(data stored in ACNUC7421 zone)

EMBL: FM204883

ID   FM204883; SV 1; circular; genomic DNA; STD; PRO; 2253793 BP.
XX
AC   FM204883;
XX
PR   Project:PRJEA30765;
XX
DT   26-MAR-2009 (Rel. 100, Created)
DT   01-JUN-2015 (Rel. 125, Last updated, Version 4)
XX
DE   Streptococcus equi subsp. equi 4047, complete genome
XX
KW   complete genome.
XX
OS   Streptococcus equi subsp. equi 4047
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2253793
RA   Holden M.T.G.;
RT   ;
RL   Submitted (08-AUG-2008) to the INSDC.
RL   Holden M.T.G., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.ppat.1000346.
RX   PUBMED; 19325880.
RA   Holden M.T.G., Heather Z., Paillot R., Steward K.F., Webb K., Ainslie F.,
RA   Jourdan T., Bason N.C., Holroyd N.E., Mungall K., Quail M.A., Sanders M.,
RA   Simmonds M., Willey D., Brooks K., Aanensen D.M., Spratt B.G., Jolley K.A.,
RA   Maiden M.C.J., Kehoe M., Chanter N., Bentley S.D., Robinson C.,
RA   Maskell D.J., Parkhill J., Waller A.S.;
RT   "Genomic evidence for the evolution of Streptococcus equi: host
RT   restriction, increased virulence, and genetic exchange with human
RT   pathogens";
RL   PLoS Pathog. 5(3):e1000346-e1000346(2009).
XX
DR   MD5; 6f61f3441a66cdb8e2d50377594d11b7.
DR   BioSample; SAMEA2272426.
DR   EnsemblGenomes-Gn; EBG00001437720.
DR   EnsemblGenomes-Gn; EBG00001437721.
DR   EnsemblGenomes-Gn; EBG00001437722.
DR   EnsemblGenomes-Gn; EBG00001437723.
DR   EnsemblGenomes-Gn; EBG00001437724.
DR   EnsemblGenomes-Gn; EBG00001437725.
DR   EnsemblGenomes-Gn; EBG00001437726.
DR   EnsemblGenomes-Gn; EBG00001437727.
DR   EnsemblGenomes-Gn; EBG00001437728.
DR   EnsemblGenomes-Gn; EBG00001437729.
DR   EnsemblGenomes-Gn; EBG00001437730.
DR   EnsemblGenomes-Gn; EBG00001437731.
DR   EnsemblGenomes-Gn; EBG00001437732.
DR   EnsemblGenomes-Gn; EBG00001437733.
DR   EnsemblGenomes-Gn; EBG00001437734.
DR   EnsemblGenomes-Gn; EBG00001437735.
DR   EnsemblGenomes-Gn; EBG00001437736.
DR   EnsemblGenomes-Gn; EBG00001437737.
DR   EnsemblGenomes-Gn; EBG00001437738.
DR   EnsemblGenomes-Gn; EBG00001437739.
DR   EnsemblGenomes-Gn; EBG00001437740.
DR   EnsemblGenomes-Gn; EBG00001437741.
DR   EnsemblGenomes-Gn; EBG00001437742.
DR   EnsemblGenomes-Gn; EBG00001437743.
DR   EnsemblGenomes-Gn; EBG00001437744.
DR   EnsemblGenomes-Gn; EBG00001437745.
DR   EnsemblGenomes-Gn; EBG00001437746.
DR   EnsemblGenomes-Gn; EBG00001437747.
DR   EnsemblGenomes-Gn; EBG00001437748.
DR   EnsemblGenomes-Gn; EBG00001437749.
DR   EnsemblGenomes-Gn; EBG00001437750.
DR   EnsemblGenomes-Gn; EBG00001437751.
DR   EnsemblGenomes-Gn; EBG00001437752.
DR   EnsemblGenomes-Gn; EBG00001437753.
DR   EnsemblGenomes-Gn; EBG00001437754.
DR   EnsemblGenomes-Gn; EBG00001437755.
DR   EnsemblGenomes-Gn; EBG00001437756.
DR   EnsemblGenomes-Gn; EBG00001437757.
DR   EnsemblGenomes-Gn; EBG00001437758.
DR   EnsemblGenomes-Gn; EBG00001437759.
DR   EnsemblGenomes-Gn; EBG00001437760.
DR   EnsemblGenomes-Gn; EBG00001437761.
DR   EnsemblGenomes-Gn; EBG00001437762.
DR   EnsemblGenomes-Gn; EBG00001437763.
DR   EnsemblGenomes-Gn; EBG00001437764.
DR   EnsemblGenomes-Gn; EBG00001437765.
DR   EnsemblGenomes-Gn; EBG00001437766.
DR   EnsemblGenomes-Gn; EBG00001437767.
DR   EnsemblGenomes-Gn; EBG00001437768.
DR   EnsemblGenomes-Gn; EBG00001437769.
DR   EnsemblGenomes-Gn; EBG00001437770.
DR   EnsemblGenomes-Gn; EBG00001437771.
DR   EnsemblGenomes-Gn; EBG00001437772.
DR   EnsemblGenomes-Gn; EBG00001437773.
DR   EnsemblGenomes-Gn; EBG00001437774.
DR   EnsemblGenomes-Gn; EBG00001437775.
DR   EnsemblGenomes-Gn; EBG00001437776.
DR   EnsemblGenomes-Gn; EBG00001437777.
DR   EnsemblGenomes-Gn; EBG00001437778.
DR   EnsemblGenomes-Gn; EBG00001437779.
DR   EnsemblGenomes-Gn; EBG00001437780.
DR   EnsemblGenomes-Gn; EBG00001437781.
DR   EnsemblGenomes-Gn; EBG00001437782.
DR   EnsemblGenomes-Gn; EBG00001437783.
DR   EnsemblGenomes-Gn; EBG00001437784.
DR   EnsemblGenomes-Gn; EBG00001437785.
DR   EnsemblGenomes-Gn; EBG00001437786.
DR   EnsemblGenomes-Gn; EBG00001437787.
DR   EnsemblGenomes-Gn; EBG00001437788.
DR   EnsemblGenomes-Gn; EBG00001437789.
DR   EnsemblGenomes-Gn; EBG00001437790.
DR   EnsemblGenomes-Gn; EBG00001437791.
DR   EnsemblGenomes-Gn; EBG00001437792.
DR   EnsemblGenomes-Gn; EBG00001437793.
DR   EnsemblGenomes-Gn; EBG00001437794.
DR   EnsemblGenomes-Gn; EBG00001437795.
DR   EnsemblGenomes-Gn; EBG00001437796.
DR   EnsemblGenomes-Gn; EBG00001437797.
DR   EnsemblGenomes-Gn; EBG00001437798.
DR   EnsemblGenomes-Gn; EBG00001437799.
DR   EnsemblGenomes-Gn; EBG00001437800.
DR   EnsemblGenomes-Gn; EBG00001437801.
DR   EnsemblGenomes-Gn; EBG00001437802.
DR   EnsemblGenomes-Gn; EBG00001437803.
DR   EnsemblGenomes-Gn; EBG00001437804.
DR   EnsemblGenomes-Gn; EBG00001437805.
DR   EnsemblGenomes-Gn; EBG00001437806.
DR   EnsemblGenomes-Gn; EBG00001437807.
DR   EnsemblGenomes-Gn; EBG00001437808.
DR   EnsemblGenomes-Gn; EBG00001437809.
DR   EnsemblGenomes-Gn; EBG00001437810.
DR   EnsemblGenomes-Gn; EBG00001437811.
DR   EnsemblGenomes-Gn; EBG00001437812.
DR   EnsemblGenomes-Gn; EBG00001437813.
DR   EnsemblGenomes-Gn; EBG00001437814.
DR   EnsemblGenomes-Gn; EBG00001437815.
DR   EnsemblGenomes-Gn; EBG00001437816.
DR   EnsemblGenomes-Gn; EBG00001437817.
DR   EnsemblGenomes-Gn; EBG00001437818.
DR   EnsemblGenomes-Gn; EBG00001437819.
DR   EnsemblGenomes-Gn; EBG00001437820.
DR   EnsemblGenomes-Gn; EBG00001437821.
DR   EnsemblGenomes-Gn; EBG00001437822.
DR   EnsemblGenomes-Gn; EBG00001437823.
DR   EnsemblGenomes-Gn; EBG00001437824.
DR   EnsemblGenomes-Gn; EBG00001437825.
DR   EnsemblGenomes-Gn; EBG00001437826.
DR   EnsemblGenomes-Gn; EBG00001437827.
DR   EnsemblGenomes-Gn; EBG00001437828.
DR   EnsemblGenomes-Gn; EBG00001437829.
DR   EnsemblGenomes-Gn; EBG00001437830.
DR   EnsemblGenomes-Gn; EBG00001437831.
DR   EnsemblGenomes-Gn; EBG00001437832.
DR   EnsemblGenomes-Gn; EBG00001437833.
DR   EnsemblGenomes-Gn; SEQ_0036.
DR   EnsemblGenomes-Gn; SEQ_0036a.
DR   EnsemblGenomes-Gn; SEQ_0038.
DR   EnsemblGenomes-Gn; SEQ_0048.
DR   EnsemblGenomes-Gn; SEQ_0083.
DR   EnsemblGenomes-Gn; SEQ_0085.
DR   EnsemblGenomes-Gn; SEQ_0100.
DR   EnsemblGenomes-Gn; SEQ_0115.
DR   EnsemblGenomes-Gn; SEQ_0150.
DR   EnsemblGenomes-Gn; SEQ_0214.
DR   EnsemblGenomes-Gn; SEQ_0232.
DR   EnsemblGenomes-Gn; SEQ_0236.
DR   EnsemblGenomes-Gn; SEQ_0239.
DR   EnsemblGenomes-Gn; SEQ_0273.
DR   EnsemblGenomes-Gn; SEQ_0275.
DR   EnsemblGenomes-Gn; SEQ_0276.
DR   EnsemblGenomes-Gn; SEQ_0307.
DR   EnsemblGenomes-Gn; SEQ_0309a.
DR   EnsemblGenomes-Gn; SEQ_0313.
DR   EnsemblGenomes-Gn; SEQ_0320.
DR   EnsemblGenomes-Gn; SEQ_0328.
DR   EnsemblGenomes-Gn; SEQ_0370.
DR   EnsemblGenomes-Gn; SEQ_0375.
DR   EnsemblGenomes-Gn; SEQ_0380.
DR   EnsemblGenomes-Gn; SEQ_0405.
DR   EnsemblGenomes-Gn; SEQ_0424.
DR   EnsemblGenomes-Gn; SEQ_0426.
DR   EnsemblGenomes-Gn; SEQ_0438.
DR   EnsemblGenomes-Gn; SEQ_0443.
DR   EnsemblGenomes-Gn; SEQ_0495.
DR   EnsemblGenomes-Gn; SEQ_0509a.
DR   EnsemblGenomes-Gn; SEQ_0509b.
DR   EnsemblGenomes-Gn; SEQ_0511.
DR   EnsemblGenomes-Gn; SEQ_0514.
DR   EnsemblGenomes-Gn; SEQ_0530.
DR   EnsemblGenomes-Gn; SEQ_0531.
DR   EnsemblGenomes-Gn; SEQ_0541.
DR   EnsemblGenomes-Gn; SEQ_0556.
DR   EnsemblGenomes-Gn; SEQ_0566.
DR   EnsemblGenomes-Gn; SEQ_0573.
DR   EnsemblGenomes-Gn; SEQ_0576.
DR   EnsemblGenomes-Gn; SEQ_0578.
DR   EnsemblGenomes-Gn; SEQ_0583a.
DR   EnsemblGenomes-Gn; SEQ_0584.
DR   EnsemblGenomes-Gn; SEQ_0585.
DR   EnsemblGenomes-Gn; SEQ_0663.
DR   EnsemblGenomes-Gn; SEQ_0685.
DR   EnsemblGenomes-Gn; SEQ_0733.
DR   EnsemblGenomes-Gn; SEQ_0738.
DR   EnsemblGenomes-Gn; SEQ_0746.
DR   EnsemblGenomes-Gn; SEQ_0749.
DR   EnsemblGenomes-Gn; SEQ_0763.
DR   EnsemblGenomes-Gn; SEQ_0774.
DR   EnsemblGenomes-Gn; SEQ_0780.
DR   EnsemblGenomes-Gn; SEQ_0808.
DR   EnsemblGenomes-Gn; SEQ_0866.
DR   EnsemblGenomes-Gn; SEQ_0871.
DR   EnsemblGenomes-Gn; SEQ_0899.
DR   EnsemblGenomes-Gn; SEQ_0909.
DR   EnsemblGenomes-Gn; SEQ_0934.
DR   EnsemblGenomes-Gn; SEQ_0943.
DR   EnsemblGenomes-Gn; SEQ_0986.
DR   EnsemblGenomes-Gn; SEQ_1007.
DR   EnsemblGenomes-Gn; SEQ_1064.
DR   EnsemblGenomes-Gn; SEQ_1068.
DR   EnsemblGenomes-Gn; SEQ_1077.
DR   EnsemblGenomes-Gn; SEQ_1088.
DR   EnsemblGenomes-Gn; SEQ_1098.
DR   EnsemblGenomes-Gn; SEQ_1101.
DR   EnsemblGenomes-Gn; SEQ_1103.
DR   EnsemblGenomes-Gn; SEQ_1149.
DR   EnsemblGenomes-Gn; SEQ_1151.
DR   EnsemblGenomes-Gn; SEQ_1155.
DR   EnsemblGenomes-Gn; SEQ_1189.
DR   EnsemblGenomes-Gn; SEQ_1195.
DR   EnsemblGenomes-Gn; SEQ_1209.
DR   EnsemblGenomes-Gn; SEQ_1214.
DR   EnsemblGenomes-Gn; SEQ_1223.
DR   EnsemblGenomes-Gn; SEQ_1225.
DR   EnsemblGenomes-Gn; SEQ_1226.
DR   EnsemblGenomes-Gn; SEQ_1272.
DR   EnsemblGenomes-Gn; SEQ_1273.
DR   EnsemblGenomes-Gn; SEQ_1276.
DR   EnsemblGenomes-Gn; SEQ_1281.
DR   EnsemblGenomes-Gn; SEQ_1284.
DR   EnsemblGenomes-Gn; SEQ_1307a.
DR   EnsemblGenomes-Gn; SEQ_1328.
DR   EnsemblGenomes-Gn; SEQ_1333.
DR   EnsemblGenomes-Gn; SEQ_1364.
DR   EnsemblGenomes-Gn; SEQ_1380.
DR   EnsemblGenomes-Gn; SEQ_1383.
DR   EnsemblGenomes-Gn; SEQ_1385.
DR   EnsemblGenomes-Gn; SEQ_1387.
DR   EnsemblGenomes-Gn; SEQ_1467.
DR   EnsemblGenomes-Gn; SEQ_1479.
DR   EnsemblGenomes-Gn; SEQ_1492.
DR   EnsemblGenomes-Gn; SEQ_1494.
DR   EnsemblGenomes-Gn; SEQ_1507.
DR   EnsemblGenomes-Gn; SEQ_1518.
DR   EnsemblGenomes-Gn; SEQ_1523.
DR   EnsemblGenomes-Gn; SEQ_1528.
DR   EnsemblGenomes-Gn; SEQ_1573.
DR   EnsemblGenomes-Gn; SEQ_1585.
DR   EnsemblGenomes-Gn; SEQ_1588a.
DR   EnsemblGenomes-Gn; SEQ_1589.
DR   EnsemblGenomes-Gn; SEQ_1590.
DR   EnsemblGenomes-Gn; SEQ_1607.
DR   EnsemblGenomes-Gn; SEQ_1613.
DR   EnsemblGenomes-Gn; SEQ_1632.
DR   EnsemblGenomes-Gn; SEQ_1667.
DR   EnsemblGenomes-Gn; SEQ_1671.
DR   EnsemblGenomes-Gn; SEQ_1677.
DR   EnsemblGenomes-Gn; SEQ_1677a.
DR   EnsemblGenomes-Gn; SEQ_1699.
DR   EnsemblGenomes-Gn; SEQ_1720.
DR   EnsemblGenomes-Gn; SEQ_1721.
DR   EnsemblGenomes-Gn; SEQ_1724.
DR   EnsemblGenomes-Gn; SEQ_1725.
DR   EnsemblGenomes-Gn; SEQ_1810.
DR   EnsemblGenomes-Gn; SEQ_1824a.
DR   EnsemblGenomes-Gn; SEQ_1854.
DR   EnsemblGenomes-Gn; SEQ_1855a.
DR   EnsemblGenomes-Gn; SEQ_1873.
DR   EnsemblGenomes-Gn; SEQ_1924.
DR   EnsemblGenomes-Gn; SEQ_1942.
DR   EnsemblGenomes-Gn; SEQ_1966.
DR   EnsemblGenomes-Gn; SEQ_1968.
DR   EnsemblGenomes-Gn; SEQ_2010.
DR   EnsemblGenomes-Gn; SEQ_2035.
DR   EnsemblGenomes-Gn; SEQ_2078.
DR   EnsemblGenomes-Gn; SEQ_2093.
DR   EnsemblGenomes-Gn; SEQ_2099.
DR   EnsemblGenomes-Gn; SEQ_2117.
DR   EnsemblGenomes-Gn; SEQ_2119.
DR   EnsemblGenomes-Gn; SEQ_2122.
DR   EnsemblGenomes-Gn; SEQ_2138.
DR   EnsemblGenomes-Gn; SEQ_2184.
DR   EnsemblGenomes-Gn; SEQ_2192.
DR   EnsemblGenomes-Gn; SEQ_2225.
DR   EnsemblGenomes-Gn; SEQ_2227.
DR   EnsemblGenomes-Gn; SEQ__r01.
DR   EnsemblGenomes-Gn; SEQ__r02.
DR   EnsemblGenomes-Gn; SEQ__r03.
DR   EnsemblGenomes-Gn; SEQ__r04.
DR   EnsemblGenomes-Gn; SEQ__r05.
DR   EnsemblGenomes-Gn; SEQ__r06.
DR   EnsemblGenomes-Gn; SEQ__r07.
DR   EnsemblGenomes-Gn; SEQ__r08.
DR   EnsemblGenomes-Gn; SEQ__r09.
DR   EnsemblGenomes-Gn; SEQ__r10.
DR   EnsemblGenomes-Gn; SEQ__r11.
DR   EnsemblGenomes-Gn; SEQ__r12.
DR   EnsemblGenomes-Gn; SEQ__r13.
DR   EnsemblGenomes-Gn; SEQ__r14.
DR   EnsemblGenomes-Gn; SEQ__r15.
DR   EnsemblGenomes-Gn; SEQ__r16.
DR   EnsemblGenomes-Gn; SEQ__r17.
DR   EnsemblGenomes-Gn; SEQ__r18.
DR   EnsemblGenomes-Gn; SEQ__t01.
DR   EnsemblGenomes-Gn; SEQ__t02.
DR   EnsemblGenomes-Gn; SEQ__t03.
DR   EnsemblGenomes-Gn; SEQ__t04.
DR   EnsemblGenomes-Gn; SEQ__t05.
DR   EnsemblGenomes-Gn; SEQ__t06.
DR   EnsemblGenomes-Gn; SEQ__t07.
DR   EnsemblGenomes-Gn; SEQ__t08.
DR   EnsemblGenomes-Gn; SEQ__t09.
DR   EnsemblGenomes-Gn; SEQ__t10.
DR   EnsemblGenomes-Gn; SEQ__t11.
DR   EnsemblGenomes-Gn; SEQ__t12.
DR   EnsemblGenomes-Gn; SEQ__t13.
DR   EnsemblGenomes-Gn; SEQ__t14.
DR   EnsemblGenomes-Gn; SEQ__t15.
DR   EnsemblGenomes-Gn; SEQ__t16.
DR   EnsemblGenomes-Gn; SEQ__t17.
DR   EnsemblGenomes-Gn; SEQ__t18.
DR   EnsemblGenomes-Gn; SEQ__t19.
DR   EnsemblGenomes-Gn; SEQ__t20.
DR   EnsemblGenomes-Gn; SEQ__t21.
DR   EnsemblGenomes-Gn; SEQ__t22.
DR   EnsemblGenomes-Gn; SEQ__t23.
DR   EnsemblGenomes-Gn; SEQ__t24.
DR   EnsemblGenomes-Gn; SEQ__t25.
DR   EnsemblGenomes-Gn; SEQ__t26.
DR   EnsemblGenomes-Gn; SEQ__t27.
DR   EnsemblGenomes-Gn; SEQ__t28.
DR   EnsemblGenomes-Gn; SEQ__t29.
DR   EnsemblGenomes-Gn; SEQ__t30.
DR   EnsemblGenomes-Gn; SEQ__t31.
DR   EnsemblGenomes-Gn; SEQ__t32.
DR   EnsemblGenomes-Gn; SEQ__t33.
DR   EnsemblGenomes-Gn; SEQ__t34.
DR   EnsemblGenomes-Gn; SEQ__t35.
DR   EnsemblGenomes-Gn; SEQ__t36.
DR   EnsemblGenomes-Gn; SEQ__t37.
DR   EnsemblGenomes-Gn; SEQ__t38.
DR   EnsemblGenomes-Gn; SEQ__t39.
DR   EnsemblGenomes-Gn; SEQ__t40.
DR   EnsemblGenomes-Gn; SEQ__t41.
DR   EnsemblGenomes-Gn; SEQ__t42.
DR   EnsemblGenomes-Gn; SEQ__t43.
DR   EnsemblGenomes-Gn; SEQ__t44.
DR   EnsemblGenomes-Gn; SEQ__t45.
DR   EnsemblGenomes-Gn; SEQ__t46.
DR   EnsemblGenomes-Gn; SEQ__t47.
DR   EnsemblGenomes-Gn; SEQ__t48.
DR   EnsemblGenomes-Gn; SEQ__t49.
DR   EnsemblGenomes-Gn; SEQ__t50.
DR   EnsemblGenomes-Gn; SEQ__t51.
DR   EnsemblGenomes-Gn; SEQ__t52.
DR   EnsemblGenomes-Gn; SEQ__t53.
DR   EnsemblGenomes-Gn; SEQ__t54.
DR   EnsemblGenomes-Gn; SEQ__t55.
DR   EnsemblGenomes-Gn; SEQ__t56.
DR   EnsemblGenomes-Gn; SEQ__t57.
DR   EnsemblGenomes-Gn; SEQ__t58.
DR   EnsemblGenomes-Gn; SEQ__t59.
DR   EnsemblGenomes-Gn; SEQ__t60.
DR   EnsemblGenomes-Gn; SEQ__t61.
DR   EnsemblGenomes-Gn; SEQ__t62.
DR   EnsemblGenomes-Gn; SEQ__t63.
DR   EnsemblGenomes-Gn; SEQ__t64.
DR   EnsemblGenomes-Gn; SEQ__t65.
DR   EnsemblGenomes-Gn; SEQ__t66.
DR   EnsemblGenomes-Tr; EBT00001815622.
DR   EnsemblGenomes-Tr; EBT00001815623.
DR   EnsemblGenomes-Tr; EBT00001815624.
DR   EnsemblGenomes-Tr; EBT00001815625.
DR   EnsemblGenomes-Tr; EBT00001815626.
DR   EnsemblGenomes-Tr; EBT00001815627.
DR   EnsemblGenomes-Tr; EBT00001815628.
DR   EnsemblGenomes-Tr; EBT00001815629.
DR   EnsemblGenomes-Tr; EBT00001815630.
DR   EnsemblGenomes-Tr; EBT00001815631.
DR   EnsemblGenomes-Tr; EBT00001815632.
DR   EnsemblGenomes-Tr; EBT00001815633.
DR   EnsemblGenomes-Tr; EBT00001815634.
DR   EnsemblGenomes-Tr; EBT00001815635.
DR   EnsemblGenomes-Tr; EBT00001815636.
DR   EnsemblGenomes-Tr; EBT00001815637.
DR   EnsemblGenomes-Tr; EBT00001815638.
DR   EnsemblGenomes-Tr; EBT00001815639.
DR   EnsemblGenomes-Tr; EBT00001815640.
DR   EnsemblGenomes-Tr; EBT00001815641.
DR   EnsemblGenomes-Tr; EBT00001815642.
DR   EnsemblGenomes-Tr; EBT00001815643.
DR   EnsemblGenomes-Tr; EBT00001815644.
DR   EnsemblGenomes-Tr; EBT00001815645.
DR   EnsemblGenomes-Tr; EBT00001815646.
DR   EnsemblGenomes-Tr; EBT00001815647.
DR   EnsemblGenomes-Tr; EBT00001815648.
DR   EnsemblGenomes-Tr; EBT00001815649.
DR   EnsemblGenomes-Tr; EBT00001815650.
DR   EnsemblGenomes-Tr; EBT00001815651.
DR   EnsemblGenomes-Tr; EBT00001815652.
DR   EnsemblGenomes-Tr; EBT00001815653.
DR   EnsemblGenomes-Tr; EBT00001815654.
DR   EnsemblGenomes-Tr; EBT00001815655.
DR   EnsemblGenomes-Tr; EBT00001815656.
DR   EnsemblGenomes-Tr; EBT00001815657.
DR   EnsemblGenomes-Tr; EBT00001815658.
DR   EnsemblGenomes-Tr; EBT00001815659.
DR   EnsemblGenomes-Tr; EBT00001815660.
DR   EnsemblGenomes-Tr; EBT00001815661.
DR   EnsemblGenomes-Tr; EBT00001815662.
DR   EnsemblGenomes-Tr; EBT00001815663.
DR   EnsemblGenomes-Tr; EBT00001815664.
DR   EnsemblGenomes-Tr; EBT00001815665.
DR   EnsemblGenomes-Tr; EBT00001815666.
DR   EnsemblGenomes-Tr; EBT00001815667.
DR   EnsemblGenomes-Tr; EBT00001815668.
DR   EnsemblGenomes-Tr; EBT00001815669.
DR   EnsemblGenomes-Tr; EBT00001815670.
DR   EnsemblGenomes-Tr; EBT00001815671.
DR   EnsemblGenomes-Tr; EBT00001815672.
DR   EnsemblGenomes-Tr; EBT00001815673.
DR   EnsemblGenomes-Tr; EBT00001815674.
DR   EnsemblGenomes-Tr; EBT00001815675.
DR   EnsemblGenomes-Tr; EBT00001815676.
DR   EnsemblGenomes-Tr; EBT00001815677.
DR   EnsemblGenomes-Tr; EBT00001815678.
DR   EnsemblGenomes-Tr; EBT00001815679.
DR   EnsemblGenomes-Tr; EBT00001815680.
DR   EnsemblGenomes-Tr; EBT00001815681.
DR   EnsemblGenomes-Tr; EBT00001815682.
DR   EnsemblGenomes-Tr; EBT00001815683.
DR   EnsemblGenomes-Tr; EBT00001815684.
DR   EnsemblGenomes-Tr; EBT00001815685.
DR   EnsemblGenomes-Tr; EBT00001815686.
DR   EnsemblGenomes-Tr; EBT00001815687.
DR   EnsemblGenomes-Tr; EBT00001815688.
DR   EnsemblGenomes-Tr; EBT00001815689.
DR   EnsemblGenomes-Tr; EBT00001815690.
DR   EnsemblGenomes-Tr; EBT00001815691.
DR   EnsemblGenomes-Tr; EBT00001815692.
DR   EnsemblGenomes-Tr; EBT00001815693.
DR   EnsemblGenomes-Tr; EBT00001815694.
DR   EnsemblGenomes-Tr; EBT00001815695.
DR   EnsemblGenomes-Tr; EBT00001815696.
DR   EnsemblGenomes-Tr; EBT00001815697.
DR   EnsemblGenomes-Tr; EBT00001815698.
DR   EnsemblGenomes-Tr; EBT00001815699.
DR   EnsemblGenomes-Tr; EBT00001815700.
DR   EnsemblGenomes-Tr; EBT00001815701.
DR   EnsemblGenomes-Tr; EBT00001815702.
DR   EnsemblGenomes-Tr; EBT00001815703.
DR   EnsemblGenomes-Tr; EBT00001815704.
DR   EnsemblGenomes-Tr; EBT00001815705.
DR   EnsemblGenomes-Tr; EBT00001815706.
DR   EnsemblGenomes-Tr; EBT00001815707.
DR   EnsemblGenomes-Tr; EBT00001815708.
DR   EnsemblGenomes-Tr; EBT00001815709.
DR   EnsemblGenomes-Tr; EBT00001815710.
DR   EnsemblGenomes-Tr; EBT00001815711.
DR   EnsemblGenomes-Tr; EBT00001815712.
DR   EnsemblGenomes-Tr; EBT00001815713.
DR   EnsemblGenomes-Tr; EBT00001815714.
DR   EnsemblGenomes-Tr; EBT00001815715.
DR   EnsemblGenomes-Tr; EBT00001815716.
DR   EnsemblGenomes-Tr; EBT00001815717.
DR   EnsemblGenomes-Tr; EBT00001815718.
DR   EnsemblGenomes-Tr; EBT00001815719.
DR   EnsemblGenomes-Tr; EBT00001815720.
DR   EnsemblGenomes-Tr; EBT00001815721.
DR   EnsemblGenomes-Tr; EBT00001815722.
DR   EnsemblGenomes-Tr; EBT00001815723.
DR   EnsemblGenomes-Tr; EBT00001815724.
DR   EnsemblGenomes-Tr; EBT00001815725.
DR   EnsemblGenomes-Tr; EBT00001815726.
DR   EnsemblGenomes-Tr; EBT00001815727.
DR   EnsemblGenomes-Tr; EBT00001815728.
DR   EnsemblGenomes-Tr; EBT00001815729.
DR   EnsemblGenomes-Tr; EBT00001815730.
DR   EnsemblGenomes-Tr; EBT00001815731.
DR   EnsemblGenomes-Tr; EBT00001815732.
DR   EnsemblGenomes-Tr; EBT00001815733.
DR   EnsemblGenomes-Tr; EBT00001815734.
DR   EnsemblGenomes-Tr; EBT00001815735.
DR   EnsemblGenomes-Tr; SEQ_0036.
DR   EnsemblGenomes-Tr; SEQ_0036a.
DR   EnsemblGenomes-Tr; SEQ_0038.
DR   EnsemblGenomes-Tr; SEQ_0048.
DR   EnsemblGenomes-Tr; SEQ_0083.
DR   EnsemblGenomes-Tr; SEQ_0085.
DR   EnsemblGenomes-Tr; SEQ_0100.
DR   EnsemblGenomes-Tr; SEQ_0115.
DR   EnsemblGenomes-Tr; SEQ_0150.
DR   EnsemblGenomes-Tr; SEQ_0214.
DR   EnsemblGenomes-Tr; SEQ_0232.
DR   EnsemblGenomes-Tr; SEQ_0236.
DR   EnsemblGenomes-Tr; SEQ_0239.
DR   EnsemblGenomes-Tr; SEQ_0273.
DR   EnsemblGenomes-Tr; SEQ_0275.
DR   EnsemblGenomes-Tr; SEQ_0276.
DR   EnsemblGenomes-Tr; SEQ_0307.
DR   EnsemblGenomes-Tr; SEQ_0309a.
DR   EnsemblGenomes-Tr; SEQ_0313.
DR   EnsemblGenomes-Tr; SEQ_0320.
DR   EnsemblGenomes-Tr; SEQ_0328.
DR   EnsemblGenomes-Tr; SEQ_0370.
DR   EnsemblGenomes-Tr; SEQ_0375.
DR   EnsemblGenomes-Tr; SEQ_0380.
DR   EnsemblGenomes-Tr; SEQ_0405.
DR   EnsemblGenomes-Tr; SEQ_0424.
DR   EnsemblGenomes-Tr; SEQ_0426.
DR   EnsemblGenomes-Tr; SEQ_0438.
DR   EnsemblGenomes-Tr; SEQ_0443.
DR   EnsemblGenomes-Tr; SEQ_0495.
DR   EnsemblGenomes-Tr; SEQ_0509a.
DR   EnsemblGenomes-Tr; SEQ_0509b.
DR   EnsemblGenomes-Tr; SEQ_0511.
DR   EnsemblGenomes-Tr; SEQ_0514.
DR   EnsemblGenomes-Tr; SEQ_0530.
DR   EnsemblGenomes-Tr; SEQ_0531.
DR   EnsemblGenomes-Tr; SEQ_0541.
DR   EnsemblGenomes-Tr; SEQ_0556.
DR   EnsemblGenomes-Tr; SEQ_0566.
DR   EnsemblGenomes-Tr; SEQ_0573.
DR   EnsemblGenomes-Tr; SEQ_0576.
DR   EnsemblGenomes-Tr; SEQ_0578.
DR   EnsemblGenomes-Tr; SEQ_0583a.
DR   EnsemblGenomes-Tr; SEQ_0584.
DR   EnsemblGenomes-Tr; SEQ_0585.
DR   EnsemblGenomes-Tr; SEQ_0663.
DR   EnsemblGenomes-Tr; SEQ_0685.
DR   EnsemblGenomes-Tr; SEQ_0733.
DR   EnsemblGenomes-Tr; SEQ_0738.
DR   EnsemblGenomes-Tr; SEQ_0746.
DR   EnsemblGenomes-Tr; SEQ_0749.
DR   EnsemblGenomes-Tr; SEQ_0763.
DR   EnsemblGenomes-Tr; SEQ_0774.
DR   EnsemblGenomes-Tr; SEQ_0780.
DR   EnsemblGenomes-Tr; SEQ_0808.
DR   EnsemblGenomes-Tr; SEQ_0866.
DR   EnsemblGenomes-Tr; SEQ_0871.
DR   EnsemblGenomes-Tr; SEQ_0899.
DR   EnsemblGenomes-Tr; SEQ_0909.
DR   EnsemblGenomes-Tr; SEQ_0934.
DR   EnsemblGenomes-Tr; SEQ_0943.
DR   EnsemblGenomes-Tr; SEQ_0986.
DR   EnsemblGenomes-Tr; SEQ_1007.
DR   EnsemblGenomes-Tr; SEQ_1064.
DR   EnsemblGenomes-Tr; SEQ_1068.
DR   EnsemblGenomes-Tr; SEQ_1077.
DR   EnsemblGenomes-Tr; SEQ_1088.
DR   EnsemblGenomes-Tr; SEQ_1098.
DR   EnsemblGenomes-Tr; SEQ_1101.
DR   EnsemblGenomes-Tr; SEQ_1103.
DR   EnsemblGenomes-Tr; SEQ_1149.
DR   EnsemblGenomes-Tr; SEQ_1151.
DR   EnsemblGenomes-Tr; SEQ_1155.
DR   EnsemblGenomes-Tr; SEQ_1189.
DR   EnsemblGenomes-Tr; SEQ_1195.
DR   EnsemblGenomes-Tr; SEQ_1209.
DR   EnsemblGenomes-Tr; SEQ_1214.
DR   EnsemblGenomes-Tr; SEQ_1223.
DR   EnsemblGenomes-Tr; SEQ_1225.
DR   EnsemblGenomes-Tr; SEQ_1226.
DR   EnsemblGenomes-Tr; SEQ_1272.
DR   EnsemblGenomes-Tr; SEQ_1273.
DR   EnsemblGenomes-Tr; SEQ_1276.
DR   EnsemblGenomes-Tr; SEQ_1281.
DR   EnsemblGenomes-Tr; SEQ_1284.
DR   EnsemblGenomes-Tr; SEQ_1307a.
DR   EnsemblGenomes-Tr; SEQ_1328.
DR   EnsemblGenomes-Tr; SEQ_1333.
DR   EnsemblGenomes-Tr; SEQ_1364.
DR   EnsemblGenomes-Tr; SEQ_1380.
DR   EnsemblGenomes-Tr; SEQ_1383.
DR   EnsemblGenomes-Tr; SEQ_1385.
DR   EnsemblGenomes-Tr; SEQ_1387.
DR   EnsemblGenomes-Tr; SEQ_1467.
DR   EnsemblGenomes-Tr; SEQ_1479.
DR   EnsemblGenomes-Tr; SEQ_1492.
DR   EnsemblGenomes-Tr; SEQ_1494.
DR   EnsemblGenomes-Tr; SEQ_1507.
DR   EnsemblGenomes-Tr; SEQ_1518.
DR   EnsemblGenomes-Tr; SEQ_1523.
DR   EnsemblGenomes-Tr; SEQ_1528.
DR   EnsemblGenomes-Tr; SEQ_1573.
DR   EnsemblGenomes-Tr; SEQ_1585.
DR   EnsemblGenomes-Tr; SEQ_1588a.
DR   EnsemblGenomes-Tr; SEQ_1589.
DR   EnsemblGenomes-Tr; SEQ_1590.
DR   EnsemblGenomes-Tr; SEQ_1607.
DR   EnsemblGenomes-Tr; SEQ_1613.
DR   EnsemblGenomes-Tr; SEQ_1632.
DR   EnsemblGenomes-Tr; SEQ_1667.
DR   EnsemblGenomes-Tr; SEQ_1671.
DR   EnsemblGenomes-Tr; SEQ_1677.
DR   EnsemblGenomes-Tr; SEQ_1677a.
DR   EnsemblGenomes-Tr; SEQ_1699.
DR   EnsemblGenomes-Tr; SEQ_1720.
DR   EnsemblGenomes-Tr; SEQ_1721.
DR   EnsemblGenomes-Tr; SEQ_1724.
DR   EnsemblGenomes-Tr; SEQ_1725.
DR   EnsemblGenomes-Tr; SEQ_1810.
DR   EnsemblGenomes-Tr; SEQ_1824a.
DR   EnsemblGenomes-Tr; SEQ_1854.
DR   EnsemblGenomes-Tr; SEQ_1855a.
DR   EnsemblGenomes-Tr; SEQ_1873.
DR   EnsemblGenomes-Tr; SEQ_1924.
DR   EnsemblGenomes-Tr; SEQ_1942.
DR   EnsemblGenomes-Tr; SEQ_1966.
DR   EnsemblGenomes-Tr; SEQ_1968.
DR   EnsemblGenomes-Tr; SEQ_2010.
DR   EnsemblGenomes-Tr; SEQ_2035.
DR   EnsemblGenomes-Tr; SEQ_2078.
DR   EnsemblGenomes-Tr; SEQ_2093.
DR   EnsemblGenomes-Tr; SEQ_2099.
DR   EnsemblGenomes-Tr; SEQ_2117.
DR   EnsemblGenomes-Tr; SEQ_2119.
DR   EnsemblGenomes-Tr; SEQ_2122.
DR   EnsemblGenomes-Tr; SEQ_2138.
DR   EnsemblGenomes-Tr; SEQ_2184.
DR   EnsemblGenomes-Tr; SEQ_2192.
DR   EnsemblGenomes-Tr; SEQ_2225.
DR   EnsemblGenomes-Tr; SEQ_2227.
DR   EnsemblGenomes-Tr; SEQ__r01-1.
DR   EnsemblGenomes-Tr; SEQ__r02-1.
DR   EnsemblGenomes-Tr; SEQ__r03-1.
DR   EnsemblGenomes-Tr; SEQ__r04-1.
DR   EnsemblGenomes-Tr; SEQ__r05-1.
DR   EnsemblGenomes-Tr; SEQ__r06-1.
DR   EnsemblGenomes-Tr; SEQ__r07-1.
DR   EnsemblGenomes-Tr; SEQ__r08-1.
DR   EnsemblGenomes-Tr; SEQ__r09-1.
DR   EnsemblGenomes-Tr; SEQ__r10-1.
DR   EnsemblGenomes-Tr; SEQ__r11-1.
DR   EnsemblGenomes-Tr; SEQ__r12-1.
DR   EnsemblGenomes-Tr; SEQ__r13-1.
DR   EnsemblGenomes-Tr; SEQ__r14-1.
DR   EnsemblGenomes-Tr; SEQ__r15-1.
DR   EnsemblGenomes-Tr; SEQ__r16-1.
DR   EnsemblGenomes-Tr; SEQ__r17-1.
DR   EnsemblGenomes-Tr; SEQ__r18-1.
DR   EnsemblGenomes-Tr; SEQ__t01-1.
DR   EnsemblGenomes-Tr; SEQ__t02-1.
DR   EnsemblGenomes-Tr; SEQ__t03-1.
DR   EnsemblGenomes-Tr; SEQ__t04-1.
DR   EnsemblGenomes-Tr; SEQ__t05-1.
DR   EnsemblGenomes-Tr; SEQ__t06-1.
DR   EnsemblGenomes-Tr; SEQ__t07-1.
DR   EnsemblGenomes-Tr; SEQ__t08-1.
DR   EnsemblGenomes-Tr; SEQ__t09-1.
DR   EnsemblGenomes-Tr; SEQ__t10-1.
DR   EnsemblGenomes-Tr; SEQ__t11-1.
DR   EnsemblGenomes-Tr; SEQ__t12-1.
DR   EnsemblGenomes-Tr; SEQ__t13-1.
DR   EnsemblGenomes-Tr; SEQ__t14-1.
DR   EnsemblGenomes-Tr; SEQ__t15-1.
DR   EnsemblGenomes-Tr; SEQ__t16-1.
DR   EnsemblGenomes-Tr; SEQ__t17-1.
DR   EnsemblGenomes-Tr; SEQ__t18-1.
DR   EnsemblGenomes-Tr; SEQ__t19-1.
DR   EnsemblGenomes-Tr; SEQ__t20-1.
DR   EnsemblGenomes-Tr; SEQ__t21-1.
DR   EnsemblGenomes-Tr; SEQ__t22-1.
DR   EnsemblGenomes-Tr; SEQ__t23-1.
DR   EnsemblGenomes-Tr; SEQ__t24-1.
DR   EnsemblGenomes-Tr; SEQ__t25-1.
DR   EnsemblGenomes-Tr; SEQ__t26-1.
DR   EnsemblGenomes-Tr; SEQ__t27-1.
DR   EnsemblGenomes-Tr; SEQ__t28-1.
DR   EnsemblGenomes-Tr; SEQ__t29-1.
DR   EnsemblGenomes-Tr; SEQ__t30-1.
DR   EnsemblGenomes-Tr; SEQ__t31-1.
DR   EnsemblGenomes-Tr; SEQ__t32-1.
DR   EnsemblGenomes-Tr; SEQ__t33-1.
DR   EnsemblGenomes-Tr; SEQ__t34-1.
DR   EnsemblGenomes-Tr; SEQ__t35-1.
DR   EnsemblGenomes-Tr; SEQ__t36-1.
DR   EnsemblGenomes-Tr; SEQ__t37-1.
DR   EnsemblGenomes-Tr; SEQ__t38-1.
DR   EnsemblGenomes-Tr; SEQ__t39-1.
DR   EnsemblGenomes-Tr; SEQ__t40-1.
DR   EnsemblGenomes-Tr; SEQ__t41-1.
DR   EnsemblGenomes-Tr; SEQ__t42-1.
DR   EnsemblGenomes-Tr; SEQ__t43-1.
DR   EnsemblGenomes-Tr; SEQ__t44-1.
DR   EnsemblGenomes-Tr; SEQ__t45-1.
DR   EnsemblGenomes-Tr; SEQ__t46-1.
DR   EnsemblGenomes-Tr; SEQ__t47-1.
DR   EnsemblGenomes-Tr; SEQ__t48-1.
DR   EnsemblGenomes-Tr; SEQ__t49-1.
DR   EnsemblGenomes-Tr; SEQ__t50-1.
DR   EnsemblGenomes-Tr; SEQ__t51-1.
DR   EnsemblGenomes-Tr; SEQ__t52-1.
DR   EnsemblGenomes-Tr; SEQ__t53-1.
DR   EnsemblGenomes-Tr; SEQ__t54-1.
DR   EnsemblGenomes-Tr; SEQ__t55-1.
DR   EnsemblGenomes-Tr; SEQ__t56-1.
DR   EnsemblGenomes-Tr; SEQ__t57-1.
DR   EnsemblGenomes-Tr; SEQ__t58-1.
DR   EnsemblGenomes-Tr; SEQ__t59-1.
DR   EnsemblGenomes-Tr; SEQ__t60-1.
DR   EnsemblGenomes-Tr; SEQ__t61-1.
DR   EnsemblGenomes-Tr; SEQ__t62-1.
DR   EnsemblGenomes-Tr; SEQ__t63-1.
DR   EnsemblGenomes-Tr; SEQ__t64-1.
DR   EnsemblGenomes-Tr; SEQ__t65-1.
DR   EnsemblGenomes-Tr; SEQ__t66-1.
DR   EuropePMC; PMC2654543; 19325880.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC2976332; 20713629.
DR   EuropePMC; PMC3034890; 21103900.
DR   EuropePMC; PMC3067147; 21263055.
DR   EuropePMC; PMC3091779; 21106082.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3640971; 23521820.
DR   EuropePMC; PMC3750634; 23742619.
DR   EuropePMC; PMC4120198; 25053786.
DR   EuropePMC; PMC4561494; 26160165.
DR   EuropePMC; PMC5727345; 29296591.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FM204883.
DR   SILVA-SSU; FM204883.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2253793
FT                   /organism="Streptococcus equi subsp. equi 4047"
FT                   /strain="4047"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom:New Forest"
FT                   /isolation_source="horse with strangles"
FT                   /collection_date="1990"
FT                   /db_xref="taxon:553482"
FT   CDS_pept        1..1353
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91873"
FT                   /db_xref="GOA:C0M7C0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7C0"
FT                   /protein_id="CAW91873.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLIKVDNHVATIF
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQIAVDYVYEDDLMIEQQHQGQQGYTEQAFQQL
FT                   PAVQSDLNPKYSFDNFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLNA
FT                   IGNSVLLENPNARIKYITAENFINEFVVHIRLDTMDELKEKFRNLDLLLIDDIQSLAKK
FT                   TLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDFE
FT                   TRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVDI
FT                   AAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQDIVLARQVAMFLAR
FT                   EMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMIGQDESLRIEIETIKNKIK"
FT   misc_feature    331..993
FT                   /locus_tag="SEQ_0001"
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
FT                   score 6.5e-116"
FT                   /inference="protein motif:PFAM:PF00308"
FT   misc_feature    451..474
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    1075..1284
FT                   /locus_tag="SEQ_0001"
FT                   /note="HMMPfam hit to PF08299, Bacterial dnaA protein
FT                   helix-turn-helix, score 7.6e-36"
FT                   /inference="protein motif:PFAM:PF08299"
FT   misc_feature    1225..1284
FT                   /locus_tag="SEQ_0001"
FT                   /note="PS01008 DnaA protein signature."
FT                   /inference="protein motif:Prosite:PS01008"
FT   CDS_pept        1510..2646
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91874"
FT                   /db_xref="GOA:C0M7C1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7C1"
FT                   /protein_id="CAW91874.1"
FT                   /translation="MIQFSINRALFIQALTATKRAISSKNAIPILSTIKIEVNPSDITL
FT                   TGSNGQISIENTIPVSNENAGLLITSTGAVLLEASFFINIISSLPDVSLEFKEIEQHQV
FT                   VLTSGKSEITLKGKDVSQYPRLQEVSTENPLILNTRLLKSIIAETAFAASMQESRPILT
FT                   GVHITLSQHKNFKAVATDSHRMSQRLITLEKTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSASQMLFRSDYISFYTRLLEGNYPDTDRLLMKQFETEAVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEIEANRISAHVNSPEVGKVNEDLDVVSQAGNDLTISFNPTYLIEALKA
FT                   IKSETVKIHFLSPVRPFTLTPGDDEESFIQLITPVRTN"
FT   misc_feature    1513..1890
FT                   /locus_tag="SEQ_0002"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 1.9e-25"
FT                   /inference="protein motif:PFAM:PF00712"
FT   misc_feature    1915..2262
FT                   /locus_tag="SEQ_0002"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 8e-32"
FT                   /inference="protein motif:PFAM:PF02767"
FT   misc_feature    2266..2637
FT                   /locus_tag="SEQ_0002"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 2.9e-30"
FT                   /inference="protein motif:PFAM:PF02768"
FT   CDS_pept        2724..2921
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91876"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7C2"
FT                   /protein_id="CAW91876.1"
FT                   /translation="MYQVGSLIEMKKPHACVIKETGKKANQWKITRVGADIKLQCTNCN
FT                   HVIMLSRHDFERKMKKVLQP"
FT   misc_feature    2724..2915
FT                   /locus_tag="SEQ_0003"
FT                   /note="HMMPfam hit to PF06107, Bacterial protein of unknown
FT                   function (DUF95, score 1.5e-44"
FT                   /inference="protein motif:PFAM:PF06107"
FT   CDS_pept        3045..3407
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0004"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91878"
FT                   /db_xref="GOA:C0M7C3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7C3"
FT                   /protein_id="CAW91878.1"
FT                   /translation="MTKFAEQLKKYRLEKQLSQDALAEKLFISRQAISKWENGDATPDL
FT                   ENLVTLAAVLEVTLDELVTGKEPAIKVIKKTEKPMNVWEFLTEESKRPMRKGDLLMLLL
FT                   VVIVLLGVYFIVIHFS"
FT   misc_feature    3066..3230
FT                   /locus_tag="SEQ_0004"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.8e-18"
FT                   /inference="protein motif:PFAM:PF01381"
FT   misc_feature    3093..3158
FT                   /locus_tag="SEQ_0004"
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2169.000, SD 6.57 at aa 17-38, sequence
FT                   LSQDALAEKLFISRQAISKWEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    3339..3395
FT                   /locus_tag="SEQ_0004"
FT                   /note="1 probable transmembrane helix predicted for SEQ0004
FT                   by TMHMM2.0 at aa 99-117"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        3491..4606
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0005"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91880"
FT                   /db_xref="GOA:C0M7C4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7C4"
FT                   /protein_id="CAW91880.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPLADIDTINLELILADLESINKRYARVEKMARTQKDKDS
FT                   VAEFAVLEKIKPVLEEGKSARTISFTDDEQKIVRQLFLLTTKPVLYVANVDEDKVAIPD
FT                   AIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDRSEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLIKYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   misc_feature    3497..3946
FT                   /locus_tag="SEQ_0005"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 7.1e-35"
FT                   /inference="protein motif:PFAM:PF01926"
FT   misc_feature    3515..3538
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    4349..4600
FT                   /locus_tag="SEQ_0005"
FT                   /note="HMMPfam hit to PF06071, Protein of unknown function
FT                   (DUF933), score 2.9e-61"
FT                   /inference="protein motif:PFAM:PF06071"
FT   CDS_pept        4765..5334
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0006"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91882"
FT                   /db_xref="GOA:C0M9G4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9G4"
FT                   /protein_id="CAW91882.1"
FT                   /translation="MVKMIVGLGNPGSKHQQTKHNVGFMAVDRLVKDLDVSFTEDKTFK
FT                   ALIGSTFINQEKIYFVKPTTFMNNSGLAVRALLTYYNISTKDLMVIYDDLDMAVGKIRL
FT                   RQKGSAGGHNGIKSIIAHIGTQEFDRVKIGIGRPSHGMSVINHVLGKFDTDDMITINIA
FT                   LDKVDKAINYYLQEKSIEKTMQQFNG"
FT   misc_feature    4774..5328
FT                   /locus_tag="SEQ_0006"
FT                   /note="HMMPfam hit to PF01195, Peptidyl-tRNA hydrolase,
FT                   score 4.3e-81"
FT                   /inference="protein motif:PFAM:PF01195"
FT   misc_feature    5089..5121
FT                   /note="PS01196 Peptidyl-tRNA hydrolase signature 2."
