDS_pept        complement(589541..590560)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0483"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58612"
FT                   /protein_id="CAR58612.1"
FT   CDS_pept        590813..591256
FT                   /transl_table=11
FT                   /locus_tag="SSPA0484"
FT                   /product="putative sugar phosphotransferase component II A"
FT                   /note="similar to Salmonella typhi CT18 putative sugar
FT                   phosphotransferase component II A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58613"
FT                   /protein_id="CAR58613.1"
FT   CDS_pept        591337..591609
FT                   /transl_table=11
FT                   /locus_tag="SSPA0485"
FT                   /product="putative sugar phosphotransferase component II B"
FT                   /note="similar to Salmonella typhi CT18 putative sugar
FT                   phosphotransferase component II B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58614"
FT                   /protein_id="CAR58614.1"
FT   CDS_pept        591630..593021
FT                   /transl_table=11
FT                   /locus_tag="SSPA0486"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58615"
FT                   /protein_id="CAR58615.1"
FT                   SGAKE"
FT   CDS_pept        593018..593848
FT                   /transl_table=11
FT                   /locus_tag="SSPA0487"
FT                   /product="putative transketolase N-terminal section"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transketolase N-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58616"
FT                   /protein_id="CAR58616.1"
FT   CDS_pept        593841..594794
FT                   /transl_table=11
FT                   /locus_tag="SSPA0488"
FT                   /product="putative transketolase C-terminal section"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transketolase C-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58617"
FT                   /protein_id="CAR58617.1"
FT   CDS_pept        complement(594843..596363)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0489"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58618"
FT                   /protein_id="CAR58618.1"
FT   CDS_pept        complement(596581..598725)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0490"
FT                   /product="phosphate acetyltransferase"
FT                   /note="similar to Salmonella typhi CT18 phosphate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58619"
FT                   /protein_id="CAR58619.1"
FT   CDS_pept        complement(598802..599863)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0491"
FT                   /product="acetate kinase"
FT                   /note="similar to Salmonella typhi CT18 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58620"
FT                   /protein_id="CAR58620.1"
FT                   ELVIAQDASRLTA"
FT   CDS_pept        600344..600799
FT                   /transl_table=11
FT                   /locus_tag="SSPA0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58621"
FT                   /db_xref="GOA:B5BCL0"
FT                   /db_xref="InterPro:IPR007334"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCL0"
FT                   /protein_id="CAR58621.1"
FT   CDS_pept        600882..601376
FT                   /transl_table=11
FT                   /locus_tag="SSPA0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58622"
FT                   /db_xref="InterPro:IPR005587"
FT                   /db_xref="InterPro:IPR023145"
FT                   /db_xref="InterPro:IPR023146"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCL1"
FT                   /protein_id="CAR58622.1"
FT                   A"
FT   CDS_pept        601369..602046
FT                   /transl_table=11
FT                   /locus_tag="SSPA0494"
FT                   /product="putative phosphatase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58623"
FT                   /protein_id="CAR58623.1"
FT                   RKT"
FT   CDS_pept        602122..603948
FT                   /transl_table=11
FT                   /locus_tag="SSPA0495"
FT                   /product="putative sodium/sulphate transporter"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   sodium/sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58624"
FT                   /protein_id="CAR58624.1"
FT   CDS_pept        complement(604054..604653)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0496"
FT                   /product="putative oxetanocin A biosynthetic enzyme"
FT                   /note="similar to Salmonella typhi CT18 putative oxetanocin
FT                   A biosynthetic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58625"
FT                   /db_xref="GOA:B5BCL4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR022971"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCL4"
FT                   /protein_id="CAR58625.1"
FT   CDS_pept        complement(604747..605961)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0497"
FT                   /product="putative aminotransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58626"
FT                   /protein_id="CAR58626.1"
FT                   SGYHQ"
FT   CDS_pept        606893..607828
FT                   /transl_table=11
FT                   /locus_tag="SSPA0498"
FT                   /product="NADH dehydrogenase operon transcriptional
FT                   regulator"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   operon transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58627"
FT                   /protein_id="CAR58627.1"
FT   CDS_pept        607908..608060
FT                   /transl_table=11
FT                   /locus_tag="SSPA0499"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58628"
FT                   /protein_id="CAR58628.1"
FT                   KLLLF"
FT   CDS_pept        608455..608898
FT                   /transl_table=11
FT                   /locus_tag="SSPA0500"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58629"
FT                   /db_xref="GOA:B5BCL8"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCL8"
FT                   /protein_id="CAR58629.1"
FT   CDS_pept        608914..609576
FT                   /transl_table=11
FT                   /locus_tag="SSPA0501"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58630"
FT                   /db_xref="GOA:B5BCL9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCL9"
FT                   /protein_id="CAR58630.1"
FT   CDS_pept        609663..611465
FT                   /transl_table=11
FT                   /locus_tag="SSPA0502"
FT                   /product="NADH dehydrogenase I chain C; chain D"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain C; chain D"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58631"
FT                   /db_xref="GOA:B5BCM0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCM0"
FT                   /protein_id="CAR58631.1"
FT   CDS_pept        611468..611968
FT                   /transl_table=11
FT                   /locus_tag="SSPA0503"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain E"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58632"
FT                   /protein_id="CAR58632.1"
FT                   RYK"
FT   CDS_pept        611965..613302
FT                   /transl_table=11
FT                   /locus_tag="SSPA0504"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain F"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58633"
FT                   /protein_id="CAR58633.1"
FT   CDS_pept        613327..616059
FT                   /transl_table=11
FT                   /locus_tag="SSPA0505"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain G"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58634"
FT                   /protein_id="CAR58634.1"
FT   CDS_pept        616056..617033
FT                   /transl_table=11
FT                   /locus_tag="SSPA0506"
FT                   /product="NADH dehydrogenase I chain H"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain H"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58635"
FT                   /protein_id="CAR58635.1"
FT   CDS_pept        617048..617590
FT                   /transl_table=11
FT                   /locus_tag="SSPA0507"
FT                   /product="NADH dehydrogenase I chain I"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58636"
FT                   /protein_id="CAR58636.1"
FT                   GEAENEAKPIDVKSLLP"
FT   CDS_pept        617601..618155
FT                   /transl_table=11
FT                   /locus_tag="SSPA0508"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain J"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58637"
FT                   /protein_id="CAR58637.1"
FT   CDS_pept        618152..618454
FT                   /transl_table=11
FT                   /locus_tag="SSPA0509"
FT                   /product="NADH dehydrogenase I chain k"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain k"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58638"
FT                   /db_xref="GOA:B5BCM7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCM7"
FT                   /protein_id="CAR58638.1"
FT   CDS_pept        618451..620292
FT                   /transl_table=11
FT                   /locus_tag="SSPA0510"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain L"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58639"
FT                   /protein_id="CAR58639.1"
FT   CDS_pept        620544..622073
FT                   /transl_table=11
FT                   /locus_tag="SSPA0511"
FT                   /product="NADH dehydrogenase I chain M"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain M"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58640"
FT                   /protein_id="CAR58640.1"
FT   CDS_pept        622260..623537
FT                   /transl_table=11
FT                   /locus_tag="SSPA0512"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /note="similar to Salmonella typhi CT18 NADH dehydrogenase
FT                   I chain N"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58641"
FT                   /protein_id="CAR58641.1"
FT   CDS_pept        complement(623678..624682)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0513"
FT                   /product="putative receptor/regulator protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   receptor/regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58642"
FT                   /protein_id="CAR58642.1"
FT   CDS_pept        complement(624748..625665)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0514"
FT                   /product="putative hydrolase"
FT                   /note="similar to Salmonella typhi CT18 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58643"
FT                   /db_xref="GOA:B5BCN2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013469"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCN2"
FT                   /protein_id="CAR58643.1"
FT   CDS_pept        625726..626187
FT                   /transl_table=11
FT                   /locus_tag="SSPA0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58644"
FT                   /protein_id="CAR58644.1"
FT   CDS_pept        626236..626547
FT                   /transl_table=11
FT                   /locus_tag="SSPA0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58645"
FT                   /protein_id="CAR58645.1"
FT   CDS_pept        626648..627943
FT                   /transl_table=11
FT                   /locus_tag="SSPA0517"
FT                   /product="isochorismate synthase"
FT                   /note="similar to Salmonella typhi CT18 isochorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58646"
FT                   /protein_id="CAR58646.1"
FT   CDS_pept        628029..629699
FT                   /transl_table=11
FT                   /locus_tag="SSPA0518"
FT                   /product="menaquinone biosynthesis protein"
FT                   /note="similar to Salmonella typhi CT18 menaquinone
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58647"
FT                   /db_xref="GOA:B5BCN6"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCN6"
FT                   /protein_id="CAR58647.1"
FT   CDS_pept        629696..630454
FT                   /transl_table=11
FT                   /locus_tag="SSPA0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58648"
FT                   /db_xref="GOA:B5BCN7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCN7"
FT                   /protein_id="CAR58648.1"
FT   CDS_pept        630469..631326
FT                   /transl_table=11
FT                   /locus_tag="SSPA0520"
FT                   /product="naphthoate synthase"
FT                   /note="similar to Salmonella typhi CT18 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58649"
FT                   /protein_id="CAR58649.1"
FT                   KRNP"
FT   CDS_pept        631326..632288
FT                   /transl_table=11