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS_pept        5337..8831
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0007"
FT                   /product="putative transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91884"
FT                   /db_xref="GOA:C0M9G5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9G5"
FT                   /protein_id="CAW91884.1"
FT                   /translation="MDILELFNQNKSIQTWQCDVTSLKRQLVMGLSGSSKAAAIASAYL
FT                   SFQGKLVVVTSTQNDMEKLAGDLSALLDEGSIFQFFADDTAAAEFIFSSMDKTISRIEA
FT                   LAFLSNPEARGILVISLAGLRILLPSPKTFQQGQIDLAVGVDTDLDNVVKKLVKIGYQR
FT                   VAQVLSPGEFSRRGDILDVYEVTQDLPVRIEFFGDEIDGIRSFDIESQKSLQKKDSTSI
FT                   KPASDMIFEPEDFDRASHNLEKQLQLAKAEHKGYLEELLTVTKEGLKHKDIRKFQSLFY
FT                   DNEWTILDYLPKGTPVFFDDFQKLVDRNAKFDLELAHLLTDDLQQGKSLPFLHYFADNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDKVYSLTQYAMQEFFNQFPLLIDEIKRYQKSGATV
FT                   LLQVESHQAYERLAKSLEAYQCQLPLVSADAIVLHQAQIIIGHLAGGFYFADEKLVLIT
FT                   EHEIYHKRLKRRARRTNMSNAERLKDYNELSKGDYVVHSVHGIGRFLGIETINIQGVHR
FT                   DYVTIQYQQSDRISLPVDQLESLSKYVSADGKEPKINKLNDGRFQKAKQRVKKQVEDIA
FT                   DDLLKLYAERSQQKGFQFSPDDELQRAFEEDFAFVETDDQVRSIKEVKKDMESVRPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAIGDHKQVAILVPTTVLAQQHYENFRERFENYPVEIAVL
FT                   SRFRSKKEQSESLERLKKGQVDIIIGTHRLLSKDVIFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLIREA
FT                   IIREMDRGGQVFYVYNKVDTVDKKVAELQELVPEASIGFVHGQMSDIQLENTLMDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYKPD
FT                   KVLTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFDMYSQL
FT                   LEQAIASKQGRALTRQKGNAEINLHIDAYLPSDYIKDERQKIDIYKRIREIDSRAAYSD
FT                   LQDEIMDRFGDYPDQVAYLLEIGLLKYYLDTAFAELVEKRDHQVMVRFEVASLQYYLTQ
FT                   DYFEALSKTSLKARISEHQGKIEIIFDVRRQKDHVILEELILFGETLGEIKSRKASS"
FT   misc_feature    6795..7088
FT                   /locus_tag="SEQ_0007"
FT                   /note="HMMPfam hit to PF02559, CarD-like/TRCF domain, score
FT                   1e-50"
FT                   /inference="protein motif:PFAM:PF02559"
FT   misc_feature    7161..7649
FT                   /locus_tag="SEQ_0007"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 4.4e-06"
FT                   /inference="protein motif:PFAM:PF04851"
FT   misc_feature    7173..7667
FT                   /locus_tag="SEQ_0007"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 1.1e-40"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    7251..7274
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    7857..8090
FT                   /locus_tag="SEQ_0007"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 8.4e-19"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    8370..8696
FT                   /locus_tag="SEQ_0007"
FT                   /note="HMMPfam hit to PF03461, TRCF domain, score 6.1e-35"
FT                   /inference="protein motif:PFAM:PF03461"
FT   CDS_pept        8800..10311
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0008"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91886"
FT                   /db_xref="GOA:C0M9G6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9G6"
FT                   /protein_id="CAW91886.1"
FT                   /translation="MRLNLEKLPHKTKQSSLLIVISGFMSKLLAASYRIPYQNLVGDRG
FT                   FYAYQQIYPLLGIISALGLTALPNVIASMAQKKKQLQLAALFKLQCYTSFLLSGILVLS
FT                   HKALASWMGAQQLAPSIVITAMVLLIVPFISFYRGLAQADMNMAPTALSQVLEQIIRVA
FT                   IIIVAALCYRVLGWTVYLTANVAAFGNLVASLVILAYLKRHSAYSLKSFLSGDTVAIRD
FT                   LTSLGLPTLVFLLFSIYLLVFQLIDSLLVKNILVSSGLSEITAEMTKGVYDRGQPLLQF
FT                   GLIFSTALFTAYLPNLTVLFHIKRESYREQSQCFFEFIFYFSLTLTVGFISILHLMNRA
FT                   LFEDNKGWLALVVYLMIIAVSSMIQFFHQKCFIEDHIKQSLLILLFGFLLKLGLTPILT
FT                   YYYAIVGSSLSTLIPLLVVLLLYAVLADIDFKAIVNAKYGLALVIMLMCVLTSQYCLPL
FT                   SGRLGALISLLVSSAVGLSSFLIACKKLGVFKEKLWSFLPFVKEK"
FT   sig_peptide     8800..8889
FT                   /locus_tag="SEQ_0008"
FT                   /note="Signal peptide predicted for SEQ0008 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.790) with cleavage site
FT                   probability 0.706 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    8833..9702
FT                   /locus_tag="SEQ_0008"
FT                   /note="HMMPfam hit to PF01943, Polysaccharide biosynthesis
FT                   protein, score 1e-05"
FT                   /inference="protein motif:PFAM:PF01943"
FT   misc_feature    join(8848..8910,8953..9021,9040..9108,9151..9219,
FT                   9274..9342,9352..9405,9466..9534,9640..9708,9742..9810,
FT                   9838..9906,9943..10011,10024..10077,10096..10164,
FT                   10177..10245)
FT                   /locus_tag="SEQ_0008"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SEQ0008 by TMHMM2.0 at aa 17-37, 52-74, 81-103, 118-140,
FT                   159-181, 185-202, 223-245, 281-303, 315-337, 347-369,
FT                   382-404, 409-426, 433-455 and 460-482"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    10216..10248
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        10342..10614
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0009"
FT                   /product="S4 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91888"
FT                   /db_xref="GOA:C0MAT0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT0"
FT                   /protein_id="CAW91888.1"
FT                   /translation="MRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKSSTDLKLND
FT                   QVEIRFGNKLLTVRVLDMKDSTKKEDAAKMYDIISETRISSDEEA"
FT   misc_feature    10342..10482
FT                   /locus_tag="SEQ_0009"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 2.3e-10"
FT                   /inference="protein motif:PFAM:PF01479"
FT   CDS_pept        10601..10972
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0010"
FT                   /product="putative septum formation initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91890"
FT                   /db_xref="GOA:C0MAT1"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT1"
FT                   /protein_id="CAW91890.1"
FT                   /translation="MKKPSIVQLNNHYINEENIKKRFEEEEIQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKGYVSLKKQGQQIITLEKEYRELEKKTKSEKQLAEQLKNDDFVKKYARAK
FT                   YYLSREGEVIYPTPGLLPK"
FT   misc_feature    10709..10762
FT                   /locus_tag="SEQ_0010"
FT                   /note="1 probable transmembrane helix predicted for SEQ0010
FT                   by TMHMM2.0 at aa 37-54"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    10724..10960
FT                   /locus_tag="SEQ_0010"
FT                   /note="HMMPfam hit to PF04977, Septum formation initiator,
FT                   score 2.2e-21"
FT                   /inference="protein motif:PFAM:PF04977"
FT   CDS_pept        10982..11101
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91891"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT2"
FT                   /protein_id="CAW91891.1"
FT                   /translation="MDNIVEKIETFLAFSDDKLAELEKENQELKKDHHRTEVK"
FT   CDS_pept        11114..12400
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0012"
FT                   /product="putative exported protein"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91893"
FT                   /db_xref="GOA:C0MAT3"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT3"
FT                   /protein_id="CAW91893.1"
FT                   /translation="MKKLLAAMLMTFFVTPLTVISTEKIPVFSEATRYHLSQDIVSSTL
FT                   YYSRIPTNPNVFEETVAYRDPELSVPKTMIAPDNRIVIKDVLLNKAAIPVFRLADDTYL
FT                   EASRQIVYEDIMFEQTAVDLDFWTQKKMTIYAEPYVLGVKTIASDSEPGRKVHASKMAQ
FT                   TEHGTYYFIDHKGWVNQKELSPTDNRMLKVQEMLLQKYNKENYSIFVKQLNTQASAGIN
FT                   ADKQMYAASISKLATLYSVQKKLKSGSLSEGKSLKYIDEVNHFYGDYDPTGSGKISKTA
FT                   DKKDYNVMELLKAVAQQSDNVATNILGYYLCNQYNQAFQSEIRALAGVDWDMEKRLLSS
FT                   HAAANLMEAIYYQKGQIISYLSQTAFDDQRISKNISVPVAHKIGDAYDYKHDVAIVYGD
FT                   NPFILSVFTDKASYDDITAIADDVYSILK"
FT   sig_peptide     11114..11200
FT                   /locus_tag="SEQ_0012"
FT                   /note="Signal peptide predicted for SEQ0012 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.801 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    11855..11878
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        12397..13680
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0013"
FT                   /product="PP-loop family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91895"
FT                   /db_xref="GOA:C0MAT4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAT4"
FT                   /protein_id="CAW91895.1"
FT                   /translation="MTYQHIYNIIKKKAYFDAHQAVLIAVSGGVDSMNLLHFLHAFQAK
FT                   LQIRIGIAHVNHKQRPESDDEEAYLRSWAKKHAIPIYVAYFQGAFSENAARHLRYQFFE
FT                   EIMQQEHYSALVTAHHADDQAETILMRLIRGSRLRHLAGIREVQPFANGQLIRPFLTVS
FT                   KAELPNPFHFEDHSNDSMAYFRNRVRHHYLPDFKRENPQATQSLIDLSAESRLLLQAFD
FT                   DLTKGLEFHRLNCFLAQSAAVQFFLLQHYLETFPQLAIKKSQFDDLLHIIRRQKQGIYP
FT                   IKNTYCLLIEKESFAIKKIIPKTDLNREFKMVSYGDSLNYRGYRFVFSGSLTDKGHDIA
FT                   IPLYSLSPVTLRHRQAGDRLFLGEFSKKLRRLFIDGKFTSEQRQNAIVGEQAGVIIFVL
FT                   VGDETYLRKASKHDIMLAKLYIDKLEKR"
FT   misc_feature    12457..13035
FT                   /locus_tag="SEQ_0013"
FT                   /note="HMMPfam hit to PF01171, PP-loop family, score 7e-85"
FT                   /inference="protein motif:PFAM:PF01171"
FT   misc_feature    12457..12525
FT                   /locus_tag="SEQ_0013"
FT                   /note="1 probable transmembrane helix predicted for SEQ0013
FT                   by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        13685..14227
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0014"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91897"
FT                   /db_xref="GOA:C0M916"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M916"
FT                   /protein_id="CAW91897.1"
FT                   /translation="MLEQDIQKILYSENDIIQRTKELGEQLTKDYHGKNPLMVGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYNGGTTSSGEVKILKDVDTNIEGRDVIFVEDIIDT
FT                   GRTLKYLRDMFKYRKANSVKIITLFDKPEGRVVDIEADYVCYNVPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   misc_feature    13697..14131
FT                   /locus_tag="SEQ_0014"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 2.2e-33"
FT                   /inference="protein motif:PFAM:PF00156"
FT   CDS_pept        14249..16219
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0015"
FT                   /product="putative cell division protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91898"
FT                   /db_xref="GOA:C0M9G7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9G7"
FT                   /protein_id="CAW91898.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIVIVVAGFQYYLRGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIVEVKGKYEKPQKVSIDTGLSFLGNSAATEVTEFTALIL
FT                   PSDSVLKEMTSVADKNGTDITVKQESSSGAWITFLMSFLPIVIFAAFMMMIMNQGGGAR
FT                   GAMSFGKNKARSQAKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKALGARIPAGV
FT                   LLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERAI
FT                   IFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNESIIVIAATNRSDVLDPA
FT                   LLRPGRFDRKVLVGRPDVKGREAILHVHAKNKPLAEDVNLKVVAQQTPGFVGADLENVL
FT                   NEAALVAARRNKTKIDASDIDEAEDRVIAGPSKKDRSISQREREMVAYHEAGHTIVGLV
FT                   LSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKDDLKEQLAGLMGGRVAEEIIFNAQ
FT                   TTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMMPGQLSPEKSYSAQTAQMID
FT                   DEVRDLLNEARNKAADIINDHRETHKLIAEALLKYETLDAAQIKSIYETGKMPNDPEND
FT                   EAEVHALSYDEIKDKMTEAKE"
FT   misc_feature    join(14285..14341,14648..14716)
FT                   /locus_tag="SEQ_0015"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0015 by TMHMM2.0 at aa 13-31 and 134-156"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    14363..14833
FT                   /locus_tag="SEQ_0015"
FT                   /note="HMMPfam hit to PF06480, FtsH Extracellular, score
FT                   1.1e-35"
FT                   /inference="protein motif:PFAM:PF06480"
FT   misc_feature    14909..15472
FT                   /locus_tag="SEQ_0015"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various c, score 1.4e-91"
FT                   /inference="protein motif:PFAM:PF00004"
FT   misc_feature    14924..14947
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    15221..15277
FT                   /note="PS00674 AAA-protein family signature."
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    15488..16114
FT                   /locus_tag="SEQ_0015"
FT                   /note="HMMPfam hit to PF01434, Peptidase family M41, score
FT                   2e-108"
FT                   /inference="protein motif:PFAM:PF01434"
FT   CDS_pept        16309..17772
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0016"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91900"
FT                   /db_xref="GOA:C0M9G8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9G8"
FT                   /protein_id="CAW91900.1"
FT                   /translation="MKFTIVRNYDKLSRTILRLESDKMTIFRKKRQAINKTEMNRHLKM
FT                   LDLIFLGLGSMVGTGIFTITGIGAANYAGPALTISIILSAIAISILALFYAEFASRIPA
FT                   NGGAYSYVYATLGEFPAWIVGWYIIMEFLTAISSVAVGWGSYLKGLLANYGLQLPNALN
FT                   GTFDPQKGTYVDLLPVLVMLLVTAIVLMNSKAALRFNSFLVLLKFSALALFVIVGLFFI
FT                   DVANWSHFAPYGFGQIYGGKSGIFAGASVMFFAFLGFESISMTVDEVKEPQKTIPRGIV
FT                   LSLTIVTILYVIVTMVLTGIVHYTKLDVPDAVAFALRSIGLYWAADYVSIVAILTLITV
FT                   CISMTYALARTVYSISRDGLLPRALCQITEKTRIPRNATLVVGALSMICAGIFPLASLA
FT                   EFVNICTLAYLVIMSFAIIKLRKNAGEPQRGEFKTPFVPLLPILAIIICVTFMSQYMVF
FT                   TWIAFGISTILGIVVYACYGYTHSQERRN"
FT   misc_feature    16447..17769
FT                   /locus_tag="SEQ_0016"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   1.3e-25"
FT                   /inference="protein motif:PFAM:PF00324"
FT   misc_feature    join(16450..16518,16528..16596,16630..16698,16819..16887,
FT                   16906..16974,17017..17085,17146..17214,17299..17367,
FT                   17428..17496,17509..17562,17599..17667,17677..17745)
FT                   /locus_tag="SEQ_0016"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SEQ0016 by TMHMM2.0 at aa 48-70, 74-96, 108-130, 171-193,
FT                   200-222, 237-259, 280-302, 331-353, 374-396, 401-418,
FT                   431-453 and 457-479"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    17014..17037
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    17704..17736
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   rRNA            18041..19589
FT                   /locus_tag="SEQ__r01"
FT                   /note="16S rRNA"
FT   tRNA            19809..19881
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="SEQ__t01"
FT                   /product="transfer RNA-Ala"
FT                   /note="tRNA Ala anticodon TGC, Cove score 84.64"
FT   rRNA            20189..23090
FT                   /locus_tag="SEQ__r02"
FT                   /note="23S rRNA"
FT   rRNA            23173..23282
FT                   /locus_tag="SEQ__r03"
FT                   /note="5S rRNA"
FT   tRNA            23303..23375
FT                   /gene="tRNA-Val"
FT                   /locus_tag="SEQ__t02"
FT                   /product="transfer RNA-Val"
FT                   /note="tRNA Val anticodon TAC, Cove score 84.84"
FT   tRNA            23389..23461
FT                   /gene="tRNA-Asp"
FT                   /locus_tag="SEQ__t03"
FT                   /product="transfer RNA-Asp"
FT                   /note="tRNA Asp anticodon GTC, Cove score 73.97"
FT   tRNA            23465..23537
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="SEQ__t04"
FT                   /product="transfer RNA-Lys"
FT                   /note="tRNA Lys anticodon TTT, Cove score 82.30"
FT   tRNA            23543..23624
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="SEQ__t05"
FT                   /product="transfer RNA-Leu"
FT                   /note="tRNA Leu anticodon TAG, Cove score 68.24"
FT   tRNA            23632..23704
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="SEQ__t06"
FT                   /product="transfer RNA-Thr"
FT                   /note="tRNA Thr anticodon TGT, Cove score 83.52"
FT   tRNA            23716..23787
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="SEQ__t07"
FT                   /product="transfer RNA-Gly"
FT                   /note="tRNA Gly anticodon GCC, Cove score 83.78"
FT   tRNA            23796..23880
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="SEQ__t08"
FT                   /product="transfer RNA-Leu"
FT                   /note="tRNA Leu anticodon TAA, Cove score 66.62"
FT   tRNA            23895..23968
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="SEQ__t09"
FT                   /product="transfer RNA-Arg"
FT                   /note="tRNA Arg anticodon ACG, Cove score 74.41"
FT   tRNA            23975..24048
FT                   /gene="tRNA-Pro"
FT                   /locus_tag="SEQ__t10"
FT                   /product="transfer RNA-Pro"
FT                   /note="tRNA Pro anticodon TGG, Cove score 80.16"
FT   tRNA            24059..24132
FT                   /gene="tRNA-Met"
FT                   /locus_tag="SEQ__t11"
FT                   /product="transfer RNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 76.98"
FT   tRNA            24153..24226
FT                   /gene="tRNA-Met"
FT                   /locus_tag="SEQ__t12"
FT                   /product="transfer RNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 89.74"
FT   tRNA            24234..24323
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="SEQ__t13"
FT                   /product="transfer RNA-Ser"
FT                   /note="tRNA Ser anticodon TGA, Cove score 61.73"
FT   tRNA            24335..24408
FT                   /gene="tRNA-Met"
FT                   /locus_tag="SEQ__t14"
FT                   /product="transfer RNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 75.45"
FT   tRNA            24433..24505
FT                   /gene="tRNA-Phe"
FT                   /locus_tag="SEQ__t15"
FT                   /product="transfer RNA-Phe"
FT                   /note="tRNA Phe anticodon GAA, Cove score 75.06"
FT   tRNA            24511..24581
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="SEQ__t16"
FT                   /product="transfer RNA-Gly"
FT                   /note="tRNA Gly anticodon TCC, Cove score 71.92"
FT   tRNA            24611..24684
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="SEQ__t17"
FT                   /product="transfer RNA-Ile"
FT                   /note="tRNA Ile anticodon GAT, Cove score 86.72"
FT   tRNA            24694..24781
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="SEQ__t18"
FT                   /product="transfer RNA-Ser"
FT                   /note="tRNA Ser anticodon GCT, Cove score 56.13"
FT   CDS_pept        24840..25655
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0017"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91902"
FT                   /db_xref="GOA:C0MAF5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAF5"
FT                   /protein_id="CAW91902.1"
FT                   /translation="MKKLNLSRLFFWLTSLALLALTLVLLFRVAISPYLSMIIRNPVTK
FT                   IDAIMSKPFAVIKEGAKELDSLMSAFSENKHLKKELRSYKLDQLQVDKLKSENRELKEL
FT                   LGLDYGTDNQFAARMISRNPYSWNKSLVIDSGKREIKEKSLVTSELGLIGRVTAVSQSS
FT                   AHVELLTSGKNIELPIKIVDKDKVIYGNLKAFKSESKTMVASEFNSNDSISLDAKVYTS
FT                   GLDGETVADIPVGKVTGFKNAADKLKRRIFIKLYADTDNLDYVLVVGKE"
FT   sig_peptide     24840..24929
FT                   /locus_tag="SEQ_0017"
FT                   /note="Signal peptide predicted for SEQ0017 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.309 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    24864..24932
FT                   /locus_tag="SEQ_0017"
FT                   /note="1 probable transmembrane helix predicted for SEQ0017
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    25188..25652
FT                   /locus_tag="SEQ_0017"
FT                   /note="HMMPfam hit to PF04085, rod shape-determining
FT                   protein MreC, score 2.2e-23"
FT                   /inference="protein motif:PFAM:PF04085"
FT   CDS_pept        25658..26161
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0018"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91904"
FT                   /db_xref="GOA:C0MAF6"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAF6"
FT                   /protein_id="CAW91904.1"
FT                   /translation="MKKSSELLVLLPFLLFFVDAHVSDLISSMLPEGYSVVSHLFLLFF
FT                   LILMVAFRSKGVICFFSLLLGLLFDYYYFDHIGILSLALPFGTMIVLGLLRFFSGSISQ
FT                   LQFFLFFTLYMFLVDVSSFILANSYQLTDMTFPYVMTFQLAPTLIVNLLILFCFRKLIL
FT                   SQFY"
FT   sig_peptide     25658..25717
FT                   /locus_tag="SEQ_0018"
FT                   /note="Signal peptide predicted for SEQ0018 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.874) with cleavage site
FT                   probability 0.501 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(25676..25744,25754..25813,25826..25879,25889..25957,
FT                   25976..26035,26063..26131)
FT                   /locus_tag="SEQ_0018"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0018 by TMHMM2.0 at aa 7-29, 33-52, 57-74, 78-100,
FT                   107-126 and 136-158"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        26257..27435
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0019"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91906"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAF7"
FT                   /protein_id="CAW91906.1"
FT                   /translation="MKKRILSAVLVSGVTLGTATTVGADDLDSKIALQNSVISNLNKEQ
FT                   KAAQDRMKTLQSQVSSLQSEQERLVAKNGELEARSAQFEQEIQVLASQIIARNEKLKGQ
FT                   ARSAQKGNTLGYLNALLNSKSISDVITRLVAINRAVSANAQMLEKQKADKLSLEEKQQE
FT                   NQEAINTIASNITAIESNQVALKTQQADLEVAKVDLALQLATAEDEKASLITRKEAAEQ
FT                   AAAQAKAQAEQEAAARAAQAQAQAQSVAAAQAAVTQAVPTPAPAQAQPVVAPAAMVSTP
FT                   AVSYAYDPSNPYPVGQCTWGVKALAPWVGNYWGNGGQWASSAAAAGFRVGATPMVGSVV
FT                   VWNDGGYGHVAYVTGVQGGQIQVMEANYAGNQSIGNYRGWFSPGAVSYIYPN"
FT   sig_peptide     26257..26328
FT                   /locus_tag="SEQ_0019"
FT                   /note="Signal peptide predicted for SEQ0019 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    27088..27426
FT                   /locus_tag="SEQ_0019"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 2.7e-38"
FT                   /inference="protein motif:PFAM:PF05257"
FT   CDS_pept        27528..28502
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0020"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91908"
FT                   /db_xref="GOA:C0MAF8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAF8"
FT                   /protein_id="CAW91908.1"
FT                   /translation="MEEKMSYSDLKLFALSSNKELAEKVAAAMGIQLGKSTVRQFSDGE
FT                   IQVNIEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQD
FT                   RKARSREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDR
FT                   HGLVGDDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGSVEGK
FT                   KCILIDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQKSAIEKLIVLD
FT                   TIYLPEERLIDKIEQISIADLIAEAIIRIHEKRPLSPLFELGK"
FT   misc_feature    27897..27926
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    27927..27974
FT                   /note="PS00114 Phosphoribosyl pyrophosphate synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    27960..28361
FT                   /locus_tag="SEQ_0020"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 7.8e-35"
FT                   /inference="protein motif:PFAM:PF00156"
FT   misc_feature    28197..28235
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        28862..29632
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0022"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91910"
FT                   /db_xref="GOA:C0MAF9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAF9"
FT                   /protein_id="CAW91910.1"
FT                   /translation="MRIQRSLGIVLYNKNYREDDKLVKIFTEAAGKRMFFVKHIGRSKL
FT                   APVVQPLTAADFLLKINDSSLSYIEDYNQVEAYRHINEDFFRLSYASYVLALADAAIPD
FT                   NEPDPQLFAFLKKTLDLMEEGLDYDILTNIFEVQILDRFGVRMNFHDCVFCHRTNLPFD
FT                   FSHKYSGVLCPQHYHEDERRYGLDPNVIYLLNRFQTLNIDELKTISVNTGMKKKLRLFI
FT                   DALYEDYVGIRLKSKVFIDDLAKWGDIMKNKQGL"
FT   misc_feature    28862..29599
FT                   /locus_tag="SEQ_0022"
FT                   /note="HMMPfam hit to PF02565, Recombination protein O,
FT                   score 2.4e-15"
FT                   /inference="protein motif:PFAM:PF02565"
FT   misc_feature    29315..29332
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        29748..30755
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0023"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91912"
FT                   /db_xref="GOA:C0MAG0"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAG0"
FT                   /protein_id="CAW91912.1"
FT                   /translation="MKKIAIDAMGGDYAPKAIVEGVNQAIESFSDIEIQLYGDQSRIES
FT                   YLVKSDRVSIVHTDEKINSDDEPAKAIRRKKNASMVLAARAVKDGRADAVLSAGNTGAL
FT                   LAAGLFIIGRIKGVDRPGLLSTLPTVDGSGFDMLDLGANAENTAEHLHQYAILGSFYAK
FT                   HVRGIAKPRIGLLNNGTEATKGDSLRKEVYNFLASDSSLQFIGNVEARDLMSGVADVVV
FT                   ADGFTGNAVLKSIEGTAMSIMGQLKSAIAVGGVKAKFGALLLKSSLYDLKDTLDYSSAG
FT                   GAVLFGLKAPLVKSHGSSDAKAIFHTIKQVRTMLETDVVGQLVEEFSKESDVND"
FT   misc_feature    29751..30713
FT                   /locus_tag="SEQ_0023"
FT                   /note="HMMPfam hit to PF02504, Fatty acid synthesis
FT                   protein, score 7.8e-129"
FT                   /inference="protein motif:PFAM:PF02504"
FT   CDS_pept        30748..30996
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0024"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91913"
FT                   /db_xref="GOA:C0MAG1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAG1"
FT                   /protein_id="CAW91913.1"
FT                   /translation="MTEEVILEKIIALIKKQRSRIDFDITEKTALKDDLGVDSIELVEF
FT                   VINIEDEFGIDIPDEDVDGMVSMGDMLNYLVKRLNQS"
FT   misc_feature    30769..30972
FT                   /locus_tag="SEQ_0024"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 1.6e-06"
FT                   /inference="protein motif:PFAM:PF00550"
FT   CDS_pept        31146..31856
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0025"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91915"
FT                   /db_xref="GOA:C0MAG2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAG2"
FT                   /protein_id="CAW91915.1"
FT                   /translation="MSNQLIYSGKAKDIYETADDGIVLISYKDQVTMLNGAHKEMIEGK
FT                   GSLNNQISALIFDRLNRVGVSTHFIKQLSETEQLNKRVAIIPLEVVLRNVAAGSFSKRF
FT                   GVKEGQALDEPIIELYYKNDALDDPFINDEHVSFLKLATDEQIAYIKQETHRINAYLKE
FT                   WFASVGLTLVDFKLEFGFDKEGMLILADEFSPDNCRLWDNAGRHMDKDVFRRQLGSLTQ
FT                   AYETVLERLRALDQ"
FT   misc_feature    31149..31850
FT                   /locus_tag="SEQ_0025"
FT                   /note="HMMPfam hit to PF01259, SAICAR synthetase, score
FT                   3.2e-106"
FT                   /inference="protein motif:PFAM:PF01259"
FT   misc_feature    31398..31442
FT                   /note="PS01057 SAICAR synthetase signature 1."
FT                   /inference="protein motif:Prosite:PS01057"
FT   misc_feature    31659..31685
FT                   /note="PS01058 SAICAR synthetase signature 2."
FT                   /inference="protein motif:Prosite:PS01058"
FT   CDS_pept        31969..35775
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0026"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase protein"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91917"
FT                   /db_xref="GOA:C0MB57"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB57"
FT                   /protein_id="CAW91917.1"
FT                   /translation="MEKRVRLVLILGWFLIGLGILTMNKRIFVEKKADFQIKAQVLLKE
FT                   LKHQLQLKTLVDLRIVQVYDVFHLDQELLLTAIKHVFSEQVTDQVLSEEALQADLKRYA
FT                   FFAIEALPGQFDQRAASSQEALLLLGASTDVTVLTSQLYLVNQDIAAEELEALKQYLLN
FT                   PVDSRFKDILAGLDDQDFSVADKVIPTLDVFNDYTAEDLARYRSEQGLAMEVEDLLFIQ
FT                   DYFKTKGRVPTETELRVLDTYWSDHCRHTTFETELKTLDFSASHFEKQLQATYETYLAM
FT                   RDELGRSERPQTLMDMATIFGRYERANGRLEDLEVSDEINAYSVEIEVDVDGVKEPWLL
FT                   MFKNETHNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRLSGAGDITSPLSETRKG
FT                   KLPQQVISRQAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVRE
FT                   KPRTGDVVVLLGGKTGRDGIGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRR
FT                   GDVTRLIKKSNDFGAGGVCVAIGELAAGLNINLDKIPLKYAGLNGTEIAISESQERMAV
FT                   VICPKDLEAFMSACHKENIHAAVVAAVTEKPNLVMTWNGQTIVDIERSFLETNGVRVSV
FT                   AAKVVDSGAPIPEARQTTAETLEADTIAVLSDLNHASQKGLQTLFDSSVGRSTVIHPLG
FT                   GRYQMTPVEGSVQKLPVQHGVTKTVSVIAQGYHPYIAEWSPYHGAAYAVIEATARLVAT
FT                   GSHWHKARFSYQEYFQRMDKQAERFGQPVAALLGAIEAQVQLGLPSIGGKDSMSGSFEE
FT                   LTVPPTLVAFGVTTAHVDHILSPEFKAAGENIYYIPGQAISEVIDFELIKSNFMTFEAI
FT                   QKKHNISSASAVKYGGVVEALALAAFGNRLGACVTLPELDRSLTAQLGGFIFTSKEEIT
FT                   GVIKLGQTTSDFTLVVNDVKLSGARLLKAFEGSLEQVYPTVFQQAGELKPVPVVTTALA
FT                   AQFKEKIAQPVVYIPVFPGTNSEYDSAKAFEREGARVNLVPFVTLNEAAIDASVDTMVD
FT                   HIHQAHIIFLAGGFSAADEPDGSAKFIVNILLNEKVRMAIDAFIEKGGLIIGICNGFQA
FT                   LVKSGLLPYGRFEAVHEASPTLFYNDANQHVAKMVETRIANTNSPWLAGVRVGDIHAVA
FT                   VSHGEGKLVVTERELAELCKNGQIFSQYVDLDGNPSMDSRYNPNGSVNAIEGLTSKNGQ
FT                   IIGKMGHSERFEEGLFQNIPGNKDQWLFRSAVHYFRGDHVGID"
FT   sig_peptide     31969..32055
FT                   /locus_tag="SEQ_0026"
FT                   /note="Signal peptide predicted for SEQ0026 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.890) with cleavage site
FT                   probability 0.835 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    31987..32055
FT                   /locus_tag="SEQ_0026"
FT                   /note="1 probable transmembrane helix predicted for SEQ0026
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    33349..33810
FT                   /locus_tag="SEQ_0026"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 1e-31"
FT                   /inference="protein motif:PFAM:PF02769"
FT   misc_feature    34237..34311
FT                   /note="PS01159 WW/rsp5/WWP domain signature."
FT                   /inference="protein motif:Prosite:PS01159"
FT   CDS_pept        35894..37351
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0027"
FT                   /product="putative amidophosphoribosyltransferase
FT                   precursor"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91919"
FT                   /db_xref="GOA:C0MB58"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB58"
FT                   /protein_id="CAW91919.1"
FT                   /translation="MTYDVKSLNEECGVFGIWRHPHAAQVTYFGLHSLQHRGQEGAGII
FT                   SNDNGELHQHRDVGLLSEVFKDSSDLDKLKGHAAIGHVRYATAGTASINNIQPFLYRFT
FT                   DAQFGLCHNGNLTNAMSLKKALESEGAIFNASSDTEILMHLIRRSHHPEFLGKVKEALN
FT                   TVKGGFAYLLMTENQLIAALDPNGFRPLSIGRMKNGAWVVSSETCAFEVVGAEWVRDVM
FT                   PGEVIIIDDQGITYDCYTTTTQLAICSMEYIYFARPDSTIAGVNVHTARKRMGKRLAQE
FT                   FQHEADIVVGVPNSSLSAAMGFAEASGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVNLLREAGATEVHVAIGSPELKYPCFYGID
FT                   IQTRRELISANHTAAEVCDIIGADSLTYLSLDGLIEAIGLDTKAPNGGLCVAYFDGQYP
FT                   TPLYDYEEAYLKSLEEKVSFHIDQVTK"
FT   misc_feature    35894..35941
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    35927..36514
FT                   /locus_tag="SEQ_0027"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 4.1e-36"
FT                   /inference="protein motif:PFAM:PF00310"
FT   misc_feature    36668..37096
FT                   /locus_tag="SEQ_0027"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 2.4e-10"
FT                   /inference="protein motif:PFAM:PF00156"
FT   misc_feature    36950..36988
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        37408..38430
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0028"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91921"
FT                   /db_xref="GOA:C0MB59"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB59"
FT                   /protein_id="CAW91921.1"
FT                   /translation="MSKNAYAQSGVDVEAGYELVERIKKHAERSKRLGVMGGLGGFGGL
FT                   FDLSKTGVKEPVLVSGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIIAAGAEPLYFL
FT                   DYLAAGKNEPAKLEQVIAGIAEGCVQAGAALIGGETAEMPGMYGQDDYDLAGFAVGIAE
FT                   KSQLIDGSRVAEGDHLLGLASSGVHSNGYSLVRRIFAGYTGEELLPELDGKKLKEVLLE
FT                   PTRIYVKAVLPLIKSGLVAGIAHITGGGFIENLPRMFSKELAAEIEEASLPVLPIFKVL
FT                   ETYGKINHEEMFEIFNMGIGMVLAVKPEHVEQVKACLDEPVYDIGRVVTRTVASVVMKP
FT                   "
FT   misc_feature    37411..37896
FT                   /locus_tag="SEQ_0028"
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, N-terminal dom, score 1.2e-70"
FT                   /inference="protein motif:PFAM:PF00586"
FT   misc_feature    37927..38424
FT                   /locus_tag="SEQ_0028"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 1.1e-43"
FT                   /inference="protein motif:PFAM:PF02769"
FT   CDS_pept        38427..38984
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0029"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91923"
FT                   /db_xref="GOA:C0MB60"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB60"
FT                   /protein_id="CAW91923.1"
FT                   /translation="MTRIAVFASGNGSNFQTIAEQFPVAFVFSDHCDAHVLSRACALGV
FT                   LSYSFELKDFENKQAYEQTLVALLQRHQIDLIVLAGYMKIVSTTLLDAYEGKIINIHPA
FT                   YLPEFPGAHGILDAWQAGVSQSGVTVHWVDSGIDTGKIIKQVRVPRLSDDTLESFEARI
FT                   HEAEYQLYPEVLDSLGVERLNR"
FT   misc_feature    38430..38951
FT                   /locus_tag="SEQ_0029"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   1.6e-55"
FT                   /inference="protein motif:PFAM:PF00551"
FT   CDS_pept        39131..40678
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0030"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase]"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91925"
FT                   /db_xref="GOA:C0MB61"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MB61"
FT                   /protein_id="CAW91925.1"
FT                   /translation="MTKRALISVSDKRGIVDLARELKHLGWDIISTGGTRLALEEAGVV
FT                   TVAIDDVTGFPEMMDGRVKTLHPLIHGGLLARRDIEHHLQAAKQNRIELIDLVVVNLYP
FT                   FKETICRPDVTYDVAVDMVDIGGPSLLRSAAKNHASVTVVVDPTDYPLVLGELASTGST
FT                   SYQTRQSLAAKAFRHTAAYDAVIADYFTRQAGETKPEKLTLTYDLKQSMRYGENPQQAA
FT                   DFYQRALPTTYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKERPTVVALKHMNPCGI
FT                   GQADDIETAWDFAYAADPVSIFGGIVVLNREVDLATAEKLHAIFLELIIAPGYSKEALA
FT                   VLTHKKKHLRILELPFAAQEASEIEAEYTGVLGGLLVQNQDVVTESPADWIVVTKRQPN
FT                   EQEMAALAFAWKTIKYVKSNAIVIANDHMTLGVGPGQTNRIASIRIAIAQATGQLEGAV
FT                   LASDAFFPFADSIEEIAAAGIKAIIQPGGSIRDSESIAAANQHGITMIFTGVRHFRH"
FT   misc_feature    39170..39517
FT                   /locus_tag="SEQ_0030"
FT                   /note="HMMPfam hit to PF02142, MGS-like domain, score
FT                   9.1e-52"
FT                   /inference="protein motif:PFAM:PF02142"
FT   misc_feature    39530..40480
FT                   /locus_tag="SEQ_0030"
FT                   /note="HMMPfam hit to PF01808, AICARFT/IMPCHase bienzyme,
FT                   score 2.2e-143"
FT                   /inference="protein motif:PFAM:PF01808"
FT   CDS_pept        complement(41056..42210)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0031"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91927"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB62"
FT                   /protein_id="CAW91927.1"
FT                   /translation="MKKVYQLLASGAILLGGNGAISSATTTISQGQSGIVHAAVLGDNY
FT                   PSKWKQGFGADPWNMYLRQCTSFVAFRLHSSNGFSLPRGYGNVESWGRIAKHQGYHVDH
FT                   TPRVGAVAWWDKGFNQSHALYGHVAWVAEVNGDTVIIEEYNYNAGQGPEKYHKRQIHKH
FT                   QVSGYIHFKDLDHNSTSHTQMLHASQAGSTRLAKSGTYYFSSQSPIKAEATLASPDLAY
FT                   YHTGQLVHYDQTLVADGYEWLSYIGHSGNHRYIPIHKLPVQPQQHSQASIDKPKPVATT
FT                   PIKVGDTVAFPGVFRVDQVAQNMIASSELAGGEPTSLNWIDSAPLHETDHKGRIAGNQI
FT                   LQVGDYFVVSGTYKVLKVDQPSKGIYVQMGSRGTWLTIDKAKKV"
FT   misc_feature    complement(41440..41634)
FT                   /locus_tag="SEQ_0031"
FT                   /note="HMMPfam hit to PF08460, Bacterial SH3 domain, score
FT                   8.9e-21"
FT                   /inference="protein motif:PFAM:PF08460"
FT   misc_feature    complement(41701..42075)
FT                   /locus_tag="SEQ_0031"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 7.9e-29"
FT                   /inference="protein motif:PFAM:PF05257"
FT   sig_peptide     complement(42097..42210)
FT                   /locus_tag="SEQ_0031"
FT                   /note="Signal peptide predicted for SEQ0031 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.627 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        42601..43863
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0032"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91928"
FT                   /db_xref="GOA:C0MB63"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB63"
FT                   /protein_id="CAW91928.1"
FT                   /translation="MKLLVIGSGGREHAIAKKLLESKGVEQVFVAPGNDGMTLDGIERV
FT                   DIDISEHSALIAFAKTNHIAWTFVGPDDALAAGIVDEFNQSGLKAFGPSRLAAELEWSK
FT                   DFAKQIMVKYGIPTAAYGTFSDFAKAKAYIEEKGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAARDMLLDNKFGDSGARVVIEEFLAGEEFSLFAFVNGDQFYLMPTAQDHKRALDGDK
FT                   GPNTGGMGAYAPVPHLSQSVVDTAVETIVKPVLKGMMTEGRPYLGILYCGLILTEDGPK
FT                   VIEFNARFGDPETQVILPRLTSDFAQNITDILEGNTANITWSDEGVTLGVVLASNGYPL
FT                   AYKKGVLLPAKTTGDIITYYAGVKLAENGKALLSNGGRVYMLVTTAVTVPAAQEKIYTE
FT                   LAQQNTEGLFYRNDIGRKAVK"
FT   misc_feature    42601..42903
FT                   /locus_tag="SEQ_0032"
FT                   /note="HMMPfam hit to PF02844, Phosphoribosylglycinamide
FT                   synthetase, N d, score 1.4e-41"
FT                   /inference="protein motif:PFAM:PF02844"
FT   misc_feature    42907..43482
FT                   /locus_tag="SEQ_0032"
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase, ATP, score 1.7e-119"
FT                   /inference="protein motif:PFAM:PF01071"
FT   misc_feature    42919..43365
FT                   /locus_tag="SEQ_0032"
FT                   /note="HMMPfam hit to PF08442, ATP-grasp domain, score
FT                   0.0042"
FT                   /inference="protein motif:PFAM:PF08442"
FT   misc_feature    42955..43476
FT                   /locus_tag="SEQ_0032"
FT                   /note="HMMPfam hit to PF02655, ATP-grasp domain, score
FT                   0.0011"
FT                   /inference="protein motif:PFAM:PF02655"
FT   misc_feature    43462..43485
FT                   /note="PS00184 Phosphoribosylglycinamide synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    43579..43857
FT                   /locus_tag="SEQ_0032"
FT                   /note="HMMPfam hit to PF02843, Phosphoribosylglycinamide
FT                   synthetase, C d, score 1.9e-13"
FT                   /inference="protein motif:PFAM:PF02843"
FT   CDS_pept        44093..44581
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0033"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91929"
FT                   /db_xref="GOA:C0MB64"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB64"
FT                   /protein_id="CAW91929.1"
FT                   /translation="MKPIISIIMGSKSDWTTMQKTAEILDQFGLAYEKKVVSAHRTPDL
FT                   MFTYAEKARERGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGLDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDETIAEQLSHFHKEQGRIAEESTHELN"
FT   misc_feature    44099..44575
FT                   /locus_tag="SEQ_0033"
FT                   /note="HMMPfam hit to PF00731, AIR carboxylase, score
FT                   7.4e-90"
FT                   /inference="protein motif:PFAM:PF00731"
FT   CDS_pept        44568..45641
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0034"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   ATPase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91931"
FT                   /db_xref="GOA:C0MBH7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBH7"
FT                   /protein_id="CAW91931.1"
FT                   /translation="MNSTKTIGIIGGGQLGQMMAISAIYMGHKVITLDPAADCPASRVS
FT                   EVIVAPYSDVEALRQLTERCDILTYEFENVDADALDTVVKEEQLPQGTELLRISQNRIF
FT                   EKDFLANKASAAVAPYKVVTSSLDLENLDFSKKYVLKTATGGYDGHGQVVIRSEADLEE
FT                   ANKLANTAECVLEEFVSFDREISVIVSGNGTDVTVFPVQENIHRNNILSKTIVPARISE
FT                   AVSAKSQAMAVKIAEQLNLSGTLCVEMFVAGDEILVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGQPLPAVKLHAPAIMLNVLGQHMEQAQRYATENPSAHLHLYGKIEAKHNRK
FT                   MGHVTVFNSQSDEVEEF"
FT   misc_feature    44868..45395
FT                   /locus_tag="SEQ_0034"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   7e-64"
FT                   /inference="protein motif:PFAM:PF02222"
FT   misc_feature    44874..45371
FT                   /locus_tag="SEQ_0034"
FT                   /note="HMMPfam hit to PF02655, ATP-grasp domain, score
FT                   0.00061"
FT                   /inference="protein motif:PFAM:PF02655"
FT   CDS_pept        45656..45880
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91932"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBH8"
FT                   /protein_id="CAW91932.1"
FT                   /translation="MIKIIVHAFIENGETGVVEVVFASENQESISEKMTELQKQYPNDY
FT                   LAIYDLPLDTDLSQLAHYPSIAIGKGEFE"
FT   CDS_pept        45904..46014
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0036"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus agalactiae hypothetical protein
FT                   UniProt:Q3D9U7 (EMBL:AAJR01000013 (317 aa) fasta scores:
FT                   E()=0.0018, 66.667% id in 30 aa. Downstream CDS, SEQ0036a
FT                   is similar to an internal region of the same
FT                   protein.;conserved hypothetical protein (fragment)"
FT                   /db_xref="PSEUDO:CAW91934.1"
FT   CDS_pept        46054..46170
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0036a"
FT                   /note="Probable gene remnant. Upstream CDS, SEQ0036 is
FT                   similar to the N-terminus of the same protein. Similar to
FT                   an internal region of Streptococcus agalactiae COH1
FT                   hypothetical protein UniProt:Q3D9U7 (EMBL:AAJR01000013 (317
FT                   aa) fasta scores: E()=6.7, 35.484% id in 31 aa;conserved
FT                   hypothetical protein (fragment)"
FT   CDS_pept        46417..47769
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0037"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91937"
FT                   /db_xref="GOA:C0M6X0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6X0"
FT                   /protein_id="CAW91937.1"
FT                   /translation="MSVFSFLKFSCFLAVLGILIMLNRYSRPEMAKIWSEENKYRAWLE
FT                   VEILADEAWAELGEIPKEDVAKIRANASFDINRILEIEEETRHDVVAFTRAVSETLGEE
FT                   RKWVHYGLTSTDVVDTAYGYLYKQANDIIRRDLENFTNIVAEKAKEHKMTIMMGRTHGV
FT                   HAEPTTFGLKLATWYSEMKRNQERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCGKL
FT                   GIRPQEISTQVLPRDLHAEYFAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKG
FT                   SSAMPHKRNPIGSENMTGLARVIRGHMVTAYENVALWHERDISHSSAERIITPDTTILI
FT                   NYMLNRFGNIVKNLTVFPENMTRNMNSTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKT
FT                   AYSWDNQVDFKPILEADENITAKLRQDELDELFNPAYYTKRVDAIFDRLGL"
FT   sig_peptide     46417..46521
FT                   /locus_tag="SEQ_0037"
FT                   /note="Signal peptide predicted for SEQ0037 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.884) with cleavage site
FT                   probability 0.575 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    46483..47334
FT                   /locus_tag="SEQ_0037"
FT                   /note="HMMPfam hit to PF00206, Lyase, score 8.8e-92"
FT                   /inference="protein motif:PFAM:PF00206"
FT   misc_feature    47257..47286
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS_pept        join(48067..48297,48297..48980)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0038"
FT                   /note="CDS contains a frameshift after codon 77. Similar to
FT                   Streptococcus pyogenes serotype M3 transcriptional
FT                   regulator UniProt:Q1JP26 (EMBL:CP000259 (303 aa) fasta
FT                   scores: E()=1.4e-83, 74.257% id in 303 aa;putative
FT                   DNA-binding protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW91939.1"
FT   misc_feature    48091..48258
FT                   /locus_tag="SEQ_0038"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   6.2e-07"
FT                   /inference="protein motif:PFAM:PF01381"
FT   CDS_pept        49195..50202
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0040"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91941"
FT                   /db_xref="GOA:C0M7R2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7R2"
FT                   /protein_id="CAW91941.1"
FT                   /translation="MTRILDNDLIGDEGSVERTLRPQYLREYIGQDRVKDQLMIFIEAA
FT                   KRREESLDHVLLFGSPGLGKTTMAFVIANELGVHLKQTSGPAIEKAGDLVAILNDLEPG
FT                   DVLFIDEIHRMPMAVEEILYSAMEDFYIDIMIGAGDTSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYQTADLTEIVERTADIFDMTIKHEAAYELARRSRGTPRIANR
FT                   LLKRVRDYAQIMGDGMITTQITDKALTMLDVDQEGLDYVDQKILRTMIEVYQGGPVGLG
FT                   TLSVNIAEERDTVEDMYEPYLIQKGFIMRTRTGRVVTEKAYQHLGYPYEKTIKT"
FT   misc_feature    49198..49353
FT                   /locus_tag="SEQ_0040"
FT                   /note="HMMPfam hit to PF05496, Holliday junction DNA
FT                   helicase ruvB N-termin, score 2.4e-26"
FT                   /inference="protein motif:PFAM:PF05496"
FT   misc_feature    49354..49893
FT                   /locus_tag="SEQ_0040"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 1.3e-26"
FT                   /inference="protein motif:PFAM:PF00004"
FT   misc_feature    49354..49734
FT                   /locus_tag="SEQ_0040"
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 0.0002"
FT                   /inference="protein motif:PFAM:PF07728"
FT   misc_feature    49369..49392
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    49942..50178
FT                   /locus_tag="SEQ_0040"
FT                   /note="HMMPfam hit to PF05491, Holliday junction DNA
FT                   helicase ruvB C-termin, score 1.5e-52"
FT                   /inference="protein motif:PFAM:PF05491"
FT   CDS_pept        50443..50901
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0041"
FT                   /product="putative phosphotyrosine protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91943"
FT                   /db_xref="GOA:C0M833"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C0M833"
FT                   /protein_id="CAW91943.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSMASPDELQVESRATSGWEHGN
FT                   PIHHGTQSLLQQYQISYDTKKTSQQITSFDFEAFDYIIGMDSHNIRDLKQMSKHQWDSK
FT                   IHLFIEGGVPDPWYTGDFEETYRLVKAGCQHWLSQISAEHESHVEIDE"
FT   misc_feature    50446..50859
FT                   /locus_tag="SEQ_0041"
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein, score 3.7e-33"
FT                   /inference="protein motif:PFAM:PF01451"
FT   CDS_pept        50907..51308
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0042"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91945"
FT                   /db_xref="GOA:C0M8D4"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8D4"
FT                   /protein_id="CAW91945.1"
FT                   /translation="MKAIINNIQKWQITRTKLEIISVLVIIVCGLSVFTLTISSKASLT
FT                   YDNGQIKYTGYVLNHRMNGKGKLVYPNGDTYVGDFNKGVFDGEGTFTASTGWSYSGQFK
FT                   KGQADGKGTLKAKDSKVYKGTFKQGIFQK"
FT   sig_peptide     50907..51032
FT                   /locus_tag="SEQ_0042"
FT                   /note="Signal peptide predicted for SEQ0042 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.446 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    50964..51023
FT                   /locus_tag="SEQ_0042"
FT                   /note="1 probable transmembrane helix predicted for SEQ0042
FT                   by TMHMM2.0 at aa 20-39"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    51063..51131
FT                   /locus_tag="SEQ_0042"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 3.5e-05"
FT                   /inference="protein motif:PFAM:PF02493"
FT   misc_feature    51132..51200
FT                   /locus_tag="SEQ_0042"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 0.001"
FT                   /inference="protein motif:PFAM:PF02493"
FT   misc_feature    51201..51269
FT                   /locus_tag="SEQ_0042"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 0.00052"
FT                   /inference="protein motif:PFAM:PF02493"
FT   CDS_pept        51305..53086
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0043"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91947"
FT                   /db_xref="GOA:C0M917"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0M917"
FT                   /protein_id="CAW91947.1"
FT                   /translation="MRIKWFSFIRVTGLLLVLLYHFFKHTFSGGFVGVDIFFTFSGYLI
FT                   TALLIDEYVSKQTIDVVAFFRRRFYRIVPPLVLLILLTIPFTFLVKSDFIAGIGQQIAA
FT                   ALGFTTNSYELLTGSSYESQFIPHLFVHTWSLAIEVHFYLLWGLLVWLLAKKGYSQKKF
FT                   RGILFLISSAVFTLSYFSMFIRAFFVSDFSSVYFSTLSHSFPFFLGAMFATMTGIKDTT
FT                   VRFQKNVKLWPRLHVIGVMAGAFALLLFLTLVLDFNHIFTYLFGFVLASLFASVMIYAA
FT                   RVLSDQTPTWQEPLLVTYLADISYGIYLFHWPFYIIFTQLMSNWLAVILTVFFSVVFST
FT                   LSYYIIEPLIQGKTPQLFGLAIDCNPYKKWLSGLALGLFLLMVGTCLTAPRVGNFETQL
FT                   LVDSLQQSQSNLNKTHTLAAGDAHALSDVSIIGDSVALRSSDAFSKLMPTAQLDAAVSR
FT                   NFSEAFELFENHIQSKSLSKTTVLAVGVNSLYNYAQDIQGFIYALPKGHRLVIVSPYDA
FT                   KNAAQVAEAREHLLQLAKKYSYVTVADWYKAAVENPNIWYGSDGVHYNNDAKLKGADLY
FT                   VSTIQAAVERAAKKDAK"
FT   misc_feature    51311..52363
FT                   /locus_tag="SEQ_0043"
FT                   /note="HMMPfam hit to PF01757, Acyltransferase family,
FT                   score 7.1e-31"
FT                   /inference="protein motif:PFAM:PF01757"
FT   misc_feature    join(51317..51373,51383..51451,51509..51574,51695..51763,
FT                   51800..51868,51878..51946,52007..52075,52085..52153,
FT                   52187..52255,52283..52351,52412..52480)
FT                   /locus_tag="SEQ_0043"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SEQ0043 by TMHMM2.0 at aa 5-23, 27-49, 69-90, 131-153,
FT                   166-188, 192-214, 235-257, 261-283, 295-317, 327-349 and
FT                   370-392"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        53506..56148
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0044"
FT                   /product="aldehyde-alcohol dehydrogenase 2 [includes:
FT                   alcohol dehydrogenase; acetaldehyde dehydrogenase]"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91949"
FT                   /db_xref="GOA:C0M9G9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9G9"
FT                   /protein_id="CAW91949.1"
FT                   /translation="MTEKNSTVETTSVAATIDALVQKGLVALDKMRQLTQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPEDCVQWIETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVSEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPAAWIAEQAGFTVPEGTNILAAEC
FT                   KEVSENEPLTREKLSPVIAVLKAESRTDGVEKARQMVEFNGLGHSAAIHTADADLAKEF
FT                   GTKIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFADVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FENLEKSVKEADFESREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLPASTPEEGVESYAKAVYDL
FT                   GCRLGIKMNFRDQGIDEEEWKAHTRELAYLAYEDQCSPANPRLPMVEHMEEIMNDAYYG
FT                   YAERPGRRK"
FT   misc_feature    53515..54801
FT                   /locus_tag="SEQ_0044"
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 3.4e-07"
FT                   /inference="protein motif:PFAM:PF00171"
FT   misc_feature    54775..54807
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    54913..56088
FT                   /locus_tag="SEQ_0044"
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 1.3e-142"
FT                   /inference="protein motif:PFAM:PF00465"
FT   misc_feature    55435..55521
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00913"
FT   misc_feature    55693..55755
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00060"
FT   CDS_pept        56643..57695
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0045"
FT                   /product="putative zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91951"
FT                   /db_xref="GOA:C0M9H0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9H0"
FT                   /protein_id="CAW91951.1"
FT                   /translation="MKAATYVAPGQLELIDQPKPEILAPTDAVVRLLKTTICGTDLHIL
FT                   GGDVPETTHGTILGHEGIGIVESVGSAVNNFKVGDKVIISCITACNTCYYCKKGIPAHC
FT                   ESGGWILGHLINGTQAEYVHIPQADGSLYHAPKTVEDDALVMLSDIFPTSYEIGVQSAK
FT                   VKPGDTVCIVGAGPIGLAALLTAQFYSPAKLIMVDLSESRLEAAKRFGATDTICSGDLD
FT                   DIVKKVHELTDGRGVDVAIECVGYPATFDICQKIIAIGGHVSNVGVHGKPVSLDLQDLW
FT                   IKNITMSTGLVNANTTEMLLNVLKSGKIDATKMVTHHFKLSEVEKAYEVFKNAGSNNAL
FT                   KVIIENDITA"
FT   misc_feature    56715..57047
FT                   /locus_tag="SEQ_0045"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 2.4e-37"
FT                   /inference="protein motif:PFAM:PF08240"
FT   misc_feature    56817..56861
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    57138..57560
FT                   /locus_tag="SEQ_0045"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 8.7e-36"
FT                   /inference="protein motif:PFAM:PF00107"
FT   CDS_pept        57898..58914
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0046"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91953"
FT                   /db_xref="GOA:C0M9Z0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z0"
FT                   /protein_id="CAW91953.1"
FT                   /translation="MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAG
FT                   YIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTL"
FT   misc_feature    57970..58293
FT                   /locus_tag="SEQ_0046"
FT                   /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
FT                   GroES-like domain, score 9.5e-49"
FT                   /inference="protein motif:PFAM:PF08240"
FT   misc_feature    58000..58017
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    58069..58113
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   misc_feature    58381..58800
FT                   /locus_tag="SEQ_0046"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
FT                   score 1.2e-39"
FT                   /inference="protein motif:PFAM:PF00107"
FT   repeat_region   58987..59006
FT                   /note="20mer direct repeat flanking genomic island"
FT   misc_feature    59007..64976
FT                   /note="putative genomic island"
FT   CDS_pept        59630..61222
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0047"
FT                   /product="putative ABC transporter, ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91954"
FT                   /db_xref="GOA:C0MAG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAG3"
FT                   /protein_id="CAW91954.1"
FT                   /translation="MKEIVRSHRLLYVIVAFFSVISAFLMTLFSIQLGKILDSISNSSS
FT                   ELLFQIVVCVCTIMAWFIMIWSYSYFKSYYVKKVILDLKERLFIGYLLREFNEIDTCDR
FT                   YNSDFLNNVTKNIDIIQENLLVPRVAVIVDLASMVTSVVAIVLIEWRLALVFLLLSIVT
FT                   VFLSQIPGKLMSKATRYYSEKSNHYLAEMTSFIEGFEQIKLLNIQKWIQKIEQNTTLEF
FT                   EDSRQKYQYRKDLASNTGMFLSFFSQVACMVAGIFFVRNNLLTVGLLVASIQLLNGVFG
FT                   PLQSFLYNKNLIKSTGTILTSIQEVLDKTNFVNGYIENKTFYEGDISSISINNLTYQVE
FT                   NRKIFTNFSFEFKKGNTYAIIGPSGVGKTTLAKLILNYYPKHLYDGEIRIDGRNIAEIN
FT                   SESLYKKIAFVQKNDFLVEGNVSDNIKLDGSLNLTDKLKDSLGFDETFLNKKLFRVQSL
FT                   ISEGEKQRIDLARFLNRRYSIYIFDEPTGNLDPARSKAILDYILSIKNAIIIVITHNQD
FT                   IKTLEQFDEVICL"
FT   sig_peptide     59630..59719
FT                   /locus_tag="SEQ_0047"
FT                   /note="Signal peptide predicted for SEQ0047 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.950) with cleavage site
FT                   probability 0.368 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    59663..60478
FT                   /locus_tag="SEQ_0047"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 1.1e-05"
FT                   /inference="protein motif:PFAM:PF00664"
FT   misc_feature    join(59663..59731,59774..59842,59999..60067,60077..60136,
FT                   60332..60400)
FT                   /locus_tag="SEQ_0047"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0047 by TMHMM2.0 at aa 12-34, 49-71, 124-146, 150-169
FT                   and 235-257"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    60692..61201
FT                   /locus_tag="SEQ_0047"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.6e-27"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    60713..60736
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        join(61385..62026,62028..62507)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0048"
FT                   /note="CDS contains a frameshift after codon 214. Similar
FT                   to Enterococcus faecalis (Streptococcus faecalis)
FT                   HesA/MoeB/ThiF family protein UniProt:Q835P7 (EMBL:AE016830
FT                   (377 aa) fasta scores: E()=8.8e-21, 28.609% id in 381
FT                   aa;ThiF family protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW91956.1"
FT   misc_feature    61751..62020
FT                   /locus_tag="SEQ_0048"
FT                   /note="HMMPfam hit to PF00899, ThiF family, score 1.3e-08"
FT                   /inference="protein motif:PFAM:PF00899"
FT   CDS_pept        62500..63675
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0050"
FT                   /product="Insulinase family metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91958"
FT                   /db_xref="GOA:C0MAT6"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT6"
FT                   /protein_id="CAW91958.1"
FT                   /translation="MNKKIIFKGDQDSKFAYFSLMFSAGTAIENTEELGFSHLIEHLLL
FT                   RSGGEQSLNELFDNNGAFIGGETSRDYINLMGYCKAENFKNIFEAIVSRVFNLNLTEEE
FT                   LLREKRVVLVELTQYENGSKTEKLVSDNRLIFKNSKWSEDIIGVRENIESVDLKKLYKF
FT                   YTENIQNGEFQIAISGPNHLKEEIAIIENKLPVGRTPVKSNFPIFSSGVTERKKNQQVS
FT                   EISMYIDISKMTTSSHDVAILTILNAMLTGVKGSVLGGKLRTKNQWVYNIISFPIFYNG
FT                   LTILKILTRTPEIHKHQVVQVLKEDLVNREDLKNTKLFDKAKKRVINEVLMSYEVKKVE
FT                   FLKTLCREKLFNIPSWESVTGEIEKVSLNELNQFAKDALMQNKQFHIIINC"
FT   misc_feature    62509..62946
FT                   /locus_tag="SEQ_0050"
FT                   /note="HMMPfam hit to PF00675, Insulinase (Peptidase family
FT                   M16), score 0.00016"
FT                   /inference="protein motif:PFAM:PF00675"
FT   misc_feature    62572..62643
FT                   /note="PS00143 Insulinase family, zinc-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00143"
FT   misc_feature    62959..63477
FT                   /locus_tag="SEQ_0050"
FT                   /note="HMMPfam hit to PF05193, Peptidase M16 inactive
FT                   domain, score 0.00018"
FT                   /inference="protein motif:PFAM:PF05193"
FT   CDS_pept        complement(63659..64522)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0051"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91960"
FT                   /db_xref="GOA:C0MB65"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB65"
FT                   /protein_id="CAW91960.1"
FT                   /translation="MILGETYRKMREEKGISISSLAGYEISKSQISRFELGETEISIFK
FT                   LLYLLEKLGITFEEFLLACNNYEPSEFNTLIKAVQNSAYNNKVETLISMIEQENKLFEE
FT                   TNSHYHKLNSIFIQSIISGLDNNHQLTNQDISYLSNYLFSLENWGYYETLILGNCCRSL
FT                   PPKLLFKYTKEALKKGKLYNSIPRNKQSLIQLLLNSLLLMIENDFYEEAIFLNQASKNL
FT                   LSNSTYFFELTILLYLEGYLELKFNIHTEKSNSKIEEALKIFNSLNKTIYQNYQEHFNK
FT                   YISNLL"
FT   misc_feature    complement(64343..64504)
FT                   /locus_tag="SEQ_0051"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2.2e-05"
FT                   /inference="protein motif:PFAM:PF01381"
FT   repeat_region   64957..64976
FT                   /note="20mer direct repeat"
FT   CDS_pept        65158..66642
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0052"
FT                   /product="putative threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91961"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBH9"
FT                   /protein_id="CAW91961.1"
FT                   /translation="MPMMYQSTRNAANKVTASQAILSGLADDGGLFTPTSMPVLDLDFE
FT                   ELKTKSYQEVAKLILSAFFDDYTEAELDACISSAYDDKFDTAVIAPLATLKDYHNLELF
FT                   HGSTIAFKDMALSILPYLLTTAAKKQGVERKIAILTATSGDTGKAAMAGFVDVPGTDII
FT                   VFYPKSGVSRIQELQMITQAGHNTHVVAIEGNFDDAQTEVKRLFNDPDLRERLAAQQIQ
FT                   LSSANSMNIGRLIPQVVYYIYAYAQLVRHQRLEAGETINIVVPTGNFGNLLVAYYAKEI
FT                   GLPVAKFICASNENNVLTDFFASGRYDKKRPFKVTTSPSMDILVSSNLERLVFYLLGND
FT                   AQKTAVLMKSLAETGQYQLADADQSILDLFAAGFATEQETAKEIKTIFESDHYVLDPHT
FT                   AVASAVYRAYREQSGDSRPTIVASTASPYKFPRVVVEAISGQQVASDFEALEQLADISG
FT                   VVVPQAVNGLQEAPIRHSLLVTVADMQQAVEAYLGV"
FT   misc_feature    65404..66276
FT                   /locus_tag="SEQ_0052"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 3.8e-08"
FT                   /inference="protein motif:PFAM:PF00291"
FT   misc_feature    65461..65505
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00165"
FT   CDS_pept        66673..67983
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0053"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91963"
FT                   /db_xref="GOA:C0MBI0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI0"
FT                   /protein_id="CAW91963.1"
FT                   /translation="MNIMTHNRKKILSLALPSMAENILQMLMGMIDNYLAAQIGLTAVS
FT                   GIAIANNILTIYQALFIALGAAVSSLIARSVGEQNHSKEIDYMANAILVTGALSVLLGL
FT                   MSVVGHKSILAFLGAASLVARLGGQYLAIVGGMILSLGLFTSLGAIIRAKGQPSIPMKV
FT                   SLLTNLLNAVFSALSLYIWGFGVIGIAWSTVASRLIGVVILCHFLPIKEIIKRFANPLD
FT                   KEIFSLSLPAAGERLMMRAGDVLIVTIIVRFGTEALAGNAIGETLTQFNYMPGLAMSTA
FT                   TVILVANQLGSGKGATIAKTVKETFLLATLMMLVMGLITYLLGPNLLPLFTADAKAQQA
FT                   GMVVLVFSLLGVPATAGTLVYTAAWQGIGQAKLPFYATTIGMWLVRISLGYFIGVTLNY
FT                   GVIGVWLATILDNATRWLILAVAFKKQQRQLFSDCHS"
FT   misc_feature    66721..67203
FT                   /locus_tag="SEQ_0053"
FT                   /note="HMMPfam hit to PF01554, MatE, score 9e-21"
FT                   /inference="protein motif:PFAM:PF01554"
FT   misc_feature    join(66751..66819,66829..66897,66931..66999,67057..67125,
FT                   67159..67218,67228..67296,67588..67656,67699..67767,
FT                   67831..67899)
FT                   /locus_tag="SEQ_0053"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SEQ0053 by TMHMM2.0 at aa 27-49, 53-75, 87-109, 129-151,
FT                   163-182, 186-208, 306-328, 343-365 and 387-409"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    67363..67848
FT                   /locus_tag="SEQ_0053"
FT                   /note="HMMPfam hit to PF01554, MatE, score 1.3e-27"
FT                   /inference="protein motif:PFAM:PF01554"
FT   CDS_pept        68363..68671
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0054"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91965"
FT                   /db_xref="GOA:C0MBW5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MBW5"
FT                   /protein_id="CAW91965.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   misc_feature    68375..68662
FT                   /locus_tag="SEQ_0054"
FT                   /note="HMMPfam hit to PF00338, Ribosomal protein S10p/S20e,
FT                   score 7.5e-60"
FT                   /inference="protein motif:PFAM:PF00338"
FT   misc_feature    68447..68494
FT                   /note="PS00361 Ribosomal protein S10 signature."