FT                   /locus_tag="SSPA0521"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="similar to Salmonella typhi CT18
FT                   O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58650"
FT                   /db_xref="GOA:B5BCN9"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCN9"
FT                   /protein_id="CAR58650.1"
FT   CDS_pept        632285..633652
FT                   /transl_table=11
FT                   /locus_tag="SSPA0522"
FT                   /product="O-succinylbenzoic acid-CoA ligase"
FT                   /note="similar to Salmonella typhi CT18 O-succinylbenzoic
FT                   acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58651"
FT                   /protein_id="CAR58651.1"
FT   CDS_pept        633750..634007
FT                   /transl_table=11
FT                   /locus_tag="SSPA0523"
FT                   /product="polymyxin B resistance protein"
FT                   /note="similar to Salmonella typhi CT18 polymyxin B
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58652"
FT                   /protein_id="CAR58652.1"
FT   CDS_pept        complement(634002..634379)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0524"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58653"
FT                   /db_xref="GOA:B5BCP2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR022832"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP2"
FT                   /protein_id="CAR58653.1"
FT   CDS_pept        complement(634379..634636)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0525"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58654"
FT                   /db_xref="GOA:B5BCP3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR022883"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP3"
FT                   /protein_id="CAR58654.1"
FT   CDS_pept        complement(634711..636357)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0526"
FT                   /product="melittin resistance protein PqaB"
FT                   /note="similar to Salmonella typhi CT18 melittin resistance
FT                   protein PqaB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58655"
FT                   /db_xref="GOA:B5BCP4"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR022839"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP4"
FT                   /protein_id="CAR58655.1"
FT   CDS_pept        complement(636354..637253)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58656"
FT                   /db_xref="GOA:B5BCP5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023557"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP5"
FT                   /protein_id="CAR58656.1"
FT                   HIPGREGWLGCQQAVSAS"
FT   CDS_pept        complement(637250..639232)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0528"
FT                   /product="putative lipopolysaccharide modification protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipopolysaccharide modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58657"
FT                   /db_xref="GOA:B5BCP6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR021168"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP6"
FT                   /protein_id="CAR58657.1"
FT   CDS_pept        complement(639229..640212)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0529"
FT                   /product="putative lipopolysaccharide modification protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipopolysaccharide modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58658"
FT                   /db_xref="GOA:B5BCP7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR022857"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP7"
FT                   /protein_id="CAR58658.1"
FT   CDS_pept        complement(640215..641372)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0530"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58659"
FT                   /db_xref="GOA:B5BCP8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022850"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP8"
FT                   /protein_id="CAR58659.1"
FT   CDS_pept        641653..642258
FT                   /transl_table=11
FT                   /locus_tag="SSPA0531"
FT                   /product="Ais protein"
FT                   /note="similar to Salmonella typhi CT18 Ais protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58660"
FT                   /db_xref="GOA:B5BCP9"
FT                   /db_xref="InterPro:IPR011310"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCP9"
FT                   /protein_id="CAR58660.1"
FT   CDS_pept        complement(642303..642728)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58661"
FT                   /db_xref="GOA:B5BCQ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR023781"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCQ0"
FT                   /protein_id="CAR58661.1"
FT   CDS_pept        642902..643549
FT                   /transl_table=11
FT                   /locus_tag="SSPA0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58662"
FT                   /protein_id="CAR58662.1"
FT   CDS_pept        643664..644860
FT                   /transl_table=11
FT                   /locus_tag="SSPA0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58663"
FT                   /protein_id="CAR58663.1"
FT   CDS_pept        645110..645892
FT                   /transl_table=11
FT                   /locus_tag="SSPA0535"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58664"
FT                   /protein_id="CAR58664.1"
FT   CDS_pept        645894..647111
FT                   /transl_table=11
FT                   /locus_tag="SSPA0536"
FT                   /product="putative MR-MLE-family protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   MR-MLE-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58665"
FT                   /db_xref="GOA:B5BCQ4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCQ4"
FT                   /protein_id="CAR58665.1"
FT                   KRPYSH"
FT   CDS_pept        647167..648456
FT                   /transl_table=11
FT                   /locus_tag="SSPA0537"
FT                   /product="putative transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58666"
FT                   /protein_id="CAR58666.1"
FT   CDS_pept        648482..649285
FT                   /transl_table=11
FT                   /locus_tag="SSPA0538"
FT                   /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58667"
FT                   /db_xref="GOA:B5BCQ6"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023593"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCQ6"
FT                   /protein_id="CAR58667.1"
FT   CDS_pept        649291..649467
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0539"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="PSEUDO:CAR58668.1"
FT   CDS_pept        complement(649554..650507)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58669"
FT                   /protein_id="CAR58669.1"
FT   CDS_pept        complement(650497..650700)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0542"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58670"
FT                   /protein_id="CAR58670.1"
FT   CDS_pept        complement(651002..652192)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0543"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /note="similar to Salmonella typhi CT18 anaerobic
FT                   glycerol-3-phosphate dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58671"
FT                   /protein_id="CAR58671.1"
FT   CDS_pept        complement(652189..653448)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0544"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit B"
FT                   /note="similar to Salmonella typhi CT18 anaerobic
FT                   glycerol-3-phosphate dehydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58672"
FT                   /db_xref="GOA:B5BCR1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCR1"
FT                   /protein_id="CAR58672.1"
FT   CDS_pept        complement(653438..655066)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0545"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /note="similar to Salmonella typhi CT18 anaerobic
FT                   glycerol-3-phosphate dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58673"
FT                   /protein_id="CAR58673.1"
FT   CDS_pept        655339..656697
FT                   /transl_table=11
FT                   /locus_tag="SSPA0546"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="similar to Salmonella typhi CT18
FT                   glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58674"
FT                   /protein_id="CAR58674.1"
FT   CDS_pept        656702..657772
FT                   /transl_table=11
FT                   /locus_tag="SSPA0547"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   periplasmic precursor"
FT                   /note="similar to Salmonella typhi CT18 glycerophosphoryl
FT                   diester phosphodiesterase periplasmic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58675"
FT                   /protein_id="CAR58675.1"
FT                   FTDFPDKAVMFLQKND"
FT   CDS_pept        complement(657888..658766)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0548"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58676"
FT                   /protein_id="CAR58676.1"
FT                   CMETLTDEGLL"
FT   CDS_pept        658928..660118
FT                   /transl_table=11
FT                   /locus_tag="SSPA0549"
FT                   /product="putative transmembrane transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58677"
FT                   /protein_id="CAR58677.1"
FT   CDS_pept        complement(660120..660374)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0550"
FT                   /product="putative ferredoxin"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58678"
FT                   /protein_id="CAR58678.1"
FT   CDS_pept        complement(660374..661504)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0551"
FT                   /product="ribonucleoside-diphosphate reductase 1 beta
FT                   chain"
FT                   /note="similar to Salmonella typhi CT18
FT                   ribonucleoside-diphosphate reductase 1 beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58679"
FT                   /protein_id="CAR58679.1"
FT   CDS_pept        complement(661617..663902)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0552"
FT                   /product="ribonucleoside-diphosphate reductase 1 alpha
FT                   chain"
FT                   /note="similar to Salmonella typhi CT18
FT                   ribonucleoside-diphosphate reductase 1 alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58680"
FT                   /protein_id="CAR58680.1"
FT                   CESGACKI"
FT   CDS_pept        complement(664258..664986)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0553"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   3-demethylubiquinone-9 3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58681"
FT                   /db_xref="GOA:B5BCS0"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BCS0"
FT                   /protein_id="CAR58681.1"
FT   CDS_pept        complement(665069..665764)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0554"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi Ty2 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58682"
FT                   /protein_id="CAR58682.1"
FT                   ARKLLALKA"
FT   CDS_pept        666003..667328
FT                   /transl_table=11
FT                   /locus_tag="SSPA0555"
FT                   /product="hypothetical protein"
FT                   /note="similar to |17548403|ref|NP_521743.1| PROBABLE
FT                   TRANSPORTER TRANSMEMBRANE PROTEIN [Ralstonia solanacearum
FT                   GMI1000]"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58683"
FT                   /protein_id="CAR58683.1"
FT   CDS_pept        667343..668545
FT                   /transl_table=11
FT                   /locus_tag="SSPA0556"
FT                   /product="putative MR-MLE-family protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   MR-MLE-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58684"
FT                   /protein_id="CAR58684.1"
FT                   K"
FT   CDS_pept        668955..671591
FT                   /transl_table=11
FT                   /locus_tag="SSPA0557"
FT                   /product="DNA gyrase subunit A"
FT                   /note="similar to Salmonella typhi CT18 DNA gyrase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58685"
FT                   /protein_id="CAR58685.1"
FT                   VADDADE"
FT   CDS_pept        671709..674555
FT                   /transl_table=11
FT                   /locus_tag="SSPA0558"
FT                   /product="sensor protein RcsC"
FT                   /note="similar to Salmonella typhi CT18 sensor protein
FT                   RcsC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58686"
FT                   /protein_id="CAR58686.1"
FT                   VLKQTLAVYAERVRKTRA"
FT   CDS_pept        complement(674658..675308)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0559"
FT                   /product="regulator of capsule synthesis B component"
FT                   /note="similar to Salmonella typhi CT18 regulator of
FT                   capsule synthesis B component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58687"
FT                   /protein_id="CAR58687.1"
FT   CDS_pept        complement(675325..677994)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0560"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58688"
FT                   /protein_id="CAR58688.1"
FT                   PGIEKYISDIDAYVKSLL"
FT   misc_RNA        complement(678298..678654)
FT                   /product="micF RNA gene"
FT   CDS_pept        678891..679859
FT                   /transl_table=11
FT                   /locus_tag="SSPA0561"
FT                   /product="outer membrane protein C"
FT                   /note="similar to Salmonella typhi CT18 outer membrane
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58689"
FT                   /protein_id="CAR58689.1"
FT   CDS_pept        679974..681026
FT                   /transl_table=11
FT                   /locus_tag="SSPA0562"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="similar to Salmonella typhi Ty2 thiamine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58690"
FT                   /protein_id="CAR58690.1"
FT                   FKTFLVSDKN"
FT   CDS_pept        681107..682168
FT                   /transl_table=11
FT                   /locus_tag="SSPA0563"
FT                   /product="ADA regulatory protein"
FT                   /note="similar to Salmonella typhi CT18 ADA regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58691"
FT                   /protein_id="CAR58691.1"
FT                   KAQLLKREAQKEE"
FT   CDS_pept        682171..682821
FT                   /transl_table=11
FT                   /locus_tag="SSPA0564"
FT                   /product="AlkB protein"
FT                   /note="similar to Salmonella typhi CT18 AlkB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58692"
FT                   /protein_id="CAR58692.1"
FT   CDS_pept        682897..684540
FT                   /transl_table=11
FT                   /locus_tag="SSPA0565"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58693"
FT                   /protein_id="CAR58693.1"
FT   CDS_pept        complement(684749..685243)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0566"
FT                   /product="ecotin precursor"
FT                   /note="similar to Salmonella typhi CT18 ecotin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58694"
FT                   /db_xref="GOA:B5BDZ1"
FT                   /db_xref="InterPro:IPR005658"
FT                   /db_xref="InterPro:IPR023084"
FT                   /db_xref="InterPro:IPR027438"
FT                   /db_xref="InterPro:IPR036198"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BDZ1"
FT                   /protein_id="CAR58694.1"
FT                   R"
FT   CDS_pept        685657..686148
FT                   /transl_table=11
FT                   /locus_tag="SSPA0567"
FT                   /product="ferredoxin-type protein NapF"
FT                   /note="similar to Salmonella typhi CT18 ferredoxin-type
FT                   protein NapF"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58695"
FT                   /protein_id="CAR58695.1"
FT                   "
FT   CDS_pept        686138..686401
FT                   /transl_table=11
FT                   /locus_tag="SSPA0568"
FT                   /product="putative napAB assembly protein"
FT                   /note="similar to Salmonella typhi Ty2 putative napAB
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58696"
FT                   /protein_id="CAR58696.1"
FT   CDS_pept        686398..688884
FT                   /transl_table=11
FT                   /locus_tag="SSPA0569"
FT                   /product="probable nitrate reductase"
FT                   /note="similar to Salmonella typhi CT18 probable nitrate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58697"
FT                   /db_xref="GOA:B5BDZ4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BDZ4"
FT                   /protein_id="CAR58697.1"
FT                   SKETDFKKCAVKLAKV"
FT   CDS_pept        688891..689586
FT                   /transl_table=11
FT                   /locus_tag="SSPA0570"
FT                   /product="ferredoxin-type protein NapG"
FT                   /note="similar to Salmonella typhi CT18 ferredoxin-type
FT                   protein NapG"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58698"
FT                   /protein_id="CAR58698.1"
FT                   WLEGKDGKS"
FT   CDS_pept        689573..690442
FT                   /transl_table=11
FT                   /locus_tag="SSPA0571"
FT                   /product="ferredoxin-type protein NapH"
FT                   /note="similar to Salmonella typhi CT18 ferredoxin-type
FT                   protein NapH"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58699"
FT                   /protein_id="CAR58699.1"
FT                   IIRDASRR"
FT   CDS_pept        690558..691007
FT                   /transl_table=11
FT                   /locus_tag="SSPA0572"
FT                   /product="cytochrome c-type protein NapB precursor"
FT                   /note="similar to Salmonella typhi CT18 cytochrome c-type
FT                   protein NapB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58700"
FT                   /protein_id="CAR58700.1"
FT   CDS_pept        691017..691619
FT                   /transl_table=11
FT                   /locus_tag="SSPA0573"
FT                   /product="cytochrome c-type protein NapC"
FT                   /note="similar to Salmonella typhi CT18 cytochrome c-type
FT                   protein NapC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58701"
FT                   /protein_id="CAR58701.1"
FT   CDS_pept        691640..692257
FT                   /transl_table=11
FT                   /locus_tag="SSPA0574"
FT                   /product="heme exporter protein A1"
FT                   /note="similar to Salmonella typhi Ty2 heme exporter
FT                   protein A1"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58702"
FT                   /protein_id="CAR58702.1"
FT   CDS_pept        692965..693702
FT                   /transl_table=11
FT                   /locus_tag="SSPA0575"
FT                   /product="heme exporter protein C1"
FT                   /note="similar to Salmonella typhi Ty2 heme exporter
FT                   protein C1"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58703"
FT                   /protein_id="CAR58703.1"
FT   CDS_pept        693699..693911
FT                   /transl_table=11
FT                   /gene="ccmD1"
FT                   /locus_tag="SSPA0576"
FT                   /product="heme exporter protein D1"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58704"
FT                   /protein_id="CAR58704.1"
FT   CDS_pept        693908..694387
FT                   /transl_table=11
FT                   /locus_tag="SSPA0577"
FT                   /product="cytochrome c-type biogenesis protein E1"
FT                   /note="similar to Salmonella typhi Ty2 cytochrome c-type
FT                   biogenesis protein E1"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58705"
FT                   /protein_id="CAR58705.1"
FT   CDS_pept        694384..696315
FT                   /transl_table=11
FT                   /locus_tag="SSPA0578"
FT                   /product="cytochrome c-type biogenesis protein F1"
FT                   /note="similar to Salmonella typhi Ty2 cytochrome c-type
FT                   biogenesis protein F1"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58706"
FT                   /protein_id="CAR58706.1"
FT                   RKPLPEAG"
FT   CDS_pept        696312..696869
FT                   /transl_table=11
FT                   /gene="dsbE1"
FT                   /locus_tag="SSPA0579"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58707"
FT                   /protein_id="CAR58707.1"
FT   CDS_pept        696866..697814
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0579a"
FT                   /product="cytochrome c-type biogenesis protein H1
FT                   (pseudogene)"
FT                   /note="Pseudogene due to 88bp deletion, relative to
FT                   Paratyphi A strain ATCC9150 (SPA0617)"
FT   variation       697264..697270
FT                   /replace="gagccgctgccggcggacaccccggtttgcggcgcgcgcgccgggtggg
FT                   gcgtttacgtgccgggggccgtcattgcgctggcggtcg"
FT                   /note="88 bp deletion relative to Paratyphi A strain
FT                   ATCC9150, causes frameshift in SSPA0579a"
FT   CDS_pept        complement(697858..698505)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0580"
FT                   /product="nitrate/nitrite response regulator protein NarP"
FT                   /note="similar to Salmonella typhi CT18 nitrate/nitrite
FT                   response regulator protein NarP"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58709"
FT                   /protein_id="CAR58709.1"
FT   CDS_pept        699538..699798
FT                   /transl_table=11
FT                   /locus_tag="SSPA0581"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58710"
FT                   /protein_id="CAR58710.1"
FT   CDS_pept        complement(699991..700194)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0582"
FT                   /product="homolog of virulence protein msgA"
FT                   /note="similar to Salmonella typhi CT18 homolog of
FT                   virulence protein msgA"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58711"
FT                   /protein_id="CAR58711.1"
FT   CDS_pept        complement(700386..702146)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0583"
FT                   /product="putative sulphatase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   sulphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58712"
FT                   /protein_id="CAR58712.1"
FT                   LTEEKRFIAN"
FT   CDS_pept        complement(702178..702405)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58713"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE09"
FT                   /protein_id="CAR58713.1"
FT   CDS_pept        702585..703592
FT                   /transl_table=11
FT                   /locus_tag="SSPA0585"
FT                   /product="nucleoid-asociated protein"
FT                   /note="similar to Salmonella typhi CT18 nucleoid-asociated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58714"
FT                   /db_xref="GOA:B5BE10"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE10"
FT                   /protein_id="CAR58714.1"
FT   CDS_pept        703620..704240
FT                   /transl_table=11
FT                   /locus_tag="SSPA0586"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58715"
FT                   /protein_id="CAR58715.1"
FT   CDS_pept        complement(704349..704633)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0587"
FT                   /product="50s ribosomal protein L25"
FT                   /note="similar to Salmonella typhi CT18 50s ribosomal
FT                   protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58716"
FT                   /db_xref="GOA:B5BE12"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE12"
FT                   /protein_id="CAR58716.1"
FT   CDS_pept        complement(704758..706518)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0588"
FT                   /product="putative helicase"
FT                   /note="similar to Salmonella typhi CT18 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58717"
FT                   /protein_id="CAR58717.1"
FT                   RFRRAHELRG"
FT   CDS_pept        706670..707365
FT                   /transl_table=11
FT                   /locus_tag="SSPA0589"
FT                   /product="ribosomal small subunit pseudouridine synthase"
FT                   /note="similar to Salmonella typhi Ty2 ribosomal small
FT                   subunit pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58718"
FT                   /protein_id="CAR58718.1"
FT                   TEEEIASVG"
FT   CDS_pept        707393..708583
FT                   /transl_table=11
FT                   /locus_tag="SSPA0590"
FT                   /product="bicyclomycin resistance protein"
FT                   /note="similar to Salmonella typhi CT18 bicyclomycin
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58719"
FT                   /protein_id="CAR58719.1"
FT   CDS_pept        708580..708678
FT                   /transl_table=11