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS_pept        68969..69595
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0055"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91967"
FT                   /db_xref="GOA:C0M660"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M660"
FT                   /protein_id="CAW91967.1"
FT                   /translation="MTKGILGEKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAEITVDIFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVSPNRVFKNKHLAGRMG
FT                   GNRVTIQNLEIVQVIPEKNVILIKGNVPGAKKSLITIKSAVKAAK"
FT   misc_feature    68993..69571
FT                   /locus_tag="SEQ_0055"
FT                   /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
FT                   1.7e-92"
FT                   /inference="protein motif:PFAM:PF00297"
FT   misc_feature    69266..69337
FT                   /note="PS00474 Ribosomal protein L3 signature."
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS_pept        69620..70243
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0056"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91969"
FT                   /db_xref="GOA:C0M6G6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6G6"
FT                   /protein_id="CAW91969.1"
FT                   /translation="MANVKLFDQTGKEVSTVELNDDIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVESLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVAVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   misc_feature    69665..70234
FT                   /locus_tag="SEQ_0056"
FT                   /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1
FT                   family, score 2.4e-72"
FT                   /inference="protein motif:PFAM:PF00573"
FT   CDS_pept        70243..70539
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0057"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91971"
FT                   /db_xref="GOA:C0M6X1"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6X1"
FT                   /protein_id="CAW91971.1"
FT                   /translation="MNLYDVIKKPVITEKSMYALEEGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAVEAE"
FT   misc_feature    70252..70527
FT                   /locus_tag="SEQ_0057"
FT                   /note="HMMPfam hit to PF00276, Ribosomal protein L23, score
FT                   3.1e-32"
FT                   /inference="protein motif:PFAM:PF00276"
FT   misc_feature    70471..70518
FT                   /note="PS00050 Ribosomal protein L23 signature."
FT                   /inference="protein motif:Prosite:PS00050"
FT   CDS_pept        70557..71390
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0058"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91972"
FT                   /db_xref="GOA:C0M6X2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6X2"
FT                   /protein_id="CAW91972.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKNKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLVNIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSNKLLVRRRNEK"
FT   misc_feature    70680..70910
FT                   /locus_tag="SEQ_0058"
FT                   /note="HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA
FT                   binding dom, score 8e-48"
FT                   /inference="protein motif:PFAM:PF00181"
FT   misc_feature    70926..71315
FT                   /locus_tag="SEQ_0058"
FT                   /note="HMMPfam hit to PF03947, Ribosomal Proteins L2,
FT                   C-terminal doma, score 8.8e-87"
FT                   /inference="protein motif:PFAM:PF03947"
FT   misc_feature    71208..71243
FT                   /note="PS00467 Ribosomal protein L2 signature."
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS_pept        71502..71780
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0059"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91974"
FT                   /db_xref="GOA:C0M7R3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7R3"
FT                   /protein_id="CAW91974.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   misc_feature    71508..71750
FT                   /locus_tag="SEQ_0059"
FT                   /note="HMMPfam hit to PF00203, Ribosomal protein S19, score
FT                   3.1e-51"
FT                   /inference="protein motif:PFAM:PF00203"
FT   misc_feature    71658..71732
FT                   /note="PS00323 Ribosomal protein S19 signature."
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS_pept        71796..72140
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0060"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91976"
FT                   /db_xref="GOA:C0M7R4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7R4"
FT                   /protein_id="CAW91976.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   misc_feature    71820..72134
FT                   /locus_tag="SEQ_0060"
FT                   /note="HMMPfam hit to PF00237, Ribosomal protein L22p/L17e,
FT                   score 2.3e-60"
FT                   /inference="protein motif:PFAM:PF00237"
FT   misc_feature    72054..72128
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS_pept        72153..72806
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0061"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91978"
FT                   /db_xref="GOA:C0M8D5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8D5"
FT                   /protein_id="CAW91978.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LAEASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRAQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   SEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   misc_feature    72156..72335
FT                   /locus_tag="SEQ_0061"
FT                   /note="HMMPfam hit to PF00417, Ribosomal protein S3,
FT                   N-terminal domai, score 4.9e-29"
FT                   /inference="protein motif:PFAM:PF00417"
FT   misc_feature    72336..72500
FT                   /locus_tag="SEQ_0061"
FT                   /note="HMMPfam hit to PF07650, KH domain, score 4.8e-23"
FT                   /inference="protein motif:PFAM:PF07650"
FT   misc_feature    72504..72755
FT                   /locus_tag="SEQ_0061"
FT                   /note="HMMPfam hit to PF00189, Ribosomal protein S3,
FT                   C-terminal domai, score 1.4e-50"
FT                   /inference="protein motif:PFAM:PF00189"
FT   misc_feature    72636..72740
FT                   /note="PS00548 Ribosomal protein S3 signature."
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS_pept        72810..73223
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0062"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91980"
FT                   /db_xref="GOA:C0M8M3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8M3"
FT                   /protein_id="CAW91980.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EVAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   misc_feature    72810..73205
FT                   /locus_tag="SEQ_0062"
FT                   /note="HMMPfam hit to PF00252, Ribosomal protein L16, score
FT                   1.2e-82"
FT                   /inference="protein motif:PFAM:PF00252"
FT   misc_feature    72984..73019
FT                   /note="PS00586 Ribosomal protein L16 signature 1."
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    73053..73088
FT                   /note="PS00701 Ribosomal protein L16 signature 2."
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS_pept        73233..73439
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0063"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91982"
FT                   /db_xref="GOA:C0M918"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M918"
FT                   /protein_id="CAW91982.1"
FT                   /translation="MKLEEIKKFVAELRGLSQEELAKKENELKKELFDLRFQAAAGQLD
FT                   QTARLNEVKKQIARVKTVQSEMK"
FT   misc_feature    73260..73433
FT                   /locus_tag="SEQ_0063"
FT                   /note="HMMPfam hit to PF00831, Ribosomal L29 protein, score
FT                   2.1e-28"
FT                   /inference="protein motif:PFAM:PF00831"
FT   CDS_pept        73467..73727
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0064"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91984"
FT                   /db_xref="GOA:C0M919"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M919"
FT                   /protein_id="CAW91984.1"
FT                   /translation="MERNQRKTLVGRVVSDKMDKTITVIVETKRNHPVYGKRINYSKKY
FT                   KAHDEKNLAKEGDIVRIMETRPLSATKRFRLVEIVEEAVII"
FT   misc_feature    73497..73703
FT                   /locus_tag="SEQ_0064"
FT                   /note="HMMPfam hit to PF00366, Ribosomal protein S17, score
FT                   1.6e-36"
FT                   /inference="protein motif:PFAM:PF00366"
FT   misc_feature    73635..73673
FT                   /note="PS00056 Ribosomal protein S17 signature."
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS_pept        73752..74120
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0065"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91985"
FT                   /db_xref="GOA:C0M9H1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9H1"
FT                   /protein_id="CAW91985.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   misc_feature    73929..74009
FT                   /note="PS00049 Ribosomal protein L14 signature."
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS_pept        74204..74509
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0066"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91987"
FT                   /db_xref="GOA:C0M9H2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9H2"
FT                   /protein_id="CAW91987.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGVEAVVLKALPKVNKVIVEGVAIIKKHQ
FT                   KPNSENPQGAIVEKEAPIHASNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   misc_feature    74210..74311
FT                   /locus_tag="SEQ_0066"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 6.6e-09"
FT                   /inference="protein motif:PFAM:PF00467"
FT   misc_feature    74219..74272
FT                   /note="PS01108 Ribosomal protein L24 signature."
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS_pept        74533..75075
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0067"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91989"
FT                   /db_xref="GOA:C0M9H3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9H3"
FT                   /protein_id="CAW91989.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   misc_feature    74605..74775
FT                   /locus_tag="SEQ_0067"
FT                   /note="HMMPfam hit to PF00281, Ribosomal protein L5, score
FT                   7.2e-30"
FT                   /inference="protein motif:PFAM:PF00281"
FT   misc_feature    74704..74754
FT                   /note="PS00358 Ribosomal protein L5 signature."
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    74785..75069
FT                   /locus_tag="SEQ_0067"
FT                   /note="HMMPfam hit to PF00673, ribosomal L5P family
FT                   C-terminus, score 5.9e-53"
FT                   /inference="protein motif:PFAM:PF00673"
FT   CDS_pept        75091..75276
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0068"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91991"
FT                   /db_xref="GOA:C0M9Z1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9Z1"
FT                   /protein_id="CAW91991.1"
FT                   /translation="MAKKSMIAKNKRPAKYSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   misc_feature    75103..75270
FT                   /locus_tag="SEQ_0068"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 9.7e-20"
FT                   /inference="protein motif:PFAM:PF00253"
FT   misc_feature    75157..75225
FT                   /note="PS00527 Ribosomal protein S14 signature."
FT                   /inference="protein motif:Prosite:PS00527"
FT   CDS_pept        75609..76007
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0069"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91993"
FT                   /db_xref="GOA:C0MAG4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAG4"
FT                   /protein_id="CAW91993.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   IKNVEVIEDGKQGIIRVFLKYGQNGERVITNLKRVSKPGLRIYSKREDVPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   misc_feature    75621..76004
FT                   /locus_tag="SEQ_0069"
FT                   /note="HMMPfam hit to PF00410, Ribosomal protein S8, score
FT                   4.8e-76"
FT                   /inference="protein motif:PFAM:PF00410"
FT   misc_feature    75912..75965
FT                   /note="PS00053 Ribosomal protein S8 signature."
FT                   /inference="protein motif:Prosite:PS00053"
FT   CDS_pept        76329..76865
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0070"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91995"
FT                   /db_xref="GOA:C0MAG5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAG5"
FT                   /protein_id="CAW91995.1"
FT                   /translation="MSRIGNKVIIIPAGVEIINNDNVVTVKGPKGELTREFNKNIEIKV
FT                   EGNEMTLVRPDDSKEMKTIHGTTRANLNNMVVGVSEGFKKELEMKGVGYRAQLQGSKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   misc_feature    76359..76574
FT                   /locus_tag="SEQ_0070"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   1.5e-24"
FT                   /inference="protein motif:PFAM:PF00347"
FT   misc_feature    76596..76823
FT                   /locus_tag="SEQ_0070"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   2.2e-30"
FT                   /inference="protein motif:PFAM:PF00347"
FT   misc_feature    76788..76814
FT                   /note="PS00525 Ribosomal protein L6 signature 1."
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS_pept        76968..77324
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0071"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91996"
FT                   /db_xref="GOA:C0MB66"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MB66"
FT                   /protein_id="CAW91996.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   misc_feature    76983..77321
FT                   /locus_tag="SEQ_0071"
FT                   /note="HMMPfam hit to PF00861, Ribosomal L18p/L5e family,
FT                   score 7.2e-56"
FT                   /inference="protein motif:PFAM:PF00861"
FT   CDS_pept        77343..77837
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0072"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAW91998"
FT                   /db_xref="GOA:C0MB67"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB67"
FT                   /protein_id="CAW91998.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGHV
FT                   GFGTGKAQEVPEAIRKAVEAAKKSMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGIADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   misc_feature    77367..77567
FT                   /locus_tag="SEQ_0072"
FT                   /note="HMMPfam hit to PF00333, Ribosomal protein S5,
FT                   N-terminal domai, score 1.3e-42"
FT                   /inference="protein motif:PFAM:PF00333"
FT   misc_feature    77421..77519
FT                   /note="PS00585 Ribosomal protein S5 signature."
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    77526..77573
FT                   /note="PS00589 PTS HPR component serine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS00589"
FT   misc_feature    77592..77813
FT                   /locus_tag="SEQ_0072"
FT                   /note="HMMPfam hit to PF03719, Ribosomal protein S5,
FT                   C-terminal domai, score 6.2e-35"
FT                   /inference="protein motif:PFAM:PF03719"
FT   CDS_pept        77852..78034
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0073"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92000"
FT                   /db_xref="GOA:C0MBI1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MBI1"
FT                   /protein_id="CAW92000.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVIKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   misc_feature    77855..78013
FT                   /locus_tag="SEQ_0073"
FT                   /note="HMMPfam hit to PF00327, Ribosomal protein L30p/L7e,
FT                   score 2.8e-14"
FT                   /inference="protein motif:PFAM:PF00327"
FT   misc_feature    77915..78013
FT                   /note="PS00634 Ribosomal protein L30 signature."
FT                   /inference="protein motif:Prosite:PS00634"
FT   CDS_pept        78236..78676
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0074"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92002"
FT                   /db_xref="GOA:C0MBW6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MBW6"
FT                   /protein_id="CAW92002.1"
FT                   /translation="MKLHELKPAKGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNAFEDGTEVTPVVLKEAGIVRA
FT                   EKSGVKILGNGELTKKLTVKAAKFSKSAEAAITAKGGSIEVI"
FT   misc_feature    78236..78541
FT                   /locus_tag="SEQ_0074"
FT                   /note="HMMPfam hit to PF01305, Ribosomal protein L15 amino
FT                   terminal re, score 5.3e-59"
FT                   /inference="protein motif:PFAM:PF01305"
FT   misc_feature    78563..78658
FT                   /locus_tag="SEQ_0074"
FT                   /note="HMMPfam hit to PF00256, Ribosomal protein L15, score
FT                   3.1e-11"
FT                   /inference="protein motif:PFAM:PF00256"
FT   misc_feature    78563..78655
FT                   /note="PS00475 Ribosomal protein L15 signature."
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS_pept        78693..79997
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0075"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92004"
FT                   /db_xref="GOA:C0M661"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C0M661"
FT                   /protein_id="CAW92004.1"
FT                   /translation="MFLKILKDALKIKNVRNKIFFTIFIILIFRIGTHITVPGVNAKSL
FT                   EQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFAQSIGITAGFNTLSSVALVKTPDVRTYLLIGALLTTGSVI
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPNAIATIREDYFVNVKSGDLQSSYIVVGIL
FT                   ILAVLAIVFFTTYVQQAEYKIPIQYTKLVQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTIIPFFQNGRDIPWLTTLQGIFNYQSPTGMIVYALLIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSVRPGRETEEFMSSLLKKLATVGAIFLAFISLVPIAAQQALNLSSSIALG
FT                   GTSLLILISTGIEGMKQLEGYLLKRKYVGFMNITE"
FT   sig_peptide     78693..78818
FT                   /locus_tag="SEQ_0075"
FT                   /note="Signal peptide predicted for SEQ0075 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.935) with cleavage site
FT                   probability 0.860 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(78750..78818,78888..78956,79041..79109,79137..79196,
FT                   79215..79283,79326..79394,79491..79559,79602..79670,
FT                   79794..79862,79875..79934)
FT                   /locus_tag="SEQ_0075"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0075 by TMHMM2.0 at aa 20-42, 66-88, 117-139, 149-168,
FT                   175-197, 212-234, 267-289, 304-326, 368-390 and 395-414"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    78897..79940
FT                   /locus_tag="SEQ_0075"
FT                   /note="HMMPfam hit to PF00344, eubacterial secY protein,
FT                   score 5.7e-167"
FT                   /inference="protein motif:PFAM:PF00344"
FT   misc_feature    78897..78956
FT                   /note="PS00755 Protein secY signature 1."
FT                   /inference="protein motif:Prosite:PS00755"
FT   misc_feature    79188..79244
FT                   /note="PS00756 Protein secY signature 2."
FT                   /inference="protein motif:Prosite:PS00756"
FT   misc_feature    79212..79268
FT                   /note="PS00095 C-5 cytosine-specific DNA methylases
FT                   C-terminal signature."
FT                   /inference="protein motif:Prosite:PS00095"
FT   CDS_pept        80149..80790
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0076"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92006"
FT                   /db_xref="GOA:C0M6X3"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6X3"
FT                   /protein_id="CAW92006.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVETFELIHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGDLVPDEVTNGIVKERLAQADIKEKGFLLDGYPRTIEQAHALDETLKAL
FT                   GLTLDGVINIEVDPASLIDRLSGRIINKKTGETFHKIFNPPVGDYKEEDFYQREDDKPE
FT                   TVKRRLDVNIAQGEPIIKHYRQAGIVRDIDGNKDISEVFADIKKVIENLK"
FT   misc_feature    80161..80712
FT                   /locus_tag="SEQ_0076"
FT                   /note="HMMPfam hit to PF00406, Adenylate kinase, score
FT                   2e-86"
FT                   /inference="protein motif:PFAM:PF00406"
FT   misc_feature    80392..80427
FT                   /note="PS00113 Adenylate kinase signature."
FT                   /inference="protein motif:Prosite:PS00113"
FT   CDS_pept        80908..81126
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0077"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92008"
FT                   /db_xref="GOA:C0M6X4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6X4"
FT                   /protein_id="CAW92008.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   misc_feature    80911..81123
FT                   /locus_tag="SEQ_0077"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   3.2e-13"
FT                   /inference="protein motif:PFAM:PF00575"
FT   misc_feature    80920..81117
FT                   /locus_tag="SEQ_0077"
FT                   /note="HMMPfam hit to PF01176, Translation initiation
FT                   factor 1A / IF-1, score 1.5e-35"
FT                   /inference="protein motif:PFAM:PF01176"
FT   CDS_pept        81152..81268
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0078"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92009"
FT                   /db_xref="GOA:C0M6X5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6X5"
FT                   /protein_id="CAW92009.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   misc_feature    81182..81262
FT                   /note="PS00828 Ribosomal protein L36 signature."
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS_pept        81286..81651
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0079"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92011"
FT                   /db_xref="GOA:C0M7C5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7C5"
FT                   /protein_id="CAW92011.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGVSEDIRV
FT                   KDLTSDQEDAIRREVDTIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   misc_feature    81292..81609
FT                   /locus_tag="SEQ_0079"
FT                   /note="HMMPfam hit to PF00416, Ribosomal protein S13/S18,
FT                   score 5.3e-55"
FT                   /inference="protein motif:PFAM:PF00416"
FT   misc_feature    81544..81585
FT                   /note="PS00646 Ribosomal protein S13 signature."
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS_pept        81669..82052
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0080"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92013"
FT                   /db_xref="GOA:C0M7C6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7C6"
FT                   /protein_id="CAW92013.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   misc_feature    81717..82046
FT                   /locus_tag="SEQ_0080"
FT                   /note="HMMPfam hit to PF00411, Ribosomal protein S11, score
FT                   2.1e-72"
FT                   /inference="protein motif:PFAM:PF00411"
FT   misc_feature    81951..82019
FT                   /note="PS00054 Ribosomal protein S11 signature."
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS_pept        82099..83037
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0081"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92015"
FT                   /db_xref="GOA:C0M834"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C0M834"
FT                   /protein_id="CAW92015.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIRIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIADGYTLKASMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTDVAKATEVMKEAEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   misc_feature    82138..82770
FT                   /locus_tag="SEQ_0081"
FT                   /note="HMMPfam hit to PF01193, RNA polymerase Rpb3/Rpb11
FT                   dimerisation, score 6e-26"
FT                   /inference="protein motif:PFAM:PF01193"
FT   misc_feature    82258..82605
FT                   /locus_tag="SEQ_0081"
FT                   /note="HMMPfam hit to PF01000, RNA polymerase Rpb3/RpoA
FT                   insert domain, score 1.5e-55"
FT                   /inference="protein motif:PFAM:PF01000"
FT   misc_feature    82804..83007
FT                   /locus_tag="SEQ_0081"
FT                   /note="HMMPfam hit to PF03118, Bacterial RNA polymerase,
FT                   alpha chain C, score 1.3e-31"
FT                   /inference="protein motif:PFAM:PF03118"
FT   CDS_pept        83052..83438
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0082"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92016"
FT                   /db_xref="GOA:C0M8M4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8M4"
FT                   /protein_id="CAW92016.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   misc_feature    83097..83435
FT                   /locus_tag="SEQ_0082"
FT                   /note="HMMPfam hit to PF01196, Ribosomal protein L17, score
FT                   1.7e-62"
FT                   /inference="protein motif:PFAM:PF01196"
FT   misc_feature    83139..83207
FT                   /note="PS01167 Ribosomal protein L17 signature."
FT                   /inference="protein motif:Prosite:PS01167"
FT   CDS_pept        complement(join(83656..83754,83754..83819,83819..83887))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0083"
FT                   /note="Similar to the C-terminal region of Streptococcus
FT                   mutans putative transposase UniProt:Q8DTK6 (EMBL:AE014133
FT                   (46 aa) blastp scores: E()=5e-04;putative transposase
FT                   (pseudogene)"
FT   CDS_pept        84743..85993
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0084"
FT                   /product="hypothetical protein"
FT                   /note="Possible gene remnant. Similar to the N-terminal
FT                   regions of several proteins, including Staphylococcus
FT                   aureus hypothetical protein. UniProt:Q99W16 (EMBL:BA000017
FT                   (464 aa) fasta scores: E()=2.3e-15, 28.804% id in 368 aa.
FT                   Similar to the N-terminal region of SEQ1361, 38.717%
FT                   identity (41.266% ungapped) in 421 aa overlap
FT                   (1-410:1-406)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92018"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:C0M920"
FT                   /protein_id="CAW92018.1"
FT                   /translation="MSIDMYLSLSEEQAQSVEAVLARRQTAYQSLQETLIQLISNSPDL
FT                   SGRTYDSAKAYSSQVLIPLLKGCMLLDEAIITACKRLPSEYRSQVDQIDLKESDLVERI
FT                   AQFDHVIGRYMDLISIEYSREEPSYSYISHLRSAEQLHRAVKRRLEEILRRLRHFDTNS
FT                   VHLFSTIQTLAAAVQIGMRQARTSWHAGSQVFVISEDMAWADTINSKWSKSKGLSYLSD
FT                   YVYDPDVLSKRAAINHSWIKTGYTMSKNFGKAVSKDYTKASFLSYGKAAKATGWTSMAV
FT                   DTGITSVREYNKKNSRAYGSEGKALIHASVAQIKSMGPIEGAIIGSKAGPWGALMGFVT
FT                   GGINVTWGVVHPESKDNMFLWIQDKMDDVYDSIVQTDLGKGTHHAKESVKGHIGRAIVR
FT                   TWDFVSQSFGKGVGYDI"
FT   CDS_pept        join(85983..86327,86331..86858)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0085"
FT                   /note="CDS contains a nonsense mutation (amber) after codon
FT                   115;putative membrane protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92020.1"
FT   misc_feature    join(86109..86168,86250..86318)
FT                   /locus_tag="SEQ_0085"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0085 by TMHMM2.0 at aa 43-62 and 90-112"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    86664..86732
FT                   /locus_tag="SEQ_0086"
FT                   /note="1 probable transmembrane helix predicted for SEQ0086
FT                   by TMHMM2.0 at aa 73-95"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        86879..87172
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92022"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z2"
FT                   /protein_id="CAW92022.1"
FT                   /translation="MQKELLPLGSVVYLEGATSKLMIVGRGPIFESNGQNVYSDYVGVM
FT                   YPEGINPEDAIFFNHEDIAKTVFEGFKDEEEQRFLEVYSDWESTLEISKIKL"
FT   rRNA            87627..89175
FT                   /locus_tag="SEQ__r04"
FT                   /note="16S rRNA"
FT   tRNA            89395..89467
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="SEQ__t19"
FT                   /product="transfer RNA-Ala"
FT                   /note="tRNA Ala anticodon TGC, Cove score 84.64"
FT   rRNA            89775..92676
FT                   /locus_tag="SEQ__r05"
FT                   /note="23S rRNA"
FT   rRNA            92759..92874
FT                   /locus_tag="SEQ__r06"
FT                   /note="5S rRNA"
FT   tRNA            92889..92961
FT                   /gene="tRNA-Val"
FT                   /locus_tag="SEQ__t20"
FT                   /product="transfer RNA-Val"
FT                   /note="tRNA Val anticodon TAC, Cove score 81.00"
FT   tRNA            92967..93037
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="SEQ__t21"
FT                   /product="transfer RNA-Gly"
FT                   /note="tRNA Gly anticodon TCC, Cove score 71.92"
FT   tRNA            93067..93140
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="SEQ__t22"
FT                   /product="transfer RNA-Ile"
FT                   /note="tRNA Ile anticodon GAT, Cove score 86.72"
FT   tRNA            93153..93224
FT                   /gene="tRNA-Glu"
FT                   /locus_tag="SEQ__t23"
FT                   /product="transfer RNA-Glu"
FT                   /note="tRNA Glu anticodon TTC, Cove score 64.66"
FT   tRNA            93235..93324
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="SEQ__t24"
FT                   /product="transfer RNA-Ser"
FT                   /note="tRNA Ser anticodon TGA, Cove score 61.73"
FT   tRNA            93336..93409
FT                   /gene="tRNA-Met"
FT                   /locus_tag="SEQ__t25"
FT                   /product="transfer RNA-Met"
FT                   /note="tRNA Met anticodon CAT, Cove score 75.45"
FT   tRNA            93434..93506
FT                   /gene="tRNA-Phe"
FT                   /locus_tag="SEQ__t26"
FT                   /product="transfer RNA-Phe"
FT                   /note="tRNA Phe anticodon GAA, Cove score 75.06"
FT   tRNA            93526..93606
FT                   /gene="tRNA-Tyr"
FT                   /locus_tag="SEQ__t27"
FT                   /product="transfer RNA-Tyr"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 63.49"
FT   tRNA            93613..93683
FT                   /gene="tRNA-Trp"
FT                   /locus_tag="SEQ__t28"
FT                   /product="transfer RNA-Trp"
FT                   /note="tRNA Trp anticodon CCA, Cove score 54.14"
FT   tRNA            93695..93767
FT                   /gene="tRNA-His"
FT                   /locus_tag="SEQ__t29"
FT                   /product="transfer RNA-His"
FT                   /note="tRNA His anticodon GTG, Cove score 65.52"
FT   tRNA            93776..93847
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="SEQ__t30"
FT                   /product="transfer RNA-Gln"
FT                   /note="tRNA Gln anticodon TTG, Cove score 64.56"
FT   tRNA            93866..93949
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="SEQ__t31"
FT                   /product="transfer RNA-Leu"
FT                   /note="tRNA Leu anticodon CAA, Cove score 70.28"
FT   CDS_pept        complement(94293..95423)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0089"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92024"
FT                   /db_xref="GOA:C0MAT7"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT7"
FT                   /protein_id="CAW92024.1"
FT                   /translation="MILRKYNDFCRLFLGRLISNCGDSIYTLVLSWYVLETTNSTWYVG
FT                   LLNFLIFIPNTFSFIFGKKIDSYPKKNLLVILEWAQLLAVLGIILGMSLREIHASLSLT
FT                   IIFSCVFLASMVGLNTYTVQDALVPKLIPTKDLAKAEMYMSVAYNGTDYVFTAISGFLL
FT                   SVISYIPLLFINIVTFLGSILFFRRIAFKEIIEQTNERTDFLSGLRFIWHNKVVLAITL
FT                   GGAIANFLFASLNVYQLLIAREVGNSAFYGLLVSVSAIGTLVGTTFVANLVLQKLSVGK
FT                   AFWLATTLLGTGIGLTALVPNRFGLLLLWFLSCLFLGITHVTQKPILRTEIPDEHLGEV
FT                   FSAFYTVTIPTLALGSLILISLLYFSNKMLRQYDIC"
FT   misc_feature    complement(join(94329..94397,94455..94508,94527..94580,
FT                   94608..94676,94713..94778,94875..94943,95061..95129,
FT                   95142..95201,95238..95306,95319..95387))
FT                   /locus_tag="SEQ_0089"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0089 by TMHMM2.0 at aa 13-35, 40-62, 75-94, 99-121,
FT                   161-183, 216-237, 250-272, 282-299, 306-323 and 343-365"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(94482..94514)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(95097..95129)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        95988..97181
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0090"
FT                   /product="putative collagen-like surface-anchored protein
FT                   SclG"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92025"
FT                   /db_xref="GOA:C0MAT8"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT8"
FT                   /protein_id="CAW92025.1"
FT                   /translation="MTTKEKQTKLMRRYGIFSVVVALTALAGLGAANEVKATAKKSLNE
FT                   LPNPVEIIQYNSTRTTDREARKYLNQLYEFLKPYLGSLEEEAQKGGPQGPVGPAGPRGE
FT                   RGEPGPKGDRGPEGQRGEQGPAGPIGPQGPRGDKGETGEIGPRGEQGPTGPTGKPGERG
FT                   PKGDRGERGEKGEQGQRGEKGEQGQRGEKGEQGQRGEKGEQGQRGEKGEQGQRGEKGEQ
FT                   GQRGEKGEQGQRGEKGEQGQRGEKGEQGQRGEKGEQGQRGEKGEQGQRGEKGEQGQRGE
FT                   KGEQGQRGEKGEQGQRGEKGEQSQRGEKGEQGKDTKPSAPKAPEQSPAPQVPKTSEQQS
FT                   ASPKVPAPKSAPSKSAAPAAQKGILPATGETNHPFFTLAALGVIASAGLLTLKRKNN"
FT   sig_peptide     95988..96098
FT                   /locus_tag="SEQ_0090"
FT                   /note="Signal peptide predicted for SEQ0090 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.930 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(96024..96083,97110..97163)
FT                   /locus_tag="SEQ_0090"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0090 by TMHMM2.0 at aa 13-32 and 375-392"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    96258..96437
FT                   /locus_tag="SEQ_0090"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 2.9e-13"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    96438..96617
FT                   /locus_tag="SEQ_0090"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 3.6e-14"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    96618..96797
FT                   /locus_tag="SEQ_0090"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 3.6e-16"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    97056..97175
FT                   /locus_tag="SEQ_0090"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   1.3e-07"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    97080..97097
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        97675..98199
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0091"
FT                   /product="putative NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92027"
FT                   /db_xref="GOA:C0MB68"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB68"
FT                   /protein_id="CAW92027.1"
FT                   /translation="MVEYWDIYTMNRLKTGRLMERGAAFVEGAYHLVVHACVFNDKGEM
FT                   LIQQRQKDKEGWPSYWDITVGGSALAGETSQEAVMRELKEELGLTLDLAGVRPHFSITF
FT                   DNGFDDTFLILQAVDVRKLVLQTEEVQAVRWASRDEILAMIDAGIFIPYFKSKIDMCFE
FT                   LVGQYGAIKWS"
FT   misc_feature    97762..98145
FT                   /locus_tag="SEQ_0091"
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 4.3e-22"
FT                   /inference="protein motif:PFAM:PF00293"
FT   misc_feature    97873..97932
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        98414..99265
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0092"
FT                   /product="4-diphosphocytidyl-2-c-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92029"
FT                   /db_xref="GOA:C0MBI2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MBI2"
FT                   /protein_id="CAW92029.1"
FT                   /translation="MTAIIERAPAKINLGLDIQGKRPDGYHDLSMVLVSVDLCDYITVD
FT                   HLEEDRILLTSNCPRLPINEHNDVYKAAYLLKERFQISTGVSIFLDKRVPVCAGMGGGS
FT                   SDAAAAIRALNQLWQLKLSPRQMIDIGMQIGSDVPYCLFAGCAQVTGKGEVVKPINGRL
FT                   SSWVVLVKPEFGISTRTIFWDIDCETISRVPIEDLVSAIEAGDYQRLLATMGNSLEDIS
FT                   IAKRPFIQKVKDKMLQSGADIALMTGSGPTVFALCQTEKQANRVVNSLKGFCKEVYKVR
FT                   TL"
FT   misc_feature    98672..98848
FT                   /locus_tag="SEQ_0092"
FT                   /note="HMMPfam hit to PF00288, GHMP kinases N terminal
FT                   domain, score 1.3e-18"
FT                   /inference="protein motif:PFAM:PF00288"
FT   misc_feature    99005..99241
FT                   /locus_tag="SEQ_0092"
FT                   /note="HMMPfam hit to PF08544, GHMP kinases C terminal,
FT                   score 3e-09"
FT                   /inference="protein motif:PFAM:PF08544"
FT   CDS_pept        99335..99778
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0093"
FT                   /product="MarR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92031"
FT                   /db_xref="GOA:C0MBI3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI3"
FT                   /protein_id="CAW92031.1"
FT                   /translation="MTILEKKLDNLVNRILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQEKLTNTDLAKRLNISQAAVTKAIKGLIKQEMLAGTKDTVDARVTYFELTDLARPI
FT                   AKEHTHHHDKTLAVYHRLLAHFSAEEQVIVEKFITAFAEELEG"
FT   misc_feature    99440..99646
FT                   /locus_tag="SEQ_0093"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 6.7e-14"
FT                   /inference="protein motif:PFAM:PF01047"
FT   misc_feature    99449..99619
FT                   /locus_tag="SEQ_0093"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.0028"
FT                   /inference="protein motif:PFAM:PF08279"
FT   misc_feature    99488..99553
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2017.000, SD 6.06 at aa 52-73, sequence
FT                   LTNTDLAKRLNISQAAVTKAIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        99781..100500
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0094"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92032"
FT                   /db_xref="GOA:C0MBW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBW7"
FT                   /protein_id="CAW92032.1"
FT                   /translation="MRYISVENLSFQYDSEPVLEGISYHLDSGEFVTLTGENGAAKSTL
FT                   IKATLGILKPRAGQVTIAKQNIHGKKLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFTRLSKHDEEHVRTSLESVGMWDSRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHRHGKAVLMITHDPEEVKAYADRNIHLIRNQRLPWRCF
FT                   NIHDAEADESKGGSFHA"
FT   misc_feature    99865..100425
FT                   /locus_tag="SEQ_0094"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.6e-47"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    100192..100236
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        100493..101302
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0095"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92034"
FT                   /db_xref="GOA:C0M662"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0M662"
FT                   /protein_id="CAW92034.1"
FT                   /translation="MLEILSYDFMQRAVMAVVAISIFAPILGIFLILRRQSLLSDTLSH
FT                   VSLAGVAFGVVLGVSPTFTTIIVVVLAAILLEYLRVVYKHYMEISTAILMSLGLAISLI
FT                   IMSKSTSSSSMSLEQYLFGSIITISTEQVAALFVIALIILALTILFIRPMYILTFDEDT
FT                   AYVDGLPVRVMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIAMRLGKNFKSVIFL
FT                   GIMIGFTGMLSGIFLSYFWETPASATITMIFIAIFLVVNLLSFIRQK"
FT   misc_feature    100508..101284
FT                   /locus_tag="SEQ_0095"
FT                   /note="HMMPfam hit to PF00950, ABC 3 transport family,
FT                   score 1.7e-90"
FT                   /inference="protein motif:PFAM:PF00950"
FT   misc_feature    join(100520..100588,100649..100717,100745..100813,
FT                   100892..100960,101018..101086,101147..101215,
FT                   101225..101293)
FT                   /locus_tag="SEQ_0095"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SEQ0095 by TMHMM2.0 at aa 10-32, 53-75, 85-107, 134-156,
FT                   176-198, 219-241 and 245-267"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    100529..101263
FT                   /locus_tag="SEQ_0095"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,
FT                   score 0.004"
FT                   /inference="protein motif:PFAM:PF01032"
FT   CDS_pept        complement(101337..102593)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0096"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92036"
FT                   /db_xref="GOA:C0M6G7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6G7"
FT                   /protein_id="CAW92036.1"
FT                   /translation="MNIFEELKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERILQTKETVLDWSQKIKEQ
FT                   LSCFLDFDNGENKAELVNNYDWFSQISFIDFLRDVGKHFTINYMMSKDSVKKRIETGIS
FT                   YTEFAYQVMQGYDFYELNAKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDATGKKFGKSEGNAIWLDAKKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAAIE
FT                   EQFNAARHERLAQKTLAREVVTLVHGEAAYQQALNITEQLFAGAIKNLSAAELKQGLSN
FT                   VPNYQVQAEDSLNIVDMLVTAGISPSKRQAREDLQNGAIYLNGERLQDLDYSLSTADRI
FT                   DNQLTVIRRGKKKYAVLTY"
FT   misc_feature    complement(101397..101540)
FT                   /locus_tag="SEQ_0096"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 1.2e-06"
FT                   /inference="protein motif:PFAM:PF01479"
FT   misc_feature    complement(101625..102518)
FT                   /locus_tag="SEQ_0096"
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 2.6e-116"
FT                   /inference="protein motif:PFAM:PF00579"
FT   misc_feature    complement(102447..102479)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        102686..104998
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0097"
FT                   /product="putative penicillin-binding protein 1B"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92038"
FT                   /db_xref="GOA:C0M7C7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7C7"
FT                   /protein_id="CAW92038.1"
FT                   /translation="MRYVMVKWKKNQTSKNHQRLELVDFGTVFLRTLKFMSSFFYVAVF
FT                   LFGMLGAGMAFGYLASQIDSVKIPSKESLVKQVESLTMMSQITYSDNSLISGIDTDLLR
FT                   TPVANDAISDNIKKAIVSTEDDNFQRHNGIVPKAIFRATLASVLGFGESSGGSTLTQQL
FT                   IKQQVLGDDPTFRRKSKEIIYALALERYMSKDDILSHYLNVSPFGRNNKGQNIAGVEEA
FT                   ARGIFGVSAKDLTVPQAAFLAGLPQSPIVYSPYLPTGQLKSADDMAYGIKRQQNVLYNM
FT                   YRTGVLTEKEYRDYKAYPISNDFIKPETVTANTHDYLYYSVLAEAQKAMYSYLIKRDKV
FT                   PAKDLKNDETKAAYEERALTELQHGGYTVKTTINKPIHQVMQKAAAQFGGLLDDGTGTV
FT                   QMGNVLTDNATGAVLGFIGGRDYAQNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGS
FT                   ASVLSNYPTTYSSGQKIMHVDSEGTAMMPLQEALNTSWNIPAFWTQKLLRDKGVDVENY
FT                   MSKMGYRIADYSIESLPLGGGIETSVAQQTNAYQMIANNGLYQKQYMVASITASDGSVV
FT                   YQHEAKPVRIFSAPTATILQELLRGPISSGATTTFKSRLAGINPSLAGADWIGKTGTTE
FT                   NYTDVWLVLATPRVTLGGWAGHDDNTSLAPLTGYNNNSNYMAYLVNAISQADPNLFGLG
FT                   QRFSLDPGVIKASVLKATGLKPGTVTINGQTISIGGELTTSLWAQKGPGATTYRFAIGG
FT                   TDADYQKAWGGFSGRRN"
FT   misc_feature    102797..102865
FT                   /locus_tag="SEQ_0097"
FT                   /note="1 probable transmembrane helix predicted for SEQ0097
FT                   by TMHMM2.0 at aa 38-60"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    102938..103456
FT                   /locus_tag="SEQ_0097"
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   1.6e-76"
FT                   /inference="protein motif:PFAM:PF00912"
FT   misc_feature    103370..103456
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    103886..104740
FT                   /locus_tag="SEQ_0097"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 7.9e-15"
FT                   /inference="protein motif:PFAM:PF00905"
FT   misc_feature    104555..104578
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        105260..108826
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0098"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92040"
FT                   /db_xref="GOA:C0M7C8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7C8"
FT                   /protein_id="CAW92040.1"
FT                   /translation="MAGHDVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLINKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIIDIFGDSELVRNTIE
FT                   KDIHKNQSDSRTDEALKEIYERLRPGEPKTADSSRSLLTARFFDARRYDLAAVGRYKIN
FT                   KKLNIKTRLLNQIIAENLIDSETGEILVEAGTEMTRSVIESIEEQLDGDLNKFVYTPND
FT                   YAVVTEPVILQKFKVVSPVDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRVIGRVTNEIVWLTADEEDEF
FT                   TVAQANSKLNPDGTFAEEIVMGRHQGNNQEFPASQVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAERV
FT                   EVRREDGSLDVYHITKFRRSNSGTAYNQRTLVKIGDIVEKGDFIADGPSMEKGEMALGQ
FT                   NPIVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREVPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GATSEDLWETVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVNGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDVMHVDD
FT                   LEKAREKQAQETQDIAESTEDN"
FT   misc_feature    105341..106666
FT                   /locus_tag="SEQ_0098"
FT                   /note="HMMPfam hit to PF04563, RNA polymerase beta subunit,
FT                   score 3e-55"
FT                   /inference="protein motif:PFAM:PF04563"
FT   misc_feature    105677..106243
FT                   /locus_tag="SEQ_0098"
FT                   /note="HMMPfam hit to PF04561, RNA polymerase Rpb2, domain,
FT                   score 1.9e-08"
FT                   /inference="protein motif:PFAM:PF04561"
FT   misc_feature    106676..106885
FT                   /locus_tag="SEQ_0098"
FT                   /note="HMMPfam hit to PF04565, RNA polymerase Rpb2, domain,
FT                   score 1.6e-39"
FT                   /inference="protein motif:PFAM:PF04565"
FT   misc_feature    107288..108454
FT                   /locus_tag="SEQ_0098"
FT                   /note="HMMPfam hit to PF00562, RNA polymerase Rpb2, domain,
FT                   score 1.4e-211"
FT                   /inference="protein motif:PFAM:PF00562"
FT   misc_feature    108011..108049
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    108458..108688
FT                   /locus_tag="SEQ_0098"
FT                   /note="HMMPfam hit to PF04560, RNA polymerase Rpb2, domain,
FT                   score 1.1e-49"
FT                   /inference="protein motif:PFAM:PF04560"
FT   CDS_pept        108917..112552
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0099"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92042"
FT                   /db_xref="GOA:C0M7R5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7R5"
FT                   /protein_id="CAW92042.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKIQEYG
FT                   HGSFIAKMGAEAIQDLLKRVDLVTEIAELKEELKTATGQKRIKAVRRLDVLDAFHKSGN
FT                   KPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVIREIVAREFAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVF
FT                   KDKDEAVMAYRNGYVHLHSRVGIAVDSMPSKLWKDSQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLKPGQNIQEVIDSLPINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGTVIEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKHLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDIADFTDANK
FT                   EIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMVRYRNIEPQAINEVEVIEEAEATEEPAIIKE"
FT   misc_feature    108926..109912
FT                   /locus_tag="SEQ_0099"
FT                   /note="HMMPfam hit to PF04997, RNA polymerase Rpb1, domain,
FT                   score 2.2e-142"
FT                   /inference="protein motif:PFAM:PF04997"
FT   misc_feature    109916..110344
FT                   /locus_tag="SEQ_0099"
FT                   /note="HMMPfam hit to PF00623, RNA polymerase Rpb1, domain,
FT                   score 1.3e-83"
FT                   /inference="protein motif:PFAM:PF00623"
FT   misc_feature    110351..110908
FT                   /locus_tag="SEQ_0099"
FT                   /note="HMMPfam hit to PF04983, RNA polymerase Rpb1, domain,
FT                   score 6.3e-71"
FT                   /inference="protein motif:PFAM:PF04983"
FT   misc_feature    110993..111223
FT                   /locus_tag="SEQ_0099"
FT                   /note="HMMPfam hit to PF05000, RNA polymerase Rpb1, domain,
FT                   score 4.2e-23"
FT                   /inference="protein motif:PFAM:PF05000"
FT   misc_feature    111227..112333
FT                   /locus_tag="SEQ_0099"
FT                   /note="HMMPfam hit to PF04998, RNA polymerase Rpb1, domain,
FT                   score 1.7e-78"
FT                   /inference="protein motif:PFAM:PF04998"
FT   CDS_pept        complement(112624..112878)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0100"
FT                   /note="Probable gene remnant. Similar to C-terminal region
FT                   Streptococcus pneumoniae IS1167 transposase UniProt:Q97SC5
FT                   (EMBL:AE005672 (422 aa) fasta scores: E()=5e-12, 65.714% id
FT                   in 70 aa;putative transposase (fragment)"
FT                   /db_xref="PSEUDO:CAW92044.1"
FT   CDS_pept        113123..113677
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0101"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92045"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8D6"
FT                   /protein_id="CAW92045.1"
FT                   /translation="MRLKKLIYSSIAALAILTYGTISANADASIPEIDQTEVITILKSD
FT                   GYLNIDEGTQEVTITEKYKQAVLSSIDLDRQEAIFTENSVTIRDIFSPRSFTGVNKIVF
FT                   TWKGYDLYLDSTNANRLSALGWGSTALSGLIPDPIVSKVLAAALGVVSASISYANAAGR
FT                   GVIVAFVGTFPRGVIHWVASQ"
FT   sig_peptide     113123..113200
FT                   /locus_tag="SEQ_0101"
FT                   /note="Signal peptide predicted for SEQ0101 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.814 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        114238..115287
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0103"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92047"
FT                   /db_xref="GOA:C0M8D7"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8D7"
FT                   /protein_id="CAW92047.1"
FT                   /translation="MMTKESQKVTDSLNTSVVSLLQYCFAIMVIVIHSGRLFQYEPLHF
FT                   FLKSFLGRMAVPYFLICTAFFLRGRLREANREKQYFKQILKTYLLWSLIYLPYAYAFFE
FT                   SLRLPKHYLPLGLCLALSYFGMCYHLWYIPALWLGWVLVQLSLKTFGKKVTLIIVAGLY
FT                   LLGSMETYSHFLSSTPFEPLLTGYMHIFQTSRNGIFYTPAYLCAGCLLYDHFSSSLFSQ
FT                   RYMRKAAVCLILLALESLLIYHHQGLDKNFFLLSALFTTFLFNASVRISLLSKYSLAKL
FT                   KKLSYYYFFLHPMFIECSLFLLRPYQLAPATKGKLVFLMTLLATHLCSEALMLLVRSQA
FT                   HAKAYLKRQ"
FT   misc_feature    join(114274..114342,114385..114438,114496..114549,
FT                   114592..114660,114697..114765,114823..114882,
FT                   114919..114978,114991..115050,115087..115155,
FT                   115183..115251)
FT                   /locus_tag="SEQ_0103"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0103 by TMHMM2.0 at aa 13-35, 50-67, 87-104, 119-141,
FT                   154-176, 196-215, 228-247, 252-271, 284-306 and 316-338"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        115348..115713
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92049"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8M5"
FT                   /protein_id="CAW92049.1"
FT                   /translation="MYQVIEMYGDWEPWWFIDGWQDDIVQEKSFDSWPAALAYFEEEWQ
FT                   RMKKSYPSYHSQKSLLATFWREDERRWCEDCDEELQQYHSLLLLKDRDIVPKHHYQSYF
FT                   EQRNDCPQASLSCKLSI"
FT   misc_feature    115348..115710
FT                   /locus_tag="SEQ_0104"
FT                   /note="HMMPfam hit to PF06279, Protein of unknown function
FT                   (DUF1033), score 6.2e-68"
FT                   /inference="protein motif:PFAM:PF06279"
FT   CDS_pept        116250..118253
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0105"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92051"
FT                   /db_xref="GOA:C0M921"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:C0M921"
FT                   /protein_id="CAW92051.1"
FT                   /translation="MKRLFIILSNILVSLFLVWVFTIWSDTFVSHYYPSVVVLDASPKA
FT                   SYNQVEAGLTRLADETDSLIAMQHQEPGPEGTPIVTYTLFGKGKLPGGLAEKVIEEPSR
FT                   LSVENNYFILKGGLTVERLRDTLAGLGMTKMTALKPSFLGTLVLIFSSGSQALGIVIFC
FT                   LTFGALTLIGHIRTLRAVGIRLISGERRWQIFLYPIRSDVCYCCLGLLLGLSLAAIMSQ
FT                   LMSFSPLVLYLIGIGLVCYNLLLIAIALFFAGLFVIGIKRVHLMQVIKGQIPVRGIISL
FT                   ILIAQLLAVLVVSFGASRTLLYVQAERQQKQGQAAWLQEDRLVTLLIGRDGLDIGNTKE
FT                   AIAKQKTWFHVMDQAVSEHGAILSRHYLVERDLQSGLSMLTASSSWNDYSPQGNVLLVT
FT                   PQYVKHQKVEVAPDISEKINQLSLGEFVLLLPEHLKTQAAQYQSVFESAVTGLASGEGH
FT                   QPMTATVSYTKTGQERFLYNTTPISYQQFLRDPIIVVLTPKSTGEQAYAFWEVALQNYF
FT                   LFDQLADTQTLIKQNGIENWVGELKTGYRIYETLLNNLRREIWLMIAGAILGIATSMLM
FT                   FNTMNLLYFEEFRRDIFIKRVSGLRFFELHRRYLLSQLLVFFVGLVISALLTQNPLMCL
FT                   LVFFLFLGNAILLLYRQMRIENKMSLLILKGA"
FT   sig_peptide     116250..116372
FT                   /locus_tag="SEQ_0105"
FT                   /note="Signal peptide predicted for SEQ0105 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.921) with cleavage site
FT                   probability 0.215 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(116262..116321,116706..116774,116856..116924,
FT                   116934..117029,117066..117134,117936..118004,
FT                   118062..118130,118140..118199)
FT                   /locus_tag="SEQ_0105"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SEQ0105 by TMHMM2.0 at aa 5-24, 153-175, 203-225, 229-260,
FT                   273-295, 563-585, 605-627 and 631-650"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    117948..118247
FT                   /locus_tag="SEQ_0105"
FT                   /note="HMMPfam hit to PF07242, Protein of unknown function
FT                   (DUF1430), score 4.1e-37"
FT                   /inference="protein motif:PFAM:PF07242"
FT   CDS_pept        118255..118902
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0106"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92053"
FT                   /db_xref="GOA:C0M922"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M922"
FT                   /protein_id="CAW92053.1"
FT                   /translation="MIRLEKVSKCFGDRVLFSDLSMTFESGKVYALIGSSGSGKTTLMN
FT                   MLAALEDYQGEIFFRGKNLKTYRSSDFFRHELGYLFQHFGLLESQTIADNLKLGLIGQK
FT                   ISKEEGRQRELEALRAVGLDYLSLEKPVFELSGGEYQRVALAKVMLKDPPFILADEPTA
FT                   SIDPEASKAIMAILLSLRHKNRTIIIATHSPSIWEMADEVISVDQLSSLTRL"
FT   misc_feature    118333..118881
FT                   /locus_tag="SEQ_0106"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   8.7e-53"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    118354..118377
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    118699..118719
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        119084..120022
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0107"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92054"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9H5"
FT                   /protein_id="CAW92054.1"
FT                   /translation="MIQELAKRLIRQAEELQAQDIYILPRGTGYELLMRVGDDRRLIDV
FT                   CESDRMANLISHFKFVAGMNVGEKRRCQLGACDYDLDDTKVSLRLSAVGDYQGQESLVI
FT                   RLLYHHQRQLRYWFDGLERVTSAIGARGLYLFSGPVGSGKTTLMYQLVSDYCKELQVIS
FT                   IEDPVEIKNDQLLQLQVNDSIGMTYDNLIKLSLRHRPDVLIIGEIRDTQTARAVIRASL
FT                   TGAMVFSTVHAKSISGVYARLLELGISRAELDNSLAMVAYQRFISGGALIDCAQKEFEH
FT                   HQANRWNQQIDQLLAEGHLNTRQARLEKIIQ"
FT   misc_feature    119084..119890
FT                   /locus_tag="SEQ_0107"
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 4e-30"
FT                   /inference="protein motif:PFAM:PF00437"
FT   misc_feature    119495..119518
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    119669..119713
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS_pept        119955..120989
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0108"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92056"
FT                   /db_xref="GOA:C0M9Z3"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z3"
FT                   /protein_id="CAW92056.1"
FT                   /translation="MISFLRRDISIPGRQGLKKLSSKQQEKLIQLLYNLLSNGFNLTEV
FT                   IAFLRKSQLLLPVYVTSMEASLLKGNGLADMLAALGYSDAVMTQINLADKHGNIKLTLE
FT                   KIQDYLSQFRQIKRKTIEAVTYPIILLGFLVVIMLGLRHYLIPQLESQNTLTDLLLHLP
FT                   HYFLGFCLLVLLLIGSFYLYAKSCSRLKLFSQLSYYPIIGSLLRQYLTAYYAREWGNLI
FT                   GQGLELITILEMMSNEKSQLMRELAKDIKQSLLAGQSFHQRVAAYPFFKKELSLMIEYG
FT                   DIKSKLGQELDIYSQESWETFFSQLNRATQWIQPIIFLVVAVVIVMIYAAILLPIYQQM
FT                   GDVF"
FT   misc_feature    120036..120395
FT                   /locus_tag="SEQ_0108"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 5.1e-16"
FT                   /inference="protein motif:PFAM:PF00482"
FT   misc_feature    join(120324..120392,120435..120503,120897..120965)
FT                   /locus_tag="SEQ_0108"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0108 by TMHMM2.0 at aa 124-146, 161-183 and 315-337"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    120594..120959
FT                   /locus_tag="SEQ_0108"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 9.4e-20"
FT                   /inference="protein motif:PFAM:PF00482"
FT   CDS_pept        120990..121313
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0109"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92058"
FT                   /db_xref="GOA:C0MAG6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAG6"
FT                   /protein_id="CAW92058.1"
FT                   /translation="MKMRLSILKDQGVQAFTLLEMLLVLLIISVLMLLFVPNLSKQKDK
FT                   VTDTGNAAVVKLVENQAELYELSHGEKPSLKQLQEDGSISDKQQKAYQDYYAKHKDEAK
FT                   KLN"
FT   sig_peptide     120990..121115
FT                   /locus_tag="SEQ_0109"
FT                   /note="Signal peptide predicted for SEQ0109 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.534 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121029..121100
FT                   /locus_tag="SEQ_0109"
FT                   /note="HMMPfam hit to PF07963, Prokaryotic N-terminal
FT                   methylation motif, score 6.8e-06"
FT                   /inference="protein motif:PFAM:PF07963"
FT   misc_feature    121032..121100
FT                   /locus_tag="SEQ_0109"
FT                   /note="1 probable transmembrane helix predicted for SEQ0109
FT                   by TMHMM2.0 at aa 15-37"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        121291..121716
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0110"
FT                   /product="putative competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92060"
FT                   /db_xref="GOA:C0MAT9"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAT9"
FT                   /protein_id="CAW92060.1"
FT                   /translation="MKLRSSIKAFTLLEGLLTLFLISFMLLYLSLPVSDSYARVEEHLF
FT                   FMRFEQAYRHLQKLSILRQKEHVLVLKPHYIKAEEAILPLPKQVKLKSTQTLTIDKLGG
FT                   NHSLARVVFENRDRQITYQFYLGSGNYQKTSQSLHRS"
FT   sig_peptide     121291..121404
FT                   /locus_tag="SEQ_0110"
FT                   /note="Signal peptide predicted for SEQ0110 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.974 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121309..121377
FT                   /locus_tag="SEQ_0110"
FT                   /note="1 probable transmembrane helix predicted for SEQ0110
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        121673..121963
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0111"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92062"
FT                   /db_xref="GOA:C0MAU0"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU0"
FT                   /protein_id="CAW92062.1"
FT                   /translation="MVIIKKQVKAYIALEGLIATGLILVIVTLILSALRYSQQELSACR
FT                   QKQELLNTAVMAMQTKQRALSLNGCHIKLLSHQKGIAIVEKDQTIIRIERQ"
FT   misc_feature    121706..121774
FT                   /locus_tag="SEQ_0111"
FT                   /note="1 probable transmembrane helix predicted for SEQ0111
FT                   by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        121950..122384
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0112"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92063"
FT                   /db_xref="GOA:C0MB69"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB69"
FT                   /protein_id="CAW92063.1"
FT                   /translation="MKDSRLKAFTLIECLIALLVISGSLLVYQALTKSLMANERYLAAN
FT                   DQNNWLLFSQQLRAELSGTTLQGVRNNRLYVEKDKKALSFGQVKGHDFRKAASNGQGYQ
FT                   PMLFGLSSSQITAVGQQVTIKLKWQSGLERTFIYAFQEKG"
FT   sig_peptide     121950..122060
FT                   /locus_tag="SEQ_0112"
FT                   /note="Signal peptide predicted for SEQ0112 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.786) with cleavage site
FT                   probability 0.473 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121974..122042
FT                   /locus_tag="SEQ_0112"
FT                   /note="1 probable transmembrane helix predicted for SEQ0112
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    122268..122315
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        122362..122724
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0113"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92065"
FT                   /db_xref="GOA:C0MBI4"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI4"
FT                   /protein_id="CAW92065.1"
FT                   /translation="MHFKRRVKAGVLLYALLMASVFLLLLQAYLSHISQLHQEYQAQMD
FT                   YAKAQLIAEMVYQEQPSGDGQIAFNCGQVSYKSHKQRFIIEIKLPHQQLYQFSYPEVQQ
FT                   ASQTSKKQSELKQSLP"
FT   sig_peptide     122362..122451
FT                   /locus_tag="SEQ_0113"
FT                   /note="Signal peptide predicted for SEQ0113 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.386 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    122386..122454
FT                   /locus_tag="SEQ_0113"
FT                   /note="1 probable transmembrane helix predicted for SEQ0113
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM 2.0"
FT   repeat_region   122736..124164
FT                   /note="ISSeq3"
FT   repeat_region   122744..122755
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        122790..123305
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0114"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92067"
FT                   /db_xref="GOA:C0M663"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M663"
FT                   /protein_id="CAW92067.1"
FT                   /translation="MTLSYEDKVQIYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    122844..122909
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    122952..123233
FT                   /locus_tag="SEQ_0114"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    123111..123149
FT                   /locus_tag="SEQ_0114"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   CDS_pept        join(123329..123856,123860..124132)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0115"
FT                   /note="putative transposase (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92069.1"
FT   repeat_region   complement(124145..124156)
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        124217..125170
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92070"
FT                   /db_xref="GOA:C0M6G9"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6G9"
FT                   /protein_id="CAW92070.1"
FT                   /translation="MNFEKIEQAYELILENSQLIENDLKTHIYDAIVEQNSFYLGAQGA
FT                   SPQVAKNIETLKALQLTKEEWRQAYQFVLIKAGKTEPLQANHQFTPDAIGFIMLYILET
FT                   LSSQESLDVLEIGSGTGNLAQTILNHSHKSIDYLGIELDDLLIDLSASIAEIMGSSAQF
FT                   IQEDAIRPQLLKESDLIISDLPVGFYPNDDIASRYQVASSDEHTYAHHLLMEQALKYLK
FT                   KDGFAIFLAPVNLLSSPQSHLLKQWLKGYAQVVALITLPEAVFGNPANAKSIIVLCKQS
FT                   NRFAETFVYPIRDLKSVDNVRDFMENFKNWKRDNVI"
FT   CDS_pept        125230..126429
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0118"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92072"
FT                   /db_xref="GOA:C0M6X6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6X6"
FT                   /protein_id="CAW92072.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEKVLAQGIIERIGLTDSISTVK
FT                   YDGKKEEHILDIPDHTEAVKRLLNDLIHFGIIGTYDEITGVGHRIVAGGEYFKESVVVD
FT                   DKVVEQVEELAALAPLHNPGAAAGIRAFRKILPDITSVCVFDTSFHTTMQKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAEEAAKMLGRPLDELKLITAHVGNGVSITANYHGQSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIAQDPELKDAADVVNMLNKQSGLGGVSGIS
FT                   SDMRDIEAGLQANNPDAVLAYNIFIDRIKKFIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVVNGLSWFGMEIDPEKNVFGYRGDISTAASKVKVLVISTDEELCIARDVERLKQTIS
FT                   "
FT   misc_feature    125236..126396
FT                   /locus_tag="SEQ_0118"
FT                   /note="HMMPfam hit to PF00871, Acetokinase family, score
FT                   4.1e-196"
FT                   /inference="protein motif:PFAM:PF00871"
FT   misc_feature    125833..125886
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01076"
FT   repeat_region   126643..128079
FT                   /note="ISSeq5"
FT   repeat_region   126650..126662
FT                   /note="imperfect inverted repeat flanking IS element"
FT   CDS_pept        126696..127184
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0119"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92074"
FT                   /db_xref="GOA:C0M6X7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6X7"
FT                   /protein_id="CAW92074.1"
FT                   /translation="MKLSYDDKLRIYELRKNGMSCSRIGQQYDIQVSNLKYMVKLMDRY
FT                   GVEIVRKGKNKYYPPELKQEIIDKVLLEGQSQLSVSLEYALPNAGMLPNWIAQYKKNGY
FT                   TILEKQRGRPTKMGRKPKKTWEEMTELERLQEELEYLRTENAYLKKLRELRLQDEARE"
FT   misc_feature    126858..127139
FT                   /locus_tag="SEQ_0119"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00051"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        127208..128047
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0120"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92076"
FT                   /db_xref="GOA:C0M7C9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7C9"
FT                   /protein_id="CAW92076.1"
FT                   /translation="MVQEGFRLNLLLEIAKMARSTYYYQVKQLDKSDKDEAINSEIKAI
FT                   YEEHKGNYGYRRIHLELKNRGFIVNHKKVQRLMKEMRLAARIRRKRRYSSYKGETGKKA
FT                   DNLIQRQFEAAKPYEKCYTDVTEFALPNNDEKLYLAPVLDGYNSEIIDFTLSRSPDLKQ
FT                   VQTMLEKAFPADSYNGTILHSDQGWQYQHQSYHHFLESKGIRPSMSRKGNSPDNGMMES
FT                   FFGILKSEMFYGLETTYQSLNELEQAITDYIFYYNNKRIKAKLKGLSPVQYRTKSFH"
FT   misc_feature    127544..128032
FT                   /locus_tag="SEQ_0120"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   7.5e-38"
FT                   /inference="protein motif:PFAM:PF00665"
FT   repeat_region   complement(128060..128071)
FT                   /note="imperfect inverted repeat flanking IS element"
FT   CDS_pept        complement(128235..128825)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0121"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92078"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7R6"
FT                   /protein_id="CAW92078.1"
FT                   /translation="MKKVKQLIIAMIASLLLIANTVPSIVYASEVTKIQQEEKVIEEKL
FT                   SQPLEISKSELDTLIQEKKALYPNLTEQEMREIAYKAMSPYTFRASVWDGQGVTLDEFA
FT                   WAFDVIVGGLISGYATIGKYVAKHGVAAARAVLSRAAKAAAQRLGVLTGFISGLLRAAF
FT                   SVINIYYNVGYALAQYVDARDYHPNNGRINAWA"
FT   misc_feature    complement(join(128319..128387,128448..128516,
FT                   128739..128807))
FT                   /locus_tag="SEQ_0121"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0121 by TMHMM2.0 at aa 7-29, 104-126 and 147-169"
FT                   /inference="protein motif:TMHMM 2.0"
FT   sig_peptide     complement(128742..128825)
FT                   /locus_tag="SEQ_0121"
FT                   /note="Signal peptide predicted for SEQ0121 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        129348..131390
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0122"
FT                   /product="putative PTS multi-domain regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92079"
FT                   /db_xref="GOA:C0M7R7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7R7"
FT                   /protein_id="CAW92079.1"
FT                   /translation="MVDSKAVVILMTLMTYQDLSLYELSVKTKFTIREIKDRIDELNEF
FT                   LAQHELSELDATRSGYRISQQLKAESDHLFTLINAEQVYLSQAERINLIYLYTFCRRDF
FT                   VSNSHYQDFLKVSKNTALTDIKALRQKLADVDLELKYTRASGYILVGDEINKHRLALVM
FT                   IATLLKSPIGLWALDYILASWHYQVSFEALEKRVSHFYQTFQMSPILDRLQVCLYAVIF
FT                   ILCRYQRRVDRVKQRQVVVSEQLDQLTALLVAEIMQQLSLKYQLFEADEAYFQLLLAGC
FT                   FEGEGTVGDDFFESLTVAIVDQMQGVALLSFSQADQLKENLKRHLIPAYYRLRYGLPSD
FT                   NDYTLRIKDSYSELFDLVKQSLEPLAKELGSPIPDSEIAYFVLHFGGYLKQQGRDFHRQ
FT                   AYQAVIVCPNGVSSSLMIKEHLKLLFPDIAFRGLSRLDQLGQLDKSGYDLVFSTIRLET
FT                   DKPFYLVPMIMTDEQAFQLVSLVNRDFPDIGYRLEVEELLHLISSYAVIHQKEKLRFAL
FT                   QQYLRQGVKRKDIRPVLQDLITKKTYQSTSEQLGWREAIYLAAQPLLESGQIQASYPEA
FT                   MIAKVEEFGTFINLGKGIAIPHARPEDGVNQVGMSMLVLEHPIYLLDDPKQEIRLLICI
FT                   AAIDNETHLKALSRLTTILRDNEQVKALLASKSFEDIKTIIAEEA"
FT   misc_feature    130239..130511
FT                   /locus_tag="SEQ_0122"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 1.2e-14"
FT                   /inference="protein motif:PFAM:PF00874"
FT   misc_feature    130953..131384
FT                   /locus_tag="SEQ_0122"
FT                   /note="HMMPfam hit to PF00359,
FT                   Phosphoenolpyruvate-dependent sugar phosph, score 9.8e-27"
FT                   /inference="protein motif:PFAM:PF00359"
FT   misc_feature    131094..131144
FT                   /note="PS00372 PTS EIIA domains phosphorylation site
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00372"
FT   CDS_pept        131392..131679
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0123"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92081"
FT                   /db_xref="GOA:C0M836"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C0M836"
FT                   /protein_id="CAW92081.1"
FT                   /translation="MALRIGTACGSGLGSSFMVQMNIESVLKDLGVTGVEVEHYDLGGA
FT                   DPTAADVWIVGRDLADSAEHLGDVRILNSIIDMDELTSLVKAICQEKGLV"
FT   misc_feature    131401..131661
FT                   /locus_tag="SEQ_0123"
FT                   /note="HMMPfam hit to PF02302, PTS system,
FT                   Lactose/Cellobiose specific IIB, score 1.4e-26"
FT                   /inference="protein motif:PFAM:PF02302"
FT   CDS_pept        131692..133035
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0124"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92083"
FT                   /db_xref="GOA:C0M8D8"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8D8"
FT                   /protein_id="CAW92083.1"
FT                   /translation="MTFLLDIVSTPAILVALIAIVGLLLQKKPAPDIVKGGIKTFVGFL
FT                   VVSGGAGIVQGSLNPFGTMFEHAFHLSGVVPNNEAIVAVALTTYGSATALIMFTGMIFN
FT                   ILIARFTRFKYIFLTGHHTLYMACMIAVIMSVAGLTSVSLIVFGGLALGIIMSVSPALV
FT                   QRYMIQLTGNDKVALGHFSSLGYWLSGFVGGLVGDKTKSTEDIDFPKSLAFLRDSTVSI
FT                   TLSMAIIYLIVAIFAGPTWISKELSSGTHGLVFALQLAGQFAAGVFVILAGVRLILGEI
FT                   VPAFKGISEKLVPHSKPALDCPIAYPYAPNAVLIGFVSSFVGGLVSMAVMIVSGTTVIL
FT                   PGVVPHFFCGATAGVIGNASGGVRGATVGAFLQGVLISYLPIFLMPVLGGLGFEGSTFS
FT                   DADFGLSGILLGTLNSIGGVTAIVIGIFVILAGLVGLSVVGKSVAKEE"
FT   misc_feature    131692..132909
FT                   /locus_tag="SEQ_0124"
FT                   /note="HMMPfam hit to PF04215, Putative sugar-specific
FT                   permease, SgaT/UlaA, score 2.6e-113"
FT                   /inference="protein motif:PFAM:PF04215"
FT   sig_peptide     131692..131772
FT                   /locus_tag="SEQ_0124"
FT                   /note="Signal peptide predicted for SEQ0124 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.651) with cleavage site
FT                   probability 0.481 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(131701..131769,131788..131856,131947..132015,
FT                   132034..132102,132112..132180,132349..132417,
FT                   132460..132528,132622..132690,132700..132768,
FT                   132802..132870,132937..133005)
FT                   /locus_tag="SEQ_0124"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SEQ0124 by TMHMM2.0 at aa 4-26, 33-55, 86-108, 115-137,
FT                   141-163, 220-242, 257-279, 311-333, 337-359, 371-393 and
FT                   416-438"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    132241..132291
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:Prosite:PS00453"
FT   misc_feature    132994..133017
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        133038..133895
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0125"
FT                   /product="putative transketolase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92085"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C0M923"
FT                   /protein_id="CAW92085.1"
FT                   /translation="MVLSDEPLTDVKRFAAEIRLNTLETLNHLGFGHYGGSLSIVELLA
FT                   VLYGEIMPMTPELFVQSDRDYLVLSKGHAGPALYSTLYLKGFFDKAFLQSLNTNGTSLP
FT                   SHPDRLLTPGIDMTTGSLGQGISVATGIAYAQALEQSPHYTYAIVGDGELNEGQCWEAI
FT                   QLAAHQQLSHFIVFVDDNKKQLDGTTEAICRPGDFVEKFTAFGFESLRVDGRDVQAIFE
FT                   AIRALQASSSHKPKCIVLDTVKGQGVSQLESMAANHHLRPTAAEKEMLAAAVRKLRASL
FT                   EVTR"
FT   misc_feature    133065..133883
FT                   /locus_tag="SEQ_0125"
FT                   /note="HMMPfam hit to PF00456, Transketolase, thiamine
FT                   diphosphate b, score 1.2e-19"
FT                   /inference="protein motif:PFAM:PF00456"
FT   CDS_pept        133892..134824
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0126"
FT                   /product="putative transketolase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92086"
FT                   /db_xref="GOA:C0M924"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C0M924"
FT                   /protein_id="CAW92086.1"
FT                   /translation="MTRASQEMRHVYRDFLIAANQEHPEVVVLEADLSSSMATNHLDQV
FT                   FGKRYINVGIMEAEMVGLAAGLAIKGYKPYLHTFGPFASRRVFDQLFLSLAYAQLGATV
FT                   IGSDAGVSAEMNGGTHMPFEDLGLLRLIPRAIVYEVSDDVQFKAVLKETLSLDGLKYIR
FT                   TIRKKPEAIYQGHEDFSNGYCLLRQGKDLVLACSGIMVKRCLEVADKMAEQGYSIGVID
FT                   VFRVKPLADELKGLLTGSPVLTVENHNRIGGLGSAICELLAQESNTPVYRMGVDERFGQ
FT                   VGQMDYLLEEYQLTPAAIEQQVLRILAAD"
FT   misc_feature    133907..134407
FT                   /locus_tag="SEQ_0126"
FT                   /note="HMMPfam hit to PF02779, Transketolase, pyridine
FT                   binding domai, score 1.4e-15"
FT                   /inference="protein motif:PFAM:PF02779"
FT   misc_feature    134435..134788
FT                   /locus_tag="SEQ_0126"
FT                   /note="HMMPfam hit to PF02780, Transketolase, C-terminal
FT                   domain, score 2e-16"
FT                   /inference="protein motif:PFAM:PF02780"
FT   CDS_pept        135376..137271
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0128"
FT                   /product="putative endopeptidase O"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92089"
FT                   /db_xref="GOA:C0M9H6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9H6"
FT                   /protein_id="CAW92089.1"
FT                   /translation="MTTYQEDFYQAVNGQWAETAVIPDDKPRTGGFSDLADEIEDLMLT
FT                   TTDAWLAGEHVPNDAILENFVKFHRLVADYDKRDQVGVAPALDLIEEYKALGSFAEFAS
FT                   KVADYELNGKPNQFPFSVAPDFMNAQLNVLWAEAPGLILPDTTYYAKDNDKGKELLAIW
FT                   RGMQEELLPKFGFSHEEVKDLLDKVITLDKQLADYVLSREEYSEYAKLYHPYDWAEFTK
FT                   LVPELPLDNIFTVILGEVPDKVVVPEERFWTEFAADYYSEKNWELLKAWLVLTAAGAYH
FT                   AYLTDEIRVLSGVYSRALSGTPQAMDKKKAAYYLAQGPFNQALGLWYAGEKFSPEAKAD
FT                   VEHKVAKMIEVYKSRLETADWLAPATREKAITKLNVITPHIGYPEKLPETYAKKVIDDK
FT                   LSLVENAQNLAKISIAHSWSKWNKPVDRSEWHMPANMVNAYYDPQQNQIVFPAAILQAP
FT                   FYSLSQSSSANYGGIGAVIAHEISHAFDTNGASFDEHGSLKNWWTDEDYAAFKERTDKI
FT                   VEQFDGLDSYGAKVNGKLTVSENVADLGGVACALEAAQSEPDFSARDFFINFATIWRMK
FT                   AREEFMQMMASIDVHAPGQWRTNVTLTNFDEFHQEFNIKEGDPMWRAPEDRVIIW"
FT   misc_feature    135382..136527
FT                   /locus_tag="SEQ_0128"
FT                   /note="HMMPfam hit to PF05649, Peptidase family M13, score
FT                   1.2e-171"
FT                   /inference="protein motif:PFAM:PF05649"
FT   misc_feature    136687..137259
FT                   /locus_tag="SEQ_0128"
FT                   /note="HMMPfam hit to PF01431, Peptidase family M13, score
FT                   2.5e-73"
FT                   /inference="protein motif:PFAM:PF01431"
FT   misc_feature    136801..136830
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS_pept        complement(137471..138511)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0129"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92090"
FT                   /db_xref="GOA:C0M9Z4"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9Z4"
FT                   /protein_id="CAW92090.1"
FT                   /translation="MAEITAKLVKELREKSGAGVMDAKKALVETDGDMEKAIELLREKG
FT                   MAKAAKKADRVAAEGLTGVYVNGNVAAVVEVNAETDFVAKNAQFVELVNATAKAIAEGK
FT                   PANNDEALALIMPSGETLADAYVNATATIGEKISFRRFALVEKTDDQHFGAYQHNGGRI
FT                   GVITVVEGGDEALAKQVSMHVAAMKPTVLSYTELDPQFIKDELAQLNHAIELDNESRAM
FT                   VNKPALPFLKYGSKAQLSADVIAQAEEDIKAELAAEGKPEKIWDKIIPGKMDRFMLDNT
FT                   KVDQAYTLLAQVYIMDDSKTVEAYLDSVNAKAISFARFEVGEGIEKKANDFESEVAATM
FT                   AAALNN"
FT   misc_feature    complement(137543..138343)
FT                   /locus_tag="SEQ_0129"
FT                   /note="HMMPfam hit to PF00889, Elongation factor TS, score
FT                   2.7e-54"
FT                   /inference="protein motif:PFAM:PF00889"
FT   misc_feature    complement(138380..138502)
FT                   /locus_tag="SEQ_0129"
FT                   /note="HMMPfam hit to PF00627, UBA/TS-N domain, score
FT                   5.5e-12"
FT                   /inference="protein motif:PFAM:PF00627"
FT   CDS_pept        complement(138679..139449)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0130"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92092"
FT                   /db_xref="GOA:C0MAG7"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAG7"
FT                   /protein_id="CAW92092.1"
FT                   /translation="MAVISMKQLLEAGVHFGHQTRRWNPKMAKYIFTERNGIHVIDLQQ
FT                   TVKLADQAYEFVRDAAANDAVILFVGTKKQAAEAVADEATRAGQYFINHRWLGGTLTNW
FT                   GTIQKRIARLKEIKRMEEEGTFEVLPKKEVALLNKQRARLEKFLGGIEDMPRIPDVMYV
FT                   VDPHKEQIAVKEAKKLGIPVVAMVDTNADPDDIDVIIPANDDAIRAVKLITAKLADAVI
FT                   EGRQGEDAEVAFEADTQAESIEEIVEVVEGSNEA"
FT   misc_feature    complement(138775..139425)
FT                   /locus_tag="SEQ_0130"
FT                   /note="HMMPfam hit to PF00318, Ribosomal protein S2, score
FT                   1.5e-100"
FT                   /inference="protein motif:PFAM:PF00318"
FT   misc_feature    complement(139399..139434)
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT                   /inference="protein motif:Prosite:PS00962"
FT   CDS_pept        complement(139910..141442)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0131"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92094"
FT                   /db_xref="GOA:C0MB70"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB70"
FT                   /protein_id="CAW92094.1"
FT                   /translation="MALSPDIKEQLAQYLNLLESDLVLQAYLGSDDSSQKVKDFIEEIA
FT                   AMSDRITVEETTLTRQPSFKITQKGQDSGVIFAGLPLGHEFASFILALLQVSGRAPKIE
FT                   QDIIDRIRAIDRPLSFETYVSLTCHNCPDVVQALNIMAVLNKNISHTMVEGGMFQEEVK
FT                   AKGIMSVPTVFLNGEEFTSGRATIEQLLEQIAGPLSKEAFADKGVYDVLVIGGGPAGNS
FT                   AAIYAARKGLNTGLLAETFGGQVMETVGIENMIGTLYTEGPKLMAQVEEHTKSYDVDII
FT                   KAQLATSIEKKDLVEVTLANGAVLKAKTAILALGAKWRSINVPGENEFKNKGVTYCPHC
FT                   DGPLFEDKNVAVIGGGNSGLEAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTDNMT
FT                   ILKNVATKDIVGDDHVTGLNYIERDSNQEKHLDLEGVFVQIGLVPNTAWLKDSGISLTD
FT                   RGEIIVDKYGSTNIPGIFAAGDCTDSAYKQIIISMGSGATAAIGAFDYLIRQ"
FT   misc_feature    complement(139985..140815)
FT                   /locus_tag="SEQ_0131"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 5.9e-51"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    complement(140120..140398)
FT                   /locus_tag="SEQ_0131"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 1.7e-17"
FT                   /inference="protein motif:PFAM:PF00070"
FT   misc_feature    complement(140372..140434)
FT                   /note="PS00573 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-II active site."
FT                   /inference="protein motif:Prosite:PS00573"
FT   misc_feature    complement(140498..140815)
FT                   /locus_tag="SEQ_0131"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreduc, score 0.0026"
FT                   /inference="protein motif:PFAM:PF00070"
FT   CDS_pept        complement(141463..142023)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0132"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92096"
FT                   /db_xref="GOA:C0MB71"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB71"
FT                   /protein_id="CAW92096.1"
FT                   /translation="MSLVGKEIAEFSAQAFHNGKFITVTNEDLKGKWAVVCFYPADFSF
FT                   VCPTELGDLQEQYEILKSLGVEVYSVSTDTHFVHKAWHDDSDVVGTITYPMIGDPSHAI
FT                   SQAFDVLGEDGLAQRGTFIIDPDGVIQMMEINADGIGRDASSLIDKIRAAQYVRKHPGE
FT                   VCPAKWKEGAETLTPSLDLVGKI"
FT   misc_feature    complement(141490..142014)
FT                   /locus_tag="SEQ_0132"
FT                   /note="HMMPfam hit to PF00578, AhpC/TSA family, score
FT                   7.7e-90"
FT                   /inference="protein motif:PFAM:PF00578"
FT   misc_feature    complement(141562..142017)
FT                   /locus_tag="SEQ_0132"
FT                   /note="HMMPfam hit to PF08534, Redoxin, score 6e-14"
FT                   /inference="protein motif:PFAM:PF08534"
FT   tRNA            142371..142441
FT                   /gene="tRNA-Cys"
FT                   /locus_tag="SEQ__t32"
FT                   /product="transfer RNA-Cys"
FT                   /note="tRNA Cys anticodon GCA, Cove score 60.11"
FT   repeat_region   142425..142442
FT                   /note="18mer direct repeat flanking prophage"
FT   misc_feature    142443..182238
FT                   /note="prophage phiSeq1"
FT   repeat_region   142543..142563
FT                   /note="21mer direct repeat flanking prophage"
FT   CDS_pept        complement(142548..143615)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0133"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92097"
FT                   /db_xref="GOA:C0MBI5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI5"
FT                   /protein_id="CAW92097.1"
FT                   /translation="MAKFRKRGDKWSYRIYYTDSQGNKREKSKGGFKTKALASAAAIKV
FT                   EAELNKDIDDISLYDFCKDWAEIYKRPHVVDKTWETYTKNLKHIKKYFGDIKLNKVTHT
FT                   LYQKKMNVFASKYAQETLEKFHYQIKGAVKVAVRDGLIKTNFAEGAIVKSQKEARAKEF
FT                   DFLEEDEYLNLIKVTSEKYQYISYFTLYIIAVTGLRFAEATGITWSDIDFEKGFIDINK
FT                   SFDYSKTQEFKETKNEQSKRQIPIDQQTIKLLRAFKENYYKENKLNRVLYGASNSLCNR
FT                   LVKKIVGRPVRNHSLRHTYASFLILKGVDLISISQLLGHENLNITLKVYAHQLDKLKEK
FT                   NNQAIKDIFGNLTDF"
FT   misc_feature    complement(142596..143096)
FT                   /locus_tag="SEQ_0133"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,
FT                   score 4.5e-19"
FT                   /inference="protein motif:PFAM:PF00589"
FT   CDS_pept        complement(143883..144569)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0134"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92099"
FT                   /db_xref="GOA:C0MBW8"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBW8"
FT                   /protein_id="CAW92099.1"
FT                   /translation="MGKIDKAARKFKFVSNSKISKFRFLPDWVLSEATYFEKEVIEPSQ
FT                   NHKIYKRGALVFVDFGVNVGSELSGHHFAIVLNKKDSFKNGVLTVIPVSSKGNKFSVKL
FT                   DGFISQKSKEYLDKTLAQKQEGFYRYRAERIKKHNGKSKTHDELMQYEKQKWVYFKIAE
FT                   EIKEVAKAYEKYNKVSYAKCLDIRTISKNRIMEINRFDPIGKIRVSDDTLTKIDKMIIN
FT                   NFIHTI"
FT   CDS_pept        complement(144580..145326)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0135"
FT                   /product="phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92101"
FT                   /db_xref="GOA:C0MBW9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBW9"
FT                   /protein_id="CAW92101.1"
FT                   /translation="MDIGAKLKQRRLEVNVSVEELAKKLGVSKTTIYRYEKGEILKVPT
FT                   EVLEKISKILNTNPAYFMGWSDTPTPVQTQTLQEIIVTSKQLEQPRQEKVLSFANEQLE
FT                   EQNKVVSIFDKKSEETEDYITDYVEGLVAAGLGAYQEDNLHMEVKLRADDVPDEYDTIA
FT                   KVAGDSMEPLIQDNDLLFIKVSSQVNMNDIGIFQVNGKNFVKKLKRDYDGAWYLQSLNN
FT                   SYEEIYLSEDDSIRTIGEVVDIYREG"
FT   misc_feature    complement(144631..144837)
FT                   /locus_tag="SEQ_0135"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24-like, score
FT                   4.8e-17"
FT                   /inference="protein motif:PFAM:PF00717"
FT   misc_feature    complement(145141..145308)
FT                   /locus_tag="SEQ_0135"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.7e-15"
FT                   /inference="protein motif:PFAM:PF01381"
FT   misc_feature    complement(145216..145281)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2380.000, SD 7.29 at aa 16-37, sequence
FT                   VSVEELAKKLGVSKTTIYRYEK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        145490..145705
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0136"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92103"
FT                   /db_xref="GOA:C0M664"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0M664"
FT                   /protein_id="CAW92103.1"
FT                   /translation="MVNVQKLKGVIVEKGTTQQAVADSIGIDRSTFYRKMKSGGAFTLD
FT                   EAGNIARAISLTKEEAIEIFFSNVVA"
FT   misc_feature    145535..145600
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1591.000, SD 4.61 at aa 16-37, sequence
FT                   TTQQAVADSIGIDRSTFYRKMK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        145740..145889
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0137"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92104"
FT                   /db_xref="UniProtKB/TrEMBL:C0M665"
FT                   /protein_id="CAW92104.1"
FT                   /translation="MPEDLIKQLEAGSEFLAKTCLHSKIIITVDGIRLVETKEFHPVSG
FT                   TLLD"
FT   CDS_pept        complement(145886..146086)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0138"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92106"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H0"
FT                   /protein_id="CAW92106.1"
FT                   /translation="MQRQYVSSSNVRSVGWENNTLEVEFNNGSIYHYHNVSQTEYRSVL
FT                   VGSVGSNIHRLAKIHTYTRIV"
FT   CDS_pept        146197..146481
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0139"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92108"
FT                   /db_xref="GOA:C0M6X8"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6X8"
FT                   /protein_id="CAW92108.1"
FT                   /translation="MDSRLLQMLDEFEAGLIDRKIKVIGMLNNETEIYPLELNKKQISK
FT                   MLGVDPKTFDVRFNSHKDFPRIETGGREKYPRDLVIEWYSKNWERTGIR"
FT   misc_feature    146308..146373
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1182.000, SD 3.21 at aa 38-59, sequence
FT                   LNKKQISKMLGVDPKTFDVRFN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        146478..146624
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0140"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92110"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7R8"
FT                   /protein_id="CAW92110.1"
FT                   /translation="MIKKLFNFIFAKPKEESRQPYQQPRGFLDFETGRRIEIDPKTQKE
FT                   YFV"
FT   CDS_pept        146621..146734
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0141"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92112"
FT                   /db_xref="UniProtKB/TrEMBL:C0M837"
FT                   /protein_id="CAW92112.1"
FT                   /translation="MMHQIKLSLRNFVETGEIDNIFDIFRILDFYFREVVS"
FT   CDS_pept        146828..147073
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0142"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92114"
FT                   /db_xref="GOA:C0M838"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0M838"
FT                   /protein_id="CAW92114.1"
FT                   /translation="MLLTILSNSDEWRVYPEELAKRCRDSVDAVRTQLKALEKAGYIRS
FT                   YRKSLGGRYGTETHRFCSDTKISDEVFQELLKELNC"
FT   CDS_pept        147250..147633
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0143"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92116"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:C0M839"
FT                   /protein_id="CAW92116.1"
FT                   /translation="MDEKKLFENFQLTFGRMISPFEIEDIQKWIHQDNMPIDVVNLALR
FT                   EAVENNKINWKYINKILVEWHKAGDTTIEKVKERLQRFEDSKEQRHATISNVPSWSNPD
FT                   YQGPTYDDLKVNPSEVSDGAGDF"
FT   CDS_pept        147614..147847
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0144"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92118"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8D9"
FT                   /protein_id="CAW92118.1"
FT                   /translation="MAQEIFDGFNALINKMYGRQSSIETFNRFVEYCQKRREENGVEPV
FT                   LNPINLFAFGVGITTEEANKLRIKRYKQENGL"
FT   CDS_pept        147844..147984
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0145"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92119"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E0"
FT                   /protein_id="CAW92119.1"
FT                   /translation="MTKQYRETLIWHRASHQEREKLLDFGLVDKSQYMMLLRQLRKKYA
FT                   I"
FT   CDS_pept        147993..148199
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0146"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92121"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8M6"
FT                   /protein_id="CAW92121.1"
FT                   /translation="MTPEEAEKAKSRAKQEIEVFSIYLEQAIDTFGSMLSPQEVFLAAG
FT                   ITYLGAGQTDIHAAVEGLYEQIQ"
FT   CDS_pept        148183..148359
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0147"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92123"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8M7"
FT                   /protein_id="CAW92123.1"
FT                   /translation="MNKSNDFNFSDDWESNYFEVQALLGQEIDKLQNRVIALSQENNRL
FT                   KAENWQLKHRKRK"
FT   CDS_pept        148361..149281
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0148"
FT                   /product="putative phage RecT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92125"
FT                   /db_xref="GOA:C0M8M8"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8M8"
FT                   /protein_id="CAW92125.1"
FT                   /translation="MANQLAHKDFFNAPVVQKKFSEVLGNNSTQFIASLLGIVNNSDLL
FT                   AKASNESIMTAAMTAATLKLPIQQSLGYAYIVPYKGQAQFQLGYKGLIQLAQRSGQYKN
FT                   INTGIVYKSQLISYNPLFEELVLDFSKPQDEIVGYFAAFKLLNGFEKVSFWSAEKAAAH
FT                   GKRFSKSFASGPWKTDFDAMAQKTVLKDILSKYGPLSVEMQKAIEEDNKDSRVSNPKDI
FT                   TPPETNSLDDLIGHQNEKKDAPSNLKDVTDDLHSEPEKTLTDENKTVLEDASYPADEIP
FT                   DFDQETGEIMASDGNLFDNLGDLMP"
FT   misc_feature    148442..149071
FT                   /locus_tag="SEQ_0148"
FT                   /note="HMMPfam hit to PF03837, RecT family, score 2.4e-66"
FT                   /inference="protein motif:PFAM:PF03837"
FT   CDS_pept        149278..150075
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0149"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92127"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR016974"
FT                   /db_xref="InterPro:IPR024432"
FT                   /db_xref="UniProtKB/TrEMBL:C0M925"
FT                   /protein_id="CAW92127.1"
FT                   /translation="MTKLDLLGKDYYSRESAIRYWSISQYKHFKECEARALAELRGDWT
FT                   DTRDNTALLVGNYVHSYFESKAAHEEFKAQNGSEMISTRGATKGQLKKDYLVAEQMIEA
FT                   LKSDSNFMAIYQGEKEAAITGFLGEIEFKGKIDCLNVERGYFVDIKTTKGPIDDTIWNG
FT                   AERVRWFEAYGYILQMAAYKTMLEAKYNKPFEPIIYAVTKETPPDTRAIRIQNLDAMQN
FT                   ELDNLAQNIKRLDDVKKGIEKSKPCGHCEYCRANQLTQRVMIF"
FT   CDS_pept        join(150181..150234,150236..150595)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0150"
FT                   /note="CDS contains a frameshift after codon 18. Similar to
FT                   Streptococcus pyogenes serotype M18 hypothetical phage
FT                   protein UniProt:Q8P088 (EMBL:AE010065 (137 aa) fasta
FT                   scores: E()=5.3e-45, 96.350% id in 137 aa. Possible
FT                   alternative translational start site after codon 24 which
FT                   may generate a functional protein. Similar to Streptococcus
FT                   pyogenes serotype M18 hypothetical phage protein
FT                   UniProt:Q8P1S1 (EMBL:AE010005 (113 aa) fasta scores:
FT                   E()=3.6e-36, 98.230% id in 113 aa;hypothetical phage
FT                   protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92128.1"
FT   CDS_pept        150592..151104
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0151"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92129"
FT                   /db_xref="GOA:C0M9Z6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z6"
FT                   /protein_id="CAW92129.1"
FT                   /translation="MSNLVLSLDISTSGTGWALFKGSDLIQSGVLKHKSDSYFERGRYM
FT                   ASQLRAIQSRALKKYDCSFSTIAVEKNSVMGPNQQSMLKIGIVTGIILGRLIADNVVFI
FT                   NVSTWRKHWKFSYKDRSKKAMKAQSKAKAAENFGKIVKDDEADAVLIGAYYVNQGYLDG
FT                   LETHDYY"
FT   CDS_pept        151091..151303
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0152"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92131"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAG8"
FT                   /protein_id="CAW92131.1"
FT                   /translation="MTTTKKHVVRIYNKGITATYAVTDKRLFREHEFATKREAMQFIRE
FT                   LELANDKRATEYYLREWRDANGRYV"
FT   CDS_pept        151287..151565
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0153"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92133"
FT                   /db_xref="InterPro:IPR021739"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAG9"
FT                   /protein_id="CAW92133.1"
FT                   /translation="MEDTFKKIKELEAACQDRTDNIKKPSHYQGRHGMEAIDVVKNFAA
FT                   CPEHEEGFYWGNAVKYLLRYHAKNGVEDLKKARQNLDWLIEKLEEVE"
FT   CDS_pept        151562..151813
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0154"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92135"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH0"
FT                   /protein_id="CAW92135.1"
FT                   /translation="MILTKDLAKKHLGCYVDRYRRNDVINGMFPKRIVELPDGRLYLRN
FT                   PIGVYTKIEEDLDIDYIFKPIKVLEFLSETEVNDDTEI"
FT   CDS_pept        151797..152189
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0155"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92137"
FT                   /db_xref="InterPro:IPR019096"
FT                   /db_xref="InterPro:IPR023385"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU1"
FT                   /protein_id="CAW92137.1"
FT                   /translation="MIPKFRVWDEDNHKMSYSDYYNVVVLSDKVYLRETLRKHQKEGKE
FT                   SLVESNVKDEYIMPLAYSDGKTTIYDKDIIRDWSTGELGVVVYDNEDCAWKVKTDTTEE
FT                   WLYNWLGCDVIGNTYEDPELLERVEE"
FT   CDS_pept        152186..152392
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0156"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92139"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI6"
FT                   /protein_id="CAW92139.1"
FT                   /translation="MTVKELIEKLQEYPDWLNVKLRLFDVDLLEAAYEANNPRRDDVIS
FT                   DEKETINVDRTDLNELEISAQGY"
FT   CDS_pept        152403..152672
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0157"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92141"
FT                   /db_xref="GOA:C0MBI7"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI7"
FT                   /protein_id="CAW92141.1"
FT                   /translation="MTEEQMIDCLLYELVKKDKAIEKKNIIIAVLTVMLCLVSVFSIAL
FT                   QNHYEPQIYGLRAQLSRTQKQLKRASEDRARQTKRLADLTGNGG"
FT   misc_feature    152478..152537
FT                   /locus_tag="SEQ_0157"
FT                   /note="1 probable transmembrane helix predicted for SEQ0157
FT                   by TMHMM2.0 at aa 26-45"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        152669..153343
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0158"
FT                   /product="phage DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92142"
FT                   /db_xref="GOA:C0MBI8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI8"
FT                   /protein_id="CAW92142.1"
FT                   /translation="MKMFTNEDCMQLMARYPDKHFDLAIVDPPYFSGPEKRQYYGRKIS
FT                   PIGVKRVYEQTTQWAIPGKDYFDELFRVSKNQIIWGVNYYDYPFGSGRIIWDKVNGSSS
FT                   FSDCEIAYCSLHDSARLFRYMWNGMMQGKSIAEGHVQQGNKKLNEKRIHPTQKPVNLYI
FT                   WLLQKYAKTGDKILDTHVGSASSLIACKELGFDYVGCELDTHIYNKAIDRLCEYDNKIK
FT                   LV"
FT   misc_feature    152729..153304
FT                   /locus_tag="SEQ_0158"
FT                   /note="HMMPfam hit to PF01555, DNA methylase, score
FT                   1.2e-05"
FT                   /inference="protein motif:PFAM:PF01555"
FT   misc_feature    152738..152758
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   misc_feature    153206..153238
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        153359..154132
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0159"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92144"
FT                   /db_xref="InterPro:IPR012865"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBI9"
FT                   /protein_id="CAW92144.1"
FT                   /translation="MNINDLKKGDKVWVEGIISSSFSNGGVHVNHAGIDAFYNLERTKI
FT                   KPDGYAEQSPKYLKNIIAKMRELPEHDRAVWIEGIFNEFGIDNSISYYLGHKQGVLQEK
FT                   DSLKPEIPSFVADWIEKHKAYYIKWEKDDKADFVFRSIDDLFNYGESLCTNDFVISSDL
FT                   SKWTKEHAYDFIIAILFGYTVKKEKLYIVELPNPNSDIEHKHIALVRLANGKLGFSEII
FT                   DTDFSLREDIKLTEEEIRKDHDWAWREEFPKEVNE"
FT   misc_feature    153674..154126
FT                   /locus_tag="SEQ_0159"
FT                   /note="HMMPfam hit to PF07852, Protein of unknown function
FT                   (DUF1642), score 2.4e-20"
FT                   /inference="protein motif:PFAM:PF07852"
FT   CDS_pept        154129..154296
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0160"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92146"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ0"
FT                   /protein_id="CAW92146.1"
FT                   /translation="MNKSEIKNLVDRLSDLIDKCDNDFEAMVFNPDQTFDLLLASHSAL
FT                   SKVLRGEVTE"
FT   CDS_pept        154293..154508
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0161"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92148"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ1"
FT                   /protein_id="CAW92148.1"
FT                   /translation="MKSYQKRFVEEYRQLTQRLSKLDKMLKKYAQGTLGFEPDCPIRLL
FT                   QEQRRVMSEYVDILEARAKFEGVDLE"
FT   CDS_pept        154524..155018
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0162"
FT                   /product="putative autolysin regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92150"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ2"
FT                   /protein_id="CAW92150.1"
FT                   /translation="MRTTPWLYLLTPLYHTEGAFMTFFPEIDIQKTKSNAKRKLKEYPR
FT                   WRRIANDVDTQKVTATYSFEPRQPHGVPSKPVERLALNRVSAEQELDAIEQAVSMILEP
FT                   ERRRILYDKYLSPYKKADKVIYTELCMSESFYYDTLDIALLAFAELYREGSLIVEQGVF
FT                   S"
FT   CDS_pept        155228..156394
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0163"
FT                   /product="phage DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92152"
FT                   /db_xref="GOA:C0MBJ3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ3"
FT                   /protein_id="CAW92152.1"
FT                   /translation="MQIQKVSISEIKMYENNAKLHPKKQIEQIKSSIKAFGNNDPIAID
FT                   ESNIIIEGHGRYTALKELGYDEVDVIKLTHLTEEQKKAYILAHNKLTMNTGFDIDILTE
FT                   ELQSIMDIDMSVFGFDVDLAAAFEEIDKELDNFDNTLPEDPKSKFGQIYQLGRHRLMCG
FT                   DGTNQSDVKKLMGGELADLLITDPPYNVAYQGKTKDALTIQNDNMDSNAFRQFLGEAFK
FT                   AADSVIKPGAVFYIWHADSEGYNFRGACLDVGWTVRQCLIWNKNAMVLGRQDYHWKHEP
FT                   CLYGWKDGASHLWASDRKQTTVIDFDKPQRNGDHPTMKPVGLFDYQIKNNTKGHDIVLD
FT                   LFGGSGTTLIACESNGRCARLMECDPKYVDVIIKRWEELTGESVIQLN"
FT   misc_feature    155237..155497
FT                   /locus_tag="SEQ_0163"
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
FT                   score 7.8e-11"
FT                   /inference="protein motif:PFAM:PF02195"
FT   misc_feature    155765..156349
FT                   /locus_tag="SEQ_0163"
FT                   /note="HMMPfam hit to PF01555, DNA methylase, score
FT                   7.9e-15"
FT                   /inference="protein motif:PFAM:PF01555"
FT   misc_feature    155774..155794
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   misc_feature    156251..156283
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        156675..157151
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0164"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92153"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ4"
FT                   /protein_id="CAW92153.1"
FT                   /translation="MANEDNLIPNSKRTPGELREIAKKGGIASGKARREKANLRKAVEL
FT                   VLGSTVPSAMLREQLEQLDISPTNQSAIALKLVENALKGDVRSAELLAKITTTEVKDSL
FT                   DRKEQRQRIKAAELATDEQRTRIELLKVKLDAEKGAKPDTHLMEKLLEVVEDGS"
FT   CDS_pept        157141..158436
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0165"
FT                   /product="phage terminase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92155"
FT                   /db_xref="GOA:C0MBX0"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX0"
FT                   /protein_id="CAW92155.1"
FT                   /translation="MAVRIKKLSTKQKDIIRRPFNYELEVNEGTPRSGKTTAGHFRYAR
FT                   YLIESEDENHLVTAYNQEQAYRLFIDGDGTGLMHIFDGNCEIKHDERGDHLLVTTPKGN
FT                   KRVYYKGGGKVNSVGAITGMSLGSVVFCEINLLHMDFIQECFRRTWAAKLRYHLADLNP
FT                   PAPQHPVIKDVFDVQNTRWTHWTMDDNPILTAERKQNIINSLKKNPYLYKRDVLGQRVM
FT                   PQGVIYGLFDMEKNVLDTLIGEPVEMYFCADGGQADATSMSCNIVTRVRDNGKISFRLN
FT                   RTAHYYHSGADTGQIKAMSTYAVELKAFIAWCVKKYQMRYTEVFVDPACKALREELHKL
FT                   GIFTTPAPNNAKDVSSKSKGIEVGIERGQNIISDGVFHLVNHIEEEYDHYHFLKEIGLY
FT                   SRDDNGKPIDKDNHAMDEFRYSVNVFVHRYYN"
FT   misc_feature    157216..158415
FT                   /locus_tag="SEQ_0165"
FT                   /note="HMMPfam hit to PF03237, Terminase-like family, score
FT                   1.6e-27"
FT                   /inference="protein motif:PFAM:PF03237"
FT   misc_feature    157225..157248
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        158449..159951
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0166"
FT                   /product="putative minor capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92157"
FT                   /db_xref="InterPro:IPR006432"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX1"
FT                   /protein_id="CAW92157.1"
FT                   /translation="MGVIQQIKNFLIRSKYVMTTQDLVNITDHPKIAVTEGEYQRIQSN
FT                   LVYYQSIFNDVEYLNTDGELKKRKLNHLPIARTAAKKIASLVFNEQAEIKVTDKVADEF
FT                   INSTLKNDRFNKNFERYLESCLALGGMAMRPYVDNDKIRVAFIQAPVFLPLQYNTQDVS
FT                   SAAIVIKTVKKVGDKTFYYTLIEIHEWKNQNDYVITNELYKTDNSSEVGRRVPLEELYG
FT                   DLKDKVNVTKVTRPLFTYLKPPGMNNKDINSPLGLSIFDNAKTTIDFINTTYDEFRWEV
FT                   KMGQRRVAVPESLTALNVRTVDSDVVPRPRFEPDQNVYIRMGGRDLDSSAIQDLTTPIR
FT                   ADDYIKAINEGLALFEMQLGVSAGLFSFDGKSVKTATEIVSENSDTYQMRNSIVALVEQ
FT                   SLKELVISIFELAAGTGLYEGSIPGMDDISINLDDGVFTDRKAELDYWIKVVGAGFGTQ
FT                   AMAIQKVLNVTDEEAKKIQAEVNTGIAKAINKQRTDVDLYGE"
FT   CDS_pept        159956..161119
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0167"
FT                   /product="putative minor capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92159"
FT                   /db_xref="GOA:C0MBX2"
FT                   /db_xref="InterPro:IPR009319"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX2"
FT                   /protein_id="CAW92159.1"
FT                   /translation="MKKKPVKLNDEQFFLEASQVSDLYHQLILDLFDQVIQRIKARGPA
FT                   SLTDNPYLWQTAKLHETGLLNADNIKLISKYSGVAEAQLRRVIENEGFKIYDDTAQQLR
FT                   EALNTRPEISSSIQDDLANYARQAIADVHNLINTTLPASVIGAYQSIVQETVAGVVTGL
FT                   KTPDQAINQTVMRWFKKGFYGFTDKSGRQWRADSYARTVVNTTAWRVFNEAKEAPAREF
FT                   GIDTFYYSKKATARDMCAPLQHQIVTTGEAREKDGVKILALSDYGYGKPEGCLGTNCKH
FT                   TKTPYVIGANTKPELPDYLKNLTPAQAKANANAQAKQRAIERSIRRSKELLHVAKQLAD
FT                   KDLVSKYQTQIRVKQGALKHLINNNDFLTYRQANIKAFLHHKTGGTK"
FT   misc_feature    159956..161050
FT                   /locus_tag="SEQ_0167"
FT                   /note="HMMPfam hit to PF06152, Phage minor capsid protein,
FT                   score 5.5e-213"
FT                   /inference="protein motif:PFAM:PF06152"
FT   CDS_pept        161116..161340
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0168"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92160"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX3"
FT                   /protein_id="CAW92160.1"
FT                   /translation="MNKRIKKKRKLETAVVMLTKEVAELRAIVSTKAQATNSELTVVKS
FT                   AVSDNQAAIKSIGDDVDYIKKNYKRKWRK"
FT   sig_peptide     161116..161220
FT                   /locus_tag="SEQ_0168"
FT                   /note="Signal peptide predicted for SEQ0168 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.785) with cleavage site
FT                   probability 0.435 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        161342..161599
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0169"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92162"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX4"
FT                   /protein_id="CAW92162.1"
FT                   /translation="MEYTEKAKVLASQEFTRLTGLEIKPEDCFVVWFSKTLQNWKALVS
FT                   TSKTKIADYAEVTHNGDKKETYVDVYTKVSNKAFADHQAR"
FT   CDS_pept        161710..162258
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0170"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92163"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX5"
FT                   /protein_id="CAW92163.1"
FT                   /translation="MENVANENVDQETTNLENSQSENKTFTQDDLTRVGTKEHSKGYNK
FT                   ALKELGFDDADSAQEALKAYRDWQESQKSEAEKQAEVLAAKDKELEEALANNKALNAKL
FT                   AAMSLGVNVDSIDDVIALSERLVTDEISIDDAIKKVLDKYPHFGQVQDKAPKITVTGNP
FT                   SVATTNSNDAFLKALGLNN"
FT   CDS_pept        162273..163145
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0171"
FT                   /product="putative phage major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92165"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX6"
FT                   /protein_id="CAW92165.1"
FT                   /translation="MSINYITKHEGVFEKKLMQAALTNILETPKVNWLGAKSFELPTIS
FT                   VTGYKAHTRSKGYNAGTVSNDKNTYTLGFDRDVEFFVDKADVDETNQELSMANISNTFI
FT                   TEHATPEVDAYRFSKIATNAIDNSHFKQEDDYSTTNVYERLKAAILPIRKYGAGNIIIY
FT                   VSSEIMDFLERSKDFTRSIATTSPQGIDTRVTSLDGVQLIEVWDDARFKTKFDFTTGFV
FT                   KDGSGKDINFLIVAKPAVIAKAKFNSIYLFAPGQHTEGDGYLYQNRLYHDLFVLKSKQD
FT                   GVYVSHKSA"
FT   CDS_pept        163156..163299
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0172"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92167"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX7"
FT                   /protein_id="CAW92167.1"
FT                   /translation="MKTYEKDNQVYKVQEGSELEIQLIADGFKEVKKKQGRKTKEDQSG
FT                   ES"
FT   CDS_pept        163299..163727
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0173"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92169"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBX8"
FT                   /protein_id="CAW92169.1"
FT                   /translation="MVFDWGVIVIAFLTQQEFEDLGFDKVEDFAKLEKRAGHAVNLYCR
FT                   NRYDHKDFKKELAFIQKAVKRAVAYQIAYLDESGVMTAEDKQSFAGISLGRTSISYTVG
FT                   HGQGSQRKTLADRFNLCLDAENELLAVGLGYAGISYDR"
FT   CDS_pept        163717..164049
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0174"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92171"
FT                   /db_xref="InterPro:IPR019612"
FT                   /db_xref="UniProtKB/TrEMBL:C0M666"
FT                   /protein_id="CAW92171.1"
FT                   /translation="MIDKRLLIDSLQVKLVKRAGDYGGFVYDDPFTISPVRFDRSFAAV
FT                   GKDNTRQEIKPSVIFIYPKYCKIRADKTWEDAIVIDSDTEYTVNKVIPIYYPHRHKIFC
FT                   YEVEVI"
FT   CDS_pept        164049..164405
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0175"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92173"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:C0M667"
FT                   /protein_id="CAW92173.1"
FT                   /translation="MAKIVVELGGIKRKVSPQALAKGKLVMNNQVMITMNPYVPYRDGS
FT                   LRGSSRADSIGVTWSGPHARPQFYGGAYNKYKSFKFKKYTTPGTGKRWDKRALANATIV
FT                   KDWEQSLLRGMGFR"
FT   CDS_pept        164402..164800
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0176"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92175"
FT                   /db_xref="InterPro:IPR024411"
FT                   /db_xref="UniProtKB/TrEMBL:C0M668"
FT                   /protein_id="CAW92175.1"
FT                   /translation="MTNDFAVVLRQFIAGLDLGIEPRLDYLTRAEDLVIYPMPGGKVNA
FT                   EYMDGTREISLPFEIAIKTKNQELANATMWAINGALSNFDLKLQSLNNSYTFTSLDVEK
FT                   PFLNDLSDQGFYIYVLDLTAHLEIEGKN"
FT   CDS_pept        164800..165261
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0177"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92176"
FT                   /db_xref="UniProtKB/TrEMBL:C0M669"
FT                   /protein_id="CAW92176.1"
FT                   /translation="MRQKNAFRGHFIAPYKTGVEETDVTKENLLELAKWIKDVSDDTDE
FT                   KTEDEAYYDGDGTEETTVVGVKGAYTFEGTYDPEDKAQAHIASLKYKLGDDRKVWHRVI
FT                   SSDGKRQWTGVATVTEIIAGSGAAADFEAFGCKITYNSLPKESVPSEVH"
FT   CDS_pept        165305..165748
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0178"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92178"
FT                   /db_xref="UniProtKB/TrEMBL:C0M670"
FT                   /protein_id="CAW92178.1"
FT                   /translation="MSGIAVDLKRTGFPVKIGQVELWFDTSQERLLEFFDIENEVNRRL
FT                   NTYEKQIIEANLDKEIEAKGVTKEVAQSALCLEAKYLEINYDLLFGEGAFAQLYAEYPD
FT                   KEALENTLEIVCREIEAKLKDMAIEREEIVKQKTKKYKKRSNL"
FT   misc_feature    165377..165415
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT                   /inference="protein motif:Prosite:PS00018"
FT   CDS_pept        165745..166326
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0179"
FT                   /product="putative phage Gp15 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92180"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:C0M671"
FT                   /protein_id="CAW92180.1"
FT                   /translation="MKLNDPLVESFDFKGEIYSVDLSFNKVLDVFDVINDDFLNEAEKC
FT                   FLCLDILLDRTDLPFTDAVDLWIYIKTNFIDIERPEKPQLDLKGNPMPVAKAKEDNKKV
FT                   IDFNLDAEFIYASFMQAYQINLFKVQNKLSWVEFKALLNALPDDTIMQRIIAIRQWKDD
FT                   GKGDKDYRDNMRKLKTKYSLNDDEEEDDGS"
FT   misc_feature    165748..166293
FT                   /locus_tag="SEQ_0179"
FT                   /note="HMMPfam hit to PF06854, Bacteriophage Gp15 protein,
FT                   score 3.8e-126"
FT                   /inference="protein motif:PFAM:PF06854"
FT   CDS_pept        166316..169576