FT                   /locus_tag="SSPA0591"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58720"
FT                   /protein_id="CAR58720.1"
FT                   /translation="MKGAVSLNGAEECAGGVGGRYPLHDGKAKRLS"
FT   CDS_pept        708974..709318
FT                   /transl_table=11
FT                   /locus_tag="SSPA0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58721"
FT                   /protein_id="CAR58721.1"
FT                   AEPFSNNNPF"
FT   CDS_pept        complement(709322..710911)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0593"
FT                   /product="putative ABC-transporter ATP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ABC-transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58722"
FT                   /protein_id="CAR58722.1"
FT                   QQAYTRQLLALS"
FT   CDS_pept        complement(710913..711938)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0594"
FT                   /product="putative binding-protein-dependent transporter"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   binding-protein-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58723"
FT                   /protein_id="CAR58723.1"
FT                   V"
FT   CDS_pept        complement(711938..713032)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0595"
FT                   /product="putative binding-protein-dependent transporter"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   binding-protein-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58724"
FT                   /protein_id="CAR58724.1"
FT   CDS_pept        complement(713042..714712)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0596"
FT                   /product="putative transport system periplasmic binding
FT                   protein"
FT                   /note="similar to Salmonella typhi CT18 putative transport
FT                   system periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58725"
FT                   /protein_id="CAR58725.1"
FT   CDS_pept        complement(714954..716510)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0597"
FT                   /product="rtn protein"
FT                   /note="similar to Salmonella typhi CT18 rtn protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58726"
FT                   /protein_id="CAR58726.1"
FT                   W"
FT   CDS_pept        complement(716836..717408)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0598"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58727"
FT                   /protein_id="CAR58727.1"
FT   CDS_pept        complement(717822..718535)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0599"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58728"
FT                   /protein_id="CAR58728.1"
FT                   FENYLPGGNKQISNK"
FT   CDS_pept        complement(718571..719557)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58729"
FT                   /protein_id="CAR58729.1"
FT   CDS_pept        complement(719769..720479)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0601"
FT                   /product="putative elongation factor"
FT                   /note="similar to Salmonella typhimurium putative
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58730"
FT                   /db_xref="GOA:B5BE26"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011897"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE26"
FT                   /protein_id="CAR58730.1"
FT                   RIHIEERRYMGRAD"
FT   CDS_pept        complement(720476..720853)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58731"
FT                   /protein_id="CAR58731.1"
FT   CDS_pept        721459..721581
FT                   /transl_table=11
FT                   /locus_tag="SSPA0603"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58732"
FT                   /protein_id="CAR58732.1"
FT   CDS_pept        721583..722248
FT                   /transl_table=11
FT                   /locus_tag="SSPA0604"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58733"
FT                   /protein_id="CAR58733.1"
FT   CDS_pept        complement(722313..723494)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0605"
FT                   /product="sugar efflux transporter"
FT                   /note="similar to Salmonella typhi Ty2 sugar efflux
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58734"
FT                   /protein_id="CAR58734.1"
FT   CDS_pept        723863..724993
FT                   /transl_table=11
FT                   /locus_tag="SSPA0606"
FT                   /product="fructose-specific IIA/FPR component of PTS
FT                   system"
FT                   /note="similar to Salmonella typhi Ty2 fructose-specific
FT                   IIA/FPR component of PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58735"
FT                   /protein_id="CAR58735.1"
FT   CDS_pept        725074..725931
FT                   /transl_table=11
FT                   /locus_tag="SSPA0607"
FT                   /product="1-phosphofructokinase"
FT                   /note="similar to Salmonella typhi CT18
FT                   1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58736"
FT                   /protein_id="CAR58736.1"
FT                   QPFN"
FT   CDS_pept        725948..727636
FT                   /transl_table=11
FT                   /locus_tag="SSPA0608"
FT                   /product="PTS system, fructose-specific IIBC component"
FT                   /note="similar to Salmonella typhi CT18 PTS
FT                   system,fructose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58737"
FT                   /protein_id="CAR58737.1"
FT   CDS_pept        complement(727691..728548)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0609"
FT                   /product="endonuclease IV"
FT                   /note="similar to Salmonella typhi CT18 endonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58738"
FT                   /db_xref="GOA:B5BE34"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE34"
FT                   /protein_id="CAR58738.1"
FT                   EVMA"
FT   CDS_pept        complement(728627..729676)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0610"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58739"
FT                   /protein_id="CAR58739.1"
FT                   NVLIHSLIA"
FT   CDS_pept        729797..730660
FT                   /transl_table=11
FT                   /locus_tag="SSPA0611"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58740"
FT                   /protein_id="CAR58740.1"
FT                   FLSYCE"
FT   CDS_pept        730850..732319
FT                   /transl_table=11
FT                   /locus_tag="SSPA0612"
FT                   /product="lysine-specific permease"
FT                   /note="similar to Salmonella typhi CT18 lysine-specific
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58741"
FT                   /protein_id="CAR58741.1"
FT   CDS_pept        732664..734655
FT                   /transl_table=11
FT                   /locus_tag="SSPA0613"
FT                   /product="colicin I receptor precursor"
FT                   /note="similar to Salmonella typhi CT18 colicin I receptor
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58742"
FT                   /protein_id="CAR58742.1"
FT   CDS_pept        complement(734699..736021)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0614"
FT                   /product="hypothetical protein"
FT                   /note="similar to |16124132|ref|NP_407445.1| putative
FT                   regulatory protein [Yersinia pestis]"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58743"
FT                   /protein_id="CAR58743.1"
FT   CDS_pept        complement(736054..736941)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0615"
FT                   /product="putative hydrolase"
FT                   /note="similar to Salmonella typhi CT18 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58744"
FT                   /protein_id="CAR58744.1"
FT                   HGFELLLFLIEDEL"
FT   CDS_pept        737092..738525
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sdaC"
FT                   /locus_tag="SSPA0615a"
FT                   /product="putative L-serine dehydratase (pseudogene)"
FT   CDS_pept        738530..738919
FT                   /transl_table=11
FT                   /locus_tag="SSPA0616"
FT                   /product="putative DNA-binding protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58746"
FT                   /protein_id="CAR58746.1"
FT   CDS_pept        complement(738908..739765)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0617"
FT                   /product="putative esterase"
FT                   /note="similar to Salmonella typhi CT18 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58747"
FT                   /protein_id="CAR58747.1"
FT                   TSPT"
FT   CDS_pept        740095..740763
FT                   /transl_table=11
FT                   /locus_tag="SSPA0618"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="similar to Salmonella typhi CT18 GTP cyclohydrolase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58748"
FT                   /db_xref="GOA:B5BE43"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE43"
FT                   /protein_id="CAR58748.1"
FT                   "
FT   CDS_pept        740778..741920
FT                   /transl_table=11
FT                   /locus_tag="SSPA0619"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58749"
FT                   /protein_id="CAR58749.1"
FT   CDS_pept        742070..743092
FT                   /transl_table=11
FT                   /locus_tag="SSPA0620"
FT                   /product="mgl repressor and galactose ultrainduction
FT                   factor"
FT                   /note="similar to Salmonella typhi CT18 mgl repressor and
FT                   galactose ultrainduction factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58750"
FT                   /protein_id="CAR58750.1"
FT                   "
FT   CDS_pept        743591..744589
FT                   /transl_table=11
FT                   /locus_tag="SSPA0621"
FT                   /product="D-galactose-binding periplasmic protein
FT                   precursor"
FT                   /note="similar to Salmonella typhi CT18 D-galactose-binding
FT                   periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58751"
FT                   /protein_id="CAR58751.1"
FT   CDS_pept        744723..746243
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="SSPA0621a"
FT                   /product="galactoside transport ATP-binding protein MglA
FT                   (pseudogene)"
FT   CDS_pept        746259..747269
FT                   /transl_table=11
FT                   /locus_tag="SSPA0622"
FT                   /product="galactoside transport system permease protein
FT                   MglC"
FT                   /note="similar to Salmonella typhi CT18 galactoside
FT                   transport system permease protein MglC"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58753"
FT                   /protein_id="CAR58753.1"
FT   CDS_pept        complement(747344..748579)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0623"
FT                   /product="putative dihydropyrimidine dehydrogenase"
FT                   /note="similar to Salmonella typhimurium putative
FT                   dihydropyrimidine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58754"
FT                   /protein_id="CAR58754.1"
FT                   FKKGEKEHALTL"
FT   CDS_pept        complement(748573..749814)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0624"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58755"
FT                   /protein_id="CAR58755.1"
FT                   AQAIHHYLEEACSC"
FT   CDS_pept        complement(750019..750264)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0625"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58756"
FT                   /protein_id="CAR58756.1"
FT   CDS_pept        complement(750261..750980)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0626"
FT                   /product="vancomycin resistance protein"
FT                   /note="similar to Salmonella typhi CT18 vancomycin
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58757"
FT                   /protein_id="CAR58757.1"
FT                   PAVTPEQLLELEKKKGK"
FT   CDS_pept        complement(751157..752041)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0627"
FT                   /product="cytidine deaminase"
FT                   /note="similar to Salmonella typhi CT18 cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58758"
FT                   /db_xref="GOA:B5BE52"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006263"
FT                   /db_xref="InterPro:IPR013171"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020797"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE52"
FT                   /protein_id="CAR58758.1"
FT                   ALGCHNIDRVLLG"