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0180"
FT                   /product="putative phage minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92182"
FT                   /db_xref="GOA:C0M672"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:C0M672"
FT                   /protein_id="CAW92182.1"
FT                   /translation="MAADGKVTILVDVDGKQVKVLNSELDKVAKHGDKGSSSLKKFAIG
FT                   AGVFKLASAAVDLVTHSLGKAITRFDTLEKYPRVMKAMGHSAEDVARSTDKLANGIDGL
FT                   PTTLDEVVGTAQRLTSITKDINKSTNLTLALNNAFLASGASSEAASRGLEQYAQMLSAG
FT                   KVDMQSWKTLQETMPYALQKTAEAFGFAGTSAQKDFYEALKNGQITFDQFSRKLIELND
FT                   GVGGFAELARENSKGIETSFNNIKNAIAKGVANSIKALDNLSKAATGKSIAEHFDNLKV
FT                   VINAAFSIINASIKASTPLFKILFSVIGAGISIVKALSPILLGAAAGIAAMRVVNTVIT
FT                   GINAFNAAWAASSAIMAMSSARIALVAPAIQAGTFATKADIVARLSQIGVLKASTLIYG
FT                   VMTGVISLSTAATIAATAAVTAFKTALTVLTGPIGWVVAGVGALVAAGVSLWSWLTRES
FT                   DETKKLKKEQEGLVESNKKLRDSVKEGVQERKKNLESVKESTAAHQKLADEIVKLAAKE
FT                   NKTAGEKQNLKNKIDQLNGSIDGLNLAYDKNSNSLSHNADQIKARISAMEAESVWQTAQ
FT                   QNLLSIEQKRSEVSKKLAENAELRKKWNEEANVSDSARKEKIAELTEEEGKLKNMQTQL
FT                   QEEYNKTSATQQAAADAMAAAEEAGAARQVIAYENMSEAQRTAINNMRTKYSELLETTT
FT                   SIFDAIEQKTALSVAQMSANLEQNRLATEQWANNLKTLAERGVDQGIIEQLRRMGPEGA
FT                   AQTQVFVDATDAELAPLQENFRAATETAKNAMGNVLDSAGIEMPEKVKSMVTNVSTGLQ
FT                   AELQAANFAQLGQEIPNGVSQGISQGAGKASDASVKMGQEVKNSFKNELGIHSPSRVFT
FT                   EYGSHITDGLSNGVTNGTSKVMQTMQSMAQQMSQKGQQIVNDMRNKSNEMTNAFSTMSS
FT                   PMYSHGVNAMQGLANGIYAGAGSALAAAQNIAAQITATIQSALDIHSPSRVMRDEVGRF
FT                   IPQGIAVGIDADRKVIDLSMQKLKESMTINATPEIASGFTGGLTGVSNQTTNNSSNSFT
FT                   LNVNVDESDGNSRDKYQRMFREFCWLIQQQQGRLGDIK"
FT   misc_feature    join(167228..167296,167315..167383,167504..167572,
FT                   167609..167677)
FT                   /locus_tag="SEQ_0180"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0180 by TMHMM2.0 at aa 305-327, 334-356, 397-419 and
FT                   432-454"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        169573..170289
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0181"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92184"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:C0M673"
FT                   /protein_id="CAW92184.1"
FT                   /translation="MTAFIKFDGKKSSDFDLKIINDVEHDSTFCDVDQVKIPGRDGVVL
FT                   KDNQRLEAIERSYPLRLHSKRRLTEVETDISNWLNAKGWKDLELSWEPDYIYKATHITP
FT                   FSIKEVLRNFGSLRANFLIHPIKYLKTGKQEVSLVNGGTLQNPGNVQAKPILKIKGTGN
FT                   GVLTINGFETGLENVQGELVIDMERHLVYKDVLSAWDNIVRTERHRMPLFDVGQNSISW
FT                   TGNFTITAVPNWGVKV"
FT   CDS_pept        170286..172427
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0182"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92186"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H1"
FT                   /protein_id="CAW92186.1"
FT                   /translation="MIPVLYEAKETKFRTFGLGEIADAYEVRITRERNGNYSLYIKYPL
FT                   DGVFASVFKEELKIKSDAGRRTKWQTFEINRVLRNSKDHIEIFARHISMRTQDIALKPF
FT                   VSGSSIDAESALEVWRDNLVGDDTFDVKSDILTLGSFNWEVDKIGNARGALGGVAGSIL
FT                   DVYGGEYEFDNRTIILHKQMGRKAPTVLEYGRNIVSVEEERLLDGNYTSIYPYVRYTPQ
FT                   PKPHEEASGKPHIGEQEQPEEQLVTLPEFILDGQYLDLYAQRRIQMVDLSSHFNDDKKE
FT                   PTVEEIRKLAQKYLKDNNVGAPKISIEVDYIDLSQTLDYQDFRVMEEVELCDIVPLYYP
FT                   KFGITTETEKVVEIVYDVYTDSNHTIKLGTIGQSISKSLTGGVTQRIETLENNQKVITN
FT                   NQQQFELNLPKYLNDLNGTKIWYEKPDDNVEHKIGDFWFEKNGKYQRTWVWDGNQWVKI
FT                   IDTEDLNPNQRVFDEAMAEIEKLKQHQQQIDKRNQRELEEFRDTLKNLALPEEAIKKIT
FT                   EAIKVDDIPSIKQSFDDLKNKVSETSETARLNAEIIGTDGKTRYNKNLLVGDPSRTKSY
FT                   DEDFIEIEANDGGFKRGETYTISFSQTCELLKKVAITLTQPHNKGLKLVLTSTKAKMEA
FT                   QTFDLTKDIEVISVYPLSYRAVLTGDWYKSKQMDFNAAEVQDLALEMSYRDVVDSNNAS
FT                   LILDWSSNPDVIFDGNGGS"
FT   CDS_pept        172427..173101
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0183"
FT                   /product="collagen-like repeat phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92188"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H2"
FT                   /protein_id="CAW92188.1"
FT                   /translation="MSETISAIVVHKSMTKNEWESSDIILPQGQLVYESDTGHSKFGDG
FT                   KNRYADLIYQGGPPGPPGPQGPTGKTGDQGPPGPTGQRGETGPQGPPGPPGADGKMTFE
FT                   QLTPEQKQQLKGDKGDRGPKGDIGPRGLTGPQGPKGEPGINGMDGPRGATGPRGPQGPA
FT                   GDPASIPDDVVRRGELAAYLLKSEYKAKGTGSGLSYKVVTQSEYDELYDYSDNELILVV
FT                   EG"
FT   misc_feature    172757..172933
FT                   /locus_tag="SEQ_0183"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copies), score 2.4e-06"
FT                   /inference="protein motif:PFAM:PF01391"
FT   CDS_pept        173103..173717
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0184"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92189"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H3"
FT                   /protein_id="CAW92189.1"
FT                   /translation="MAYKLYTKADAGDNLLLVAGHLPDDTKRLKIRRETLDVLSITHYQ
FT                   TYDMVHLKSTVKKAYSKNTVVTAVAAAASKPKVKPKQVLNFAKATKVYIGSTRVVAVYM
FT                   GDRLLWSDKDSSGTKTVSVVGSLDIRQSQKMLYLYLIASDIADVKSKRIKSIAINGVNL
FT                   SSAAQINFEDSDYYCLVTIERVANIKEIKNIAQKNKLTLEF"
FT   CDS_pept        173728..175611
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0185"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92191"
FT                   /db_xref="InterPro:IPR012892"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H4"
FT                   /protein_id="CAW92191.1"
FT                   /translation="MSRDPTLMIDESNLVIGKDGRMHYTFTAEDDNQKVRLKSNCLGTA
FT                   HFNQLMIERGDQATDYVAPVVVEGSGNPTGLFKDLKELSLELTDTKNSNLWSKIKLTTN
FT                   GMLREYHRDHISTEIVETADGIAKRISDDTGQKLALINETIKGIKREYQDADERLSASY
FT                   QAGIEGLKAQLANDKIGLQAEIKLSAQGLSQKYDDELRKLYAKITTTSSGTTEAYENKL
FT                   EGLRAEFTRSNQGMRTELESQISGLKAVQQSTAKQISQEIRDRTGAISRVQQDLASYQR
FT                   RLQDAEKNYSSLTQTVKGLQSTVSDPSGKIQSRFTQLQNQIDQRVTRDDVMSIINLSGD
FT                   SIKLAIQKAGGIDAKMSAKEIISAINLNGYGVRISGERIALDGNTTVNGAFGAKLGEFI
FT                   KLKADQIIGGTIDAAKIRVINLNASSIVGLDANFIRAKIEHTITSLLEGKVIRARNGAM
FT                   MIDLNSAKMDFNSNATINFNNKDNALVRKDGTHTAFVHFSNATPKNYTGSALYASIGIT
FT                   SSGDGVNSASSGRFCGARFFRYARGYEHTALVDQAEIYGDDIVFSDDFNIDRGFKMRPS
FT                   LMPKMVDLNKMYQAILALGRCWLHANNTAWTFNSDTTSAIIREYNSYINGL"
FT   misc_feature    173728..175566
FT                   /locus_tag="SEQ_0185"
FT                   /note="HMMPfam hit to PF07902, gp58-like protein, score 0"
FT                   /inference="protein motif:PFAM:PF07902"
FT   misc_feature    174700..174774
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   CDS_pept        175620..176057
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0186"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92193"
FT                   /db_xref="InterPro:IPR011675"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H5"
FT                   /protein_id="CAW92193.1"
FT                   /translation="MDLTVQNKDLNTLYSVLDKIKVTNMRVNRGRAKLLAKVEAKLREY
FT                   AKDEVDIIDQYAAKNDKGKWIVDDKGNAKLADVTKVAELNELLDELANESIVIKGHEYS
FT                   KRFIDFLEYLAEAEDEFTGAEIILIDNILEQYEANKKGAEA"
FT   misc_feature    175620..176048
FT                   /locus_tag="SEQ_0186"
FT                   /note="HMMPfam hit to PF07761, Protein of unknown function
FT                   (DUF1617), score 2.9e-93"
FT                   /inference="protein motif:PFAM:PF07761"
FT   CDS_pept        176054..176665
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0187"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92194"
FT                   /db_xref="InterPro:IPR009796"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H6"
FT                   /protein_id="CAW92194.1"
FT                   /translation="MRNWKIVGKYPQPNALGVIEGTHVIITGDDGASIPQTIKKDLSST
FT                   NDLDVIKMVLDEFKKSEYVEIAMGEAVQKVDDLEKLSQETAKTATTAQAAAGLAKVSAE
FT                   RTQKMINLQTIHMLTSVDKIEPDIYKGMLELIEPAKKGQYQEHDVFTVVDESHEEQAGE
FT                   GNLVFVYVNEAFEYDKQTLKDLESEDKVTVIKYADLVKGK"
FT   CDS_pept        176676..177047
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0188"
FT                   /product="putative phage holin"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92196"
FT                   /db_xref="GOA:C0M6H7"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H7"
FT                   /protein_id="CAW92196.1"
FT                   /translation="MFIFLRQLIQTQDGKILFTLGAIAVAMMIDFLTGTVAAKINPNID
FT                   FRSKEGINGILRKICSIALMIFFIPLSILLPNDTGVAFLYVMYVGYLLFELKSILENLN
FT                   KMGIDVALFKQFIDMFSKK"
FT   sig_peptide     176676..176789
FT                   /locus_tag="SEQ_0188"
FT                   /note="Signal peptide predicted for SEQ0188 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.986 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    176688..177044
FT                   /locus_tag="SEQ_0188"
FT                   /note="HMMPfam hit to PF05105, Holin family, score 4e-23"
FT                   /inference="protein motif:PFAM:PF05105"
FT   misc_feature    join(176721..176789,176832..176900,176913..176972)
FT                   /locus_tag="SEQ_0188"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0188 by TMHMM2.0 at aa 16-38, 53-75 and 80-99"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        177057..177167
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0189"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92198"
FT                   /db_xref="GOA:C0M6H8"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H8"
FT                   /protein_id="CAW92198.1"
FT                   /translation="MRAITRLAIVLAIAVLYVPLSVIALIVYPFLDKEDR"
FT   sig_peptide     177057..177128
FT                   /locus_tag="SEQ_0189"
FT                   /note="Signal peptide predicted for SEQ0189 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.799) with cleavage site
FT                   probability 0.476 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    177075..177143
FT                   /locus_tag="SEQ_0189"
FT                   /note="1 probable transmembrane helix predicted for SEQ0189
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        177164..178378
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0190"
FT                   /product="phage-associated cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92200"
FT                   /db_xref="GOA:C0M6X9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6X9"
FT                   /protein_id="CAW92200.1"
FT                   /translation="MTFLDDIKQGCLDGWTKYKILPSLTAAQAILESGWGKYAPHNALF
FT                   GIKADSSWTGKSFNTKTQEEYQPGVVTDIVDRFRAYDSWDESILDHGQFLVDNPRYKSV
FT                   VGETDYKKACHAIKAAGYATASDYAELLIQLIEENNLQKWDAEALAKRKESQMISSQCR
FT                   EVIEFYINLANAGMGVDKDGAYGTQCADVPCYAAKHWFGVDLWGNAADLLDSASAQGWE
FT                   VHRMPTEANPRAGAFFVMDAWFDGVNYGHTGLVYVDSDGYTMQTIEQNIDGNADALYVG
FT                   GPARFNTRDFTGVIGWFYPPYQGDAVTQTVSTDPKTSDTIVETSQAGTFTLDVAEINIR
FT                   RWPSLASEVVGSYKQGDTVSFDSEGYANGYYWISYVGGSGMRNYMAIGITDKDGNIISL
FT                   WGKLN"
FT   misc_feature    177182..177586
FT                   /locus_tag="SEQ_0190"
FT                   /note="HMMPfam hit to PF01832, Mannosyl-glycoprotein
FT                   endo-beta-N-ace, score 2.7e-19"
FT                   /inference="protein motif:PFAM:PF01832"
FT   misc_feature    177500..177532
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00639"
FT   misc_feature    177671..178060
FT                   /locus_tag="SEQ_0190"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 5.1e-25"
FT                   /inference="protein motif:PFAM:PF05257"
FT   misc_feature    178127..178324
FT                   /locus_tag="SEQ_0190"
FT                   /note="HMMPfam hit to PF08460, Bacterial SH3 domain, score
FT                   3.5e-09"
FT                   /inference="protein motif:PFAM:PF08460"
FT   CDS_pept        complement(178456..179112)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0191"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92201"
FT                   /db_xref="GOA:C0M6Y0"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y0"
FT                   /protein_id="CAW92201.1"
FT                   /translation="MNPSVKIKWLLTASGITTYKIGKKIGESTQFLDRYKNDPQKIGGM
FT                   RLEKAEKLLDYIGTLKQEDVIRNTWNNQQILVQNSTEDEITDYFNSYPFAVKLNWIKPH
FT                   KEMFIVNFDTVGDNTFKKYPYDLDNLYFFAGINREYMVRFADFLRACGTKLYFGGSRAL
FT                   YQVDGKKYQIIAKIKRPSEIGPALKVINVIETDVYREDLVPKISEEESILSPEEL"
FT   misc_feature    complement(179002..179067)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1031.000, SD 2.70 at aa 16-37, sequence
FT                   ITTYKIGKKIGESTQFLDRYKN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(179129..179500)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0192"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92203"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y1"
FT                   /protein_id="CAW92203.1"
FT                   /translation="MRYNKSEIMKNAWAMFNSCNWGAENFKFVSVEEKTFAACLKEAWA
FT                   EEKEYVEEKIKESANAPKSEEAKAWDWACRKLNANKLQNVEATDKVAWVSEMAKEMWSS
FT                   NIWAQAIKAVKLHIKLFAA"
FT   CDS_pept        complement(179637..179993)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0193"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92205"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y2"
FT                   /protein_id="CAW92205.1"
FT                   /translation="MTKTTVQRKKSIYINGALEKVYDECNNGSRNRKFSGRVTDIVERY
FT                   DILMALTEIPELTPEQKMILGEAILGGFMDRNKIRYLPDAIADTDLDGCLALAKIVKDL
FT                   DYTQRIKLIESINI"
FT   CDS_pept        complement(179986..180132)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0194"
FT                   /product="phage membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92207"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y3"
FT                   /protein_id="CAW92207.1"
FT                   /translation="MTTKNMLLGLLTVSTIIFLVVSKSWDLKMLTAAIYIATLYLKAVI
FT                   EDD"
FT   sig_peptide     complement(180061..180132)
FT                   /locus_tag="SEQ_0194"
FT                   /note="Signal peptide predicted for SEQ0194 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985) with cleavage site
FT                   probability 0.735 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(180067..180120)
FT                   /locus_tag="SEQ_0194"
FT                   /note="1 probable transmembrane helix predicted for SEQ0194
FT                   by TMHMM2.0 at aa 5-22"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(180129..181439)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0195"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92208"
FT                   /db_xref="GOA:C0M6Y4"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y4"
FT                   /protein_id="CAW92208.1"
FT                   /translation="MVKCMGKREIREEINGKVYKTFSEIARDYSMYPSTVIIRYDRGLR
FT                   GAELVAKRVIRNPKKNIKKPKKHIDKGFPLKIEGVVYNKVSDLADKYGINQATLRNGIA
FT                   AGFTGDEIVKPVTKSIRGRSISINGIDYPSLSAAAKELGFDRMKLRRLYYSGYRDDELL
FT                   TKMKCERKMQRFTGAVIFGTEYTRIRDIALKFNIPETTLRGRYQNGARDEQLICNKKGE
FT                   FTLPGRKLPAFIRFKEAQGEYIFQRTYKNETVTKGRKRFEDIMAISRLVDDYIKIFDRL
FT                   PRDLGNDTIKIDYNTILGKQFGELFVKGIVLQDNKRKLWCVCSCGKEKYYLPPGVVEGK
FT                   IKSCGHLEGLMLTQKNEELKEIQRNRDVALASNTTTGKKNISYNNSKKAFEFKITRGET
FT                   SLFQRFKTLDQALEYKQKVLNYIKKHDGKLPSKEDIK"
FT   misc_feature    complement(180819..180884)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1139.000, SD 3.07 at aa 186-207, sequence
FT                   TRIRDIALKFNIPETTLRGRYQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(181128..181193)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1368.000, SD 3.85 at aa 83-104, sequence
FT                   NKVSDLADKYGINQATLRNGIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(181462..181848)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0196"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92210"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y5"
FT                   /protein_id="CAW92210.1"
FT                   /translation="MNKEQLIKTIKETDYNFYAVRGWDEGYKIGEVLPESVKWDYERDM
FT                   PTDIEVGGTCTTIPDSQHSDFKDYYETEEEMIEAIEKAVKINKSNYCYSKLYLVGSYNR
FT                   NPYNAYEADENEAILADAVVLMEL"
FT   CDS_pept        181998..182216
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0197"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92212"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y6"
FT                   /protein_id="CAW92212.1"
FT                   /translation="MFMLIYDEFKQAVDDGYITGDTVAIVRKNGQIFDYVLPGEEVQPW
FT                   EVVTEEKVENVLRELDWRSVKSRSKLL"
FT   repeat_region   182186..182206
FT                   /note="21mer direct repeat flanking prophage"
FT   repeat_region   182239..182256
FT                   /note="18mer direct repeat flanking prophage"
FT   CDS_pept        182462..182671
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0199"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92213"
FT                   /db_xref="GOA:C0M7D0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D0"
FT                   /protein_id="CAW92213.1"
FT                   /translation="MTMAQGTVKWFNAEKGFGFISTENGQDVFAHFSAIQSDGFRSLDE
FT                   GQRVTFDVEDGQRGPQAVNITKLS"
FT   misc_feature    182468..182665
FT                   /locus_tag="SEQ_0199"
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain, score 1.5e-43"
FT                   /inference="protein motif:PFAM:PF00313"
FT   misc_feature    182510..182566
FT                   /note="PS00352 'Cold-shock' DNA-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00352"
FT   CDS_pept        182841..183302
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0200"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92215"
FT                   /db_xref="GOA:C0M7D1"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D1"
FT                   /protein_id="CAW92215.1"
FT                   /translation="MPTKNTSDSIEEYIKELLAQSGIAEIKRSMLADSFQVVPSQINYV
FT                   IKTRFTESRGYEVESKRGGGGYIRIAKVHFSDKHHLIGTLIASIDDCLSEQAFTDSIQL
FT                   LFDEQLLTEREGNIILAVASNDVLGHQAPEIRARMLYRLLQRIDRKGSN"
FT   misc_feature    182841..182960
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    182847..183287
FT                   /locus_tag="SEQ_0200"
FT                   /note="HMMPfam hit to PF05848, Firmicute transcriptional
FT                   repressor of class, score 1e-99"
FT                   /inference="protein motif:PFAM:PF05848"
FT   misc_feature    182916..182981
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1287.000, SD 3.57 at aa 26-47, sequence
FT                   IKRSMLADSFQVVPSQINYVIK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        183302..185743
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0201"
FT                   /product="putative stress response-related Clp ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92217"
FT                   /db_xref="GOA:C0M7D2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D2"
FT                   /protein_id="CAW92217.1"
FT                   /translation="MMIYSLKMQDIFNQAQFQAERFDSPYLETWHILLAMVAVDHSLAA
FT                   MVLSEFERKIRAEEYEAAAILAMGKSPKEVTSVQFKPQSKALSEILAFAHAICQVINEH
FT                   EVGSEHVLFAILLNPDIMASRLLELAGYRLKDSGKGEPRFADLRKAIELNAGYSKETIK
FT                   AIHELRKPKKSKSVGTFSEMMKPQSTAGELSDFTRDLTEMARQGLLEPVIGREKEVSRM
FT                   VQVLCRKTKNNPVLVGDAGVGKTALAYGLAQRIANGAIPYELQDMRVLELDMMSVVAGT
FT                   RFRGDFEERMNQLIDDIEADGKIILFVDELHTIMGSGSGIDSTLDAANILKPALSRGTL
FT                   HMVGATTQEEYQKHIEKDAALSRRFAKILIEEPSVEDAYQILLGLKPSYEQYHNVTISD
FT                   TAVHTAVKLARRYLTSKQLPDSAIDLLDEASAMVQSMVKKTQPDFITPLDQALLDGDMS
FT                   KVSALLVKEDKQPKLKPTAVTEDDMLHTLSKLSGIPLEKLTQADSKKYLNLEKELHKRV
FT                   VGQEMAVSAIARAIRRNQSGIRTGRRPIGSFMFLGPTGVGKTELAKALAELLFDDESAL
FT                   IRFDMSEYMEKFAASRLNGAPPGYVGYDEGGELTEKVRNKPYAVLLFDEVEKAHPDIFN
FT                   ILLQVLDDGMLTDSRGCKVDFSNTIIIMTSNLGATALRDDKTVGFGAKAIGHDHQAMEK
FT                   RILEELKKAYRPEFINRIDEKVVFHSLTQENMRDVVKIMVKPLIAALAEKHISLKFQPS
FT                   ALKYLSEAGYDVEMGARPLRRTLQTEVEDRLAELMLSGELSSGQSLKIGVSRGKLAFDI
FT                   A"
FT   misc_feature    183344..183508
FT                   /locus_tag="SEQ_0201"
FT                   /note="HMMPfam hit to PF02861, Clp amino terminal domain,
FT                   score 0.036"
FT                   /inference="protein motif:PFAM:PF02861"
FT   misc_feature    183491..183514
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    183581..183769
FT                   /locus_tag="SEQ_0201"
FT                   /note="HMMPfam hit to PF02861, Clp amino terminal domain,
FT                   score 0.27"
FT                   /inference="protein motif:PFAM:PF02861"
FT   misc_feature    183998..184582
FT                   /locus_tag="SEQ_0201"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 5.3e-07"
FT                   /inference="protein motif:PFAM:PF00004"
FT   misc_feature    184013..184036
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    184277..184315
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT                   /inference="protein motif:Prosite:PS00870"
FT   misc_feature    184928..185446
FT                   /locus_tag="SEQ_0201"
FT                   /note="HMMPfam hit to PF07724, ATPase family associated
FT                   with various cellul, score 1.4e-100"
FT                   /inference="protein motif:PFAM:PF07724"
FT   misc_feature    184940..185449
FT                   /locus_tag="SEQ_0201"
FT                   /note="HMMPfam hit to PF07728, ATPase family associated
FT                   with various cellul, score 6.3e-05"
FT                   /inference="protein motif:PFAM:PF07728"
FT   misc_feature    184955..184978
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    185033..185089
FT                   /note="PS00871 Chaperonins clpA/B signature 2."
FT                   /inference="protein motif:Prosite:PS00871"
FT   CDS_pept        186516..186950
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0202"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92219"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D3"
FT                   /protein_id="CAW92219.1"
FT                   /translation="MKKSTKAFIALMILIGGLLMVFSLNGKITEEQQKKDLETSIAKLL
FT                   VHDYEGVKTIKFQGWGHSRETGSWGTTVIINESNQMSFSFSSIKTLEDIGSTRYNPNTF
FT                   KLVEKPETDSKPRIMDRMNEINATSLAGVTVIYSNNNQED"
FT   sig_peptide     186516..186608
FT                   /locus_tag="SEQ_0202"
FT                   /note="Signal peptide predicted for SEQ0202 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.348 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    186534..186587
FT                   /locus_tag="SEQ_0202"
FT                   /note="1 probable transmembrane helix predicted for SEQ0202
FT                   by TMHMM2.0 at aa 7-24"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        187171..187602
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0203"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92221"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D4"
FT                   /protein_id="CAW92221.1"
FT                   /translation="MKKSTKAFIALMILIGGLLMVFSLNGKRTEEQQKKDLETSIAKLL
FT                   VHDYEDVKEVKFTGWGRSRETGSWGTIVVINGENEIGFSFDGLSGLADISGRSYHPDTF
FT                   KLVEKNSLEEMGPVKYRIKDIEKVSLEGVSITYSREKRS"
FT   sig_peptide     187171..187263
FT                   /locus_tag="SEQ_0203"
FT                   /note="Signal peptide predicted for SEQ0203 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.396 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    187189..187242
FT                   /locus_tag="SEQ_0203"
FT                   /note="1 probable transmembrane helix predicted for SEQ0203
FT                   by TMHMM2.0 at aa 7-24"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        187607..188893
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92223"
FT                   /db_xref="GOA:C0M7D5"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D5"
FT                   /protein_id="CAW92223.1"
FT                   /translation="MISDSSYKKLSEQVYNVEPSKAKSNDAPIVLKGNRLIDDKTGKQY
FT                   RVLLVQDNNNDAHKINDNGMQAMAVAPIVQGDVDTSQVVIAYAGTNAADSRDLDTDWQL
FT                   LIRGNQDDLVSGNLDGGNFVIAENQLRSAQKFYQQVKRKYPHSALTTTGHSLGAYLALI
FT                   VAAEHKIPATTFNGPDPVRGMSAEAITWVKANSNMYNNFRINFDGIGNFGAYFGTDDLA
FT                   ISRNVDAMLLSANPLYYHDLGAYRFNQKGQIVDRDGKLIGTQYLVSRAYLTVLASKKRM
FT                   SSYNQLKKHWQSTGKGISSSEELFLDAAQGMILGSSMAKVAREGADEALDHKTVADAKL
FT                   MEVWSAIDFNAFHELPYYEVQALFASYGITYDRFVRDFQDYTQSKVSKLSALATDFENL
FT                   NRDIQTVIDSKLETDQQLAGEFRAWQTEL"
FT   CDS_pept        188875..189267
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92224"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7R9"
FT                   /protein_id="CAW92224.1"
FT                   /translation="MADRIVEEVAIYRKLREMDDAEQDFLRQKKGYQKREDSLSERRHV
FT                   LDDLINSEYQKMSVFLKRLDLSANAASDFFKELDRLKDQSNAEFHLQRAALEEERAQST
FT                   KTFRQEQDQRETELLDMRRAYANTNN"
FT   CDS_pept        189248..189538
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92226"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7S0"
FT                   /protein_id="CAW92226.1"
FT                   /translation="MLIPITEYYIEEEYAYALRLMRQMLERQRIATVARLANSQGEAIK
FT                   KTFKDQIKATASQTKESLQIMEGQLDTAIKGAVRDQLEQVVKKKLPKYNKL"
FT   repeat_region   complement(189701..191130)
FT                   /note="ISSeq3"
FT   repeat_region   189710..189721
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        complement(189734..190537)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0207"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92227"
FT                   /db_xref="GOA:C0M6L9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6L9"
FT                   /protein_id="CAW92227.1"
FT                   /translation="MLEILDLSRSTYYYQVKQLAQEDKDMDLKELIQGIYDEHHGNYGY
FT                   RRIHLELRNRGFIVNHKKVQRLMTVMGLKARIRRKRKYSSYKGEVGKKADNLIKRQFEG
FT                   SKPYEKCYTDVTEFTLPEGKLYLSPVLDGYNSEIIDFTLSRSPDLKQVQTMLEKAFPAD
FT                   SYNGTILHSDQGWQYQHQSYHHFLETKGIRPSMSRKGNSPDNGMMESFFGILKSEMFYG
FT                   LETTYQSLNELEQAITDYIFYYNNKRIKAKLKGLSPVQYRTKSFH"
FT   misc_feature    complement(189749..190231)
FT                   /locus_tag="SEQ_0207"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   1.1e-37"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(190561..191076)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0208"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92229"
FT                   /db_xref="GOA:C0M663"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M663"
FT                   /protein_id="CAW92229.1"
FT                   /translation="MTLSYEDKVQIYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    complement(190633..190914)
FT                   /locus_tag="SEQ_0208"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    complement(190717..190755)
FT                   /locus_tag="SEQ_0208"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   misc_feature    complement(190957..191022)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(191111..191122)
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        complement(191230..192855)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0209"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92231"
FT                   /db_xref="GOA:C0M7S3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7S3"
FT                   /protein_id="CAW92231.1"
FT                   /translation="MAKDIKFSADARESMVRGVDILADTVKVTLGPKGRNVVLEKAFGS
FT                   PLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLK
FT                   NVTAGANPIGIRRGIEAATTTAVEALKAVAQPVSGKEAIAQVASVSSRSEKVGDYISEA
FT                   MERVGNDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDNEKMVADLENPFILITD
FT                   KKISNIQDILPLLEEVLKTSRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAVLTGGTVITEDLGLELKDATMAALGQAAKVTVDKDNTVIVEGAGSSEAI
FT                   SNRVSLIKSQLETTTSEFDREKLQERLAKLAGGVAVIKVGAATETELKEMKLRIEDALN
FT                   ATRAAVEEGIVAGGGTALINVMDKVAALELDGDAATGRNIVLRALEEPVRQIAYNAGYE
FT                   GSVIIDKLKNSAAGIGFNAATGEWVDMIATGIIDPVKVTRSALQNAASVAGLILTTEAV
FT                   VATKPEPAAPAMPQGMDPGMMGGF"
FT   misc_feature    complement(191290..192792)
FT                   /locus_tag="SEQ_0209"
FT                   /note="HMMPfam hit to PF00118, TCP-1/cpn60 chaperonin
FT                   family, score 4.5e-195"
FT                   /inference="protein motif:PFAM:PF00118"
FT   misc_feature    complement(191614..191649)
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT                   /inference="protein motif:Prosite:PS00296"
FT   CDS_pept        complement(192923..193210)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0210"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92233"
FT                   /db_xref="GOA:C0M7S4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7S4"
FT                   /protein_id="CAW92233.1"
FT                   /translation="MLKPLGDRVVLKFEAEKEQTVGGFVLAASHKEATKVGTVVAVSET
FT                   GIRTITGDIVPPSVAVGDKVLVEYGSGLEVKDGDQELVICREADILAVLA"
FT   misc_feature    complement(192929..193210)
FT                   /locus_tag="SEQ_0210"
FT                   /note="HMMPfam hit to PF00166, Chaperonin 10 Kd subunit,
FT                   score 2e-32"
FT                   /inference="protein motif:PFAM:PF00166"
FT   misc_feature    complement(193133..193207)
FT                   /note="PS00681 Chaperonins cpn10 signature."
FT                   /inference="protein motif:Prosite:PS00681"
FT   repeat_region   193352..194788
FT                   /note="ISSeq5"
FT   repeat_region   193359..193371
FT                   /note="imperfect inverted repeat flanking IS element"
FT   CDS_pept        193405..193893
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0211"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92235"
FT                   /db_xref="GOA:C0M6X7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6X7"
FT                   /protein_id="CAW92235.1"
FT                   /translation="MKLSYDDKLRIYELRKNGMSCSRIGQQYDIQVSNLKYMVKLMDRY
FT                   GVEIVRKGKNKYYPPELKQEIIDKVLLEGQSQLSVSLEYALPNAGMLPNWIAQYKKNGY
FT                   TILEKQRGRPTKMGRKPKKTWEEMTELERLQEELEYLRTENAYLKKLRELRLQDEARE"
FT   misc_feature    193567..193848
FT                   /locus_tag="SEQ_0211"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00051"
FT                   /inference="protein motif:PFAM:PF01527"
FT   CDS_pept        193890..194756
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0212"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92237"
FT                   /db_xref="GOA:C0M7S6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7S6"
FT                   /protein_id="CAW92237.1"
FT                   /translation="MRKAETIREMVQEGFRLNLLLEIAKMARSTYYYQVKQLDKSDKDE
FT                   AINSEIKAIYEEHKGNYGYRRIHLELKNRGFIVNHKKVQRLMKEMRLAARIRRKRRYSS
FT                   YKGETGKKADNLIQRQFEAAKPYEKCYTDVTEFALPNNDEKLYLAPVLDGYNSEIIDLT
FT                   LSRSPDLKQVQTMLEKAFPADSYNGTILHSDQGWQYQHQSYHHFLESKGIRPSMSRKGN
FT                   SPDNGMMESFFGILKSEMFYGLETTYQSLNELEQAITDYIFYYNNKRIKAKLKGLSPVQ
FT                   YRTKSFH"
FT   misc_feature    194253..194741
FT                   /locus_tag="SEQ_0212"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   2.2e-37"
FT                   /inference="protein motif:PFAM:PF00665"
FT   repeat_region   complement(194769..194780)
FT                   /note="imperfect inverted repeat flanking IS element"
FT   CDS_pept        complement(194883..195353)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0213"
FT                   /product="putative mutator protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92238"
FT                   /db_xref="GOA:C0M840"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C0M840"
FT                   /protein_id="CAW92238.1"
FT                   /translation="MLEVIKNWVNICVKEGDKILLLNRQHDDFPGWIQPGGKVNTSESF
FT                   FEAAVRELKEETGLTALNLQLKGISGFTNPDKPERYVYYDFLCEDFEGKLLTKSREGLP
FT                   QWHAIADLDKLDMQEDIRQRLPLYWRQGSFERLHYWSDKEKKVVKTITHLYD"
FT   misc_feature    complement(194961..195341)
FT                   /locus_tag="SEQ_0213"
FT                   /note="HMMPfam hit to PF00293, NUDIX domain, score 1.1e-14"
FT                   /inference="protein motif:PFAM:PF00293"
FT   misc_feature    complement(195186..195245)
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        join(195574..196194,196194..196424)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0214"
FT                   /note="CDS contains a frameshift after codon 207. Similar
FT                   to Streptococcus ratti MutR-like protein UniProt:Q3YB74
FT                   (EMBL:DQ145753 (292 aa) fasta scores: E()=7e-56, 56.842% id
FT                   in 285 aa;putative DNA-binding protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92240.1"
FT   CDS_pept        196727..197047
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0216"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92242"
FT                   /db_xref="GOA:C0M842"
FT                   /db_xref="InterPro:IPR009086"
FT                   /db_xref="InterPro:IPR020038"
FT                   /db_xref="UniProtKB/TrEMBL:C0M842"
FT                   /protein_id="CAW92242.1"
FT                   /translation="MRANGLGRRKRMATLERHHKMLLLSMALGAASWLALGLISLPNLA
FT                   GALGISTANANTTVNLLSAYSTVSSVVAIVGAVTGVGSIGAGIAATVLYLIKQKGKAAA
FT                   LW"
FT   sig_peptide     196727..196891
FT                   /locus_tag="SEQ_0216"
FT                   /note="Signal peptide predicted for SEQ0216 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.953 between residues 55 and 56"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(196787..196855,196946..197014)
FT                   /locus_tag="SEQ_0216"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0216 by TMHMM2.0 at aa 21-43 and 74-96"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        197061..198200
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0217"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92244"
FT                   /db_xref="GOA:C0M843"
FT                   /db_xref="UniProtKB/TrEMBL:C0M843"
FT                   /protein_id="CAW92244.1"
FT                   /translation="MKHVFKYHKGDILGYLNIVGFTLLFYGSVIGMIMFRDYLTYDGAG
FT                   SLISTFILVSGTYHSVKSTFPYEGKRHPTFILTPYYLFKHLLLSVTKVYAFQIRVVTIG
FT                   IICLAIAFPEQLVWIALSVLAVFIYWLSLPLVAIFRVAGRLLNLLMIYGMYLNQELLVI
FT                   ACLCLNVVILVLSVTINVHYPYQWLAVRARKEEKTITLLKLVINTITDHLALMVLFSIF
FT                   CIAVTYFTQRLLLSFDYSSFSIPVFFLSASTYIALLEVMVGKNIKELELDRGLAVLQFL
FT                   NRDISVYKAYRNSQFLLSAHILAVIHTGCAIGLLPFLLNGQAALFLSNLVMIPFIYFIS
FT                   FCYFVKSLKIVAGDLSVFRWVILVLYFILVVIAMVGSRL"
FT   misc_feature    join(197097..197165,197337..197396,197415..197483,
FT                   197541..197609,197670..197738,197781..197849,
FT                   197949..198017,198027..198095,198129..198188)
FT                   /locus_tag="SEQ_0217"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SEQ0217 by TMHMM2.0 at aa 13-35, 93-112, 119-141, 161-183,
FT                   204-226, 241-263, 297-319, 323-345 and 357-376"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    197979..198011
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT                   /inference="protein motif:Prosite:PS00133"
FT   CDS_pept        198197..198679
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0218"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92246"
FT                   /db_xref="GOA:C0M844"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:C0M844"
FT                   /protein_id="CAW92246.1"
FT                   /translation="MIMRKFLRYYISFIIFSIAIGILIGLLITSDTVILSKPERGWDFT
FT                   LEVLKNNSNNFLSYIFLFFLSPALQLIDLVSVVIQITLGMRKSGFLITALGLFPHGLLE
FT                   IPNFLFYQGLSQYMLWTVLTEKSMTSFLERERRYVRYYLISYYVLLIAGIMEGLLG"
FT   sig_peptide     198197..198304
FT                   /locus_tag="SEQ_0218"
FT                   /note="Signal peptide predicted for SEQ0218 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.514 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(198215..198283,198362..198430,198608..198661)
FT                   /locus_tag="SEQ_0218"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0218 by TMHMM2.0 at aa 7-29, 56-78 and 138-155"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        198676..199263
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0219"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92248"
FT                   /db_xref="GOA:C0M845"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M845"
FT                   /protein_id="CAW92248.1"
FT                   /translation="MKIVNESKSFSNRKILNHISFDFSKGLYKVEGNNGSGKTTFLRLL
FT                   AGLERFDSGHRLQHKGDILYLDTNAIGVVPLTIEDNLTLLWKTFNASPDEETLSVINQF
FT                   FGERLLDHYLTASVGTKAKVGLSLLFVKDWDYIFIDEALSTLDGFSLDMVAGRLLALKE
FT                   KATVFYVSHNLSHQQLLSESQVIYLNGKGEIY"
FT   misc_feature    198748..199245
FT                   /locus_tag="SEQ_0219"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.3e-08"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    198769..198792
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        199260..199742
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0220"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92250"
FT                   /db_xref="GOA:C0M846"
FT                   /db_xref="UniProtKB/TrEMBL:C0M846"
FT                   /protein_id="CAW92250.1"
FT                   /translation="MKGNPFNRNLSWLIAYVLLLSCYVFILVDGGFLKNSVQELEVLLG
FT                   QTSLAIKLFLMVISIAFSIISLLVEYFLSKFLVLLFIEAGIVSLNDVLTAKSVTLVIHL
FT                   SALLLKLSPSPLFQFVVNALGIVIMYGLSIKRQGNRTTALLFCLPFTLDILATLLL"
FT   misc_feature    199293..199325
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    join(199296..199355,199398..199466,199485..199544,
FT                   199602..199661)
FT                   /locus_tag="SEQ_0220"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0220 by TMHMM2.0 at aa 13-32, 47-69, 76-95 and 115-134"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        199767..200282
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0221"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92251"
FT                   /db_xref="GOA:C0M847"
FT                   /db_xref="UniProtKB/TrEMBL:C0M847"
FT                   /protein_id="CAW92251.1"
FT                   /translation="MKKILYLSVLLGTSILATLIKIYNTFFAKLKASSGHSTGNIEIDA
FT                   LLSESRLVLERQHAFTTNGINKLFVMMMSLMLLLALYYLIKKDLKAVYSYLLYLVLTLV
FT                   HAIYSFFSLSPLAKLYSDDMLGATIQTGEKAKLIFSVVLFLLYLLIVVANNRVKSSVEP
FT                   ASSIGIDV"
FT   sig_peptide     199767..199868
FT                   /locus_tag="SEQ_0221"
FT                   /note="Signal peptide predicted for SEQ0221 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.964) with cleavage site
FT                   probability 0.422 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(199779..199847,199968..200021,200040..200108,
FT                   200151..200219)
FT                   /locus_tag="SEQ_0221"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0221 by TMHMM2.0 at aa 5-27, 68-85, 92-114 and 129-151"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        200916..202550
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0222"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92253"
FT                   /db_xref="GOA:C0M8E1"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E1"
FT                   /protein_id="CAW92253.1"
FT                   /translation="MTRFFQKKQAKSLAIGFVSLFAVLIGYGAFHYSKASRINAYLQAR
FT                   SSGSGQVLENIKEYLVWADTNEQLTNDQARYTSFKRYSKAELVSKRQQLQTATAADDMY
FT                   VKSVGRKFLIFPDYRIAVKPVALTIKTNVPNVDILLNHKKIAVSQSEDFSTTIERLPAA
FT                   DYKASINGYYKDRKIKVSKAYDGKNHTLDLRVTFKTFTVTSNVRDGELYIDGERVETLK
FT                   AGQLQLEEYPVTEIAKAYIKKTFPDGELTSSKHSLAPVAEGSQLEINIDHLLTEEQAGQ
FT                   VLVAAFDQLLTYLNQGQDPAGLSTVFEQGANNAFYKGLKDSIKAKFQTDTRKASRLSIP
FT                   SILLSKLTQIGKQSYLVDFTAVYDFVYDKETDPEKGTSGNVRQDLTGKLTLKKSGDSYL
FT                   VSQSGPKNITVASEKNQVKPSIFPEGLVGTWIGHRSDMTFTMILAKDGSITTTIGNKNG
FT                   NGSQTTKSAKITKVEEKGDGLFLYTVAPDADIAALVPGGGLGGVNVKYAFGVKWSGDVA
FT                   TIVVWQTANNAAFDYSKPMLGPDMKKQ"
FT   sig_peptide     200916..201026
FT                   /locus_tag="SEQ_0222"
FT                   /note="Signal peptide predicted for SEQ0222 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.484 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    200952..201011
FT                   /locus_tag="SEQ_0222"
FT                   /note="1 probable transmembrane helix predicted for SEQ0222
FT                   by TMHMM2.0 at aa 13-32"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(202691..203596)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0223"
FT                   /product="RNA pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92255"
FT                   /db_xref="GOA:C0M8E2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E2"
FT                   /protein_id="CAW92255.1"
FT                   /translation="MTGSMTTANKPEMGFQISFINPYQATTVKELLEDRLLIPRKIRHF
FT                   LRIKKHVWVNDELINWQSPVKQGDHIKLQFDQEDYPDKGILMGKPGLVDCLYQDEHLII
FT                   VNKPEGMKTHGNEPTELALLNHVSAYTGKTCYVVHRLDMETSGAILFAKNPFILPILNR
FT                   LLEHRDIKRDYWALIEGQLEQQTVTYRDPIGRHRHDRRKRVVDSKHGQEAITHLALLQA
FT                   FDQTCLVNCRLETGRTHQIRVHLAHHKHPLIGDPLYSRQKAERLMLHAHQLTLRHPLAQ
FT                   EMIRVTAPSKSFKEGLQQLN"
FT   misc_feature    complement(202856..203296)
FT                   /locus_tag="SEQ_0223"
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase, score 1.6e-47"
FT                   /inference="protein motif:PFAM:PF00849"
FT   misc_feature    complement(203141..203185)
FT                   /note="PS01129 Rlu family of pseudouridine synthase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01129"
FT   CDS_pept        complement(203568..203765)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92257"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E3"
FT                   /protein_id="CAW92257.1"
FT                   /translation="MIMNKFQAFKETLSAESLKAVYDETRLEVASDEREGTEAFSVTLA
FT                   TQMAINLIEKYHDWLNDNSK"
FT   CDS_pept        203994..205748
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0225"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92259"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E4"
FT                   /protein_id="CAW92259.1"
FT                   /translation="MNKPLIKSCLLALLTLAGLTSMAAQADVNTYNQGRTYNDTPYYSA
FT                   YHHYYDHTRDTADNGIDNWGRLTRYHYYRETYYQLEAERQQLVRTYLELKASYDDQVAL
FT                   SSQRLQQYQSGWSDLQSRFEQLRKTNPVVGGDYRIVELEGNFQSYQTLLQQLSMADFVS
FT                   QYKDRLDTLTRLDTERARLIDTWWESDSNYSDLNTNLTLVNGYIKELNQALQELLKDHQ
FT                   GKMTSDLQTLGDRQAELARRLTDIESRPKRQATSQPRGSQTHWRSAPRADVALWNELRN
FT                   EGDYASATTDNALPLQPYRADLTAVHDLEALQAQSDRAHRLRAKEIVFTLQRSNISRQG
FT                   DIDLSGAITAFIKEKLLVTPNARGVSSGFRWQMQTYDNERLTITLMPQYYMTDDQYKEY
FT                   YDHLKAWTAQHIQSTDTEVEKIDKIQDYIMTNYHYATGKVGGVTRTGISVQTPYAFIKD
FT                   KEAVCQAYAQMFKDMGRLAGLDVHYIQGYGDPVGGLSSLHAWNIVKVDGQYYHIDLTWN
FT                   DTIDSTNHNHTYTLRGNDFMSKTHLWNAAYAISDSDYAAYPRRSFLRYGTYATNYSRNT
FT                   FYPGYSYA"
FT   sig_peptide     203994..204071
FT                   /locus_tag="SEQ_0225"
FT                   /note="Signal peptide predicted for SEQ0225 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.949 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        205889..206269
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92261"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E5"
FT                   /protein_id="CAW92261.1"
FT                   /translation="MKSIRRYDVNEEWAHTGLVEAGDFYFLNYCVGNVGQDIEAQINGA
FT                   FDEMERRLGLVGLTLEVVVQMDCLFRDIWNVPVMEKIIKERFNGKYPARKFLQTAFAHQ
FT                   GGPDGLLFQVDGVAYSKHISVS"
FT   misc_feature    205928..206248
FT                   /locus_tag="SEQ_0226"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
FT                   score 0.0017"
FT                   /inference="protein motif:PFAM:PF01042"
FT   CDS_pept        206307..208640
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0227"
FT                   /product="penicillin-binding protein 2a"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92263"
FT                   /db_xref="GOA:C0M8E6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E6"
FT                   /protein_id="CAW92263.1"
FT                   /translation="MTFLELLQKKFFPKKYQEKQALKERAAQHMADKEATTQATATALA
FT                   DQEAQAGQTERQSVLQRSKSYGVKRKNRPIWLQRLEAILPSQQGPIRRFLRRYHVGKIL
FT                   LILMGTFVLLLGSYLFYLSKTAKVSDLQDALKATTVIYDRKGEYAGSLSGQKGTYVELD
FT                   AISDDLEKAVIATEDRTFYTNNGINFKRFLLAIVTAGRFGGGSTITQQLAKNAYLSQEQ
FT                   SIKRKAREFFLALELTKKYSKNDILTMYLNNSYFGNGIWGVEDASQKYFGTSAANLTLD
FT                   EAATLAGMLKGPEIYNPYYSIEKATNRRDTVLSAMVDAGKISKQQAQEAQAIGMGNRLA
FT                   DTYVGKTDDYQYPSYFDAVINEAISRYGISEKDIVNDGYKIYTELDQNYQAGMQTTFNE
FT                   DSLFPVSEFDGSSAEAASVALDPKTGAVRGLVGRVNSTENQPFRSFNYATQAKRSPAST
FT                   IKPLVVYTPAVAAGWSLEHELPNSVQDFGGYQPHNYGNYESETIPMYQALANSYNIPAV
FT                   SILDQLGVDKAFSYGEKFGLKMSETKKELGVALGSGVTTNPLEMAQAYAVFANGGVKHI
FT                   AHLITRIENAKGKVIKTFTDKTKRVISQSVADKMTSMMLGTFSNGTAVNANVYGYTLAG
FT                   KTGTTETDFNPDLSGDQWVIGYTPDVVISQWVGFNQTDEHHYLSDSSAGTASAIFSTQA
FT                   SYILPYTKGSQFKVDNAYAQNGISAVYGINETNTQAGIDSQSIIDSLRKSAEEASKSIS
FT                   EAVDQSGLREKAQSIWKSIVDYFR"
FT   misc_feature    206604..206672
FT                   /locus_tag="SEQ_0227"
FT                   /note="1 probable transmembrane helix predicted for SEQ0227
FT                   by TMHMM2.0 at aa 100-122"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    206721..207212
FT                   /locus_tag="SEQ_0227"
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   3e-80"
FT                   /inference="protein motif:PFAM:PF00912"
FT   misc_feature    207324..207347
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    207549..208379
FT                   /locus_tag="SEQ_0227"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 1.5e-44"
FT                   /inference="protein motif:PFAM:PF00905"
FT   misc_feature    208194..208217
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        208689..208841
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0228"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92265"
FT                   /db_xref="GOA:C0M8M9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8M9"
FT                   /protein_id="CAW92265.1"
FT                   /translation="MAQKKASLACVECGSRNYSIGISSTPRPTRLEVNKFCKYCKAYTL
FT                   HKETR"
FT   misc_feature    208695..208838
FT                   /locus_tag="SEQ_0228"
FT                   /note="HMMPfam hit to PF00471, Ribosomal protein L33, score
FT                   5.1e-12"
FT                   /inference="protein motif:PFAM:PF00471"
FT   CDS_pept        208853..209029
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0229"
FT                   /product="putative preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92267"
FT                   /db_xref="GOA:C0M8N0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N0"
FT                   /protein_id="CAW92267.1"
FT                   /translation="MGFISGIFKLLRDTTWPDRKQRWKDFISVLEYTAFFTVIIFIFDQ
FT                   LLSKGILSLINLF"
FT   misc_feature    208928..208996
FT                   /locus_tag="SEQ_0229"
FT                   /note="1 probable transmembrane helix predicted for SEQ0229
FT                   by TMHMM2.0 at aa 26-48"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        209405..209965
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0230"
FT                   /product="transcription antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92268"
FT                   /db_xref="GOA:C0M8N1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N1"
FT                   /protein_id="CAW92268.1"
FT                   /translation="MKGSNMLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNIL
FT                   RVEIPTQTVNVEKNGQVKEVEENRFPGYVLVEMVMTDDAWFVVRNTPNVTGFVGSHGNR
FT                   SKPTPLLEEEIRAILLSMGQTVDVFDTNIKEGDMVQIIDGAFIGQEGRVVEIENNKVKL
FT                   MLNMFGSETLAEVELYQIAELSS"
FT   misc_feature    209438..209743
FT                   /locus_tag="SEQ_0230"
FT                   /note="HMMPfam hit to PF02357, Transcription termination
FT                   factor nusG, score 8e-52"
FT                   /inference="protein motif:PFAM:PF02357"
FT   misc_feature    209801..209902
FT                   /locus_tag="SEQ_0230"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 1.4e-07"
FT                   /inference="protein motif:PFAM:PF00467"
FT   CDS_pept        211008..212525
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0231"
FT                   /product="putative Mga-like regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92270"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N2"
FT                   /protein_id="CAW92270.1"
FT                   /translation="MSIENLFTKQQWRELELITLLSETKNPLYYKDACQMLDCSVLTLQ
FT                   SCITNSVFMEDLGKLFYKDSQFHIHYNHQSGLKEVYRRALLESPSLQLMSALFFDDFAS
FT                   LDDLAEALFISLSTLKRLIRKTNLYLKEHFDIIISAKPIRVVGDEYNIRLFYIKYFSEA
FT                   YTFSEWPFASLLNENHHEQFVQLMASLIEVKIDFAIFRQLKLLSAVNLIRYLKGFKIGK
FT                   HKALSSLSLELLQDSQEMKKLSHLFVLKFSVPLDELVLSEMFSNYLDDDLVLEKSLQVD
FT                   KVKEEVPGPQSLLSWIDLLSEMEGATGIVLPNKYEVARYLHATVILGVEDISESFLIYD
FT                   YKKDYLAFFKEHYTYVYFRFTDYVKRLFKDGDMELATNLLNNLVYSLLIAWENFFLTMC
FT                   ELMKKPKLLIIERSHGSTGSFLKKYIGEFFEITIFDKLTIEALCLQHDYDVIITDTVIR
FT                   GCEHADIFFFSRFVPTVIVAKLNHYLRKRMGSIFETKTTNKLGNIGY"
FT   misc_feature    211029..211202
FT                   /locus_tag="SEQ_0231"
FT                   /note="HMMPfam hit to PF08280, M protein trans-acting
FT                   positive regulator (M, score 3.7e-13"
FT                   /inference="protein motif:PFAM:PF08280"
FT   misc_feature    211224..211487
FT                   /locus_tag="SEQ_0231"
FT                   /note="HMMPfam hit to PF05043, Mga helix-turn-helix domain,
FT                   score 3.3e-29"
FT                   /inference="protein motif:PFAM:PF05043"
FT   misc_feature    211314..211379
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1528.000, SD 4.39 at aa 103-124, sequence
FT                   ASLDDLAEALFISLSTLKRLIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    211533..212189
FT                   /locus_tag="SEQ_0231"
FT                   /note="HMMPfam hit to PF08270, M protein trans-acting
FT                   positive regulator (M, score 4.9e-33"
FT                   /inference="protein motif:PFAM:PF08270"
FT   CDS_pept        212726..213670
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0232"
FT                   /note="Probable gene remnant. CDS lacks an N-terminal
FT                   signal sequence which is required for processing of this
FT                   cell surface-anchored protein. Similar to the C-terminus of
FT                   Streptococcus pyogenes serotype M18 Streptococcal
FT                   protective antigen Spa UniProt:Q8NZA4 (EMBL:AE010108 (570
FT                   aa) fasta scores: E()=9.3e-13, 44.062% id in 320
FT                   aa;putative cell surface-anchored protein (fragment)"
FT   misc_feature    213536..213658
FT                   /locus_tag="SEQ_0232"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   1.1e-08"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    213560..213577
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    213578..213646
FT                   /locus_tag="SEQ_0232"
FT                   /note="1 probable transmembrane helix predicted for SEQ0232
FT                   by TMHMM2.0 at aa 251-273"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        214259..216760
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0234"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92273"
FT                   /db_xref="GOA:C0M8N3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8N3"
FT                   /protein_id="CAW92273.1"
FT                   /translation="MTFYNHKAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREINTTDPSYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLADLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDSITTAEQAQAVA
FT                   EYKRQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEMPIWIADYVLASYGTGAIMAV
FT                   PAHDERDWAFAKQFNLEIIPVLEGGNVDEAAYTEDGIHINSDFLDGLDKACAIAKMVAW
FT                   LEETGVGHEKVSYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPEQDLPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNDEQLADKD
FT                   LLKQWLPVDIYIGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVATDKVDKRDGSFFHMETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGARKFLDRVYRLITTKEIVAENSGALDKAYHETVKAVTE
FT                   QIEGMKFNTAIAQLMIFVNAANKEDELYVAYAKGFVQLLAPFAPHLGEELWQILTASGQ
FT                   SISYVAWPTHDDSKLVENDVEIVVQIKGKVKAKLVVAKDLSREELEKVALAHDKIQAEI
FT                   AGKEVAKVIVVPNKLVNIVVK"
FT   misc_feature    214292..216208
FT                   /locus_tag="SEQ_0234"
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 1.1e-12"
FT                   /inference="protein motif:PFAM:PF00133"
FT   misc_feature    214385..214417
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    216302..216661
FT                   /locus_tag="SEQ_0234"
FT                   /note="HMMPfam hit to PF08264, Anticodon-binding domain,
FT                   score 4.7e-07"
FT                   /inference="protein motif:PFAM:PF08264"
FT   CDS_pept        216947..217438
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0235"
FT                   /product="anti-phagocytic factor H binding protein"
FT                   /note="Similar to Streptococcus equi subname: full=se18.9
FT                   UniProt:Q2QJF9 (EMBL:DQ068464) (163 aa) fasta scores:
FT                   E()=4.4e-51, 96.933% id in 163 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92274"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N4"
FT                   /protein_id="CAW92274.1"
FT                   /translation="MKKLVLASAAALVLAGATVSTGTVSANSSRYNYTGWNQGGYSWKY
FT                   LRLRNKNPYSRRTLTEDYSDQRKNEAKDSIKELSKLSDKEKKNFADRIDALTDTYAISS
FT                   ILSEAKNKNNDYLEFDKEYEALFNSNKYKLEIEKIKDRVYFDEGYSARQGINDLKSLEN
FT                   "
FT   sig_peptide     216947..217024
FT                   /locus_tag="SEQ_0235"
FT                   /note="Signal peptide predicted for SEQ0235 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.989 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    216956..217024
FT                   /locus_tag="SEQ_0235"
FT                   /note="1 probable transmembrane helix predicted for SEQ0235
FT                   by TMHMM2.0 at aa 4-26"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        217829..218200
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0236"
FT                   /note="CDS lacks appropriate translational start site and
FT                   therefore does not have an intact N-terminal signal
FT                   sequence. Similar to Streptococcus pneumoniae hypothetical
FT                   protein SPR1549 UniProt:Q8CYF3 (EMBL:AE008523 (130 aa)
FT                   fasta scores: E()=2.6e-11, 38.400% id in 125 aa;putative
FT                   exported protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92276.1"
FT   CDS_pept        218271..219059
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0237"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92278"
FT                   /db_xref="GOA:C0M927"
FT                   /db_xref="UniProtKB/TrEMBL:C0M927"
FT                   /protein_id="CAW92278.1"
FT                   /translation="MLQYRLFPFRYFYPLVPLLFLGFIYFDSLKHILFFDTSAVDLSGG
FT                   IEVKKSLLLSMIRLDSVVFDFSFYQSFIYPLVMILVAYAYYYLKSRHLKYLIGRKSDYG
FT                   KRCIFLKLQLSLYVLLSFYIVIFALTLVSWLNGVAHMNGNLMPYFDQNSILRFFGQGAT
FT                   TFIAYYCLVKSLALFVHTYFVCFLVDYLQSFIKSSMLYLILMWALSPLLYSYLPPKYVL
FT                   MTSLMSTSYSDADIPYLLSPYLGLVGVCIVLKLRKHHEII"
FT   misc_feature    join(218289..218348,218466..218534,218595..218663,
FT                   218763..218831,218850..218918,218976..219029)
FT                   /locus_tag="SEQ_0237"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0237 by TMHMM2.0 at aa 7-26, 66-88, 109-131, 165-187,
FT                   194-216 and 236-253"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        219046..219663
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0238"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92279"
FT                   /db_xref="GOA:C0M928"
FT                   /db_xref="UniProtKB/TrEMBL:C0M928"
FT                   /protein_id="CAW92279.1"
FT                   /translation="MKLSNLLVVGMKACLTGLLIHLLLIKANMTGERDFHNLVCYRLLM
FT                   PFPVIEGETADFVKVITLLGLSFNSFYFTISFLADLAEGTKEIFRFHARSQLVFFNKLW
FT                   RTSTIFYIKEWLLFIVLILGVLMTYYGAPYHIERLCYLMVSWLTIDICLIYVMIRYASS
FT                   AVVAMILFASLTLIRYFLFDVWWCLLLIVLVHMLYDNYYKES"
FT   misc_feature    join(219052..219120,219223..219291,219370..219438,
FT                   219466..219534,219571..219639)
FT                   /locus_tag="SEQ_0238"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0238 by TMHMM2.0 at aa 3-25, 60-82, 109-131, 141-163 and
FT                   176-198"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        join(219665..220048,220052..220285)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0239"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   128. Similar to Streptococcus pneumoniae ABC transporter,
FT                   ATP-binding protein UniProt:Q97PD4 (EMBL:AE005672 (210 aa)
FT                   fasta scores: E()=1.8e-26, 52.913% id in 206 aa;ABC
FT                   transporter, ATP-binding protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92281.1"
FT   misc_feature    219764..219787
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        220768..222201
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0241"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92283"
FT                   /db_xref="GOA:C0M9H7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9H7"
FT                   /protein_id="CAW92283.1"
FT                   /translation="MKMLIAPLNWFSQDILQNPAFFVGLLVLIGYLLLKKPLHEVFAGF
FT                   VKATVGYLILNVGAGGLVNTFRPILVALGKKFELKAAVIDPYFGLAAANTKLEEMGSIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQLQNAFGA
FT                   WAVGIICGLYWAVSSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLD
FT                   NLKLASFLTIFHDTVVASATLMLVFFGAILAVLGPDMMSNAELIGAGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFTFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVVVCVFLLAIP
FT                   QLQFARAKDKEAYYRGEAQ"
FT   misc_feature    220780..222060
FT                   /locus_tag="SEQ_0241"
FT                   /note="HMMPfam hit to PF04215, Putative sugar-specific
FT                   permease, SgaT/UlaA, score 2.7e-250"
FT                   /inference="protein motif:PFAM:PF04215"
FT   misc_feature    join(220810..220869,220888..220956,221068..221136,
FT                   221161..221229,221245..221298,221476..221538,
FT                   221596..221655,221782..221850,221860..221919,
FT                   221956..222024,222067..222135)
FT                   /locus_tag="SEQ_0241"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SEQ0241 by TMHMM2.0 at aa 15-34, 41-63, 101-123, 132-154,
FT                   160-177, 237-257, 277-296, 339-361, 365-384, 397-419 and
FT                   434-456"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        222316..222594
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0242"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92285"
FT                   /db_xref="GOA:C0M9H8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9H8"
FT                   /protein_id="CAW92285.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQAVL"
FT   misc_feature    222322..222582
FT                   /locus_tag="SEQ_0242"
FT                   /note="HMMPfam hit to PF02302, PTS system,
FT                   Lactose/Cellobiose specific IIB, score 1e-25"
FT                   /inference="protein motif:PFAM:PF02302"
FT   CDS_pept        222810..223295
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0243"
FT                   /product="sugar phosphotransferase system (PTS), IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92286"
FT                   /db_xref="GOA:C0M9H9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9H9"
FT                   /protein_id="CAW92286.1"
FT                   /translation="MNLKKAFIENNSIRLGLSAASWQEAVKLAVQPLIDSGAVTSEYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGVGVKRNAFALITLTKPVTFSDGKEASVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELEDAISRLVACHTPAEVLALVDESKNSPYLEGLDLDS"
FT   misc_feature    222825..223253
FT                   /locus_tag="SEQ_0243"
FT                   /note="HMMPfam hit to PF00359,
FT                   Phosphoenolpyruvate-dependent sugar phosph, score 8.4e-34"
FT                   /inference="protein motif:PFAM:PF00359"
FT   CDS_pept        223393..224055
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0244"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92288"
FT                   /db_xref="GOA:C0M9I0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I0"
FT                   /protein_id="CAW92288.1"
FT                   /translation="MTHIPKLQVALDHSDLQGAVRAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMAAALKAIK
FT                   EERGERGEIQVELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGEVWGEKDLNKVKAL
FT                   IDMGFRVSVTGGLDINTLKLFEGVNVFTFIAGRGITEAEDPAAAARAFKDEIRRIWG"
FT   misc_feature    223405..224025
FT                   /locus_tag="SEQ_0244"
FT                   /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate
FT                   decarboxylase / HUMP, score 1.8e-55"
FT                   /inference="protein motif:PFAM:PF00215"
FT   CDS_pept        224060..224923
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0245"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92290"
FT                   /db_xref="GOA:C0M9I1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I1"
FT                   /protein_id="CAW92290.1"
FT                   /translation="MARPIGIYEKATPKHFTWLERLQFAKVLGFDFVEMSVDESDARLA
FT                   RLDWSKQERLDIVKAIYETGVRIPSICFSGHRRYPLGSSNPETEATSLELMKKCIVLAQ
FT                   DLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQACTWAEEAQVILAIEIMDDPFINSIE
FT                   KYLAVEKEIDSPYLFVYPDTGNVSAWHNDLWSEFYNGHRSIAALHLKDTYAVTETSKGQ
FT                   FRDVPFGQGCVDWEAMFDVLKKTHYHGPFLIEMWSENCETVEETRAAIKEAQDFLYPLI
FT                   EKAGLS"
FT   misc_feature    224123..224758
FT                   /locus_tag="SEQ_0245"
FT                   /note="HMMPfam hit to PF01261, Xylose isomerase-like TIM
FT                   barrel, score 4e-45"
FT                   /inference="protein motif:PFAM:PF01261"
FT   CDS_pept        224923..225639
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0246"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92292"
FT                   /db_xref="GOA:C0M9I2"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I2"
FT                   /protein_id="CAW92292.1"
FT                   /translation="MAKRLQEMRERVCAANKALPLHGLVKFTWGNVSEVCRELGRIVIK
FT                   PSGVDYDQLTPENMVVTDLDGTIVEGELNPSSDLPTHVQLYKAWPEVGGIVHTHSTEAV
FT                   GWAQAGRDIPFYGTTHADYFYGPIPCARSLTADEVNGAYEKETGTVILEEFASRGLDPM
FT                   AVPGIVVRNHGPFTWGKTPELAVYHSVVLEEVAKMNRLTEQINPRVEPAPTYIMDKHYL
FT                   RKHGPNAYYGQKGSRH"
FT   misc_feature    224950..225582
FT                   /locus_tag="SEQ_0246"
FT                   /note="HMMPfam hit to PF00596, Class II Aldolase and
FT                   Adducin N-terminal, score 7.1e-96"
FT                   /inference="protein motif:PFAM:PF00596"
FT   misc_feature    225442..225465
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        225943..227589
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0247"
FT                   /product="putative transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92294"
FT                   /db_xref="GOA:C0M9I3"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I3"
FT                   /protein_id="CAW92294.1"
FT                   /translation="MIILDKKSYDLLSYLIRLKEAETVMAISAALGQSRRKIYYHLDKI
FT                   NEALPSHVAQIVSYPRVGILLNSEQKAACQQLLNEVADYHYVMKGDERRSLSAIYIAVA
FT                   TERVTLDKLMMINDVSRNTILNDLAELREELSSYNNKIQLHATKAKGYYFDCHPMALIQ
FT                   YLYKVLAGVYQGGNSSFIELFDHKLSETQGLSAYFSKEVLDYFHEYLFLSQASLGKTIN
FT                   IQDSQFMLQILPFILLSYRNMQLHSETKTALKRDFNLIWKRKEYQIAKALASELYHNFK
FT                   LHLDDIEVGMIAMLMLSFRKDQDHHVESQDYEQMRATIGDFIDQLELRYQLHFTHKKDL
FT                   LRQLTRHCKALVYRKAYGIFSINPLTDHIKEKYEELFAMAQSCAVILEQAWQIRLTDDD
FT                   VAYLTIHLGGELRHSHADWDKTKLVIVSDDGIGIQKLLLKQCQRYLPNCQIEAVFTTEQ
FT                   YQSVFDLMSVDIVVSTTDALEALVPVLIVNPILSDDDIIRLIRFSKQGRLSDSSRFSLE
FT                   LEKAIETIVKDDADRYALKTKIEKLIHHELL"
FT   misc_feature    226222..226401
FT                   /locus_tag="SEQ_0247"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.001"
FT                   /inference="protein motif:PFAM:PF08279"
FT   misc_feature    226549..226839
FT                   /locus_tag="SEQ_0247"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 9.6e-15"
FT                   /inference="protein motif:PFAM:PF00874"
FT   misc_feature    226900..227172
FT                   /locus_tag="SEQ_0247"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 5.2e-16"
FT                   /inference="protein motif:PFAM:PF00874"
FT   CDS_pept        227784..228875
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92295"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z7"
FT                   /protein_id="CAW92295.1"
FT                   /translation="MAKVQDITRESWILSTFPEWGTWLNEEIEEEVVPEGNFSMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKKVKDMVRGHQMANMAGVRKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLDHVKFVGPYECGKIWESWGVPKDRII
FT                   VVKPGDSFAFKDIKVTAVESFDRTCIVTLPVAGAEENGGELAGLPVTDEELARKTVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYQFHPFIWEVGGKYTYPQDQDRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   CDS_pept        228883..229182
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92297"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z8"
FT                   /protein_id="CAW92297.1"
FT                   /translation="MPHLALLGGAFDLSRVLLDMTSSYGQSKLTLCLADLIAIGSLLGS
FT                   LSIGLVAGQESDRSIKSARGGCWVSSQGAKCQKGLLAVVCSGLLSAWLTSDITA"
FT   CDS_pept        229381..230577
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0250"
FT                   /product="putative glycine betaine transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92299"
FT                   /db_xref="GOA:C0M9Z9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9Z9"
FT                   /protein_id="CAW92299.1"
FT                   /translation="MGTILEVRHLSKLFGKKQKAALEMIKAGKSKSAIFKKTGVTVGVY
FT                   DASFEVQEGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGRDISKLSVDQLREVR
FT                   RHDMNMVFQSFALFPHKTILENTEFGLELRGVPKQERREIAKRALDQSGLLEVRDQYPD
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRRDMQDELLELQETMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEDILTNPANDFVREFVEDVDRSKVLTAQHIMI
FT                   KPITTTVDLDGPQVALNRMHNEEVSMLMATNRRRQLIGSLTADGAIEARQKKLPLSEVI
FT                   DRNVRTVSKDTVITDILPLIYDSSAPIAVTDEQHRLLGVIIRGRVLEALANIPDDDLN"
FT   misc_feature    229540..230103
FT                   /locus_tag="SEQ_0250"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4e-64"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    229561..229584
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    229873..229917
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    230212..230550
FT                   /locus_tag="SEQ_0250"
FT                   /note="HMMPfam hit to PF00571, CBS domain pair, score
FT                   8.6e-13"
FT                   /inference="protein motif:PFAM:PF00571"
FT   CDS_pept        230595..232325
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0251"
FT                   /product="putative glycine-betaine binding permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92301"
FT                   /db_xref="GOA:C0MA00"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA00"
FT                   /protein_id="CAW92301.1"
FT                   /translation="MENLLQTTLPVAQLVEQLTEWLTKTFSGFFDLLQLVGNALMDWIT
FT                   QTLLFINPLLFMLLVTCAMFFLARKKWPLPIFTLLGLLFVYNQGLWAELINTFTLVLVA
FT                   SLISVLLGIPLGIWMAKNKIVHQVINPMLDLMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLALRHIPTELVEASDAFGSTPKQKLLKVELPLAKHTMMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGRGFVSGLALVILAIILDRMTQHFNGKPQ
FT                   ERTQTGKTKKWLGLAALAVFLLSALGRGFAAMLSSSADKGQKVTIAYVQWDSEVASTHV
FT                   IAQVLRDEGYQVTLTPLDNAVMWQTIANGDADFSTSAWLPVTHQQQYQKYQDKLDNLGP
FT                   NLKGTKLGLAVPAYMSDVNSIEELSDQANQQIIGIEPGAGIMTAADKTQKAYSNLADWE
FT                   LVAASTGAMTTSLDQAVKKKEPIVVTAWSPHWMFAKYDLKYLADPKKTFGSKENINTIA
FT                   RRGLKADLPAVHRIVDHFHWEKEDMEAVMLDINQGMTPEAAAKKWVASHADKVAKWTQS
FT                   "
FT   misc_feature    join(230736..230795,230808..230867,230886..230954,
FT                   231024..231092,231237..231305,231348..231401,
FT                   231468..231536)
FT                   /locus_tag="SEQ_0251"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SEQ0251 by TMHMM2.0 at aa 48-67, 72-91, 98-120, 144-166,
FT                   215-237, 252-269 and 292-314"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    230874..231440
FT                   /locus_tag="SEQ_0251"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.4e-31"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    231129..231215
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    231558..232289
FT                   /locus_tag="SEQ_0251"
FT                   /note="HMMPfam hit to PF04069, Substrate binding domain of
FT                   ABC-type gly, score 3e-93"
FT                   /inference="protein motif:PFAM:PF04069"
FT   CDS_pept        232731..235391
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0252"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92303"
FT                   /db_xref="GOA:C0MA01"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA01"
FT                   /protein_id="CAW92303.1"
FT                   /translation="MWYNKGMENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTN
FT                   AIYGFHLMLDHMMKRVQPTHVLVAFDAGKTTFRTELFADYKAGRAKTPDEFREQFPYIR
FT                   DMLGALGIAFYELEHYEADDIIGTLDKMAERTEIPFDVTIVSGDKDLIQLTDANTVVEI
FT                   SKKGVAEFEEFTPAYLMDKMGLTPEQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEY
FT                   GSLEGIYEHIDSFKPSKMKENLLHDKEQAFLSKTLATINTSAPITIGLEDIVYQGPDLD
FT                   RLSQFYDEMDFVQLKNALASQLPQEPVAEIAYQEVTDIRADMFSDDTVFYFEALRDNYH
FT                   REELIGFAWGNQGQIYASADISLLTTKLFKKVLEQPIATYDFKRSKVLLSHLGLDLPAA
FT                   SYDARLANYLLSTVEDNEMATLARLYTTISLDTDEVVYGKGVKRAVPDKAVLLGHLARK
FT                   VQVLLDSRPVMLDKLAEHEQADLYTDIELPLANVLAKMEIEGIAVNQDSLQEMAEQNKV
FT                   VIEELTQEIYEMAGEVFNINSPKQLGVILFEKMQLPLHLTKKTKTGYSTAVDVLERLAP
FT                   IAPIVAKILDYRQITKLQSTYVIGLQDYIMADGRIHTRYLQDLTQTGRLSSVDPNLQNI
FT                   PIRLEQGRLIRKAFTPSHDDAVLLSSDYSQIELRVLAHISGDEHLIAAFKEGADIHTST
FT                   AMRVFGIEKPEDVTANDRRNAKAVNFGIVYGISDFGLSNNLGIPRKQAKAYIDTYFERY
FT                   PGIKAYMERVVREAKDKGYVETLFKRRRQLPDINSRQFNVRSFAERTAINSPIQGSAAD
FT                   ILKIAMINLDQALVAGGFETKMLLQVHDEIVLEVPNHELAAVKALVKETMESAVSLAVP
FT                   LRVDESAGKSWYEAK"
FT   misc_feature    232761..233279
FT                   /locus_tag="SEQ_0252"
FT                   /note="HMMPfam hit to PF02739, 5'-3' exonuclease,
FT                   N-terminal resolvase-, score 1.7e-93"
FT                   /inference="protein motif:PFAM:PF02739"
FT   misc_feature    233283..233585
FT                   /locus_tag="SEQ_0252"
FT                   /note="HMMPfam hit to PF01367, 5'-3' exonuclease,
FT                   C-terminal SAM fold, score 5.8e-56"
FT                   /inference="protein motif:PFAM:PF01367"
FT   misc_feature    233667..234122
FT                   /locus_tag="SEQ_0252"
FT                   /note="HMMPfam hit to PF01612, 3'-5' exonuclease, score
FT                   0.011"
FT                   /inference="protein motif:PFAM:PF01612"
FT   misc_feature    234237..235385
FT                   /locus_tag="SEQ_0252"
FT                   /note="HMMPfam hit to PF00476, DNA polymerase family A,
FT                   score 6.7e-212"
FT                   /inference="protein motif:PFAM:PF00476"
FT   misc_feature    234864..234923
FT                   /note="PS00447 DNA polymerase family A signature."
FT                   /inference="protein motif:Prosite:PS00447"
FT   misc_feature    235554..235586
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        235631..236083
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0254"
FT                   /product="putative CoA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92305"
FT                   /db_xref="GOA:C0MA02"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA02"
FT                   /protein_id="CAW92305.1"
FT                   /translation="MIDTFQNPSDETITSYLESSKTIAVVGLSDRQTTAAYDVARFMQA
FT                   KGYRIVPVNPRLAGQSVLGEVVYASLAAIPFKVDIANVFRRSEYLPQVAQDFLACQGQV
FT                   FWAQLGLYSQEAEELLRSAGKADIVMNRCIKIDYLRLISKQDQDSC"
FT   misc_feature    235676..235960
FT                   /locus_tag="SEQ_0254"
FT                   /note="HMMPfam hit to PF02629, CoA binding domain, score
FT                   1.1e-06"
FT                   /inference="protein motif:PFAM:PF02629"
FT   CDS_pept        236120..236593
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0255"
FT                   /product="ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92307"
FT                   /db_xref="GOA:C0MAH1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH1"
FT                   /protein_id="CAW92307.1"
FT                   /translation="MDIHSHQQALNAYENVLEHLRDKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPQYPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EVCGTIADFMDVDVMDIAKEAHQQTGYKVTRIPVIAYGVCPSCQTKQGKDTDY"
FT   misc_feature    236183..236542
FT                   /locus_tag="SEQ_0255"
FT                   /note="HMMPfam hit to PF01475, Ferric uptake regulator
FT                   family, score 6.8e-50"
FT                   /inference="protein motif:PFAM:PF01475"
FT   CDS_pept        236953..238779
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0256"
FT                   /product="putative cell surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92309"
FT                   /db_xref="GOA:C0MAH2"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH2"
FT                   /protein_id="CAW92309.1"
FT                   /translation="MKKFTKRCLKGCGLVGLVFSTGLVALSDNIDSALTVGAETTTASA
FT                   FENNGTGQHLNWHIDIPQEYTVELGEPITISDLMSQITVTRKGSNGTVNDGDTFDFISN
FT                   GDGSRGIDTPGVKIWFDFYNAAGTSFLTDEMLASPTYAVPGGSYTIKAWVFYGKNDTKK
FT                   LFTFKLKNSNSNKTELRKSLEEAKLKLSQPEGTYSDESLQALQSAVTLGKTYLNSDPDQ
FT                   NTVDQSVTTIDSAITSLVNLNALNEAINQATPFITDGKEYPKEAYDGLVQKLAAAAKLQ
FT                   NSFGPSQGDVDKAATDLTQALTTLKTAVAHEALDQALAKLLELYRENPNLALTSESLKE
FT                   LYNKAIEAAGTFYRTVNKDKERKDISLYELERYTTETNSVVDTILKVKAAIAEEGKAKL
FT                   RSALDQLNALIGENLDLSPYTAASAQAYTDQLAKAKEVAAAGETAYAQETEPTAITNSL
FT                   VKVLNAKKSLSDAKAALVAKPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVD
FT                   PVDPVDPVDPVDPVDPIDPADPVKPSDPEVKPEPKPESKPEAKKEDKKAADKQQVLPAT
FT                   ADTANPFFTAAALAVIACAGQLAIVSRRKESN"
FT   sig_peptide     236953..237066
FT                   /locus_tag="SEQ_0256"
FT                   /note="Signal peptide predicted for SEQ0256 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.726 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    238645..238767
FT                   /locus_tag="SEQ_0256"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   1.8e-07"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    238702..238734
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        238914..242876
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0257"
FT                   /product="putative carbohydrate-binding exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92311"
FT                   /db_xref="GOA:C0MAH3"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="InterPro:IPR038637"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH3"
FT                   /protein_id="CAW92311.1"
FT                   /translation="MFKPYTDGKQRFAIKTFKTGAASVLVATLFLTLGLTTVSADEQQV
FT                   TASAAIATTLEAQEAVDQQAADQSATAAQDTAAEGSSETLPVVIGTATTETTDSKSQVA
FT                   AAEQATEASAEETTKQEQTEVSQAVETTNKTEAKDYIYLSDETRVNPSKVGHGSFLQDK
FT                   NPAGGTITLVVDGEVLAFDKGIAVHAPSQLYYDVEQYSNEYTRLSAYLGVDYSRRGKDD
FT                   GVSFNIYKSKDGKSWESLVTTGTVTGTSEAVYVDLDITGAKYVKLIANSLKNNGNDHSV
FT                   YADLRLLKTDYDLSSEVSYDRLKTTEEYDALLSKNSVTDNYDNPDNLALVLEREFVNRV
FT                   GYHTIQSAVKKNEKVKVALDWLLSDEDALSLFLEAGSMFNGSTLKTLNALGDLYATNKA
FT                   DLEDKGNGYVYKKMMLATAVAYCKEIKSFVVNYGGTYLASDPVLKYQAFKELYRDNEFL
FT                   RKEEFANYNMELVRAVMDAKIDDEEILWLHHYAEQKYGDKVASYTSGYSYTKYKNIGYG
FT                   GADMRSADNQAQWTEKYQLVGTLNDDAFNVTYDNRHRIWMLMEKGAVCWGLSNLGVAVN
FT                   EVFGIPAVNIYQNDHEAYLVYRQDDQGNGIWDIRDNVYGNRWAISYSRWGTTTATEARL
FT                   LLGWGLKSYNDIHKNASYMLLAQAALNQYDKFKESLYYNLIANVYEAGSDQQIEAYSKA
FT                   LDVLELNLDTYDGLIEAYAKNGQKTDQDWLDLGKRVIAAYTYYPQVMVEAIKRITPNIS
FT                   DQAAKAELDLLSYNALIAAKTATDKEVLQSNEVRIIANYILTGNPIETASFSFDDKTLR
FT                   LHENYQDTDLTVRYSIDNGKTWLETKDKVIVFSDDLLAKLNIEDGILVGFDAVSATYRI
FT                   NLTKAAAPTNSSLYGNDLENRLIGAIEHLEVSLDNGQSWQAYDGTERFNDTVTVLARYR
FT                   AHGTSLASDSVTYTFTADSTDPTMHYISIDDIQAVTYANEQSGRSGKHMVDGRDMATQW
FT                   HTLFNQVTEDKSYTVEFKDDKNFSAIAYLPGGVNGMIHSAKVDISSDGKVWTTVVDSTD
FT                   WKQNTELKTVSFTPTTGRFVRITALDTYGKSSGQANKFVSGSAYRFFEDISSPIEAPVR
FT                   NDILALKDSILTILKETNTATKEIESFAITNSGLTAATTEKNQAIQGKILETIKDLGLT
FT                   GTYYITLENTGTYDDLADLLNHQLVITYQDKAAGPLYVLAMNSLSSGDEALDAEYSLDL
FT                   IKSALKSALESENIDLKTFEGLSISSQLPAAKTAVNTALMEKLQQLLPGDYFIDLAGLP
FT                   TAASIDELLDSQLFIYYRESHWTTAYALDRGAFQQL"
FT   sig_peptide     238914..239033
FT                   /locus_tag="SEQ_0257"
FT                   /note="Signal peptide predicted for SEQ0257 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.604 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    238929..239009
FT                   /locus_tag="SEQ_0257"
FT                   /note="HMMPfam hit to PF04650, YSIRK type signal peptide,
FT                   score 2.5e-05"
FT                   /inference="protein motif:PFAM:PF04650"
FT   misc_feature    238974..239033
FT                   /locus_tag="SEQ_0257"
FT                   /note="1 probable transmembrane helix predicted for SEQ0257
FT                   by TMHMM2.0 at aa 21-40"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    239316..239780
FT                   /locus_tag="SEQ_0257"
FT                   /note="HMMPfam hit to PF08305, NPCBM domain, score 1.2e-16"
FT                   /inference="protein motif:PFAM:PF08305"
FT   misc_feature    241386..241421
FT                   /locus_tag="SEQ_0257"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   0.63"
FT                   /inference="protein motif:PFAM:PF02012"
FT   misc_feature    241614..241649
FT                   /locus_tag="SEQ_0257"
FT                   /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
FT                   2.3"
FT                   /inference="protein motif:PFAM:PF02012"
FT   misc_feature    241794..242171
FT                   /locus_tag="SEQ_0257"
FT                   /note="HMMPfam hit to PF00754, F5/8 type C domain, score
FT                   1.7e-12"
FT                   /inference="protein motif:PFAM:PF00754"
FT   misc_feature    242127..242150
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(243072..243917)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0258"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92313"
FT                   /db_xref="GOA:C0MAH4"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH4"
FT                   /protein_id="CAW92313.1"
FT                   /translation="MSIREIKREARQTLKGLKGKYLLFLVPIILSIFYSGIEVHQTYVT
FT                   TQGIEVSVGASYFPLIVLIMLTVFTLSAAYTMLDVIRYYRREVSFSEATIAFSGNLFGK
FT                   VLVLLIIKGLLFILWSLIWIVGLVILTISSAALLTSYNTGAAVMTPIIFMVIGFVIFII
FT                   GLIVYMNRYCAYSMAEYILYDKVKEGTYMGAITAIEESKDMISGYKGKYFLLHLSFIGW
FT                   FILVILSFGLIYIYVLPYYTTADVTFYHHLKHIHDETELPIDAERLTITGSKEAPSAIS
FT                   "
FT   misc_feature    complement(243150..243917)
FT                   /locus_tag="SEQ_0258"
FT                   /note="HMMPfam hit to PF06161, Protein of unknown function
FT                   (DUF975), score 4e-79"
FT                   /inference="protein motif:PFAM:PF06161"
FT   misc_feature    complement(join(243213..243281,243414..243482,
FT                   243510..243578,243693..243761,243789..243857))
FT                   /locus_tag="SEQ_0258"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0258 by TMHMM2.0 at aa 28-50, 60-82, 121-143, 153-175
FT                   and 220-242"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        244322..245464
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0259"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92315"
FT                   /db_xref="GOA:C0MAH5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAH5"
FT                   /protein_id="CAW92315.1"
FT                   /translation="MTNYPITYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKEIGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQAILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVSMDFPGYSIGGLA
FT                   VGESHAEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVVKNAKFAEDFTPLDHHCDCYTCQHYTRAYLRHLLKADETFGMRLTSYHN
FT                   LYFLVNLMKQVRQAILDDNLLEFRQDFLERYGYNSSSRNF"
FT   misc_feature    244715..245428
FT                   /locus_tag="SEQ_0259"
FT                   /note="HMMPfam hit to PF01702, Queuine
FT                   tRNA-ribosyltransferase, score 4.8e-145"
FT                   /inference="protein motif:PFAM:PF01702"
FT   CDS_pept        245894..247138
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0260"
FT                   /product="putative collagen-like cell surface-anchored
FT                   protein SclH"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92316"
FT                   /db_xref="GOA:C0MAH6"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH6"
FT                   /protein_id="CAW92316.1"
FT                   /translation="MRNKKTSIRLVQKYGICSAVVALATIASLGIGNDVRAEDFTYPSM
FT                   YNQGYFFQQFIKKEILNPGSGSSSDWETSTHYNNGRMLENVLRYLWRVEQFLKKSTGQS
FT                   EQLYKLYEKDSLGIPGPQGPMGPAGPQGLRGERGPVGERGPIGPQGPEGKPGQQGPKGD
FT                   TGPQGEPGQQGPKGDIGPQGEPGLPGPKGDTGPQGAPGQQGPKGDTGPQGEQGLQGPKG
FT                   DTGPQGAPGQQGPKGDTGPQGEPGQPGPKGDTGPQGEQGLQGPKGDTGPQGAPGQQGPK
FT                   GDTGPQGAPGQQGPKGDTGPQGVPGQQGESQKVPEVPKAPETPEKKEQPQAPKEPETPK
FT                   APEQSPAPQAPKSSEQPASPKAPAPQSAPNKSAAPAAQKGTLPATGEANHPFFTLAALS
FT                   VIASAGVLGLKKKQD"
FT   sig_peptide     245894..246004
FT                   /locus_tag="SEQ_0260"
FT                   /note="Signal peptide predicted for SEQ0260 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.959 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    245930..245998
FT                   /locus_tag="SEQ_0260"
FT                   /note="1 probable transmembrane helix predicted for SEQ0260
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    246251..246430
FT                   /locus_tag="SEQ_0260"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 3.5e-12"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    246431..246610
FT                   /locus_tag="SEQ_0260"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 2.4e-12"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    246611..246790
FT                   /locus_tag="SEQ_0260"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 1.4e-12"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    247013..247132
FT                   /locus_tag="SEQ_0260"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   1.5e-11"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    247037..247054
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   repeat_region   complement(247670..249098)
FT                   /note="ISSeq3"
FT   repeat_region   247678..247689
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        complement(247702..248505)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0261"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92318"
FT                   /db_xref="GOA:C0M6L9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6L9"
FT                   /protein_id="CAW92318.1"
FT                   /translation="MLEILDLSRSTYYYQVKQLAQEDKDMDLKELIQGIYDEHHGNYGY
FT                   RRIHLELRNRGFIVNHKKVQRLMTVMGLKARIRRKRKYSSYKGEVGKKADNLIKRQFEG
FT                   SKPYEKCYTDVTEFTLPEGKLYLSPVLDGYNSEIIDFTLSRSPDLKQVQTMLEKAFPAD
FT                   SYNGTILHSDQGWQYQHQSYHHFLETKGIRPSMSRKGNSPDNGMMESFFGILKSEMFYG
FT                   LETTYQSLNELEQAITDYIFYYNNKRIKAKLKGLSPVQYRTKSFH"
FT   misc_feature    complement(247717..248199)
FT                   /locus_tag="SEQ_0261"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   1.1e-37"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(248529..249044)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0262"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92319"
FT                   /db_xref="GOA:C0M663"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M663"
FT                   /protein_id="CAW92319.1"
FT                   /translation="MTLSYEDKVQIYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    complement(248601..248882)
FT                   /locus_tag="SEQ_0262"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    complement(248685..248723)
FT                   /locus_tag="SEQ_0262"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   misc_feature    complement(248925..248990)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(249079..249090)
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        249478..249789
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0263"
FT                   /product="CHY zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92321"
FT                   /db_xref="GOA:C0MAU4"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU4"
FT                   /protein_id="CAW92321.1"
FT                   /translation="MRNCFGIALDQEYRCVHYHTVLDIVGLKCARCQAYYACYHCHDTL
FT                   QDHAFEPTDHKETYPVICGHCRQLLRRSEYECGSCPFCFSPFNPAYHKHQDIYFSKEL"
FT   misc_feature    249520..249738
FT                   /locus_tag="SEQ_0263"
FT                   /note="HMMPfam hit to PF05495, CHY zinc finger, score
FT                   4e-25"
FT                   /inference="protein motif:PFAM:PF05495"
FT   misc_feature    249589..249606
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS_pept        249793..250332
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0264"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92323"
FT                   /db_xref="GOA:C0MAU5"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU5"
FT                   /protein_id="CAW92323.1"
FT                   /translation="MLSTKDLVKVAMMTTLIIILGLIPAIPLGFVPVPIVLQNLGVMLA
FT                   GLILGGKKGTLSILLFLVIGLFLPVFSGSRTTVPVLMGPSAGYVLAWLFVPLVFAFLYR
FT                   SWLARYRSLAFLAIFISGVLLVDLLGTIWLAVYTDMPLTRSLVASLVFIPGDTIKAVIA
FT                   TALAVSYKDSFLNTNS"
FT   sig_peptide     249793..249906
FT                   /locus_tag="SEQ_0264"
FT                   /note="Signal peptide predicted for SEQ0264 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.956) with cleavage site
FT                   probability 0.239 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(249835..249903,249937..250005,250048..250116,
FT                   250135..250203,250231..250299)
FT                   /locus_tag="SEQ_0264"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0264 by TMHMM2.0 at aa 15-37, 49-71, 86-108, 115-137 and
FT                   147-169"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    249868..250314
FT                   /locus_tag="SEQ_0264"
FT                   /note="HMMPfam hit to PF02632, BioY family, score 3e-18"
FT                   /inference="protein motif:PFAM:PF02632"
FT   CDS_pept        250431..251213
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0265"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92325"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU6"
FT                   /protein_id="CAW92325.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTAYLVTGHDGFQLLMDAGSRSLNELE
FT                   KEINPLDLDAVIISHYHPDHVADLGVLRHYYQLYPRHLGKPRLLPIYGHDEDEAEFAKL
FT                   TLPGVSKGIAYQVDRVEALGPFDITFIKTVHPVVCYAFRIVERATGQVLVFTGDTGYFE
FT                   ELADFAAEADVFLADVYLYEGNEHHMAHLTSKEAGQLASRAKVKRLVLTHMPPLPPEGI
FT                   DPKRHLEVLRQQAQGYAGQIPVDLALPHRAWDLGSLSQ"
FT   CDS_pept        251210..251704
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0266"
FT                   /product="putative deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92326"
FT                   /db_xref="GOA:C0MB72"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB72"
FT                   /protein_id="CAW92326.1"
FT                   /translation="MSYSKQEQEYFMREALKEAEKSLLKDEIPIGCVIVKAGHIIGRGH
FT                   NAREERNQAIMHAEIMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGLARIPHVVY
FT                   GASNQKFGGAGSLYQILTDERLNHRVQLEVGLLADDCAKLMQTFFRQRRDQKKQDKESK
FT                   I"
FT   misc_feature    251222..251527
FT                   /locus_tag="SEQ_0266"
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminas, score 6.7e-34"
FT                   /inference="protein motif:PFAM:PF00383"
FT   misc_feature    251378..251491
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT                   /inference="protein motif:Prosite:PS00903"
FT   misc_feature    251501..251623
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   CDS_pept        complement(251814..253040)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0267"
FT                   /product="putative lipoprotein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92328"
FT                   /db_xref="GOA:C0MB73"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB73"
FT                   /protein_id="CAW92328.1"
FT                   /translation="MKNKLSLFLLAALTIVGLSACAWRSNPLADKEQQFGLTGARRQQV
FT                   LDQIDQRYYYQQLSQAEKENYLLLYDSLSAFHEVTSLAPASKHSLMTTIDAFMMDNPAF
FT                   FWITSANYRLERSDQVAFVTFPLPEKVEQTYHRLQAIGDDIIADMPATNDYERVRYFYE
FT                   WIIKQTDYNRDAFEAYQSGHEALIASNQDIRSVFLDHLSVCNGYAQAFQFLCQKAGIPV
FT                   AYIRGSVTFDRSQDVFTHAWNTVQIAGKNYAVDTTFGDPVFDQNESIKQLEVNYNFLCL
FT                   PDQLMKQSHQASRDIVINQTETLTDVWTIPECSDDSLLYTKLNHSYFTAFDRPDILASL
FT                   EQQLRTNQPQTSLQFANQDLYNQMVSDLEQHSDSYHSLFQAYWPNAAGYFYSLHPSTFS
FT                   ISISIINQQ"
FT   sig_peptide     complement(252975..253040)
FT                   /locus_tag="SEQ_0267"
FT                   /note="Signal peptide predicted for SEQ0267 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.417 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(252978..253010)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_RNA        253219..253311
FT                   /locus_tag="SEQ__m0010"
FT   CDS_pept        253353..253973
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0268"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92329"
FT                   /db_xref="GOA:C0MB74"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB74"
FT                   /protein_id="CAW92329.1"
FT                   /translation="MRKYLQIRLYELSHYVEIIISIILVISLLVLTGRLALSLTGIFTI
FT                   KSGIDTYLQSFLNQAMSIAIGVELIKMLSKHTSGTIIEVLLFAIARQIVVAHGSAKDSL
FT                   LSVIALAILFATRKYLFTSFDDTSSIIVRGSQKVKIANVLARVELPVINKNELMRDLML
FT                   RHLEEEGKTATIGASIAFSDVALRVDHMHEGVITRIEIIKSLK"
FT   misc_feature    253389..253457
FT                   /locus_tag="SEQ_0268"
FT                   /note="1 probable transmembrane helix predicted for SEQ0268
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        254370..255623
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0269"
FT                   /product="hyaluronan synthase"
FT                   /EC_number="2.4.1.212"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92331"
FT                   /db_xref="GOA:C0MB75"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB75"
FT                   /protein_id="CAW92331.1"
FT                   /translation="MRTLKNLITVVAFSIFWVLLIYVNVYLFGAKGSLSIYGFLLIAYL
FT                   LVKMSLSFFYKPFKGRAGQYKVAAIIPSYNEDAESLLETLKSVQQQTYPLAEIYVVDDG
FT                   SADETGIKRIEDYVRDTGDLSSNVIVHRSEKNQGKRHAQAWAFERSDADVFLTVDSDTY
FT                   IYPDALEELLKTFNDPTVFAATGHLNVRNRQTNLLTRLTDIRYDNAFGVERAAQSVTGN
FT                   ILVCSGPLSVYRREVVVPNIDRYINQTFLGIPVSIGDDRCLTNYATDLGKTVYQSTAKC
FT                   ITDVPDKMSTYLKQQNRWNKSFFRESIISVKKIMNNPFVALWTILEVSMFMMLVYSVVD
FT                   FFVGNVREFDWLRVLAFLVIIFIVALCRNIHYMLKHPLSFLLSPFYGVLHLFVLQPLKL
FT                   YSLFTIRNADWGTRKKLL"
FT   sig_peptide     254370..254450
FT                   /locus_tag="SEQ_0269"
FT                   /note="Signal peptide predicted for SEQ0269 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.925) with cleavage site
FT                   probability 0.465 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(254388..254456,254466..254534,255324..255392,
FT                   255420..255479,255498..255551)
FT                   /locus_tag="SEQ_0269"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0269 by TMHMM2.0 at aa 7-29, 33-55, 319-341, 351-370 and
FT                   377-394"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    254505..255617
FT                   /locus_tag="SEQ_0269"
FT                   /note="HMMPfam hit to PF03142, Chitin synthase, score
FT                   0.0039"
FT                   /inference="protein motif:PFAM:PF03142"
FT   misc_feature    254571..255086
FT                   /locus_tag="SEQ_0269"
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase family,
FT                   score 2.1e-31"
FT                   /inference="protein motif:PFAM:PF00535"
FT   CDS_pept        255876..257081
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0270"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92333"
FT                   /db_xref="GOA:C0MBJ5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ5"
FT                   /protein_id="CAW92333.1"
FT                   /translation="MKISVAGSGYVGLSLSILLAQHNDVTVVDIIDEKVRLINQGISPI
FT                   KDADIEEYLKNAPLNLTATLDGASAYSNADLIIIATPTNYDSERNYFDTRHVEEVIEQV
FT                   LDLNASATIIIKSTIPLGFIKHVREKYQTDRIIFSPEFLRESKALYDNLYPSRIIVSYE
FT                   KDDSPRVIQAAKAFAGLLKEGAKSKDTPVLFMGSQEAEAVKLFANTFLAMRVSYFNELD
FT                   TYSESKGLDAQRVIEGVCHDQRIGNHYNNPSFGYGGYCLPKDSKQLLANYRGIPQSLMS
FT                   AIVESNKIRKSYLAEQILDRASSQKQAGVPLTIGFYRLIMKSNSDNFRESAIKDIIDII
FT                   NDYGVNIVIYEPMLGEDIGYRVVKDLEQFKNESTIIVSNRFEDDLADVIDKVYTRDVFG
FT                   RD"
FT   misc_feature    255876..256433
FT                   /locus_tag="SEQ_0270"
FT                   /note="HMMPfam hit to PF03721, UDP-glucose/GDP-mannose
FT                   dehydrogenase, score 5.5e-58"
FT                   /inference="protein motif:PFAM:PF03721"
FT   misc_feature    255876..256391
FT                   /locus_tag="SEQ_0270"
FT                   /note="HMMPfam hit to PF01210, NAD-dependent
FT                   glycerol-3-phosphate deh, score 0.0011"
FT                   /inference="protein motif:PFAM:PF01210"
FT   misc_feature    256464..256745
FT                   /locus_tag="SEQ_0270"
FT                   /note="HMMPfam hit to PF00984, UDP-glucose/GDP-mannose
FT                   dehydrogenase, score 1.6e-36"
FT                   /inference="protein motif:PFAM:PF00984"
FT   misc_feature    256830..257060
FT                   /locus_tag="SEQ_0270"
FT                   /note="HMMPfam hit to PF03720, UDP-glucose/GDP-mannose
FT                   dehydrogenase, score 6.6e-06"
FT                   /inference="protein motif:PFAM:PF03720"
FT   CDS_pept        257131..258039
FT                   /transl_table=11
FT                   /gene="hasC1"
FT                   /gene_synonym="gtaB1"
FT                   /locus_tag="SEQ_0271"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase 1"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92335"
FT                   /db_xref="GOA:C0MBJ6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ6"
FT                   /protein_id="CAW92335.1"
FT                   /translation="MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   LKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQS
FT                   HPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVM
FT                   RVPHEEVSNYGVIAPQGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILE
FT                   NQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKD
FT                   DLTDYIIKLGKALESTQQQTK"
FT   sig_peptide     257131..257208
FT                   /gene="hasC1"
FT                   /gene_synonym="gtaB1"
FT                   /locus_tag="SEQ_0271"
FT                   /note="Signal peptide predicted for SEQ0271 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.956) with cleavage site
FT                   probability 0.948 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    257146..257955
FT                   /gene="hasC1"
FT                   /gene_synonym="gtaB1"
FT                   /locus_tag="SEQ_0271"
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl transferase,
FT                   score 3.2e-20"
FT                   /inference="protein motif:PFAM:PF00483"
FT   CDS_pept        complement(258131..258538)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0273"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pyogenes serotype M1 integral
FT                   membrane protein (rhomboid family) UniProt:Q491A8
FT                   (EMBL:CP000017 (223 aa) fasta scores: E()=6.5e-33, 70.229%
FT                   id in 131 aa;putative rhomboid family membrane protein
FT                   (fragment)"
FT                   /db_xref="PSEUDO:CAW92337.1"
FT   misc_feature    complement(258134..258388)
FT                   /locus_tag="SEQ_0273"
FT                   /note="HMMPfam hit to PF01694, Rhomboid family, score
FT                   2.6e-05"
FT                   /inference="protein motif:PFAM:PF01694"
FT   misc_feature    complement(join(258194..258253,258290..258358,
FT                   258437..258505))
FT                   /locus_tag="SEQ_0273"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0273 by TMHMM2.0 at aa 12-34, 61-83 and 96-115"
FT                   /inference="protein motif:TMHMM 2.0"
FT   sig_peptide     complement(258449..258538)
FT                   /pseudo
FT                   /locus_tag="SEQ_0273"
FT                   /note="Signal peptide predicted for SEQ0273 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.695 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(258535..259062)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0274"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92338"
FT                   /db_xref="GOA:C0MBJ8"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBJ8"
FT                   /protein_id="CAW92338.1"
FT                   /translation="MIKKDYRQLVLQRLAMMTPEDKLEKDLALLAAVVASSSYQEAQTL
FT                   VTYLPLPHEYQSHLLIERALQDGKTILVPKTRSRGEMVFVAYDPCDLIQTAFGLMEPRC
FT                   TIAVAKSEIDAIHVPGLVFHPAGYRIGYGGGYYDRYLRDYQGATFSTIYACQWEDFVVE
FT                   AHDIAVKEVYCQ"
FT   misc_feature    complement(258538..259056)
FT                   /locus_tag="SEQ_0274"
FT                   /note="HMMPfam hit to PF01812, 5-formyltetrahydrofolate
FT                   cyclo-ligase, score 1.4e-43"
FT                   /inference="protein motif:PFAM:PF01812"
FT   misc_feature    complement(258598..258630)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   repeat_region   join(259260..260435,261865..262475)
FT                   /note="ISSeq4"
FT   CDS_pept        join(259379..260434,261865..262488)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0275"
FT                   /note="CDS is disrupted by the insertion of the an IS
FT                   element after codon 352;transposase (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92340.1"
FT   repeat_region   complement(260436..261864)
FT                   /note="ISSeq3"
FT   repeat_region   260444..260455
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        complement(join(260468..260740,260744..261271))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0276"
FT                   /note="transposase (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92342.1"
FT   CDS_pept        complement(261295..261810)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0278"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92344"
FT                   /db_xref="GOA:C0M663"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M663"
FT                   /protein_id="CAW92344.1"
FT                   /translation="MTLSYEDKVQIYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    complement(261367..261648)
FT                   /locus_tag="SEQ_0278"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    complement(261451..261489)
FT                   /locus_tag="SEQ_0278"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   misc_feature    complement(261691..261756)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(261845..261856)
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        262550..263491
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0280"
FT                   /product="putative collagen-like cell surface-anchored
FT                   protein SclD"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92345"
FT                   /db_xref="GOA:C0MBY2"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBY2"
FT                   /protein_id="CAW92345.1"
FT                   /translation="MKLIDSYSHSNSGHVRISFGKGSYRKLRLFLPQKERKMRYTLNKN
FT                   KRARNYGLCSAAIALAAVASLGTAGSAKAEEAKTLDQLPNPEEQILYNYWDTNDQKARE
FT                   YLGDLYGFLKSYLGELEKKAKEPGPAGPKGEKGEKGEKGETGPMGPQGLKGEDGKDGAP
FT                   GEKGEKGDPGIQGPKGEKGDQGQKGEKGDQGQKGEKGDQGQKGEKGDQGQKGEKGDQGQ
FT                   KGEKGDQGQKGEKGDQGIQGQGEHGHKGHHGKDAKPSAPKADSKSTAKAMAPAAQKGTL
FT                   PATGETNHPFFTLAALGVIASAGMLTLKGKKN"
FT   sig_peptide     262550..262741
FT                   /locus_tag="SEQ_0280"
FT                   /note="Signal peptide predicted for SEQ0280 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.649) with cleavage site
FT                   probability 0.397 between residues 64 and 65"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    262691..262759
FT                   /locus_tag="SEQ_0280"
FT                   /note="1 probable transmembrane helix predicted for SEQ0280
FT                   by TMHMM2.0 at aa 48-70"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    262925..263101
FT                   /locus_tag="SEQ_0280"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 1e-10"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    263102..263281
FT                   /locus_tag="SEQ_0280"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copi, score 1.1e-10"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    263366..263485
FT                   /locus_tag="SEQ_0280"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   1.5e-08"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    263390..263407
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS_pept        263960..264562
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0281"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92347"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBY3"
FT                   /protein_id="CAW92347.1"
FT                   /translation="MISVKKNLCRLGVLSSSLLLLTAATTPSVIAFADIQTSAIKNNTD
FT                   DADGMYFVQSYEMSVEDKELLVRNVKANHPTVSEDFIREVIERQLVGDYTLPEEETLFR
FT                   SAWQGVTVDQLGAALDVAIGMALTGGAGSIAAGVLRVGKREAVGRVKSILIKYGLGKMI
FT                   AEIPVDYMLNLLSPGYHIARYIDSIDTVPNNNRINLW"
FT   sig_peptide     263960..264058
FT                   /locus_tag="SEQ_0281"
FT                   /note="Signal peptide predicted for SEQ0281 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.917 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(263996..264064,264308..264376)
FT                   /locus_tag="SEQ_0281"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0281 by TMHMM2.0 at aa 13-35 and 117-139"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(264978..265358)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0282"
FT                   /product="putative glucitol/sorbitol-specific
FT                   phosphotransferase system (PTS), IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92349"
FT                   /db_xref="GOA:C0M674"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:C0M674"
FT                   /protein_id="CAW92349.1"
FT                   /translation="MIKVFETRVTAIGSEAADMISAANMLILFDQGAPADLADFCYTID
FT                   NKQVSGSISAGGQLVIDQMAYDITAVGAVVEKNLAQLGHITISFDGSTASSLPGTLHVK
FT                   GKGLPQVRQGSLVQIFAWLRCS"
FT   misc_feature    complement(265005..265358)
FT                   /locus_tag="SEQ_0282"
FT                   /note="HMMPfam hit to PF03829, PTS system
FT                   glucitol/sorbitol-specific IIA, score 3.2e-56"
FT                   /inference="protein motif:PFAM:PF03829"
FT   CDS_pept        complement(265392..266384)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0283"
FT                   /product="putative glucitol/sorbitol-specific
FT                   phosphotransferase system (PTS), IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92351"
FT                   /db_xref="GOA:C0M675"
FT                   /db_xref="InterPro:IPR004702"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/TrEMBL:C0M675"
FT                   /protein_id="CAW92351.1"
FT                   /translation="MTYHSITVVKGSGGYGGPLTITPTEAKHKFIYITGGGKKPDIVDK
FT                   IAALTGMEAVNGFVTSIPDDEIALAIVDCGGTLRCGIYPKKGIPTINIVATGKSGPLAQ
FT                   YITEDIYVSAVGLEQITASDAQAHVASAKESSVPKASSYDTSKKITEQRAESSFVARIG
FT                   MGAGKVVAIFNQAAREAIQTLINTILPFMAFVSLLIGFIQGSGVGNWLAKLMVPLAGNI
FT                   WGLIIIGFICSLPFLSPLLGPGAVISQIIGTLIGVEIGKGTIPPQMALPALFAINTQNG
FT                   CDFIPVALGLSEANAETVEVGVPSVLYSRFLNGVPRVVVAWIASIGLYQ"
FT   misc_feature    complement(265398..265676)
FT                   /locus_tag="SEQ_0283"
FT                   /note="HMMPfam hit to PF07663, Sorbitol phosphotransferase
FT                   enzyme II C-t, score 2e-51"
FT                   /inference="protein motif:PFAM:PF07663"
FT   misc_feature    complement(join(265653..265721,265764..265832))
FT                   /locus_tag="SEQ_0283"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0283 by TMHMM2.0 at aa 185-207 and 222-244"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(265839..266375)
FT                   /locus_tag="SEQ_0283"
FT                   /note="HMMPfam hit to PF03612, Sorbitol phosphotransferase
FT                   enzyme II N-t, score 7.5e-111"
FT                   /inference="protein motif:PFAM:PF03612"
FT   CDS_pept        complement(266400..266945)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0284"
FT                   /product="putative glucitol/sorbitol-specific
FT                   phosphotransferase system (PTS), IIC2 component"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92353"
FT                   /db_xref="GOA:C0M676"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:C0M676"
FT                   /protein_id="CAW92353.1"
FT                   /translation="MEMITRFAEGFMKLFQLGGETFVSWMTGIVPVVLMLLVAMNALIG
FT                   ILGDQRVNQLAKISAKNPISRYMVLPFISAFMLGNPMAISMGRFMPEYYKPSYVAAQMQ
FT                   FCHTSNGVFPHINPGELFVWLGIASGIKTLGLSQMDLAIRYLLVGLIMNFVGGWVTDFT
FT                   TAYVAKQQGVTLSKMIEL"
FT   misc_feature    complement(266421..266945)
FT                   /locus_tag="SEQ_0284"
FT                   /note="HMMPfam hit to PF03608, PTS system enzyme II
FT                   sorbitol-specific facto, score 3.8e-135"
FT                   /inference="protein motif:PFAM:PF03608"
FT   misc_feature    complement(join(266466..266525,266676..266744,
FT                   266805..266873))
FT                   /locus_tag="SEQ_0284"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0284 by TMHMM2.0 at aa 25-47, 68-90 and 141-160"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(267081..267542)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0285"
FT                   /product="glucitol operon activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92355"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:C0M677"
FT                   /protein_id="CAW92355.1"
FT                   /translation="MSFMVIFGLFVIVAYLFQLLLGLRQLKHFNAVYASLRRQGRVAIG
FT                   RRAGKIRAGTIVMFALDQSGKVLDARQMQGVTVAARFKPMPAYIGQDIHYFDRYNPLIR
FT                   RENKLLRLAIEDAREVFLRVEAGVYEDAPKYASAFDWTLQAKQLLARFK"
FT   misc_feature    complement(267129..267533)
FT                   /locus_tag="SEQ_0285"
FT                   /note="HMMPfam hit to PF06923, Glucitol operon activator
FT                   protein (GutM), score 1.4e-66"
FT                   /inference="protein motif:PFAM:PF06923"
FT   misc_feature    complement(267474..267533)
FT                   /locus_tag="SEQ_0285"
FT                   /note="1 probable transmembrane helix predicted for SEQ0285
FT                   by TMHMM2.0 at aa 4-23"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(267542..269314)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0286"
FT                   /product="transcription antiterminator"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   orthologues. Possible gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92357"
FT                   /db_xref="GOA:C0M678"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C0M678"
FT                   /protein_id="CAW92357.1"
FT                   /translation="MSNAASSIGQLNDILDGDATITQQGAFLQLQVYDYARLETILAGS
FT                   LRKASDFNSASKRVAYLLKRLLQSSSALVIDDLADEIGVSRSTINKDLKAAKALARTYS
FT                   VMIQGKPNHGIQAVGTELNLRLLYVHEVYKYFEPQGLCGDSLFFLDELYQTYQLPRKIQ
FT                   ELLTKSFAITIERMRQGRYLTDPIPYYSNEVDSSAFMEELVYHIELAYQLSLSQYERQF
FT                   ISFPLNIQYIEDLAYQEKPLQQSIVRLYSKMIEHIKTSLLVTIDQDKLFVALHTHLKLL
FT                   VNRLIFHVQANDIFHGEIRYKYPLAFDMAIVAAQVLAEEFDCAIELSECSYLALYFEMM
FT                   MKDAEHVTEPTVKKIAVVCTTGRGTANMICRRLSKVLGPDLLISQFSEEQFNPDDNDHY
FT                   FAIFTTVPLKFGQLKSPVLQITNLFDDQWLQNEWRRVHHYHQKNLATITLHFARLSKGK
FT                   AYTDYLTEMAELLEEKQLVDRQFGQRLLEREALQSTLFGNRIAFPHTINDKETKTVLLL
FT                   GLLDEPYREHDCLVEFIFLVAISKRVEAQMEADLLKIYDDIFKIASDDKLQAELRSLKS
FT                   QAEFIAFTKEKGVF"
FT   misc_feature    complement(268295..268564)
FT                   /locus_tag="SEQ_0286"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 7.3e-12"
FT                   /inference="protein motif:PFAM:PF00874"
FT   misc_feature    complement(268907..269215)
FT                   /locus_tag="SEQ_0286"
FT                   /note="HMMPfam hit to PF05043, Mga helix-turn-helix domain,
FT                   score 0.0025"
FT                   /inference="protein motif:PFAM:PF05043"
FT   misc_feature    complement(268967..269143)
FT                   /locus_tag="SEQ_0286"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 1.1e-09"
FT                   /inference="protein motif:PFAM:PF08279"
FT   misc_feature    complement(269033..269098)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1780.000, SD 5.25 at aa 73-94, sequence
FT                   LVIDDLADEIGVSRSTINKDLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(269608..270957)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0287"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92359"
FT                   /db_xref="GOA:C0M6H9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6H9"
FT                   /protein_id="CAW92359.1"
FT                   /translation="MSHITFDYSKVLEQFAGQHEIDFLQGQVTEADQALRQGTGPGSDF
FT                   LGWLELPENYDKEEFARILKAAEKIKADSDVLVVIGIGGSYLGAKAAIDFLNSHFANLQ
FT                   TAKERKAPQILYAGNSISSSYLADLVDYVQDKDFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANHWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAVVRNILYRKGYVTEILANYEPSLQYF
FT                   SEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDKPRQNVI
FT                   IPEMAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFITLPEQDEFTLGYTIY
FT                   FFELAIALSGYLNGVNPFDQPGVEAYKKNMFALLGKPGFEELGAALNARL"
FT   misc_feature    complement(269620..270939)
FT                   /locus_tag="SEQ_0287"
FT                   /note="HMMPfam hit to PF00342, Phosphoglucose isomerase,
FT                   score 1e-153"
FT                   /inference="protein motif:PFAM:PF00342"
FT   misc_feature    complement(270310..270351)
FT                   /note="PS00765 Phosphoglucose isomerase signature 1."