FT   CDS_pept        complement(752195..752890)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0628"
FT                   /product="puatative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 puatative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58759"
FT                   /protein_id="CAR58759.1"
FT                   FPLILAVMR"
FT   CDS_pept        complement(752887..753285)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0629"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58760"
FT                   /db_xref="GOA:B5BE54"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="InterPro:IPR022957"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE54"
FT                   /protein_id="CAR58760.1"
FT   CDS_pept        complement(753417..754325)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0630"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58761"
FT                   /protein_id="CAR58761.1"
FT   CDS_pept        754451..755809
FT                   /transl_table=11
FT                   /locus_tag="SSPA0631"
FT                   /product="putative n-hydroxybenzoate transporter"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   n-hydroxybenzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58762"
FT                   /protein_id="CAR58762.1"
FT   CDS_pept        755821..756858
FT                   /transl_table=11
FT                   /locus_tag="SSPA0632"
FT                   /product="putative gentisate 1,2-dioxygenase"
FT                   /note="similar to Salmonella typhi CT18 putative gentisate
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58763"
FT                   /protein_id="CAR58763.1"
FT                   REARY"
FT   CDS_pept        756874..757575
FT                   /transl_table=11
FT                   /locus_tag="SSPA0633"
FT                   /product="FAA-hydrolase-family protein"
FT                   /note="similar to Salmonella typhi CT18
FT                   FAA-hydrolase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58764"
FT                   /protein_id="CAR58764.1"
FT                   EGLTPIAVKIV"
FT   CDS_pept        757584..758228
FT                   /transl_table=11
FT                   /locus_tag="SSPA0634"
FT                   /product="glutathione-S-transferase-family protein"
FT                   /note="similar to Salmonella typhi CT18
FT                   glutathione-S-transferase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58765"
FT                   /protein_id="CAR58765.1"
FT   CDS_pept        758243..759436
FT                   /transl_table=11
FT                   /locus_tag="SSPA0635"
FT                   /product="putative n-hydroxybenzoate hydroxylase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   n-hydroxybenzoate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58766"
FT                   /protein_id="CAR58766.1"
FT   CDS_pept        759545..760483
FT                   /transl_table=11
FT                   /locus_tag="SSPA0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58767"
FT                   /protein_id="CAR58767.1"
FT   CDS_pept        complement(760554..760751)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0637"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58768"
FT                   /protein_id="CAR58768.1"
FT   CDS_pept        760943..762379
FT                   /transl_table=11
FT                   /locus_tag="SSPA0638"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58769"
FT                   /protein_id="CAR58769.1"
FT   CDS_pept        762445..763206
FT                   /transl_table=11
FT                   /locus_tag="SSPA0639"
FT                   /product="putative oxidoreductase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58770"
FT                   /protein_id="CAR58770.1"
FT   CDS_pept        complement(763255..763851)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0640"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58771"
FT                   /protein_id="CAR58771.1"
FT   CDS_pept        763983..764570
FT                   /transl_table=11
FT                   /locus_tag="SSPA0641"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58772"
FT                   /protein_id="CAR58772.1"
FT   CDS_pept        764775..765683
FT                   /transl_table=11
FT                   /locus_tag="SSPA0642"
FT                   /product="penicillin-binding protein 7"
FT                   /note="similar to Escherichia coli K12 penicillin-binding
FT                   protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58773"
FT                   /protein_id="CAR58773.1"
FT   CDS_pept        complement(765742..767472)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0643"
FT                   /product="D-lactate dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58774"
FT                   /protein_id="CAR58774.1"
FT                   "
FT   CDS_pept        767739..770045
FT                   /transl_table=11
FT                   /locus_tag="SSPA0644"
FT                   /product="periplasmic beta-glucosidase precursor"
FT                   /note="similar to Salmonella typhi CT18 periplasmic
FT                   beta-glucosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58775"
FT                   /protein_id="CAR58775.1"
FT                   GVDSARVKQGSFELL"
FT   CDS_pept        770226..771143
FT                   /transl_table=11
FT                   /locus_tag="SSPA0645"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58776"
FT                   /protein_id="CAR58776.1"
FT   CDS_pept        771147..772316
FT                   /transl_table=11
FT                   /locus_tag="SSPA0646"
FT                   /product="putative permease transmembrane component"
FT                   /note="similar to Salmonella typhi CT18 putative permease
FT                   transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58777"
FT                   /protein_id="CAR58777.1"
FT   CDS_pept        772309..773256
FT                   /transl_table=11
FT                   /locus_tag="SSPA0647"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="similar to Salmonella typhi CT18 ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58778"
FT                   /protein_id="CAR58778.1"
FT   CDS_pept        773240..773971
FT                   /transl_table=11
FT                   /locus_tag="SSPA0648"
FT                   /product="putative permease transmembrane component"
FT                   /note="similar to Salmonella typhi CT18 putative permease
FT                   transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58779"
FT                   /protein_id="CAR58779.1"
FT   CDS_pept        complement(773952..774059)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0649"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58780"
FT                   /db_xref="GOA:B5BE74"
FT                   /db_xref="InterPro:IPR020870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE74"
FT                   /protein_id="CAR58780.1"
FT   CDS_pept        complement(774119..774850)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0650"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58781"
FT                   /protein_id="CAR58781.1"
FT   CDS_pept        775073..776758
FT                   /transl_table=11
FT                   /locus_tag="SSPA0651"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58782"
FT                   /protein_id="CAR58782.1"
FT   CDS_pept        776755..777474
FT                   /transl_table=11
FT                   /locus_tag="SSPA0652"
FT                   /product="putative two-component system response regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58783"
FT                   /protein_id="CAR58783.1"
FT                   VPVSRRYLKSLKEAIGL"
FT   CDS_pept        777521..777988
FT                   /transl_table=11
FT                   /locus_tag="SSPA0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58784"
FT                   /protein_id="CAR58784.1"
FT   CDS_pept        complement(778045..778575)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0654"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58785"
FT                   /protein_id="CAR58785.1"
FT                   QKLLEESGYHRIN"
FT   CDS_pept        complement(778747..779205)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0655"
FT                   /product="putative lipoprotein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58786"
FT                   /protein_id="CAR58786.1"
FT   CDS_pept        complement(779446..781479)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0656"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="similar to Salmonella typhi CT18 methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58787"
FT                   /db_xref="GOA:B5BE81"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BE81"
FT                   /protein_id="CAR58787.1"
FT   CDS_pept        781644..782753
FT                   /transl_table=11
FT                   /locus_tag="SSPA0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58788"
FT                   /protein_id="CAR58788.1"
FT   CDS_pept        783031..783312
FT                   /transl_table=11
FT                   /locus_tag="SSPA0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58789"
FT                   /protein_id="CAR58789.1"
FT   CDS_pept        783591..784124
FT                   /transl_table=11
FT                   /locus_tag="SSPA0659"
FT                   /product="putative fimbrial subunit protein"
FT                   /note="similar to Salmonella typhi CT18 putative fimbrial
FT                   subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58790"
FT                   /protein_id="CAR58790.1"
FT                   GSVESVLTMTVLTD"
FT   CDS_pept        784186..784866
FT                   /transl_table=11
FT                   /locus_tag="SSPA0660"
FT                   /product="putative fimbrial chaperone protein"
FT                   /note="similar to Salmonella typhi CT18 putative fimbrial
FT                   chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58791"
FT                   /protein_id="CAR58791.1"
FT                   KIEN"
FT   CDS_pept        784895..787381
FT                   /transl_table=11
FT                   /locus_tag="SSPA0661"
FT                   /product="putative outer membrane usher protein"
FT                   /note="similar to Salmonella typhi CT18 putative outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58792"
FT                   /protein_id="CAR58792.1"
FT                   ITFDKQIDENNVYICR"
FT   CDS_pept        787397..788419
FT                   /transl_table=11
FT                   /locus_tag="SSPA0662"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58793"
FT                   /protein_id="CAR58793.1"
FT                   "
FT   CDS_pept        complement(788463..788777)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58794"
FT                   /protein_id="CAR58794.1"
FT                   "
FT   CDS_pept        789187..789984
FT                   /transl_table=11
FT                   /locus_tag="SSPA0664"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /note="similar to Salmonella typhi CT18
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58795"
FT                   /db_xref="GOA:B5BF36"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF36"
FT                   /protein_id="CAR58795.1"
FT   CDS_pept        789971..790771
FT                   /transl_table=11
FT                   /locus_tag="SSPA0665"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="similar to Salmonella typhi CT18
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58796"
FT                   /protein_id="CAR58796.1"
FT   CDS_pept        790807..791553
FT                   /transl_table=11
FT                   /locus_tag="SSPA0666"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="similar to Salmonella typhi Ty2 putative GntR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58797"
FT                   /protein_id="CAR58797.1"
FT   CDS_pept        complement(791527..792387)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0667"
FT                   /product="putative sugar kinase"
FT                   /note="similar to Salmonella typhi CT18 putative sugar
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58798"
FT                   /protein_id="CAR58798.1"
FT                   AHKNV"
FT   CDS_pept        complement(792489..793493)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0668"
FT                   /product="putative hydrolase"
FT                   /note="similar to Salmonella typhi CT18 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58799"
FT                   /protein_id="CAR58799.1"
FT   CDS_pept        complement(793490..794761)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0669"
FT                   /product="putative nucleoside permease"
FT                   /note="similar to Salmonella typhi CT18 putative nucleoside
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58800"