FT                   /inference="protein motif:Prosite:PS00765"
FT   CDS_pept        complement(271133..272515)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0288"
FT                   /product="bifunctional GlmU protein [includes:
FT                   UDP-N-acetylglucosamine pyrophosphorylase;
FT                   glucosamine-1-phosphate N-acetyltransferase]"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92361"
FT                   /db_xref="GOA:C0M6I0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6I0"
FT                   /protein_id="CAW92361.1"
FT                   /translation="MKNYAIILAAGKGTRMKSGLPKVLHKVSGLSMLEHVLNSVSALAP
FT                   QKQLTVIGHQAEQVRAVLGDQSLTVVQEEQLGTGHAVMMAEEELSGLEGQTLVIAGDTP
FT                   LIRGESLKALLDYHIREKNVATILTANAKDPFGYGRIIRNVAGEVVNIVEQKDANEAEQ
FT                   EVKEINTGTYIFDNKRLFEALKHLTTDNAQGEYYLTDVISIFKAGQERVGAYLLKDFDE
FT                   SLGVNDRLALAQAEVIMQERINRQHMLNGVTLQNPAATYIESSVEIAPDVLIEANVTLK
FT                   GQTRIGSRSVITNGSYILDSRLGEGVVVSQSVIEDSVLADGVTVGPYAHIRPDSQLDES
FT                   VHIGNFVEVKGSHLGANTKAGHLTYLGNAEIGSEVNIGAGSITVNYDGQRKYQTVIGDH
FT                   AFIGSHSTLIAPVEVGENALTAAGSTIAQSVPADSVAIGRSRQVVKEGYAKRLPHHPDQ
FT                   PQ"
FT   misc_feature    complement(271232..271285)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 14"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271286..271339)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 1.2"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271361..271414)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 36"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271463..271516)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 42"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271517..271570)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 0.99"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271616..271669)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 9.6"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271670..271723)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (th, score 4.2"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    complement(271829..272506)
FT                   /locus_tag="SEQ_0288"
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl transferase,
FT                   score 1.6e-10"
FT                   /inference="protein motif:PFAM:PF00483"
FT   CDS_pept        complement(272684..273586)
FT                   /transl_table=11
FT                   /gene="gtaB2"
FT                   /gene_synonym="hasC2"
FT                   /locus_tag="SEQ_0289"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase 2"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92363"
FT                   /db_xref="GOA:C0M6I1"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6I1"
FT                   /protein_id="CAW92363.1"
FT                   /translation="MTKVRKAIIPTAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   LKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAINLHFIRQS
FT                   HPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVM
FT                   RVPHEEVSNYGVIAPQGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILE
FT                   NQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKD
FT                   DLTDYIIKLSKQLNKDVKK"
FT   misc_feature    complement(272762..273571)
FT                   /gene="gtaB2"
FT                   /gene_synonym="hasC2"
FT                   /locus_tag="SEQ_0289"
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl transferase,
FT                   score 2.1e-18"
FT                   /inference="protein motif:PFAM:PF00483"
FT   sig_peptide     complement(273509..273586)
FT                   /gene="gtaB2"
FT                   /gene_synonym="hasC2"
FT                   /locus_tag="SEQ_0289"
FT                   /note="Signal peptide predicted for SEQ0289 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.930) with cleavage site
FT                   probability 0.922 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(273612..274631)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0290"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92365"
FT                   /db_xref="GOA:C0M6I2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6I2"
FT                   /protein_id="CAW92365.1"
FT                   /translation="MPKQKVAILGPGSWGTALAQVLNDNGHEVRLWGNIPEQINEINTR
FT                   HTNSHYFKDIVLDEAIKATLDLKEALADIDAILFVVPTKVTRLVAKQVAQVLDHKAIVM
FT                   HASKGLEPGTHERLSTILEEEIPAQLRSEVVVVSGPSHAEETIVRDITLITAASKDITA
FT                   ARYVQTLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLKDIENNMGM
FT                   VIEGISTTKVAYEIAQELGVYMPITSAIYKSIYEGADIKESILGMMSNEFRSENEWHT"
FT   misc_feature    complement(273654..274088)
FT                   /locus_tag="SEQ_0290"
FT                   /note="HMMPfam hit to PF07479, NAD-dependent
FT                   glycerol-3-phosphate deh, score 1.2e-70"
FT                   /inference="protein motif:PFAM:PF07479"
FT   misc_feature    complement(274137..274622)
FT                   /locus_tag="SEQ_0290"
FT                   /note="HMMPfam hit to PF01210, NAD-dependent
FT                   glycerol-3-phosphate deh, score 1.4e-80"
FT                   /inference="protein motif:PFAM:PF01210"
FT   misc_feature    complement(274155..274616)
FT                   /locus_tag="SEQ_0290"
FT                   /note="HMMPfam hit to PF02558, Ketopantoate reductase
FT                   PanE/ApbA, score 0.00046"
FT                   /inference="protein motif:PFAM:PF02558"
FT   CDS_pept        274841..275290
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0291"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92367"
FT                   /db_xref="GOA:C0M6I3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6I3"
FT                   /protein_id="CAW92367.1"
FT                   /translation="MPRIIAELRELTHQVEQISEEIAKKYDLQHLAGPQGHVLVFLHCH
FT                   QDRDIFVKDIEKELQISKSVTSNLVKRMEKNGFIRVVASATDKRCKQVVLTSAGRAKLP
FT                   VLKECRRDIERYFFKEISREELLTVKKVIDQLKQNIRAYKGDTDA"
FT   misc_feature    274931..275146
FT                   /locus_tag="SEQ_0291"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 2.4e-13"
FT                   /inference="protein motif:PFAM:PF01047"
FT   CDS_pept        275283..276992
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0292"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92368"
FT                   /db_xref="GOA:C0M6Y7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y7"
FT                   /protein_id="CAW92368.1"
FT                   /translation="MLRNAVMKYKWYAALSLVMISGVVASALLQPHYLKDVLAAIMEND
FT                   QTRIAEVGFWLLVIAGIGLVSGAVNTILSAKIAQGVSADIREQTFRKIQSFSYANVEAF
FT                   NAGNLVVRMTNDINQIQNFVMMLFQILLRLPILFVGAFILAVQALPSLWWVLVLVVVMT
FT                   MVVIGLVMSQMGPRFGIFQRLMDRINQIAKENLRGVRVVKSFVQEKSQYDTFKEASNDL
FT                   LGLNLFIGYGFSIMQPILMLVSYMAIYLSLYLVSGLVKTDPAVIGNMASFMTYMGQISF
FT                   AITMVGFMGMQASRALTSIGRIREILETEPAMTFVNHEQEELTGSIVFDDVSFTYPNDS
FT                   EATLKHISFEVEPGQMVGIVGATGAGKSTLAQLIPRLFDPQEGQILIGGKALPSISQET
FT                   LRDTVSIVLQKAILFSGTIADNLRQGNPYADQLALENAARIAQAKEFIDRMDAGYQSEV
FT                   EERGNNFSGGQKQRMSIARGVINNPKILVLDDSTSALDAKSEKLVQEALNKELKETTTV
FT                   IIAQKISSVVKADKILVLDNGRLIGEGTHAELVASNPIYREIYETQKGREEN"
FT   sig_peptide     275283..275399
FT                   /locus_tag="SEQ_0292"
FT                   /note="Signal peptide predicted for SEQ0292 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.884 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(275316..275384,275436..275504,275565..275624,
FT                   275652..275720,275739..275807,275985..276053,
FT                   276072..276140)
FT                   /locus_tag="SEQ_0292"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SEQ0292 by TMHMM2.0 at aa 12-34, 52-74, 95-114, 124-146,
FT                   153-175, 235-257 and 264-286"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    275319..276131
FT                   /locus_tag="SEQ_0292"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 4.4e-21"
FT                   /inference="protein motif:PFAM:PF00664"
FT   misc_feature    276342..276896
FT                   /locus_tag="SEQ_0292"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.9e-50"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    276363..276386
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    276675..276719
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        276992..278788
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0293"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92370"
FT                   /db_xref="GOA:C0M6Y8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y8"
FT                   /protein_id="CAW92370.1"
FT                   /translation="MKILRFFWFYFKRYKLSFVVIFFAIVLATYLQVKAPVFLGDSLAE
FT                   LGEWVQRYYKAQALSKMTGQPLVEPSMAPFRTVMGKLLLAYLFTAVANLIYSLLFTRVI
FT                   SHSTNRMRKGLFGKLERLTVGFFDSHKDGAILSRFTSDLDNIQNSMNQSLIQVLTNIAL
FT                   YIGLVLMMFRQDSRLALVTIASTPVALILLVVIITMARKYTDLQQKEVSALNAYMDEKI
FT                   SGQKAIIVQGVQQDAIDGFIEHNERVRAATFKGRLFAGLLFPVMNGMSLLNTAIVIFAG
FT                   STIVLGDKSMSTAAALGLVVTFVQYSQQYYQPIMQIASSWGELQLAFTGAGRIQEMFDE
FT                   KEEVRPEHAPVFTALKEGVEIKHVDFGYLPGQKILSDVSISAPKGKMVAVVGPTGSGKT
FT                   TIMNLINRFYDVDAGSITFDGRDIREYDLDSLRQRVGIVLQESVLFSGTIADNIRFGNQ
FT                   TISQKEVETAARATHIHEFIMSLPDGYQTQVSDDENVFSTGQKQLISIARTLLTDPQVL
FT                   ILDEATSNVDTVTESKIQKAMEAIVAGRTSFVIAHRLKTILNADEIIVLKDGKVIEQGS
FT                   HHELLRQKGFYAELYHNQFVFE"
FT   sig_peptide     276992..277123
FT                   /locus_tag="SEQ_0293"
FT                   /note="Signal peptide predicted for SEQ0293 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.310 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    277031..277933
FT                   /locus_tag="SEQ_0293"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 6e-27"
FT                   /inference="protein motif:PFAM:PF00664"
FT   misc_feature    join(277037..277090,277235..277303,277451..277510,
FT                   277523..277591,277760..277828)
FT                   /locus_tag="SEQ_0293"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0293 by TMHMM2.0 at aa 16-33, 82-104, 154-173, 178-200
FT                   and 257-279"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    277766..277786
FT                   /note="PS00046 Histone H2A signature."
FT                   /inference="protein motif:Prosite:PS00046"
FT   misc_feature    278144..278698
FT                   /locus_tag="SEQ_0293"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-55"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    278165..278188
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        278950..279717
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92372"
FT                   /db_xref="GOA:C0M6Y9"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Y9"
FT                   /protein_id="CAW92372.1"
FT                   /translation="MIDLQEILARMNPNQKINYDRVMQQMTKVWARESIRPRILMHVCC
FT                   APCSTYTLEYLTQYADITVYFANSNIHPKDEYHRRAYVTQKFVAEFNDKTGNSVQFIEA
FT                   DYVPNEFVKTVRGLEKESEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAANIQGID
FT                   LVQVKKDAKAFMADKDLEADFPRIRFSYAGKEI"
FT   misc_feature    279064..279663
FT                   /locus_tag="SEQ_0294"
FT                   /note="HMMPfam hit to PF02677, Uncharacterized BCR,
FT                   COG1636, score 1e-46"
FT                   /inference="protein motif:PFAM:PF02677"
FT   CDS_pept        279919..280365
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0295"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92374"
FT                   /db_xref="GOA:C0M6Z0"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z0"
FT                   /protein_id="CAW92374.1"
FT                   /translation="MTRIRGFELVSGFTDTDLLPKRETAHAAGYDLSVAEETSIAPGEI
FT                   VLVPTGVKAYMQDGEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPANEGHIFAQMK
FT                   NITDQTITLSAGERIVQGVFMPFLIADGDQAGGERTGGFGSTGG"
FT   misc_feature    279961..280359
FT                   /locus_tag="SEQ_0295"
FT                   /note="HMMPfam hit to PF00692, dUTPase, score 1.7e-17"
FT                   /inference="protein motif:PFAM:PF00692"
FT   CDS_pept        280432..281793
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0296"
FT                   /product="putative DNA repair protein"
FT                   /note="CDS appears to lack an appropriate inframe
FT                   translational start site. There is an upstream, out of
FT                   frame methionine codon (ATG) that could be the
FT                   translational start site for this CDS, therefore this CDS
FT                   would be a pseudogene resulting from a frameshift mutation.
FT                   However, alignment of the N-termini of orthologues of this
FT                   CDS shows that the predicted translational start occurs at
FT                   an isoleucine codon (ATA), which has been shown to be a
FT                   rare translational start codon in some bacteria. Similar to
FT                   Streptococcus pyogenes serotype M6 RadA UniProt:Q5XDZ7
FT                   (EMBL:CP000003 (453 aa) fasta scores: E()=1.5e-133, 89.625%
FT                   id in 453 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92375"
FT                   /db_xref="GOA:C0M6Z1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z1"
FT                   /protein_id="CAW92375.1"
FT                   /translation="MAKKKARFICGECGYQSPKYLGRCPNCSAWSSFVEETEVKDVKNA
FT                   RISLTGEKSKPIKLKHINGVRYQRIQTEMNEFNRVLGGGVVPGSLVLIGGDPGIGKSTL
FT                   LLQVSIQLADKGTVLYVSGEESAEQIKMRSDRLGQTDNDFYLYAETNMQAIRAEIEAIQ
FT                   PDFLIIDSIQTIMSPEISGVQGSVSQVREVTAELLQLAKSNHIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFDMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQALVIPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTNPQEAFLGEIGLTGDI
FT                   RRVTRIEQRINEAAKLGFTKLYAPKSSLQGIDLPKGIEVVGVTTVGEVLKAVFT"
FT   misc_feature    280714..280737
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        282443..282589
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0297"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92377"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z2"
FT                   /protein_id="CAW92377.1"
FT                   /translation="MLPMSRLAHLPLVSVRLVLSACVKKQFSIQTFQAKDDKIDRQLKA
FT                   EIA"
FT   sig_peptide     282443..282544
FT                   /locus_tag="SEQ_0297"
FT                   /note="Signal peptide predicted for SEQ0297 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.662) with cleavage site
FT                   probability 0.652 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        282615..283121
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0298"
FT                   /product="putative carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92379"
FT                   /db_xref="GOA:C0M6Z3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z3"
FT                   /protein_id="CAW92379.1"
FT                   /translation="MSYFERFLSANEAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRITDDMLRSLVISQQQLGTREIVVLHHTDCGAQTFTNEAFTA
FT                   QLHDTLGVDVSDCDFLPFTDVEASVREDMAILQQSPLIPKDVVISGAVYDVATGRMSQV
FT                   AMPKS"
FT   misc_feature    282684..283106
FT                   /locus_tag="SEQ_0298"
FT                   /note="HMMPfam hit to PF00484, Carbonic anhydrase, score
FT                   1.2e-13"
FT                   /inference="protein motif:PFAM:PF00484"
FT   CDS_pept        283249..283962
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92381"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D6"
FT                   /protein_id="CAW92381.1"
FT                   /translation="MAYNRMTYTIDSSMQFPLVEIDLDMGESVFLQKGSMVYHTPSISL
FT                   NTKLNGRGSGLGKLVGAIGRSMVSGESMFITQAIANDVSGKLALAPSMPGQVIALELGV
FT                   DQYRLNDGAFLALDGSAHYTMKRQKLGKALFSGQGGFFVMSTQGEGTLLVNAFGSIKKI
FT                   TLHGDSMTIDNSHVVAWSQDLDYDIHLENGFMQSIGTGEGVVNTFSGYGDVYVQSLNLQ
FT                   QFAGVLQSYIVTGGH"
FT   misc_feature    283264..283944
FT                   /locus_tag="SEQ_0299"
FT                   /note="HMMPfam hit to PF01987, Protein of unknown function
FT                   DUF124, score 3.8e-84"
FT                   /inference="protein motif:PFAM:PF01987"
FT   CDS_pept        284564..286009
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0300"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92383"
FT                   /db_xref="GOA:C0M7D7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D7"
FT                   /protein_id="CAW92383.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGIDWDESPETHERYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYVNEYLGMSAYEKAAYIAEREAAGIVPTVRLAVNEA
FT                   GVYKWTDMVKGDIVFEGGNVGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPVFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEAEIFSREQLIALFDEIRLSKSPAAFDQKKMDWMSNEYFKHADLGAV
FT                   YALCKPFLEAAGRLTEKAEKLVELYQPQLSSADEIVPLTDLFFSDFPELTAKEKEVMAA
FT                   ETVPTVLKAFKEKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGREQSIEHIANML"
FT   misc_feature    284573..285541
FT                   /locus_tag="SEQ_0300"
FT                   /note="HMMPfam hit to PF00749, tRNA synthetases class I (E
FT                   and Q), cata, score 4.3e-158"
FT                   /inference="protein motif:PFAM:PF00749"
FT   misc_feature    284594..284629
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        286454..287800
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0301"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92384"
FT                   /db_xref="GOA:C0M7D8"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D8"
FT                   /protein_id="CAW92384.1"
FT                   /translation="MTDIYYLFLLLSLMIYYVTEISIFSFLSDIKLALWKQIFVLTAAL
FT                   FLNQFALLPPLIIDPLLLLAVLALEKRPCFSLKALFLAFVPGVFVDLLSRFILAIVLPY
FT                   IFSVNGSYVRHLVLDFIAYVMIFPSFALINYFVGKDYKQIVKADRFDKASSFYSLFLLF
FT                   SLAYYIDLFMILGFTDPFLDLKSPIMMSTSYKVLFLIFTLLLIYLLSYFNHQSKEFLKQ
FT                   ELKKEQQAYIANLETYGKHLEKLYKGVKVFQLVYLKRLERLGQAIDSGSVSDVQTVYAQ
FT                   TVDEATDYWDDKHYNISKLSKISVSSIKSLLSSKIIKAEKAGIALSLEVPDRIRDSYIS
FT                   ELDLLLLVSIFCDNAIEAALETAQPAVAIAYFLSDDQQIFTVTNTTKDERVMISRIFEE
FT                   GYSSKGSGRGIGLSNAKRILQKYPELSLRTRSHDYQFSQTLIMPKIEKE"
FT   misc_feature    join(286466..286534,286586..286654,286688..286756,
FT                   286799..286867,286916..286984,287012..287080)
FT                   /locus_tag="SEQ_0301"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0301 by TMHMM2.0 at aa 5-27, 45-67, 79-101, 116-138,
FT                   155-177 and 187-209"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    287468..287782
FT                   /locus_tag="SEQ_0301"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 9.2e-07"
FT                   /inference="protein motif:PFAM:PF02518"
FT   CDS_pept        287812..289110
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0302"
FT                   /product="putative sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92386"
FT                   /db_xref="GOA:C0M7D9"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7D9"
FT                   /protein_id="CAW92386.1"
FT                   /translation="MLGMSFFYALIFVNSWVIFSTFSGIKLAVRSLLLVGACFVVANLL
FT                   LDHVLLVDQLVFVAVSVGFAPHKKASEHLFNGLFAIMIVELLFRIIGSFLLPAVLGYSI
FT                   HQINNDIGLLMVCHALVLPAFYLFSYIFSVDLTLIKFISEDKLKKWVFWMNAALLFYYV
FT                   MVHCMINIQGDFFKIYFRYRSVMIFLYLMLLIWVIVKLDRFAKDQLSQRLALAQKERVA
FT                   YLEKHNQYIERLCREIRAIKHDSENILISLKDSIDSGDIAAISKVYQTVIQESASSIRQ
FT                   LTPELSALDNVQDSVIRSLLHAKLLEAKLQGIAVYIDIPETLASSSVRLLDVIVLFKVV
FT                   IDNAILSAKGSSRPFLSIAYFNQDGKRFFIIENSTRLKRVDIAKQFDASRLELGSHAHK
FT                   RLLQFSAVLERYPHITFSTKSDHYRLRQLLEMR"
FT   misc_feature    join(287830..287898,287926..287994,288031..288099,
FT                   288142..288210,288259..288327,288355..288408)
FT                   /locus_tag="SEQ_0302"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0302 by TMHMM2.0 at aa 7-29, 39-61, 74-96, 111-133,
FT                   150-172 and 182-199"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        289114..289854
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0303"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92388"
FT                   /db_xref="GOA:C0M7E0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7E0"
FT                   /protein_id="CAW92388.1"
FT                   /translation="MLNIFILEDNLIQQSRIEAIVASILEEGRIPHNQLEVFSNPQKLF
FT                   DSIQERGDHQLYFLDIEIGDKSRSGLELASDIRQKDPNAVLVFVTTHSEFAPISFRYKV
FT                   SALDFIDKAVDSQQFKERIEECIRYTYEMMSSRQVEEMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIHAVAPKLFLCHRSYLVNLDNVVRIDKAKQLVYF
FT                   ENGDSCMVSRLRMKQLFEKWKSFR"
FT   misc_feature    289117..289485
FT                   /locus_tag="SEQ_0303"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5.4e-07"
FT                   /inference="protein motif:PFAM:PF00072"
FT   misc_feature    289558..289842
FT                   /locus_tag="SEQ_0303"
FT                   /note="HMMPfam hit to PF04397, LytTr DNA-binding domain,
FT                   score 6.3e-26"
FT                   /inference="protein motif:PFAM:PF04397"
FT   CDS_pept        290346..290705
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0304"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92390"
FT                   /db_xref="GOA:C0M7E1"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7E1"
FT                   /protein_id="CAW92390.1"
FT                   /translation="MKKSYRVKREKDFQAIFKLGQSMANRKFVIYHLKGEHKHFRAGIS
FT                   VGKKLGNAVTRNAVKRKIRHVLMELGDHLKSEDFVVIARRGAEELDYQAVKQNLHHVLK
FT                   LAKLLEEGFEIEKKS"
FT   misc_feature    290346..290666
FT                   /locus_tag="SEQ_0304"
FT                   /note="HMMPfam hit to PF00825, Ribonuclease P, score
FT                   4.8e-28"
FT                   /inference="protein motif:PFAM:PF00825"
FT   CDS_pept        290671..291498
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0305"
FT                   /product="membrane protein OxaA 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92392"
FT                   /db_xref="GOA:C0M7E2"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7E2"
FT                   /protein_id="CAW92392.1"
FT                   /translation="MRKVLRLKKRVKTAALVPLVLLLVACGRGEVTAQSSSSWEQLVYF
FT                   FAKAIQWLSFDGSTGIGIILFTIMIRLLLLPLFNMQIKSGQKMQDIQPELKALQKKYAA
FT                   KDTATRMKLAEESQALYKKYGVNPYMSLLPLLIQMPVMFALFQSLTRVAFLREGTFLWV
FT                   ELARHDHLFILPILAAVFTFLSTWLTNLAAREKTAMITIMTYVMPVFIFFMGFNLASGV
FT                   VLYWAVSNAFQVVQLLLFNNPFKVIAERQRLADEEKERRAKERRARKRAMKRK"
FT   sig_peptide     290671..290769
FT                   /locus_tag="SEQ_0305"
FT                   /note="Signal peptide predicted for SEQ0305 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.536 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(290707..290766,290824..290892,291055..291123,
FT                   291181..291249,291286..291354)
FT                   /locus_tag="SEQ_0305"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0305 by TMHMM2.0 at aa 13-32, 52-74, 129-151, 171-193
FT                   and 206-228"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    290716..290748
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    290839..291405
FT                   /locus_tag="SEQ_0305"
FT                   /note="HMMPfam hit to PF02096, 60Kd inner membrane protein,
FT                   score 4.4e-56"
FT                   /inference="protein motif:PFAM:PF02096"
FT   CDS_pept        291510..292409
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0306"
FT                   /product="putative ssDNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92394"
FT                   /db_xref="GOA:C0M7E3"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7E3"
FT                   /protein_id="CAW92394.1"
FT                   /translation="MVLFTGKTVEEAIEKGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGINEKTVYKADKKAVRSVPEEINRQNAPVINPDEVELEEMKAVRSQDRRAAE
FT                   SDAHQPTGPLSTAQSAPTQSKAQPVSSAAGASQLDPAAADMSKDIELAAQEISDYVTKI
FT                   IYEMDIEASIERTNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDRYSKNFS
FT                   VSLNVHDYVEHRTETLIDFTKKVSKRVLESGQDYTMDPMSNSERKIVHKTVSAIDGVES
FT                   YSEGNDPNRYVVVSLIHD"
FT   misc_feature    292233..292400
FT                   /locus_tag="SEQ_0306"
FT                   /note="HMMPfam hit to PF01424, R3H domain, score 1.6e-11"
FT                   /inference="protein motif:PFAM:PF01424"
FT   CDS_pept        complement(292449..292697)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0307"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Streptococcus thermophilus transposase Tnp1193
FT                   UniProt:Q5LYW0 (EMBL:CP000024 (448 aa) fasta scores:
FT                   E()=1.9e-05, 45.333% id in 75 aa;transposase (fragment)"
FT                   /db_xref="PSEUDO:CAW92396.1"
FT   CDS_pept        293050..294858
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0308"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92398"
FT                   /db_xref="GOA:C0M7S8"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7S8"
FT                   /protein_id="CAW92398.1"
FT                   /translation="MSYNIKYDEITSLQQSTQTTISAWGDGITSIQTALSALIGDSRLQ
FT                   GQTASSIKSYLSEVHGTLLQTLQSLMNDYSASLLLYKDGYYQIDSNSHAQLPGQVFKTL
FT                   QSELRLSQAHLKDQLELLQNTRAKLSDLVHYSGVSHAKTVVDYSELITDIHRLDEAIIQ
FT                   YESNHASQDLAAFKELLASTKALIAEYSSKPKRAGSYQVGDIGQLNTIKRFATAYQGVA
FT                   RHLETNAKRLQAAQERDHARFEAVAAEDRAKQGWIDLALSLVTIAVGVAAIVMTAGAAT
FT                   PLVVGAFVVGSGTVAYGASNLYEAGHNIYLGSVGDGLTVATNPLRDTLFMGNDRLYHQI
FT                   GGLFTTASAALILIGQTKSVAKGLTEFTIGEVGGFIGGQASYHGTKLLGGSEQDAQRAT
FT                   LVGNILAGYAASSAARRFSLNEPIAARVTKPTYNHQQLLKNLENSRLARESSNFGGYIK
FT                   KESVTKYPTQIDSKVTVGAKENLPGWIADSFTDSHYRTVITGEEITLYRTFGGASDAGG
FT                   GFVTTVPATNRIQAKIDTALLPEWKNTRQYEAVIKIPKGSQLNIGKVAPQTVKSSGTTL
FT                   IGGGDQVLLPNRWPLEWIQEIRIVPN"
FT   CDS_pept        294873..295133
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92399"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7S9"
FT                   /protein_id="CAW92399.1"
FT                   /translation="MDNNNCFQYTQRLRELIELEYPKQKNYSGILRDLYVLTNDIDNNR
FT                   IVGNINFSSLARQFVDDTTQYDSPILKTLKDLEVCLNRKRR"
FT   CDS_pept        295235..295474
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0309a"
FT                   /note="Possible gene remnant;putative membrane protein
FT                   (fragment)"
FT   CDS_pept        295456..295878
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92402"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T0"
FT                   /protein_id="CAW92402.1"
FT                   /translation="MEHSQLEWEDVSQYEEVKGYGQQVWKRQGTYYLVTNEGGIAEQRV
FT                   VYELPYDLFELLEQGKRNLGEIAFKLRYDCWPPTEEEKIASDKAFLQRSPIALIADPTS
FT                   WELFTQEELRKLIPIAEQKWIDWKGKLPDDYVSPLK"
FT   CDS_pept        296077..296946
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0311"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal region of Streptococcus
FT                   pyogenes serotype M3 NAD glycohydrolase Nga UniProt:Q1J8R6
FT                   (EMBL:CP000262 (454 aa) fasta scores: E()=6.4e-34, 41.667%
FT                   id in 264 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92404"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="InterPro:IPR041934"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T1"
FT                   /protein_id="CAW92404.1"
FT                   /translation="MKNLENSRLATESSRFKSYVAREKLINTLRKQNADLNLITFREKA
FT                   IEIFNRDLKGNSWVSIRQADEFVETLDDYAQLSVDNGAVSTKADFYKMYSNKNYIYLDG
FT                   FIKNIKQLYIKTGASSIVNGQDLYNAIEQYGTIGRGKSGNFATSMAEDIALLYDSSGNL
FT                   VSSGMIEAIKGVDEGKYLSGAFQYEYSPQFVKSFDQIGEVRTVTGKTPGSSLLNIPGAK
FT                   TWAGKNMALSQSELMMPSIDTSNLKLEDVLLSMESTGIYTLNNPTIVLKDGTKKIVEGQ
FT                   FIIRKLGN"
FT   misc_feature    296479..296502
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        296948..297454
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0312"
FT                   /product="hypothetical protein"
FT                   /note="N-terminal region is similar to the N-terminus of
FT                   Streptococcus pyogenes hypothetical protein UniProt:Q5R2D9
FT                   (EMBL:AB128036 (161 aa) fasta scores: E()=0.17, 23.967% id
FT                   in 121 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92406"
FT                   /db_xref="InterPro:IPR032002"
FT                   /db_xref="InterPro:IPR038509"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T2"
FT                   /protein_id="CAW92406.1"
FT                   /translation="MTQTFFNNDVDERRRQLYLDARSKGHLEKCFRGDSGFKINAKDSY
FT                   FQSITDINVLIERCLYPLYDLGDSIIPHETERILSQFSTSKNVVELYQVVSYIFYQKNN
FT                   KLLKKNFSFYIDFNPMIPDLVFSVKRLSPENIVTDDEKAMVGFIKNMFQKIPQVQSYLE
FT                   AQNCK"
FT   CDS_pept        join(297598..297924,297928..298020)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0313"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   109;hypothetical protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92407.1"
FT   CDS_pept        298137..298253
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92409"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T4"
FT                   /protein_id="CAW92409.1"
FT                   /translation="MELPTTGIVELEKLGAREDWTGSLFFVSLSSLSSNNRT"
FT   CDS_pept        298549..299274
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0315"
FT                   /product="putative N-acetylmannosamine-6-phosphate
FT                   2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92411"
FT                   /db_xref="GOA:C0M848"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0M848"
FT                   /protein_id="CAW92411.1"
FT                   /translation="MLEKPSKAELLTALKDGLIVSCQALPGEPLYSEAGGIMPLMAKAA
FT                   EEAGAVGIRANGVRDIKEIQAVTDLPIIGIIKKEYPPQAPFITPTMAEVDALAALDVAV
FT                   IALDCTQRERHDGLAIADFIRSIRKKYPEQLFMADISTLEEGLVAYEAGIDFVGTTLSG
FT                   YTPYSRQGTGPDMELISALCDAGVSVIAEGKIHSPEEARAVQALGVAGIVVGGAITRPK
FT                   EIAERFVAALKKEEKSHGF"
FT   misc_feature    298660..299250
FT                   /locus_tag="SEQ_0315"
FT                   /note="HMMPfam hit to PF04131, Putative
FT                   N-acetylmannosamine-6-phosphate epi, score 5e-125"
FT                   /inference="protein motif:PFAM:PF04131"
FT   CDS_pept        299264..300775
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0316"
FT                   /product="sugar phosphotransferase system (PTS), IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92413"
FT                   /db_xref="GOA:C0M849"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C0M849"
FT                   /protein_id="CAW92413.1"
FT                   /translation="MDFKKFSKLGQAFMLPISILPVAGLLLGIGGALSNSNAIAQFPIL
FT                   NQAWLQAIFTIMSTAGNAVFANIALIFAIGVAVGLANGDKGTAGLSGAVAYLVFTATIS
FT                   GYLTLFSAKDAQIDTGVLGALTVGLVVVSLHNKYRKIELPAFLGFFGGSRFIPIVSSLA
FT                   AIVIGSVFYVIWPPIQNLLVVFGEKIADMGSIGTFLYGFFLRLTGAVGLHHTIYPMFWY
FT                   TSLGGSEVVAGETIQGAQNIFFAQLADANHTDLFTYGTRFFAGRFATMMFGLPAACLAM
FT                   YHAIPKANRKKVGSFYSSSALTSLLTGITEPIEFAFLFVAPWLYVVHAFLDGCSFLVAD
FT                   LLKIRIGNSFSGGLIDFLIFGVFQGNDHTNWLLVIPVGIVWFMVYYFVFKFFVSKFQVA
FT                   VPGMVAQVEAEGQAETTNTQSSSLREVSLAIIEALGGQANIEDVTACATRLRVSLSDSS
FT                   LVNKNVLTSLGATAVLDVKNGIQAIYGGKAILYSQEINQLLGRED"
FT   sig_peptide     299264..299377
FT                   /locus_tag="SEQ_0316"
FT                   /note="Signal peptide predicted for SEQ0316 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.427 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    299291..300262
FT                   /locus_tag="SEQ_0316"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 1.2e-95"
FT                   /inference="protein motif:PFAM:PF02378"
FT   misc_feature    join(299297..299365,299408..299506,299525..299593,
FT                   299606..299665,299726..299794,299837..299905,
FT                   300050..300118,300206..300274,300293..300361,
FT                   300374..300442)
FT                   /locus_tag="SEQ_0316"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0316 by TMHMM2.0 at aa 12-34, 49-81, 88-110, 115-134,
FT                   155-177, 192-214, 263-285, 315-337, 344-366 and 371-393"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    300542..300646
FT                   /locus_tag="SEQ_0316"
FT                   /note="HMMPfam hit to PF00367, phosphotransferase system,
FT                   EIIB, score 5.5e-14"
FT                   /inference="protein motif:PFAM:PF00367"
FT   misc_feature    300578..300631
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS01035"
FT   CDS_pept        300777..301292
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0317"
FT                   /product="putative glucose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92414"
FT                   /db_xref="GOA:C0M850"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:C0M850"
FT                   /protein_id="CAW92414.1"
FT                   /translation="MIKKWKQLLSAKKADALSDRILSVAKGQLVPITSVSDPVFSERLM
FT                   GDGFAIIPQEGAIYAPVTGRVMTVFPTKHAYGIVTPAGLEVLIHIGVDTVELGEAAFSS
FT                   DIVAGQEVVAGQLLAQVSLPVLEAAQKDSTVMVVFTNSQDIADMRLADAGAVAARAEVG
FT                   QVRLKATL"
FT   misc_feature    300822..301220
FT                   /locus_tag="SEQ_0317"
FT                   /note="HMMPfam hit to PF00358,
FT                   phosphoenolpyruvate-dependent sugar phosph, score 3.1e-48"
FT                   /inference="protein motif:PFAM:PF00358"
FT   misc_feature    301023..301061
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00371"
FT   repeat_region   complement(301564..301591)
FT                   /note="perfect repeat flanking IS element"
FT   repeat_region   complement(301591..303135)
FT                   /note="ISSeq2"
FT   CDS_pept        complement(301647..303044)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0318"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92416"
FT                   /db_xref="GOA:C0M7Y9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7Y9"
FT                   /protein_id="CAW92416.1"
FT                   /translation="MIESKKYLVIKAVCEGKKQKNRACVELGLSKRQVNRLILAYREKG
FT                   KSAFVHGNRSKRPTHAMSLETKRRIIEKYQSYGDLRPNVVHFCELLAEEENIAYSDTTV
FT                   RKLLYQAGFLSPKTQRATKRRLKQEAKQKKREAEKRGSKLPTASNFFEEPDKAHPSRAR
FT                   KKFKGELIQMEASQFPWFGQQETHLHVAIDDASGDIVGAYFDTQETLNGYYHVLEQILE
FT                   VHGIPFQFLTDKRTVFTYASSQSKKIEEDTFTQFGYACHQLGIAIETSSIPQAKGRVER
FT                   LNQTLQSRLPIDLQRNQITSISQANRYLKRWIKRFNKQFGGLASESVFEKAPKPAQRNL
FT                   LLARISERVIDSGHHIRYQNNFYLPVEGDKKIYFTRKTKALVIEAFDGDIYLNIADNIY
FT                   ATRKLPKHEKHSKEFEMVPKTKKERRKYIPPQSHPWKLASFKQYLHKIGKSYEEFKRER
FT                   NTSQPQL"
FT   misc_feature    complement(302055..302558)
FT                   /locus_tag="SEQ_0318"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   6.4e-17"
FT                   /inference="protein motif:PFAM:PF00665"
FT   misc_feature    complement(302904..302927)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   repeat_region   complement(303135..303162)
FT                   /note="perfect repeat flanking IS element"
FT   CDS_pept        303267..303401
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0319"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92418"
FT                   /db_xref="GOA:C0M852"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M852"
FT                   /protein_id="CAW92418.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLASRRRKGRKVLSA"
FT   misc_feature    303270..303329
FT                   /note="PS00784 Ribosomal protein L34 signature."