FT                   /protein_id="CAR58800.1"
FT   CDS_pept        795015..796067
FT                   /transl_table=11
FT                   /locus_tag="SSPA0670"
FT                   /product="fructose-bisphosphate aldolase class I"
FT                   /note="similar to Salmonella typhi CT18
FT                   fructose-bisphosphate aldolase class I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58801"
FT                   /protein_id="CAR58801.1"
FT                   VYLDSKVTIA"
FT   CDS_pept        complement(796120..797019)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0671"
FT                   /product="putative diacylglycerol kinase catalytic domain"
FT                   /note="similar to Salmonella typhimurium putative
FT                   diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58802"
FT                   /db_xref="GOA:B5BF43"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR022433"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF43"
FT                   /protein_id="CAR58802.1"
FT                   VLPGALRCRLPPDCPLLR"
FT   CDS_pept        797584..797919
FT                   /transl_table=11
FT                   /locus_tag="SSPA0672"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58803"
FT                   /protein_id="CAR58803.1"
FT                   RTRPAWP"
FT   CDS_pept        798041..798457
FT                   /transl_table=11
FT                   /locus_tag="SSPA0673"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58804"
FT                   /protein_id="CAR58804.1"
FT   CDS_pept        complement(798416..798607)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58805"
FT                   /protein_id="CAR58805.1"
FT                   TPFPPSRIIGIQIYSFIL"
FT   CDS_pept        complement(799074..800435)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0675"
FT                   /product="putative protease"
FT                   /note="similar to Salmonella typhi CT18 putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58806"
FT                   /protein_id="CAR58806.1"
FT   CDS_pept        800599..801216
FT                   /transl_table=11
FT                   /locus_tag="SSPA0676"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58807"
FT                   /protein_id="CAR58807.1"
FT   CDS_pept        801534..801632
FT                   /transl_table=11
FT                   /locus_tag="SSPA0677"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58808"
FT                   /protein_id="CAR58808.1"
FT                   /translation="MCRFVNQGMAVALFFNEITSEVELTIADDTQY"
FT   CDS_pept        801872..802291
FT                   /transl_table=11
FT                   /locus_tag="SSPA0678"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58809"
FT                   /protein_id="CAR58809.1"
FT   CDS_pept        802456..802606
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0678a"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT   CDS_pept        802728..803090
FT                   /transl_table=11
FT                   /locus_tag="SSPA0679"
FT                   /product="hypothetical protein"
FT                   /note="similar to |2126036|pir||I69804 hypothetical protein
FT                   rhsF [imported] - Escherichia coli (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58811"
FT                   /protein_id="CAR58811.1"
FT                   TPDNKYYKFTPGTGKN"
FT   CDS_pept        803100..803402
FT                   /transl_table=11
FT                   /locus_tag="SSPA0680"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58812"
FT                   /protein_id="CAR58812.1"
FT   CDS_pept        803532..804032
FT                   /transl_table=11
FT                   /locus_tag="SSPA0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58813"
FT                   /protein_id="CAR58813.1"
FT                   CCD"
FT   CDS_pept        804160..804642
FT                   /transl_table=11
FT                   /locus_tag="SSPA0682"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58814"
FT                   /protein_id="CAR58814.1"
FT   CDS_pept        804860..805138
FT                   /transl_table=11
FT                   /locus_tag="SSPA0683"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58815"
FT                   /protein_id="CAR58815.1"
FT   CDS_pept        805207..805809
FT                   /transl_table=11
FT                   /locus_tag="SSPA0684"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58816"
FT                   /protein_id="CAR58816.1"
FT   CDS_pept        805919..806398
FT                   /transl_table=11
FT                   /locus_tag="SSPA0685"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0685"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58817"
FT                   /protein_id="CAR58817.1"
FT   CDS_pept        806466..806930
FT                   /transl_table=11
FT                   /locus_tag="SSPA0686"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58818"
FT                   /protein_id="CAR58818.1"
FT   CDS_pept        807031..807474
FT                   /transl_table=11
FT                   /locus_tag="SSPA0687"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58819"
FT                   /protein_id="CAR58819.1"
FT   CDS_pept        807586..808314
FT                   /transl_table=11
FT                   /locus_tag="SSPA0688"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58820"
FT                   /protein_id="CAR58820.1"
FT   CDS_pept        complement(808445..809128)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0689"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="frameshift in homopolymer at 809147..809153 relative
FT                   to other Salmonella enterica serovars likely interferes
FT                   with expression of the encoded protein"
FT                   /db_xref="PSEUDO:CAR58821.1"
FT   CDS_pept        complement(809168..811279)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0690"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58822"
FT                   /protein_id="CAR58822.1"
FT                   LPGQVNSMV"
FT   CDS_pept        complement(811290..811985)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0691"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58823"
FT                   /protein_id="CAR58823.1"
FT                   NEFKIFEPI"
FT   CDS_pept        complement(812007..812891)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0692"
FT                   /product="hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58824"
FT                   /protein_id="CAR58824.1"
FT                   QTTRYLPVIKEVQ"
FT   CDS_pept        complement(813478..814200)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0693"
FT                   /product="putative two-component system response regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58825"
FT                   /protein_id="CAR58825.1"
FT                   RAVYGVGYRWEADACRLV"
FT   CDS_pept        complement(814197..815600)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0694"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58826"
FT                   /protein_id="CAR58826.1"
FT                   LDRDLQREV"
FT   CDS_pept        complement(815600..817012)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0695"
FT                   /product="putative transporter protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58827"
FT                   /db_xref="GOA:B5BF67"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023721"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF67"
FT                   /protein_id="CAR58827.1"
FT                   QNMVISRRKRSL"
FT   CDS_pept        complement(817009..820089)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0696"
FT                   /product="putative RND-family transporter protein"
FT                   /note="similar to Salmonella typhi CT18 putative RND-family
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58828"
FT                   /db_xref="GOA:B5BF68"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR023931"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF68"
FT                   /protein_id="CAR58828.1"
FT   CDS_pept        complement(820090..823212)
FT                   /transl_table=11
FT                   /gene="yegN"
FT                   /locus_tag="SSPA0697"
FT                   /product="putative RND-family transporter protein"
FT                   /note="similar to Salmonella typhi CT18 putative RND-family
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58829"
FT                   /db_xref="GOA:B5BF69"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR022831"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF69"
FT                   /protein_id="CAR58829.1"
FT   CDS_pept        complement(823212..824524)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yegN"
FT                   /locus_tag="SSPA0697"
FT                   /product="putative RND-family transporter protein
FT                   (pseudogene)"
FT   misc_RNA        complement(824668..824804)
FT                   /product="tp8; sRNA"
FT   CDS_pept        complement(824869..826221)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0698"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58831"
FT                   /protein_id="CAR58831.1"
FT   CDS_pept        826355..827224
FT                   /transl_table=11
FT                   /locus_tag="SSPA0699"
FT                   /product="DNA-3-methyladenine glycosidase II"
FT                   /note="similar to Salmonella typhi CT18 DNA-3-methyladenine
FT                   glycosidase II"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58832"
FT                   /protein_id="CAR58832.1"
FT                   DSEIAGIQ"
FT   CDS_pept        complement(827192..830182)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0700"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58833"
FT                   /protein_id="CAR58833.1"
FT                   TSYFAIH"
FT   CDS_pept        830513..831154
FT                   /transl_table=11
FT                   /locus_tag="SSPA0701"
FT                   /product="uridine kinase"
FT                   /note="similar to Salmonella typhi CT18 uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58834"
FT                   /db_xref="GOA:B5BF73"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF73"
FT                   /protein_id="CAR58834.1"
FT   CDS_pept        831245..831826
FT                   /transl_table=11
FT                   /locus_tag="SSPA0702"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="similar to Salmonella typhi CT18 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58835"
FT                   /db_xref="GOA:B5BF74"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BF74"
FT                   /protein_id="CAR58835.1"
FT   CDS_pept        831865..833721
FT                   /transl_table=11
FT                   /locus_tag="SSPA0703"
FT                   /product="putative outer membrane assembly protein"
FT                   /note="similar to Salmonella typhi CT18 putative outer
FT                   membrane assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0703"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58836"
FT                   /protein_id="CAR58836.1"
FT   CDS_pept        complement(833816..835375)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0704"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58837"
FT                   /protein_id="CAR58837.1"
FT                   PD"
FT   CDS_pept        836134..837189
FT                   /transl_table=11
FT                   /locus_tag="SSPA0705"
FT                   /product="putative polysaccharide export protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58838"
FT                   /protein_id="CAR58838.1"
FT                   MTDTASDIHSW"
FT   CDS_pept        837195..837644
FT                   /transl_table=11
FT                   /locus_tag="SSPA0706"
FT                   /product="putative protein-tyrosine phosphatase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   protein-tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58839"
FT                   /protein_id="CAR58839.1"
FT   CDS_pept        837641..839800
FT                   /transl_table=11
FT                   /locus_tag="SSPA0707"
FT                   /product="putative tyrosine-protein kinase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   tyrosine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0707"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58840"
FT                   /protein_id="CAR58840.1"
FT   CDS_pept        839887..840728
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0708"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /note="similar to Salmonella typhi Ty2 hypothetical
FT                   protein"
FT                   /note="Pseudogene due to frameshift in homopolymeric tract,
FT                   resulting in premature stop codon after 255 amino acids.
FT                   CDS is intact in Paratyphi A strain ATCC9150 (SPA0751)."
FT   variation       840620..840623
FT                   /replace="ttttt"
FT                   /note="deletion in homopolymeric tract relative to
FT                   Paratyphi A strain ATCC9150, causes frameshift in SSPA0708"
FT   CDS_pept        840731..841219
FT                   /transl_table=11
FT                   /locus_tag="SSPA0709"
FT                   /product="putative acetyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0709"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58842"
FT                   /protein_id="CAR58842.1"
FT   CDS_pept        841216..842433
FT                   /transl_table=11
FT                   /locus_tag="SSPA0710"
FT                   /product="putative glycosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0710"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58843"
FT                   /protein_id="CAR58843.1"
FT                   SFYQNL"
FT   CDS_pept        842408..843622
FT                   /transl_table=11
FT                   /locus_tag="SSPA0711"
FT                   /product="putative colanic acid polymerase"
FT                   /note="similar to Salmonella typhimurium putative colanic
FT                   acid polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0711"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58844"
FT                   /protein_id="CAR58844.1"
FT                   ALKIS"
FT   CDS_pept        843635..844381
FT                   /transl_table=11
FT                   /locus_tag="SSPA0712"
FT                   /product="putative glycosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0712"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58845"
FT                   /protein_id="CAR58845.1"
FT   CDS_pept        844397..844951
FT                   /transl_table=11
FT                   /locus_tag="SSPA0713"
FT                   /product="putative acetyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0713"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58846"
FT                   /protein_id="CAR58846.1"
FT   CDS_pept        844975..846096
FT                   /transl_table=11
FT                   /locus_tag="SSPA0714"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="similar to Salmonella typhi CT18 GDP-mannose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0714"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58847"
FT                   /protein_id="CAR58847.1"
FT   CDS_pept        846099..847064
FT                   /transl_table=11
FT                   /locus_tag="SSPA0715"
FT                   /product="GDP-fucose synthetase"
FT                   /note="similar to Salmonella typhi Ty2 GDP-fucose
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0715"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58848"
FT                   /protein_id="CAR58848.1"
FT   CDS_pept        847067..847540
FT                   /transl_table=11
FT                   /locus_tag="SSPA0716"
FT                   /product="putative O-antigen biosynthesis protein"
FT                   /note="similar to Salmonella typhi CT18 putative O-antigen
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0716"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58849"
FT                   /protein_id="CAR58849.1"
FT   CDS_pept        847537..848760
FT                   /transl_table=11
FT                   /locus_tag="SSPA0717"
FT                   /product="putative glycosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0717"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58850"
FT                   /protein_id="CAR58850.1"
FT                   QFIADIRG"
FT   CDS_pept        848757..850199
FT                   /transl_table=11
FT                   /locus_tag="SSPA0718"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /note="similar to Salmonella typhi CT18 mannose-1-phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0718"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58851"
FT                   /protein_id="CAR58851.1"
FT   CDS_pept        850310..851680
FT                   /transl_table=11
FT                   /locus_tag="SSPA0719"
FT                   /product="phosphomannomutase"
FT                   /note="similar to Salmonella typhi Ty2 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0719"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58852"
FT                   /protein_id="CAR58852.1"
FT   CDS_pept        851734..853128
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="wcaJ"
FT                   /locus_tag="SSPA0719a"
FT                   /product="putative extracellular polysaccharide
FT                   biosynthesis protein (pseudogene)"
FT   CDS_pept        853230..854708
FT                   /transl_table=11
FT                   /locus_tag="SSPA0720"
FT                   /product="putative transmembrane transport protein"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0720"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58854"
FT                   /protein_id="CAR58854.1"
FT   CDS_pept        854730..856010
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="wcaK"
FT                   /locus_tag="SSPA0720a"
FT                   /product="putative extracellular polysaccharide
FT                   biosynthesis protein (pseudogene)"
FT   CDS_pept        856007..857146
FT                   /transl_table=11
FT                   /locus_tag="SSPA0721"
FT                   /product="putative glycosyl transferase in colanic acid
FT                   gene cluster"
FT                   /note="similar to Salmonella typhimurium putative glycosyl
FT                   transferase in colanic acid gene cluster"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58856"
FT                   /protein_id="CAR58856.1"
FT   CDS_pept        857157..858560
FT                   /transl_table=11
FT                   /locus_tag="SSPA0722"
FT                   /product="putative exported protein"
FT                   /note="similar to Salmonella typhi CT18 putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0722"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58857"
FT                   /protein_id="CAR58857.1"
FT                   NFSLPKRGG"
FT   CDS_pept        858609..859631
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="galF"
FT                   /locus_tag="SSPA0722a"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase
FT                   (pseudogene)"
FT   CDS_pept        860008..861093
FT                   /transl_table=11
FT                   /locus_tag="SSPA0723"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="similar to Salmonella typhi CT18 dTDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0723"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58859"
FT                   /protein_id="CAR58859.1"
FT   CDS_pept        861093..861992
FT                   /transl_table=11
FT                   /locus_tag="SSPA0724"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="similar to Salmonella typhi CT18
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0724"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58860"
FT                   /protein_id="CAR58860.1"
FT                   WELGVKRMLTEMFTTTTI"
FT   CDS_pept        862040..862918
FT                   /transl_table=11
FT                   /locus_tag="SSPA0725"
FT                   /product="TDP-glucose pyrophosphorylase"
FT                   /note="similar to Salmonella typhi CT18 TDP-glucose
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0725"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58861"
FT                   /protein_id="CAR58861.1"
FT                   GKYLLKMVKGL"
FT   CDS_pept        862928..863470
FT                   /transl_table=11
FT                   /locus_tag="SSPA0726"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="similar to Salmonella typhi CT18
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0726"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58862"
FT                   /protein_id="CAR58862.1"
FT                   SAKDAAAPLLHQALLTE"
FT   CDS_pept        863476..864450
FT                   /transl_table=11
FT                   /locus_tag="SSPA0727"
FT                   /product="putative reductase RfbI"
FT                   /note="similar to Salmonella typhi CT18 putative reductase
FT                   RfbI"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0727"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58863"
FT                   /protein_id="CAR58863.1"
FT   CDS_pept        864466..865239
FT                   /transl_table=11
FT                   /locus_tag="SSPA0728"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="similar to Salmonella typhi CT18 glucose-1-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0728"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58864"
FT                   /protein_id="CAR58864.1"
FT   CDS_pept        865244..866323
FT                   /transl_table=11
FT                   /locus_tag="SSPA0729"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /note="similar to Salmonella typhi CT18 CDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0729"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58865"
FT                   /protein_id="CAR58865.1"
FT   CDS_pept        866350..867663
FT                   /transl_table=11
FT                   /locus_tag="SSPA0730"
FT                   /product="putative dehydratase RfbH"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   dehydratase RfbH"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0730"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58866"
FT                   /protein_id="CAR58866.1"
FT   CDS_pept        867699..868538
FT                   /transl_table=11
FT                   /locus_tag="SSPA0731"
FT                   /product="paratose synthase"
FT                   /note="similar to Salmonella typhi Ty2 paratose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0731"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58867"
FT                   /protein_id="CAR58867.1"
FT   CDS_pept        868519..869550
FT                   /transl_table=11
FT                   /gene="rfbE"
FT                   /locus_tag="SSPA0732"
FT                   /product="CDP-tyvelose-2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0732"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58868"
FT                   /protein_id="CAR58868.1"
FT                   SSI"
FT   CDS_pept        869621..870919
FT                   /transl_table=11
FT                   /gene="rfbX"
FT                   /locus_tag="SSPA0733"
FT                   /product="putative O-antigen transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0733"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58869"
FT                   /protein_id="CAR58869.1"
FT   CDS_pept        870921..871922
FT                   /transl_table=11
FT                   /locus_tag="SSPA0734"
FT                   /product="putative glycosyl transferase"
FT                   /note="similar to Salmonella typhi Ty2 putative glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0734"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58870"
FT                   /protein_id="CAR58870.1"
FT   variation       871467
FT   CDS_pept        872497..873558
FT                   /transl_table=11
FT                   /locus_tag="SSPA0735"
FT                   /product="putative glycosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0735"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58871"
FT                   /protein_id="CAR58871.1"
FT                   MKQMVGNWLAESK"
FT   CDS_pept        873559..874503
FT                   /transl_table=11
FT                   /locus_tag="SSPA0736"
FT                   /product="putative rhamnosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0736"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58872"
FT                   /protein_id="CAR58872.1"
FT   CDS_pept        874504..875943
FT                   /transl_table=11
FT                   /locus_tag="SSPA0737"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /note="similar to Salmonella typhi Ty2 mannose-1-phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0737"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58873"
FT                   /protein_id="CAR58873.1"
FT   CDS_pept        875930..877363
FT                   /transl_table=11
FT                   /locus_tag="SSPA0738"
FT                   /product="phosphomannomutase"
FT                   /note="similar to Salmonella typhi CT18 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0738"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58874"
FT                   /protein_id="CAR58874.1"
FT   CDS_pept        877435..878865
FT                   /transl_table=11
FT                   /locus_tag="SSPA0739"
FT                   /product="undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /note="similar to Salmonella typhi CT18
FT                   undecaprenyl-phosphate galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0739"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58875"
FT                   /protein_id="CAR58875.1"
FT                   IAILFKTAKVVLRRDGAY"
FT   CDS_pept        879029..880435
FT                   /transl_table=11
FT                   /locus_tag="SSPA0740"
FT                   /product="6-phosphogluconate dehydrogenase,decarboxylating"
FT                   /note="similar to Salmonella typhi CT18 6-phosphogluconate
FT                   dehydrogenase, decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0740"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58876"
FT                   /protein_id="CAR58876.1"
FT                   EGIFHTEWLE"
FT   CDS_pept        880672..881838
FT                   /transl_table=11
FT                   /locus_tag="SSPA0741"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /note="similar to Salmonella typhi Ty2 UDP-glucose
FT                   6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0741"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58877"
FT                   /protein_id="CAR58877.1"
FT   CDS_pept        881987..882964
FT                   /transl_table=11
FT                   /locus_tag="SSPA0742"
FT                   /product="polysaccharide chain length regulator"
FT                   /note="similar to Salmonella typhi Ty2 polysaccharide chain
FT                   length regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0742"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58878"
FT                   /protein_id="CAR58878.1"
FT   CDS_pept        complement(883045..883656)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0743"
FT                   /product="phosphoribosyl-AMP cyclohydrolase /
FT                   phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="similar to Salmonella typhi CT18 phosphoribosyl-AMP
FT                   cyclohydrolase / phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0743"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58879"
FT                   /protein_id="CAR58879.1"
FT   CDS_pept        complement(883650..884426)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0744"
FT                   /product="cyclase HisF"
FT                   /note="similar to Salmonella typhi CT18 cyclase HisF"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0744"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58880"
FT                   /db_xref="GOA:B5BFB5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BFB5"
FT                   /protein_id="CAR58880.1"
FT   CDS_pept        complement(884408..885145)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0745"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="similar to Salmonella typhi CT18
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0745"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58881"
FT                   /db_xref="GOA:B5BFB6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BFB6"
FT                   /protein_id="CAR58881.1"
FT   CDS_pept        complement(885145..885735)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0746"
FT                   /product="amidotransferase"
FT                   /note="similar to Salmonella typhi CT18 amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0746"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58882"
FT                   /protein_id="CAR58882.1"
FT   CDS_pept        complement(885735..886802)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0747"
FT                   /product="imidazoleglycerol-phosphate dehydratase;
FT                   histidinol phosphatase"
FT                   /note="similar to Salmonella typhi CT18
FT                   imidazoleglycerol-phosphate dehydratase; histidinol
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0747"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58883"
FT                   /protein_id="CAR58883.1"
FT                   IRVEGDTLPSSKGVL"
FT   CDS_pept        complement(886799..887878)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0748"
FT                   /product="histidinol-phosphate aminotransferase
FT                   (imidazole)"
FT                   /note="similar to Salmonella typhi CT18
FT                   histidinol-phosphate aminotransferase (imidazole)"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0748"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58884"
FT                   /db_xref="GOA:B5BFB9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BFB9"
FT                   /protein_id="CAR58884.1"
FT   CDS_pept        complement(887875..889179)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0749"
FT                   /product="histidinol dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0749"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58885"
FT                   /protein_id="CAR58885.1"
FT   CDS_pept        complement(889282..890181)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0750"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /note="similar to Salmonella typhi CT18 ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0750"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58886"
FT                   /db_xref="GOA:B5BFC1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BFC1"
FT                   /protein_id="CAR58886.1"
FT                   KALGASSILVLPIEKMME"
FT   CDS_pept        890540..891364
FT                   /transl_table=11
FT                   /locus_tag="SSPA0751"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0751"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58887"
FT                   /protein_id="CAR58887.1"
FT   CDS_pept        891410..892324
FT                   /transl_table=11
FT                   /locus_tag="SSPA0752"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0752"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58888"
FT                   /protein_id="CAR58888.1"
FT   CDS_pept        892604..893968
FT                   /transl_table=11
FT                   /locus_tag="SSPA0753"
FT                   /product="putative amino acid transporter protein"
FT                   /note="similar to Salmonella typhi CT18 putative amino acid
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0753"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58889"
FT                   /protein_id="CAR58889.1"
FT   CDS_pept        complement(894104..895534)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0754"
FT                   /product="exodeoxyribonuclease I"
FT                   /note="similar to Salmonella typhi CT18
FT                   exodeoxyribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0754"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58890"
FT                   /protein_id="CAR58890.1"
FT                   KTKLGLLKSLWQYATEIV"
FT   CDS_pept        complement(895901..898244)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sopA"
FT                   /locus_tag="SSPA0754a"
FT                   /product="secreted protein (pseudogene)"
FT   CDS_pept        898863..901138
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="phsA"
FT                   /locus_tag="SSPA0754b"
FT                   /product="thiosulfate reductase precursor (pseudogene)"
FT   CDS_pept        901153..901731
FT                   /transl_table=11
FT                   /locus_tag="SSPA0755"
FT                   /product="thiosulfate reductase electron transport protein
FT                   PhsB"
FT                   /note="similar to Salmonella typhi CT18 thiosulfate
FT                   reductase electron transport protein PhsB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0755"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58893"
FT                   /protein_id="CAR58893.1"
FT   CDS_pept        901728..902492
FT                   /transl_table=11
FT                   /locus_tag="SSPA0756"
FT                   /product="thiosulfate reductase cytochrome b subunit"
FT                   /note="similar to Salmonella typhi CT18 thiosulfate
FT                   reductase cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0756"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58894"
FT                   /protein_id="CAR58894.1"
FT   CDS_pept        902616..903787
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="dacD"
FT                   /locus_tag="SSPA0756a"
FT                   /product="penicillin-binding protein (pseudogene)"
FT   CDS_pept        903938..904405
FT                   /transl_table=11
FT                   /locus_tag="SSPA0757"
FT                   /product="putative DNA gyrase inhibitory protein"
FT                   /note="similar to Salmonella typhi CT18 putative DNA gyrase
FT                   inhibitory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0757"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58896"
FT                   /protein_id="CAR58896.1"
FT   CDS_pept        904524..905582
FT                   /transl_table=11
FT                   /locus_tag="SSPA0758"
FT                   /product="putative membrane protein"
FT                   /note="similar to Salmonella typhi CT18 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0758"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58897"
FT                   /protein_id="CAR58897.1"
FT                   LLSHLICRALRK"
FT   CDS_pept        905827..906162
FT                   /transl_table=11
FT                   /locus_tag="SSPA0759"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0759"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58898"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5BFD0"
FT                   /protein_id="CAR58898.1"
FT                   HADVKAE"
FT   CDS_pept        complement(906196..907098)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0760"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0760"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58899"
FT                   /protein_id="CAR58899.1"
FT   CDS_pept        complement(907156..908370)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0761"
FT                   /product="putative propionate kinase"
FT                   /note="similar to Salmonella typhi CT18 putative propionate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0761"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58900"
FT                   /protein_id="CAR58900.1"
FT                   LCVPA"
FT   CDS_pept        complement(908355..908807)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0762"
FT                   /product="putative propanediol utilization protein PduV"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   propanediol utilization protein PduV"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0762"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58901"
FT                   /protein_id="CAR58901.1"
FT   CDS_pept        complement(908812..909162)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0763"
FT                   /product="putative propanediol utilization protein PduU"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   propanediol utilization protein PduU"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0763"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58902"
FT                   /protein_id="CAR58902.1"
FT                   MMQFTTCSITRT"
FT   CDS_pept        complement(909162..909716)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0764"
FT                   /product="putative propanediol utilization protein PduT"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   propanediol utilization protein PduT"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0764"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58903"
FT                   /protein_id="CAR58903.1"
FT   CDS_pept        complement(909719..911047)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0765"
FT                   /product="putative ferredoxin"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0765"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58904"
FT                   /protein_id="CAR58904.1"
FT   CDS_pept        complement(911071..912183)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0766"
FT                   /product="putative propanol dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 putative propanol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0766"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58905"
FT                   /protein_id="CAR58905.1"
FT   CDS_pept        complement(912195..913589)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0767"
FT                   /product="putative CoA-dependent proprionaldehyde
FT                   dehydrogenase"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   CoA-dependent proprionaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0767"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58906"
FT                   /protein_id="CAR58906.1"
FT                   NGFSIR"
FT   CDS_pept        complement(913586..914596)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0768"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0768"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58907"
FT                   /protein_id="CAR58907.1"
FT   CDS_pept        complement(914606..914881)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0769"
FT                   /product="Propanediol utilization: polyhedral bodies"
FT                   /note="similar to Salmonella typhimurium Propanediol
FT                   utilization: polyhedral bodies"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0769"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58908"
FT                   /protein_id="CAR58908.1"
FT   CDS_pept        complement(914885..915376)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0770"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0770"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58909"
FT                   /protein_id="CAR58909.1"
FT                   "
FT   CDS_pept        complement(915373..916005)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0771"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to Salmonella typhi CT18 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0771"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58910"
FT                   /protein_id="CAR58910.1"
FT   CDS_pept        complement(916005..916487)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0772"
FT                   /product="putative propanediol utilization protein PduK"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   propanediol utilization protein PduK"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0772"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58911"
FT                   /protein_id="CAR58911.1"
FT   CDS_pept        complement(916491..916766)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0773"
FT                   /product="putative propanediol utilization protein PduJ"
FT                   /note="similar to Salmonella typhi CT18 putative
FT                   propanediol utilization protein PduJ"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0773"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58912"
FT                   /protein_id="CAR58912.1"
FT   CDS_pept        complement(916785..917135)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0774"
FT                   /product="PduH protein"
FT                   /note="similar to Salmonella typhi CT18 PduH protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0774"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58913"
FT                   /protein_id="CAR58913.1"
FT                   LVKGIPFRDLHA"
FT   CDS_pept        complement(917125..918786)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSPA0775"
FT                   /product="PduG protein (pseudogene)"
FT                   /note="similar to Salmonella typhi CT18 PduG protein"
FT                   /note="Pseudogene in Sanger sequence but not McClelland
FT                   sequence, due to deletion of 171nt (57aa) in Sanger
FT                   sequence"
FT                   /db_xref="PSEUDO:CAR58914.1"
FT   CDS_pept        complement(918993..919514)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0776"
FT                   /product="diol dehydratase small subunit"
FT                   /note="similar to Salmonella typhi CT18 diol dehydratase
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0776"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58915"
FT                   /protein_id="CAR58915.1"
FT                   VERKKLKGDD"
FT   CDS_pept        complement(919529..920203)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0777"
FT                   /product="diol dehydratase medium subunit"
FT                   /note="similar to Salmonella typhi CT18 diol dehydratase
FT                   medium subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0777"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58916"
FT                   /protein_id="CAR58916.1"
FT                   AL"
FT   CDS_pept        complement(920214..921878)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0778"
FT                   /product="glycerol dehydratase large subunit"
FT                   /note="similar to Salmonella typhi CT18 glycerol
FT                   dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0778"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58917"
FT                   /protein_id="CAR58917.1"
FT   CDS_pept        complement(921897..922598)
FT                   /transl_table=11
FT                   /locus_tag="SSPA0779"
FT                   /product="putative propanediol utilization protein PduB"
FT                   /note="similar to Salmonella typhi Ty2 putative propanediol
FT                   utilization protein PduB"
FT                   /db_xref="EnsemblGenomes-Gn:SSPA0779"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58918"
FT                   /protein_id="CAR58918.1"
FT                   SEPKNDRPSYI"