FT                   /inference="protein motif:Prosite:PS00784"
FT   CDS_pept        join(303688..304119,304123..304413)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0320"
FT                   /note="CDS contains a nonsense mutation (amber) after codon
FT                   144. Similar to Streptococcus pyogenes serotype M3 putative
FT                   N-acetylmannosamine-6-phosphate 2-epimerase NanE
FT                   UniProt:Q8K8P4 (EMBL:AE014074 (234 aa) fasta scores:
FT                   E()=9.5e-62, 76.923% id in 234 aa;putative
FT                   N-acetylmannosamine-6-phosphate 2-epimerase (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92420.1"
FT   misc_feature    join(303799..304119,304123..304389)
FT                   /locus_tag="SEQ_0320"
FT                   /note="HMMPfam hit to PF04131, Putative
FT                   N-acetylmannosamine-6-phosphate epi, score 1.4e-118"
FT                   /inference="protein motif:PFAM:PF04131"
FT   CDS_pept        304432..305745
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0321"
FT                   /product="extracellular solute-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92422"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E7"
FT                   /protein_id="CAW92422.1"
FT                   /translation="MKMKKLASFVMLGASVLGLAACGSSSKEADKSDSAAKTEITWWAF
FT                   PTFTQEKADDSVGTYEKKIIAAFEKANPDIKVKLETIDFTSGPEKITTAIEAGTAPDVL
FT                   FDAPGRIIEYGKNGKLADLNDLFTDEFIKDVNNDNIIQASKAGDTAYMYPISSAPFYMA
FT                   LNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFANL
FT                   YSSRITNDDVTKYTTDDANSVKSMEKIASWIKDGLLMNGSQYDGSADIQNFANGQTSFT
FT                   ILWSPAQAGTQAKLLEASKVDYVEVPFPSEDGKPELEYLVNGFAVFNNKDDKKIEASKK
FT                   FIQFIADDKEWGPKNVVRTGAFPVRSSYGNLYDDERMAMVSKWTQYYSPYYNTIDGFAE
FT                   MRTLWFPMVQAVSNGDEKPAAALKAFTEKANKTIEKAQ"
FT   sig_peptide     304432..304515
FT                   /locus_tag="SEQ_0321"
FT                   /note="Signal peptide predicted for SEQ0321 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.651 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    304459..305487
FT                   /locus_tag="SEQ_0321"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 1.1e-27"
FT                   /inference="protein motif:PFAM:PF01547"
FT   misc_feature    304465..304497
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        305846..306733
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0322"
FT                   /product="putative transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92423"
FT                   /db_xref="GOA:C0M8E8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E8"
FT                   /protein_id="CAW92423.1"
FT                   /translation="MNVNKLKMRETLVSYAFLAPVLVFFVVFVLVPMIMGFVTSFFNYT
FT                   MTDFTFVGLDNYVRMFQDPVFIKSLINTLIIVVGSVPIVVFFSLFVATKTYNKHVISRS
FT                   FYRAVFFLPVVTGSVAVTVVWKWIYDPMSGILNYVLKYGHVIEQNISWLGDKHWALLAI
FT                   IVILLTTSVGQPIILYIAAMGNIDNSLVEAARVDGATELQVFWKIKWPSLLPTTLYITV
FT                   ITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAILISLI
FT                   SFAQFKFLGNDVEY"
FT   sig_peptide     305846..305953
FT                   /locus_tag="SEQ_0322"
FT                   /note="Signal peptide predicted for SEQ0322 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.972) with cleavage site
FT                   probability 0.457 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(305879..305947,306053..306121,306158..306226,
FT                   306317..306385,306635..306703)
FT                   /locus_tag="SEQ_0322"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0322 by TMHMM2.0 at aa 12-34, 70-92, 105-127, 158-180
FT                   and 264-286"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    306041..306730
FT                   /locus_tag="SEQ_0322"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.7e-14"
FT                   /inference="protein motif:PFAM:PF00528"
FT   CDS_pept        306746..307576
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0323"
FT                   /product="putative transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92425"
FT                   /db_xref="GOA:C0M8E9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8E9"
FT                   /protein_id="CAW92425.1"
FT                   /translation="MRKKKLTASDILTTAILCLLTILFIFPFYWIMTGAFKSQPDTIVV
FT                   PPQWWPKAPTVENFKALIIQNPALKWLWNSIYISVATMLLVCGTSSLAGYALAKKRFYG
FT                   QRLLFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIIKPGFAALAIFTFINTWNDYFMQLVMLTSRDH
FT                   LTISLGVATMQAEMATNYGLIMAGAALAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   misc_feature    306746..306889
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   sig_peptide     306746..306856
FT                   /locus_tag="SEQ_0323"
FT                   /note="Signal peptide predicted for SEQ0323 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.534 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(306779..306847,306971..307039,307064..307132,
FT                   307145..307213,307289..307357,307460..307528)
FT                   /locus_tag="SEQ_0323"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0323 by TMHMM2.0 at aa 12-34, 76-98, 107-129, 134-156,
FT                   182-204 and 239-261"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    306959..307558
FT                   /locus_tag="SEQ_0323"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 7.3e-24"
FT                   /inference="protein motif:PFAM:PF00528"
FT   CDS_pept        307592..308047
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92427"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F0"
FT                   /protein_id="CAW92427.1"
FT                   /translation="MLYDVLENIRRYKGIHRHLDVAIDFLLTRDLRSLTDGKHVILEDK
FT                   VVLFIQHNCLNKEDNALFEYHKRYADLHLLVEGNERVRYGLGYKQEAVSFDEASDIGFV
FT                   TCERTYDLDLGNDCFCYFFPNEAHQPNGFNDDGDAVTKCLIKVLMED"
FT   misc_feature    307592..308041
FT                   /locus_tag="SEQ_0324"
FT                   /note="HMMPfam hit to PF04074, Domain of unknown function
FT                   (DUF386), score 2e-39"
FT                   /inference="protein motif:PFAM:PF04074"
FT   CDS_pept        308072..308722
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0325"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92429"
FT                   /db_xref="GOA:C0M8N5"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N5"
FT                   /protein_id="CAW92429.1"
FT                   /translation="MSSKKRKLMQSIFSLDSKWLRASATIFDLIVLNLLFVLSCLPVVT
FT                   IGIAKMALYASLRDYRQGDIGSVVGVYGSYLRRFAKRGLQLGILEVLLTSFILVDLYLI
FT                   QAQVSLFFQLFKISCIAILFVAIMVFLYAYPLAMRYDLPLMSLFQRSFILLSLFFPFSF
FT                   AFLAVMLLVVFLLQLSPLSLLGGLSLLAIIGISSLTYPYVVIMENLLQKVQLY"
FT   sig_peptide     308072..308233
FT                   /locus_tag="SEQ_0325"
FT                   /note="Signal peptide predicted for SEQ0325 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.795) with cleavage site
FT                   probability 0.601 between residues 54 and 55"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(308147..308215,308315..308383,308420..308488,
FT                   308531..308599,308618..308686)
FT                   /locus_tag="SEQ_0325"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0325 by TMHMM2.0 at aa 26-48, 82-104, 117-139, 154-176
FT                   and 183-205"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    308156..308374
FT                   /locus_tag="SEQ_0325"
FT                   /note="HMMPfam hit to PF04854, Protein of unknown function,
FT                   DUF624, score 1.6e-07"
FT                   /inference="protein motif:PFAM:PF04854"
FT   misc_feature    308159..308191
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        308751..309671
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0326"
FT                   /product="putative N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92431"
FT                   /db_xref="GOA:C0M8N6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N6"
FT                   /protein_id="CAW92431.1"
FT                   /translation="MKTLTKYQGIIPAFYACYDAEGNISPERVRALTQYYIDKGVQGLY
FT                   VNGSSGECIYQSVADRKLVLEHVMAVAKGKLTIINHVACNNTKDSIELAQHAEALGVDA
FT                   IAAIPPIYFRLPEHAVAAYWNAISAAAPNTDFVIYNIPQLAGIALTPSLYQEMLKNERV
FT                   IGVKNSSMPVQDIQTFCAIGGDDHLVFNGPDEQFLGGRLMGASAGIGGTYGAMPELFLR
FT                   LNQLIKDKDLETAKALQYAINDIIGLLVSAHGNMYGVIKEVLRINERLDIGSVRSPLPE
FT                   LTENDLVICQQAAALIKQTKEQFCS"
FT   misc_feature    308766..309653
FT                   /locus_tag="SEQ_0326"
FT                   /note="HMMPfam hit to PF00701, Dihydrodipicolinate
FT                   synthetase family, score 8e-35"
FT                   /inference="protein motif:PFAM:PF00701"
FT   misc_feature    308769..308801
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        309686..310570
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0327"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92433"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N7"
FT                   /protein_id="CAW92433.1"
FT                   /translation="MKRYLAIDIGGTAIKYGLMTETADILEKHEIATEAHKGGPAILDK
FT                   VKDLVATYQEAGLAGVAISSAGMVDPDKGEIFYAGPQIPNYAGTQFKRVIEETFGIPCD
FT                   VENDVNCAGLAEAISGSAKDCPVALCLTIGTGIGGCLLIDSQVFHGSSYSACEVGYIHL
FT                   PDGAFQDLASTTALVRDVARRHGDAVSDWNGRRIFEEAKAGNHHCIAAIDQLVDYLAQG
FT                   LANICYVANPNAIVLGGGIMAQKDYLQDKILAALNNYLVPSIAEKTQLRFASHENNAGM
FT                   IGAYYHFKHKEQV"
FT   misc_feature    309701..310216
FT                   /locus_tag="SEQ_0327"
FT                   /note="HMMPfam hit to PF00480, ROK family, score 8.8e-27"
FT                   /inference="protein motif:PFAM:PF00480"
FT   misc_feature    310073..310105
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        310570..310857
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0328"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus suis putative acetyl xylan esterase
FT                   UniProt:Q8RR40 (EMBL:AB071365 (323 aa) fasta scores:
FT                   E()=8.5e-20, 55.319% id in 94 aa;putative acetyl xylan
FT                   esterase (AXE1) family protein (fragment)"
FT                   /db_xref="PSEUDO:CAW92435.1"
FT   CDS_pept        complement(310884..311708)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0329"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92436"
FT                   /db_xref="GOA:C0M8N9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8N9"
FT                   /protein_id="CAW92436.1"
FT                   /translation="MIHNHRLISKMEAALDSMTSLEKSIAQFFMETDLKVEELTASDMI
FT                   KRLHVSQAALTRFAKKCGFTGYREFIFECQKSREAMDQKAPNLQNYNTKKVLMNYRELI
FT                   EKATELINEKQLQDIAQWIENAERIYFYGKGSSALAAKEFKLRLMRLGVICEALDDTDS
FT                   FTWVNSSITDKCLVIGFSLSAQTASVLEALQTAGTRGAKTVLLTTQTDEIPYQLDEIVH
FT                   IATARHLNYGNRISPQFPMLFVTDIIYAYFLEINKEGKTKIFQETIINPSDK"
FT   misc_feature    complement(310947..311351)
FT                   /locus_tag="SEQ_0329"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 1.9e-11"
FT                   /inference="protein motif:PFAM:PF01380"
FT   misc_feature    complement(311352..311696)
FT                   /locus_tag="SEQ_0329"
FT                   /note="HMMPfam hit to PF01418, Helix-turn-helix domain,
FT                   rpiR family, score 0.0006"
FT                   /inference="protein motif:PFAM:PF01418"
FT   CDS_pept        311937..312710
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0330"
FT                   /product="TatD related DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92438"
FT                   /db_xref="GOA:C0M8P0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P0"
FT                   /protein_id="CAW92438.1"
FT                   /translation="MIEIFDTHTHLNVDHFSGKEEEELALAKEFGVSYHNVVGFDQETI
FT                   DQALTLADAYREVYATIGWHPTEAGSYTQAVEDSLIACLKHPKVVALGEIGLDYYWMED
FT                   PKEVQIEVFKRQLQLAKDHDLPFVVHTRDALEDTYQVLKEAGVGPRGGIMHSYSGSLEM
FT                   AQRFVDLGMLISFSGVVTFKKAVDVQEAARHLPLDKLLVETDAPYLAPVPKRGRENHTA
FT                   YTRYVVEKIAELRGLSVEEIAAATTANAKRVFRID"
FT   misc_feature    311940..312701
FT                   /locus_tag="SEQ_0330"
FT                   /note="HMMPfam hit to PF01026, TatD related DNase, score
FT                   1.8e-122"
FT                   /inference="protein motif:PFAM:PF01026"
FT   misc_feature    311946..311972
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01137"
FT   misc_feature    312507..312557
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT                   /inference="protein motif:Prosite:PS01091"
FT   CDS_pept        312682..313278
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92440"
FT                   /db_xref="GOA:C0M8P1"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P1"
FT                   /protein_id="CAW92440.1"
FT                   /translation="MQRGCLELTEKLKIQEVIVVEGKDDTANLQRFYDVDTYETKGSAI
FT                   TDEDLERIDRLNKLRGVIVFTDPDYHGERIRKLIMRAVPTARHAFLRRHEAKPRSKSKG
FT                   RSLGVEHASFEDLQKALSQVTQSFDDESYFDISQTDLIRLGLLLAADSRKRREYLGEVL
FT                   RIGYSNGKQLLKRLKLFGITLSEVEDVMTSYQTEQ"
FT   misc_feature    312724..312957
FT                   /locus_tag="SEQ_0331"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   2.7e-07"
FT                   /inference="protein motif:PFAM:PF01751"
FT   CDS_pept        313622..314494
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0332"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92442"
FT                   /db_xref="GOA:C0M8P2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8P2"
FT                   /protein_id="CAW92442.1"
FT                   /translation="MRIADYSVTKSILDRYGFTFKKSFGQNFLTDTNILQKIVDTAEID
FT                   KSVNVIEIGPGIGALTEFLAERAAEVMAFEIDERLVPILADTLRDFDNVQVVNQDILKA
FT                   DLQTQLKQFSNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQREVADRISAE
FT                   PNTKAYGSLSIAVQYYMTAKIAFVVPRTVFVPAPNVDSAILKMTRRDQPLIEVQDEDFF
FT                   FRVSRVGFVHRRKTLWNNLVSHFGKAEDTKARLEQGLALAGIKPSIRGEALSIQDFGRL
FT                   ADALKQVGF"
FT   misc_feature    313670..314452
FT                   /locus_tag="SEQ_0332"
FT                   /note="HMMPfam hit to PF00398, Ribosomal RNA adenine
FT                   dimethylase, score 7.8e-77"
FT                   /inference="protein motif:PFAM:PF00398"
FT   misc_feature    313769..313852
FT                   /note="PS01131 Ribosomal RNA adenine dimethylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01131"
FT   CDS_pept        314655..315527
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0333"
FT                   /product="probable GTPase EngC"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92444"
FT                   /db_xref="GOA:C0M8P3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P3"
FT                   /protein_id="CAW92444.1"
FT                   /translation="MQGKIIKALAGFYYVESEGQVYQTRARGNFRKRGQTPYVGDLVEF
FT                   SAEDNSEGYILAIAERKNSLVRPPIVNIDQAAVIMSAKEPDFNTNLLDRFLILLEHKAI
FT                   HPIIYISKIDLLEQPESIEAIGQHYRAIGYDFVTSLSHLLPLLAGKTTVFMGQTGVGKS
FT                   TLLNRIAPELALETGDISDSLGRGRHTTRAVSFYDAYNGKIADTPGFSSLDYGIDNAED
FT                   LNEAFPELRRLSHSCKFRSCTHTHEPKCAVKEALGNGELWSVRYQNYLQFLSEIENRRE
FT                   TYQKVSKRK"
FT   misc_feature    314658..315476
FT                   /locus_tag="SEQ_0333"
FT                   /note="HMMPfam hit to PF03193, Protein of unknown function,
FT                   DUF258, score 9.8e-153"
FT                   /inference="protein motif:PFAM:PF03193"
FT   misc_feature    315120..315143
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        315536..316198
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0334"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92446"
FT                   /db_xref="GOA:C0M8P4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P4"
FT                   /protein_id="CAW92446.1"
FT                   /translation="MSSLKIAPSILAADYACFAAELARIEKTDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVNPERYVEAFAQAGADIMTIHVESTLHSHGALQK
FT                   IRAAGMKAGVVINPGTPVSAVEPLLSLVDQVLIMTVNPGFGGQAFIPECLEKVAAIAKM
FT                   RDERGLSFDIEVDGGVDDKTIRACYQAGANVFVAGSYLFKAADLAAQVQTLRAALNG"
FT   misc_feature    315548..316150
FT                   /locus_tag="SEQ_0334"
FT                   /note="HMMPfam hit to PF00834, Ribulose-phosphate 3
FT                   epimerase family, score 1.6e-107"
FT                   /inference="protein motif:PFAM:PF00834"
FT   misc_feature    315557..316177
FT                   /locus_tag="SEQ_0334"
FT                   /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate
FT                   decarboxylase /, score 0.002"
FT                   /inference="protein motif:PFAM:PF00215"
FT   misc_feature    315632..315676
FT                   /note="PS01085 Ribulose-phosphate 3-epimerase family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01085"
FT   misc_feature    315938..316006
FT                   /note="PS01086 Ribulose-phosphate 3-epimerase family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01086"
FT   CDS_pept        316191..316823
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0335"
FT                   /product="putative thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92447"
FT                   /db_xref="GOA:C0M8P5"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P5"
FT                   /protein_id="CAW92447.1"
FT                   /translation="MVKVALFAGGDLSYFTCDFDYFVGIDRGSLFLLENGLPLNMAVGD
FT                   FDSIPQVAFEVVKEQAELLVQASPEKNDTDTELALKEVFTRFPEAEVTIFGAFGGRLDH
FT                   LLSNVFLPADPELAPFMAQICLRDQQNAISYRSSGWQTIRQDKDMTYVAFMADGDADLT
FT                   ITGAKFDLTTSNFFKKKVYASNEFIDQPIKVHVPKGYLIIIQSKDRS"
FT   misc_feature    316212..316577
FT                   /locus_tag="SEQ_0335"
FT                   /note="HMMPfam hit to PF04263, Thiamin pyrophosphokinase,
FT                   catalytic d, score 5.7e-43"
FT                   /inference="protein motif:PFAM:PF04263"
FT   misc_feature    316605..316799
FT                   /locus_tag="SEQ_0335"
FT                   /note="HMMPfam hit to PF04265, Thiamin pyrophosphokinase,
FT                   vitamin B1, score 1.7e-19"
FT                   /inference="protein motif:PFAM:PF04265"
FT   CDS_pept        316825..318096
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0336"
FT                   /product="RmuC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92449"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C0M930"
FT                   /protein_id="CAW92449.1"
FT                   /translation="MDLILFVLVLVLIGLAAYSFVSIKHLQSRLEKALDDNADNLSDQL
FT                   TYQLDMANKSQLLELSTVMNRQQNELFQQLMVIRDTLHQGLAENRDRSDQRLETMTQSL
FT                   SQAVKNLQDSNEKRLEEMRHTVEEKLEKTLKNRLQTSFEAVSKQLESVNQGLGEMRTVA
FT                   KDVGTLNKVLSNTKTRGILGELQLGQIVEDIMTANQYEREFATVSGSSDRVEYAIKLPG
FT                   NGQGDYIYLPIDSKFPLEDYYRLEDAYEAGDRAAIETSRKALLAAIKRFAKSIHSKYLN
FT                   PPETTNFGIMFLPTEGLYSEVVRNPAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NLQKNADDISKILGNVKLEFEKFGGLLAKAQKQLNTANHTLDQLMSTRTKAIVRALATV
FT                   EGYQDQSTQSLLHIPLLEEADDED"
FT   misc_feature    316831..316890
FT                   /locus_tag="SEQ_0336"
FT                   /note="1 probable transmembrane helix predicted for SEQ0336
FT                   by TMHMM2.0 at aa 3-22"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    317170..318072
FT                   /locus_tag="SEQ_0336"
FT                   /note="HMMPfam hit to PF02646, RmuC family, score 5.7e-138"
FT                   /inference="protein motif:PFAM:PF02646"
FT   CDS_pept        318086..319024
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0337"
FT                   /product="putative 3'-5' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92451"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C0M931"
FT                   /protein_id="CAW92451.1"
FT                   /translation="MKINQMKKDQPFEGFYLIKSAEVRKTRAGKDFIAFTFQDDTGEIS
FT                   GNLWDAQPYNVEEFVAGKIVFMKGRREVYNGTPQVNQITLRNIRPGEPNDPKEFKEKAP
FT                   VSVTEVRDYLDQMLFKIENATWQRIVRALYRKYDKEFFTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPELNKSLLFAGIMLHDLAKVLELTGPDNTEYTIRGNLIGHIALINE
FT                   EITKTITELNIDDNKEEVTVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMSTALSRIGEGEMTNRIFAMDNRSFYKPKY"
FT   misc_feature    318131..318343
FT                   /locus_tag="SEQ_0337"
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain, score 0.0052"
FT                   /inference="protein motif:PFAM:PF01336"
FT   misc_feature    318557..318922
FT                   /locus_tag="SEQ_0337"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 4e-05"
FT                   /inference="protein motif:PFAM:PF01966"
FT   CDS_pept        319124..319939
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0338"
FT                   /product="putative pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92453"
FT                   /db_xref="GOA:C0M932"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0M932"
FT                   /protein_id="CAW92453.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEESNIGEIDTLTGASGGVIFTPSISEAEARSIVEELCQRLSESNRILPGGYIY
FT                   LSDLLSTPKLLQNIGRIIANAFKGQKIDAVMTVATKGVPLANAVANILNVPFVIVRRDL
FT                   KITEGSTVSVNYASASSYRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMMSLLTEF
FT                   DSTLVGVAVFAENAQSEREQMSFKSLLKVSEIDVKNNRVVVEVGNIFDK"
FT   misc_feature    319433..319849
FT                   /locus_tag="SEQ_0338"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 6.1e-17"
FT                   /inference="protein motif:PFAM:PF00156"
FT   CDS_pept        319976..322480
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0339"
FT                   /product="putative membrane anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92455"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:C0M933"
FT                   /protein_id="CAW92455.1"
FT                   /translation="MEQENSRTKHVKSTIALTSTIALLGTSVGVSHQVKADDAKSGDAN
FT                   TSNTSEATLAKPETLEEAVLAVKATEETLSERKKELAETNTNIAETEGEIANLEATKKE
FT                   QIAELAKAEELLETYSSMSEEDLAKSIEKHETELETINTELEKATTESQAQAEAVAKQQ
FT                   ETIAAEATKADQLATQLTAAEQKVSDLNTMISQPEAIVSEAQAAKEEVKRISDDLAKAT
FT                   ANLATVKETVHSQLTSDLAANKAALAAKEAELQRLQNGVATAQLNVAGSNKLILPKDYP
FT                   IEEIKKLAASGYIGTAAYNQYYQAVKDTMIAKAEPGAAMNQYVDIPEDLNRVVDPDNLS
FT                   QEVQNELAQFAAQMINDVRKQLGLVPVTVTVGSQEFARLLTKSYKETHQNTRPSFVYGQ
FT                   VDASGHRGVGPHDQTIIEESAVKVGLRQKDDNMYENLGAFNEVHTVNGIKRGIYDSIKY
FT                   MLFTDHLHGNTYGHAVNFLRVDKTDPNAPVYLGFSTSNVESLNEHFVIFPESDIVDATR
FT                   FSTTEIPKSGQVIDRSASIQALTNDIASIKGKIASLESRLADPSSEAEVTAAQAKISQL
FT                   QHQLEAAQAKSHKLDQQVEQLANTKDSLRTQLLAAKEEQAQLKANLDKALALLASSKAT
FT                   LHKLEAAMEEAKARVAGLASQKAQLEDLLAFEKNPNRIELAQEKVAAAKKALADTEDKL
FT                   LAAQASLSDLQAQRARLQLSIATIEQQLVLLKNLVQEKQRLRLEAERLNSMSETRQLLN
FT                   QLAPQAAKAGVGSELVATGLLVSKVASAIAKQSPTSHSYGAGAASHAAVDDNTQRAVQA
FT                   GMVMLAAAGLATVKLKKGSKKR"
FT   sig_peptide     319976..320083
FT                   /locus_tag="SEQ_0339"
FT                   /note="Signal peptide predicted for SEQ0339 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.974 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        322663..323076
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0340"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92456"
FT                   /db_xref="GOA:C0M934"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M934"
FT                   /protein_id="CAW92456.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVHTKLAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   misc_feature    322666..323070
FT                   /locus_tag="SEQ_0340"
FT                   /note="HMMPfam hit to PF00164, Ribosomal protein S12, score
FT                   1e-64"
FT                   /inference="protein motif:PFAM:PF00164"
FT   misc_feature    322828..322851
FT                   /note="PS00055 Ribosomal protein S12 signature."
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS_pept        323097..323567
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0341"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92458"
FT                   /db_xref="GOA:C0M935"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M935"
FT                   /protein_id="CAW92458.1"
FT                   /translation="MSRKNRAPKREVLPDPLYNSKLVTRLINRIMLDGKRGTASSIVYD
FT                   AFSEIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   misc_feature    323097..323543
FT                   /locus_tag="SEQ_0341"
FT                   /note="HMMPfam hit to PF00177, Ribosomal protein S7p/S5e,
FT                   score 2e-81"
FT                   /inference="protein motif:PFAM:PF00177"
FT   misc_feature    323154..323234
FT                   /note="PS00052 Ribosomal protein S7 signature."
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS_pept        complement(323815..323991)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0343"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92460"
FT                   /db_xref="UniProtKB/TrEMBL:C0M936"
FT                   /protein_id="CAW92460.1"
FT                   /translation="MQTKTRLKSNPIKTITHLEGENFLLKSCSLCLYILIVTEFELQVT
FT                   DKKDNRSVCLELA"
FT   CDS_pept        324110..326188
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0344"
FT                   /product="elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92462"
FT                   /db_xref="GOA:C0M937"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M937"
FT                   /protein_id="CAW92462.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEEITNEELVAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKTAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GTSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   misc_feature    324131..324955
FT                   /locus_tag="SEQ_0344"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 7.1e-113"
FT                   /inference="protein motif:PFAM:PF00009"
FT   misc_feature    324158..324181
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    324260..324307
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    325073..325276
FT                   /locus_tag="SEQ_0344"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 2.3e-18"
FT                   /inference="protein motif:PFAM:PF03144"
FT   misc_feature    325538..325897
FT                   /locus_tag="SEQ_0344"
FT                   /note="HMMPfam hit to PF03764, Elongation factor G, domain
FT                   IV, score 5.7e-67"
FT                   /inference="protein motif:PFAM:PF03764"
FT   misc_feature    325901..326164
FT                   /locus_tag="SEQ_0344"
FT                   /note="HMMPfam hit to PF00679, Elongation factor G
FT                   C-terminus, score 1e-46"
FT                   /inference="protein motif:PFAM:PF00679"
FT   CDS_pept        326542..327579
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0345"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92464"
FT                   /db_xref="GOA:C0M938"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0M938"
FT                   /protein_id="CAW92464.1"
FT                   /translation="MIFIRRKSLMVVKVGINGFGRIGRLAFRLIQNVEGVEVTRINDLT
FT                   DPAMLAHLLKYDSTQGRFDGDVEVVEGGCNVNGKFVKVSAEANPENIDWASQEVDIVLE
FT                   ATGFFASKAGAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHEILDGTETVISGASCTT
FT                   NCLAPMAKVLQDKFGVVEGLMTTIHGYTGDQMTLDAPHRKGDFRRARAAAVNIVPNSTG
FT                   AAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVSVLEKDVTADEVNAAMKAAANDSFG
FT                   YTEDQIVSSDVVGIHYGSLFDATQTKVLTVDGKQLVKTVSWYDNEMSYTAQLVRTLEYF
FT                   AKIAK"
FT   misc_feature    326575..327024
FT                   /locus_tag="SEQ_0345"
FT                   /note="HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NA, score 1.5e-78"
FT                   /inference="protein motif:PFAM:PF00044"
FT   misc_feature    327016..327039
FT                   /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00071"
FT   misc_feature    327037..327510
FT                   /locus_tag="SEQ_0345"
FT                   /note="HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-, score 2.5e-99"
FT                   /inference="protein motif:PFAM:PF02800"
FT   CDS_pept        328123..328977
FT                   /transl_table=11
FT                   /gene="lppC"
FT                   /locus_tag="SEQ_0346"
FT                   /product="acid phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92465"
FT                   /db_xref="GOA:C0M939"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0M939"
FT                   /protein_id="CAW92465.1"
FT                   /translation="MTSKKILNLVSLGLSLVLISGCTTNGEKKAAPSQDKDKQEKVVRL
FT                   TNDQLRARENTMATLWYQQSEEAKALYLQGYQVAKQRLDTLLSQATDKPYSIVLDIDET
FT                   VLDNSPYQAKNIKEGTGFTPDSWDKWVQKKSAKAVAGAKDFLQYANDKGVQIYYVSDRT
FT                   TKQVEPTMENLEKEGIPVQGKDHFLFLEEGVKSKEGRRQKVQETTNLVLLFGDNLLDFA
FT                   EFSKTSHEDRRKLLDQLHAEFGSKFIIFPNPMYGSWESSVYNGQKLDSEGQIKARDKAL
FT                   EAY"
FT   sig_peptide     328123..328209
FT                   /gene="lppC"
FT                   /locus_tag="SEQ_0346"
FT                   /note="Signal peptide predicted for SEQ0346 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.685 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    328156..328188
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        329187..330383
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0347"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92467"
FT                   /db_xref="GOA:C0M940"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M940"
FT                   /protein_id="CAW92467.1"
FT                   /translation="MAKLTVKDLDLKGKKVLVRVDFNVPLKNGVITNDNRISAALPTIK
FT                   YIIEHGGRAILFSHLGRVKEEADKEGKSLAPVAKNLAEKLGQEVIFPGSTRGAELEAAI
FT                   DALEDGQVLLVENTRFEDIDGKKESKNDPELGKYWASLGEGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIKEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLCEEDKLDVAKSLLEKSNGKLVLPVDSKEANAFADYTE
FT                   VKVTEGEAVDTGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQEGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKELPGLAALTEK"
FT   misc_feature    329187..330371
FT                   /locus_tag="SEQ_0347"
FT                   /note="HMMPfam hit to PF00162, Phosphoglycerate kinase,
FT                   score 1.4e-179"
FT                   /inference="protein motif:PFAM:PF00162"
FT   misc_feature    329229..329261
FT                   /note="PS00111 Phosphoglycerate kinase signature."
FT                   /inference="protein motif:Prosite:PS00111"
FT   CDS_pept        330806..331327
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0349"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92469"
FT                   /db_xref="GOA:C0M941"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:C0M941"
FT                   /protein_id="CAW92469.1"
FT                   /translation="MNYHFDASKLKLGMRTFKTGLAVFFVLLLFHFFDFQGLQIGALTA
FT                   VFSLRESFDKTISFGTSRILGNSIGGFFAIIFYLLDTLFQGAFWVTLVFVPILTMLTIM
FT                   FNVAFNNQSGIIGAVAALLIITLSIPTGEAFMYVIARVFETFCGVFIAILVNTDVELIR
FT                   NKWLSRKLKK"
FT   misc_feature    join(330866..330934,330977..331045,331064..331132,
FT                   331145..331213)
FT                   /locus_tag="SEQ_0349"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0349 by TMHMM2.0 at aa 21-43, 58-80, 87-109 and 114-136"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        331403..331774
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0350"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92471"
FT                   /db_xref="GOA:C0M9I4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I4"
FT                   /protein_id="CAW92471.1"
FT                   /translation="MKEKELRRSMAVFPIGAVMTLTDLSARQIRYYEDQELIKPERTEG
FT                   NRRLFSLNDMDRLLEIKDFLDEGLNIAAIKREYAERQDKLMQKQKVLTDADVRRILHDE
FT                   LLNQGGFSTPSQHIGNFRI"
FT   misc_feature    331442..331552
FT                   /locus_tag="SEQ_0350"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 4.5e-10"
FT                   /inference="protein motif:PFAM:PF00376"
FT   CDS_pept        331811..333157
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0351"
FT                   /product="putative glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92472"
FT                   /db_xref="GOA:C0M9I5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I5"
FT                   /protein_id="CAW92472.1"
FT                   /translation="MAITAADVRREVKEKHVTFLRLMFTDIMGVMKNVEIPATEEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWIVFPWGDENGTVGGLICDIYTAEGKP
FT                   FAGDPRGNLKRALKHMDEVGYQSFNLGPEPEFFLFKIDEAGEPTLEVNDKGGYFDLAPI
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYADALKACDNIQIFKLVVKTI
FT                   AREHGLYATFMAKPKFGIAGSGMHCNMSLFDKGGNNAFYDENDKRGMKLSDDAYYFLGG
FT                   LMKHAYNYTAITNPTVNSYKRLVPGYEAPVYVAWAGSNRSPLIRVPASRGMGTRLELRS
FT                   VDPTANPYLALAVLLEAGLDGIINKIEAPAPIEANIYMMTAEERNAAGIVDLPSTLHNA
FT                   LKALQKDEVIQKALGDHIYTNFLEAKRIEWSSYATFVSQWEIDNYLHNY"
FT   misc_feature    331856..332110
FT                   /locus_tag="SEQ_0351"
FT                   /note="HMMPfam hit to PF03951, Glutamine synthetase,
FT                   beta-Grasp domain, score 3e-14"
FT                   /inference="protein motif:PFAM:PF03951"
FT   misc_feature    331967..332023
FT                   /note="PS00180 Glutamine synthetase signature 1."
FT                   /inference="protein motif:Prosite:PS00180"
FT   misc_feature    332126..332896
FT                   /locus_tag="SEQ_0351"
FT                   /note="HMMPfam hit to PF00120, Glutamine synthetase,
FT                   catalytic domain, score 2.2e-152"
FT                   /inference="protein motif:PFAM:PF00120"
FT   CDS_pept        333390..335048
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0352"
FT                   /product="putative peptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92474"
FT                   /db_xref="GOA:C0M9I6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I6"
FT                   /protein_id="CAW92474.1"
FT                   /translation="MTVLGTKACKRLGLAAVTLASVAALMACGNKQSASTDKKSEINWY
FT                   TPTEIITLDISKNTDTYSALAIGNSGSNLLRADAKGKLQPDLAEKVDVSEDGLTYTATL
FT                   RDGLKWSDGSDLTAEDFVYSWQRMVDPKTASEYAYLATESHLKNAEDINSGKNPDLDSL
FT                   GVKADGNKVIFTLTEPAPQFKSLLSFSNFVPQKESFVKDAGKDYGTTSEKQIYSGPYIV
FT                   KDWNGTSGTFKLVKNKNYWDAKNVKTETVNVQTVKKPDTAVQMYKQGKLDFANISGTSA
FT                   IYNANKKHKDVVPVLEATTAYIVYNQTGAIEGLNSLKIRQALNLATDRKGIVSAAVDTG
FT                   SKPATALVPTGLAKLSDGTDLTEHVAPGYKYDDKEAAKLFKEGLAELGKDALTITITAD
FT                   ADAPAAKSAVDYIKETWETALPGLTVEEKFVPFKQRLEDTKNQNFEVAVVLWGGDYPKG
FT                   STFYGLFKSGSAYNYGKFTNADYDAAYNKALTTDALNTDAAADDYKAAEKALYDNALYN
FT                   PLYFRSGEGLQNPSIKGLIRNSTGLNVDFTYAYKD"
FT   sig_peptide     333390..333497
FT                   /locus_tag="SEQ_0352"
FT                   /note="Signal peptide predicted for SEQ0352 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.513 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    333441..333473
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    333633..334808
FT                   /locus_tag="SEQ_0352"
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding prot, score 2.8e-76"
FT                   /inference="protein motif:PFAM:PF00496"
FT   CDS_pept        335217..336131
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0353"
FT                   /product="di-tripeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92476"
FT                   /db_xref="GOA:C0M9I7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I7"
FT                   /protein_id="CAW92476.1"
FT                   /translation="MIKYLLKRVAILVVTLWVVITLSFFLMQVMPGTPYNSPKLTDDMI
FT                   AMLNQQYGLDKPLWQQYLKYLFDILHGDFGTSYQSINQSVTTLISQRLGVSVHLGVQAL
FT                   IVGISSGLAVGAVSARNKNNSIDAILSVISTLGISMPSFIIGLLLLDYLGFKWNLLPLS
FT                   GWGSFGQTILPTLALAIPVFAQVTRFFRSEMIETLSTDYIQLARAKGLTKRQVTRRHAY
FT                   RNSMIPVLTLVGPMAAGILTGSALIEQIFSIPGIGQQFVTSIPTKDYPVIMGTTIVYAL
FT                   MLMVAILATDMIISIADPRVRLG"
FT   sig_peptide     335217..335324
FT                   /locus_tag="SEQ_0353"
FT                   /note="Signal peptide predicted for SEQ0353 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.966) with cleavage site
FT                   probability 0.421 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(335241..335309,335496..335564,335598..335666,
FT                   335709..335768,335889..335957,336039..336107)
FT                   /locus_tag="SEQ_0353"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0353 by TMHMM2.0 at aa 9-31, 94-116, 128-150, 165-184,
FT                   225-247 and 275-297"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    335493..336125
FT                   /locus_tag="SEQ_0353"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 4.5e-49"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    335814..335879
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1106.000, SD 2.95 at aa 200-221, sequence
FT                   TDYIQLARAKGLTKRQVTRRHA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        336141..337172
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0354"
FT                   /product="di-tripeptide transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92478"
FT                   /db_xref="GOA:C0M9I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I8"
FT                   /protein_id="CAW92478.1"
FT                   /translation="MLEETKSFKLVGAGSLATQEKIEKPALSFLQDAWRRLKHNKLAVI
FT                   AMGFLAVLLLFSIGSLFVVSTDDANSFNSKEVSIYRNLPPKLSSSLPFWNGTITYAGNT
FT                   EPNDAYADQGVPEDKAFLLGTDNLGRSIGKRITVGIRISLLIAIVATLIDLVIGVTYGL
FT                   VSGFVGGKTDMVMQRIIEIISSIPNLVIVTMLGLLLGNGVTSIIISIAIVGWTSMARQV
FT                   RNLTLSYRERDFVLASRALGESNIRIAFKHVLPNISGIIIVQIMMTVPSAIMYESVLSA
FT                   INLGVKPPTASIGSLITDAQESLQYYPYQVLLPAFALVLISLAFILLGDGLRDAFDPKS
FT                   SDE"
FT   misc_feature    join(336264..336332,336564..336632,336711..336779,
FT                   336897..336965,337059..337127)
FT                   /locus_tag="SEQ_0354"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0354 by TMHMM2.0 at aa 42-64, 142-164, 191-213, 253-275
FT                   and 307-329"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    336558..337166
FT                   /locus_tag="SEQ_0354"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.6e-44"
FT                   /inference="protein motif:PFAM:PF00528"
FT   CDS_pept        337184..338230
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0355"
FT                   /product="di-tripeptide transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92480"
FT                   /db_xref="GOA:C0M9I9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9I9"
FT                   /protein_id="CAW92480.1"
FT                   /translation="MTNETILSVKNLHVDFKTYAGDVKAIRDISFELKKGETLAIVGES
FT                   GSGKSVTTRTLMGLNAKNASISGNICFKGKQLNELKEEEWVKVRGNEIAMIFQDPMTSL
FT                   DPTMTIGMQIAEAIMIHQSIHKTEALKRALDLMRQVGIPNAEEHLKDYPHQWSGGMRQR
FT                   AVIAIALAANPDILIADEPTTALDVTIQAQILKLMKDIQSQTASSIIFITHDLGVVAGM
FT                   VDRVAVMYAGKIVEYGTVDEVFYHPQHPYTWGLLNSMPTTATAAGSLRSIPGTPPDLLN
FT                   PPKGDAFAARNEFALDIDHIKEPPMFKVSDSHYAATWLLDERAPKITPPFPIRKRWAKW
FT                   QEMEERKA"
FT   misc_feature    337289..337879
FT                   /locus_tag="SEQ_0355"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.9e-56"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    337310..337333
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    337886..338080
FT                   /locus_tag="SEQ_0355"
FT                   /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
FT                   transporter, C-termi, score 2.2e-27"
FT                   /inference="protein motif:PFAM:PF08352"
FT   CDS_pept        338230..339165
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0356"
FT                   /product="di-tripeptide transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92482"
FT                   /db_xref="GOA:C0M9J0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9J0"
FT                   /protein_id="CAW92482.1"
FT                   /translation="MTEARKKLIEVKNVSLTFNKGKKNEVKAIDRLSFDIYEGEVFGLV
FT                   GESGSGKTTVGRAILKLYDISDGEIIFNGENVSQLKGKKLHSFRKHAQMIFQDPQASLN
FT                   GRMKIRDIVAEGLDIHGLTASKAEREARVQELLKLVGLNQNHLTRYPHEFSGGQRQRIG
FT                   IARALAVKPTFIIADEPISALDVSIQAQVVSLMQQLQKKRGLTYLFIAHDLSMVKYISD
FT                   RIGVMHWGKMLEIGTSDEVYNHPIHPYTKSLISAIPEPDPEKERKRIAEVYDPSQELDG
FT                   QERQMHEITPGHFVLATQAEAEQYRAECGL"
FT   misc_feature    338344..338919
FT                   /locus_tag="SEQ_0356"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.2e-61"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    338365..338388
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    338689..338733
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    338926..339150
FT                   /locus_tag="SEQ_0356"
FT                   /note="HMMPfam hit to PF08352, Oligopeptide/dipeptide
FT                   transporter, C-termi, score 2.3e-08"
FT                   /inference="protein motif:PFAM:PF08352"
FT   CDS_pept        complement(339794..341476)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0357"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92483"
FT                   /db_xref="GOA:C0M9J1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9J1"
FT                   /protein_id="CAW92483.1"
FT                   /translation="MTNISLRPNEVGVYAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFP
FT                   EDDLLGIDYVIPDYSYIVDNLERVKALVITHGHEDHIGGIPFLLKQANVPIYAGPLALA
FT                   LIRGKLEEHGLLRDAVLYEINHNTELTFKHMSVTFFKTTHSIPEPLGIVIHTPQGKVIC
FT                   TGDFKFDFTPVGDPADLHRMAALGKDGVLCLLSDSTNAEIPTFTNSEKVVGQSIMNIIE
FT                   GIHGRIIFASFASNIYRLQQAAEAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVPKGTF
FT                   IEPNEIKHYHASEILIMCTGSQGESMAALARIANGTHRQVSLQPGDTVIFSSSPIPGNT
FT                   VSVNKLINTIQEAGVDVIHGKVNNIHTSGHGGQQEQKLMLSLIKPKYFMPVHGEYRMQK
FT                   VHAGLAVDIGIPEENIFIMENGDVLALTSDSARIAGHFNAQDIYVDGNGIGDIGTAVLR
FT                   DRRDLSEDGVVLAVATVDFETQMILAGPDILSRGFIYMRESGELIRESQRVLFNAIRIA
FT                   LKNKDASIQSVNGAIVNALRPFLYEKTEREPIIIPMVLTPDSQ"
FT   misc_feature    complement(340289..340411)
FT                   /locus_tag="SEQ_0357"
FT                   /note="HMMPfam hit to PF07521, RNA-metabolising
FT                   metallo-beta-lactamase, score 1.4e-14"
FT                   /inference="protein motif:PFAM:PF07521"
FT   misc_feature    complement(340295..340381)
FT                   /note="PS01292 Uncharacterized protein family UPF0036
FT                   signature"
FT                   /inference="protein motif:Prosite:PS01292"
FT   CDS_pept        complement(341478..341708)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92485"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9J2"
FT                   /protein_id="CAW92485.1"
FT                   /translation="MIYKVFYQETKERSPRRENTQALYLDIDAASELEGRIKARKMVEE
FT                   HTDYNVEFIELLSDKHLDYEKETGVFTLTEF"
FT   misc_feature    complement(341481..341705)
FT                   /locus_tag="SEQ_0358"
FT                   /note="HMMPfam hit to PF07288, Protein of unknown function
FT                   (DUF1447), score 5.9e-50"
FT                   /inference="protein motif:PFAM:PF07288"
FT   CDS_pept        341994..342692
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0359"
FT                   /product="glycoprotease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92487"
FT                   /db_xref="GOA:C0M9J3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9J3"
FT                   /protein_id="CAW92487.1"
FT                   /translation="MKTLAFDTSNKALSVALLDDGTLLADLTINVKKNHSISLMPAIDF
FT                   LMSSADLKPKDLDRIVVAEGPGSYTGLRVATATAKMLAYSLSIDLVGVSSLYALAASTC
FT                   RENPDSLVVPLIDARRRHVYVGYYHHQKAVKQDKYASFDAVLAELVSCDHVIFVGEVEG
FT                   FAEDIRSALPEAKIKPSLPSAFEVGLLGSSLSADNVAAFVPQYLKRVEAEENWLKTHAA
FT                   GDDSQYVKRV"
FT   misc_feature    342057..342641
FT                   /locus_tag="SEQ_0359"
FT                   /note="HMMPfam hit to PF00814, Glycoprotease family, score
FT                   2.3e-54"
FT                   /inference="protein motif:PFAM:PF00814"
FT   CDS_pept        342695..343120
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0360"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92489"
FT                   /db_xref="GOA:C0M9J4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9J4"
FT                   /protein_id="CAW92489.1"
FT                   /translation="MMSIQEKAAAVYQVLKEVYGQSPWTLKQIVSDMQQEHVDYFTFYH
FT                   QETLLGFLAIQQLPGEMEITNLAVLPSYQGQGIASWLMGQLDGFEGVIFLEVRASNHRA
FT                   QQLYLKHGFEVVGQRSNYYHDPIEAALIMRREGKNDR"
FT   misc_feature    342815..343036
FT                   /locus_tag="SEQ_0360"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 7.6e-15"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS_pept        343110..344126
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0361"
FT                   /product="putative glycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92491"
FT                   /db_xref="GOA:C0M9J5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9J5"
FT                   /protein_id="CAW92491.1"
FT                   /translation="MTDRYILAVESSCDETSVAILKNDNVLLTNIIASQVESHKRFGGV
FT                   VPEVASRHHVEVITTCFDDALKEAQLEASDLTAVAVTYGPGLVGALLVGLAAAKAFAWA
FT                   NDLPLIPVNHMAGHLMAAREQGELEYPLMALLVSGGHTELVYVTEPGEYHIVGETRDDA
FT                   VGEAYDKVGRVMGLPYPAGREIDQLAHQGTDTYHFPRAMMKEDHLEFSFSGLKSAFINL
FT                   HHNAQQKGEELVLEDLCASFQAAVLDILLAKTKKALKQYPSKMLVVAGGVAANQGLRER
FT                   LAEEITDIAVVIPPLRLCGDNAGMIALAAVVEYEKGHVAGLDLNAKPSLAFDSFHQQ"
FT   misc_feature    343185..344033
FT                   /locus_tag="SEQ_0361"
FT                   /note="HMMPfam hit to PF00814, Glycoprotease family, score
FT                   1.2e-76"
FT                   /inference="protein motif:PFAM:PF00814"
FT   CDS_pept        344193..345176
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0362"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92492"
FT                   /db_xref="GOA:C0M9J6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9J6"
FT                   /protein_id="CAW92492.1"
FT                   /translation="MAVYIKEPRTLWLGASFVTTLGVSLLCAMIYIFSIEEKLQGVGIL
FT                   VLGVIGFLAIVWLMSSPFILLLFLSFNGIRLIKREGLSFRNLLLIGSAVLLFVHPFISR
FT                   LLLESIGDSKLLRIMYETSDLLILYLLLIVSVYTISSMLNTFYFRKTKEDYIIVLGSGL
FT                   NGDQVTPLLASRINKGIQIYQKNPGSKLIMSGGKGADELIAEGEAMCRYAIQQGIKSED
FT                   ILVENQSRNTRENILLSKQLIPSGASFCLVTNRYHLFRALLLAKELALPCRCYGAKTKL
FT                   YFSMNAFIREIVGYLQLKKKQHLLAMLILTVGYIAIRVVMIYMLHI"
FT   sig_peptide     344193..344294
FT                   /locus_tag="SEQ_0362"
FT                   /note="Signal peptide predicted for SEQ0362 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.740) with cleavage site
FT                   probability 0.666 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(344226..344294,344337..344405,344442..344510,
FT                   344568..344636,345102..345170)
FT                   /locus_tag="SEQ_0362"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0362 by TMHMM2.0 at aa 12-34, 49-71, 84-106, 126-148 and
FT                   304-326"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    344646..345077
FT                   /locus_tag="SEQ_0362"
FT                   /note="HMMPfam hit to PF02698, DUF218 domain, score
FT                   7.9e-48"
FT                   /inference="protein motif:PFAM:PF02698"
FT   CDS_pept        complement(345571..345840)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0363"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92494"
FT                   /db_xref="GOA:C0MA03"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA03"
FT                   /protein_id="CAW92494.1"
FT                   /translation="MAKKSKIAKYHKQLQLIEQYADLRRELKAKGDYEALRKLPRDSNP
FT                   NRLKNRDRIDGRPHAYMRKFGVSRINFRELAHKGQLPGITKASW"
FT   misc_feature    complement(345577..345741)
FT                   /locus_tag="SEQ_0363"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 2.1e-17"
FT                   /inference="protein motif:PFAM:PF00253"
FT   CDS_pept        complement(346034..347206)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0364"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92496"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA04"
FT                   /protein_id="CAW92496.1"
FT                   /translation="MILYDTIIIGGGPAGMMAAISSSYYGYKTLLLDKNKRLGKKLAGT
FT                   GGGRCNVTNSGSHDELIAGIPGNGRFLYSVFSQFDNHDIIAFFKENGVTLKEEDHGRMF
FT                   PTTDQSKTIINALEQKIKSLGAQVLISTEIVSVKKRNNLFYLKSVDQTFSCERLIVATG
FT                   GKSYPSTGSTGFGYDIARHFNIAVTELEAAESPLLTDFPHKALQGISLADVTLSCGKHQ
FT                   ITHDLLFTHFGLSGPAALRLSSFVKGGDIAELDLLPQTSAAELLSYLAQHREKALKNAL
FT                   KTLMPERVADFLAKGYPEKGKQLTPTQTQELVNRIKQLPIPITGKISLAKSFVTKGGID
FT                   LKEINPKTLESKKVAGLYFAGEVLDVNAHTGGFNITAALCSGWVAGSSQS"
FT   misc_feature    complement(346043..347197)
FT                   /locus_tag="SEQ_0364"
FT                   /note="HMMPfam hit to PF03486, HI0933-like protein, score
FT                   6e-207"
FT                   /inference="protein motif:PFAM:PF03486"
FT   misc_feature    complement(346082..347194)
FT                   /locus_tag="SEQ_0364"
FT                   /note="HMMPfam hit to PF00890, FAD binding domain, score
FT                   0.0042"
FT                   /inference="protein motif:PFAM:PF00890"
FT   misc_feature    complement(346103..347194)
FT                   /locus_tag="SEQ_0364"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidored, score 0.00028"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    complement(346400..347194)
FT                   /locus_tag="SEQ_0364"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.00026"
FT                   /inference="protein motif:PFAM:PF01266"
FT   CDS_pept        347281..347862
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0365"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92498"
FT                   /db_xref="GOA:C0MA05"
FT                   /db_xref="InterPro:IPR007489"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA05"
FT                   /protein_id="CAW92498.1"
FT                   /translation="MLLFLIRIFSYSNKEEIMAIEKTVSELADILGVSRQAVNNRVKSL
FT                   PEEDLDKNDKGVTVVKRSGLVKLEEIYKKTIFDDEPISEETKQRELLEILVDEKNTEIT
FT                   RLYEQLKAKDSQLAAKDEQMRIKDVQIAEKDKQLDQQQQLTAKAMADKETLKLELEEAK
FT                   AEADQVRLQAEEIQSEMGPKKGFLNRLFGK"
FT   misc_feature    347344..347409
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1868.000, SD 5.55 at aa 22-43, sequence
FT                   KTVSELADILGVSRQAVNNRVK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    347629..347772
FT                   /locus_tag="SEQ_0365"
FT                   /note="HMMPfam hit to PF04394, Protein of unknown function,
FT                   DUF536, score 5e-14"
FT                   /inference="protein motif:PFAM:PF04394"
FT   CDS_pept        347907..348494
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0366"
FT                   /product="putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92500"
FT                   /db_xref="GOA:C0MA06"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA06"
FT                   /protein_id="CAW92500.1"
FT                   /translation="MKQLEAYIAFDMEFNTVNEVSHIIQLSAVKWHKHQEVDSFDSYVY
FT                   TAVPLQSFINGLTGITSDKIVSAPKVDEVLDAFKQFVGDTPLIGYNAQKSDLPILAANG
FT                   LDLSAQYAVDVFDEAYERRSSDLNGIANLRLQTVADFLGIKGRGHNSLEDARMTARVYE
FT                   AFVEFDDNKSYLNKQKEAIADNPFAALGGLFD"
FT   misc_feature    347925..348392
FT                   /locus_tag="SEQ_0366"
FT                   /note="HMMPfam hit to PF00929, Exonuclease, score 3.2e-14"
FT                   /inference="protein motif:PFAM:PF00929"
FT   CDS_pept        348598..349320
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0367"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92502"
FT                   /db_xref="GOA:C0MA07"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA07"
FT                   /protein_id="CAW92502.1"
FT                   /translation="MSDIYSTGELAKAAGVTVRTVQYYDKRGILLPSQLTEGGRRIYTE
FT                   SDLERLKIICFLRDLDFSIEQIKRVLAEDNVMAVLDLLLVDHIQQLEQDLRTKKHQLDT
FT                   AVKLLSGIRCSSSHSIKNLSDMSLTMNNQKAWRRLQLKMFSNIALAILVHVMLVLLTSY
FT                   FHLSWLVWIEAPLWIIFFTLLIVYFRKQFEYLCPNCHTIFEPDFKEFALAGHTPRTRRL
FT                   TCPHCHQKSYCLELAKEK"
FT   misc_feature    348610..348675
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1629.000, SD 4.74 at aa 5-26, sequence
FT                   YSTGELAKAAGVTVRTVQYYDK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    348613..348726
FT                   /locus_tag="SEQ_0367"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 2.7e-12"
FT                   /inference="protein motif:PFAM:PF00376"
FT   misc_feature    join(349024..349092,349102..349161)
FT                   /locus_tag="SEQ_0367"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0367 by TMHMM2.0 at aa 143-165 and 169-188"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(349362..349661)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92504"
FT                   /db_xref="GOA:C0MA08"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MA08"
FT                   /protein_id="CAW92504.1"
FT                   /translation="MMNMQNMMKQAQKLQKQMEQKQADLAAMQFTGKSAQELVTATFTG
FT                   DKQLVSIDFKEAVVDPEDIETLQDMTAQAINAALAQIDEATKKTLGAFAGKLPF"
FT   misc_feature    complement(349365..349640)
FT                   /locus_tag="SEQ_0368"
FT                   /note="HMMPfam hit to PF02575, Uncharacterised BCR, YbaB
FT                   family COG0718, score 1.9e-38"
FT                   /inference="protein motif:PFAM:PF02575"
FT   misc_feature    complement(349560..349583)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        350059..350646
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0369"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92505"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA09"
FT                   /protein_id="CAW92505.1"
FT                   /translation="MTTTKQSKTTLAARYLKLGLTSAMFAGGAFLALGSAPAVSASTHA
FT                   GNDQPATQRLTDQEIYERAQKLDLPDYVRGSIYGILNQNSSVTYPKDIAGLEQSEAPQP
FT                   PAAPQLTDQDAQKLDLPDYVRGSIYGILNQNSSVTYPKDIAGLEQSEAPQPPAAPQLTD
FT                   QDAQQLDLPDYVRGSIYGILNQNSSITYPRDY"
FT   sig_peptide     350059..350181
FT                   /locus_tag="SEQ_0369"
FT                   /note="Signal peptide predicted for SEQ0369 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.832 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    350110..350178
FT                   /locus_tag="SEQ_0369"
FT                   /note="1 probable transmembrane helix predicted for SEQ0369
FT                   by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        join(350785..351330,352763..352903)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0370"
FT                   /note="CDS is disrupted by the insertion of an IS element
FT                   after codon 182. Similar to Streptococcus agalactiae
FT                   serotype DNA-binding response regulator UniProt:Q3K2Z0
FT                   (EMBL:CP000114 (228 aa) fasta scores: E()=3.6e-61, 75.330%
FT                   id in 227 aa;response regulator protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92507.1"
FT   misc_feature    350791..351129
FT                   /locus_tag="SEQ_0370"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.1e-39"
FT                   /inference="protein motif:PFAM:PF00072"
FT   repeat_region   351331..352759
FT                   /note="ISSeq3"
FT   repeat_region   351339..351350
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        351385..351900
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0371"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92509"
FT                   /db_xref="GOA:C0M663"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M663"
FT                   /protein_id="CAW92509.1"
FT                   /translation="MTLSYEDKVQIYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    351439..351504
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    351547..351828
FT                   /locus_tag="SEQ_0371"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    351706..351744
FT                   /locus_tag="SEQ_0371"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   CDS_pept        351924..352727
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0372"
FT                   /product="putative transposase for IS1664 element"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92510"
FT                   /db_xref="GOA:C0M6I7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6I7"
FT                   /protein_id="CAW92510.1"
FT                   /translation="MLEILDLSRSTYYYQVKQLAQEDKDMDLKELIQGIYDEHHGNYGY
FT                   RRIHLELRNRGFIVNHKKVQRLMTVMGLKARIRRKRKYSSYKGEVGKKADNLIKRQFEG
FT                   SKPYEKCYTDVTEFTLPEGKLYLSPVLDGYNSEIIDFTLSRSPDLKQVQTMLEKAFPAD
FT                   SYNGTILHSDQGWQYQHQSYHHFLETKGIRPSMSRKGNSPDNGMMESFFGILKSEMFYG
FT                   LETTYQSLNELEQAITEYIFYYNNKRIKAKLKGLSPVQYRTKSFH"
FT   misc_feature    352230..352712
FT                   /locus_tag="SEQ_0372"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   8.8e-38"
FT                   /inference="protein motif:PFAM:PF00665"
FT   repeat_region   complement(352740..352751)
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        352905..353951
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0374"
FT                   /product="histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92512"
FT                   /db_xref="GOA:C0MA13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA13"
FT                   /protein_id="CAW92512.1"
FT                   /translation="MRLRTYIVIGYLMSMLITIAGLIVGLNQMLITIEDISYILVIALI
FT                   ASVAGGIVNMILLSNVFSSLKRLKKKIQAISERNFDSGQLIKCPLEFKDLEEAFNQMSS
FT                   ELKVSFESLSESEHEKSMMIAQLSHDIKTPLTSIQATVEGILDGVIPREEERHYLNTIS
FT                   RQTNRLNQLVEELHMVSLNDQKQDDKQQLQIIYLEKLLIDMLSEFQLTLEQEKRSVHIE
FT                   VAKEVVKISSRYDALSRIMLNLVSNALKYSKANTALTIHAYQQEQSIRIDVIDQGQGIK
FT                   KEDLPLIFKRLYRVEASRNMKTGGHGLGLSIARQLARQLGGDIAVESQLGKGSCFSLLL
FT                   PASPPLGD"
FT   misc_feature    join(352923..352991,353019..353087)
FT                   /locus_tag="SEQ_0374"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0374 by TMHMM2.0 at aa 7-29 and 39-61"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    353019..353228
FT                   /locus_tag="SEQ_0374"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 5.6e-08"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    353259..353459
FT                   /locus_tag="SEQ_0374"
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.6e-15"
FT                   /inference="protein motif:PFAM:PF00512"
FT   misc_feature    353598..353933
FT                   /locus_tag="SEQ_0374"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.4e-37"
FT                   /inference="protein motif:PFAM:PF02518"
FT   CDS_pept        complement(join(354323..355120,355119..355319,
FT                   355319..356212))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="CDS contains frameshifts after codons 298 and 365.
FT                   Possible deletions at these frameshift sites. CDS contains
FT                   an LPxTN motif. Similar to the intact Streptococcus equi
FT                   Fibronectin-binding protein Fnz UniProt:P72416 (EMBL:X99995
FT                   (597 aa) fasta scores: E()=2.9e-192, 91.798% id in 634
FT                   aa;fibronectin-binding protein Fne (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92514.1"
FT   misc_feature    complement(354347..354406)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="1 probable transmembrane helix predicted for SEQ0375
FT                   by TMHMM2.0 at aa 242-261"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(354473..354586)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 1.8e-19"
FT                   /inference="protein motif:PFAM:PF02986"
FT   misc_feature    complement(354590..354697)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 1.4e-19"
FT                   /inference="protein motif:PFAM:PF02986"
FT   misc_feature    complement(354701..354808)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 8.8e-18"
FT                   /inference="protein motif:PFAM:PF02986"
FT   misc_feature    complement(354812..354919)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 8.8e-18"
FT                   /inference="protein motif:PFAM:PF02986"
FT   misc_feature    complement(354923..355030)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0375"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding repeat,
FT                   score 6.7e-18"
FT                   /inference="protein motif:PFAM:PF02986"
FT   misc_feature    complement(355853..356071)
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0377"
FT                   /note="HMMPfam hit to PF08341, Fibronectin-binding protein
FT                   signal sequence, score 3.9e-27"
FT                   /inference="protein motif:PFAM:PF08341"
FT   sig_peptide     complement(356117..356212)
FT                   /pseudo
FT                   /gene="fne"
FT                   /locus_tag="SEQ_0377"
FT                   /note="Signal peptide predicted for SEQ0377 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.985 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        356463..357971
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0378"
FT                   /product="putative regulatory protein-RofA related"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92516"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH8"
FT                   /protein_id="CAW92516.1"
FT                   /translation="MLEEYLEPVINHQALLLTILLGKKRISFHAIQQKTGFSLANIKRY
FT                   IHQLEELFQGDIAFEWDSTIVRCTVLKRGKPFLKTIYRQSVRLHILKFLLIKAPCYKVK
FT                   SVSGFAREHFISTPSAYRLIQHMKPFVEECGLALEDNSVVGEEWRIRYLIALLHDKYGI
FT                   VIYELTDHDLDIVHDFIFSIKKQQTPHPLLDKKFRFFDVLLSLSWKRGEFDVAIPQEGI
FT                   FKRLKSLALYGYLEDFFKREGKLLLDMDFPSSEIDYIFLVYLTVNNSFSITQWSEEDSS
FT                   ALLTIIQEDPAYQELLGELRQLFGHYIAFDKACIQTLIPYFRKTLFDLSLFIPQKYYYA
FT                   EEYQGSKLLANRIELMINSWAERVSGVGRLTGSNLHLLCTRLEQLVREGLPPLAIAVIE
FT                   INKKNIDILYSLVMQQVSPCVAKVYRFNILSEAELPWRTDFDLIVTTAEMTAFIEERLS
FT                   LNENTKILDFNFDFVMYQAEYLSQVIRELRDKQYQEALDTILNG"
FT   misc_feature    356481..356657
FT                   /locus_tag="SEQ_0378"
FT                   /note="HMMPfam hit to PF08280, M protein trans-acting
FT                   positive regulator (M, score 5e-06"
FT                   /inference="protein motif:PFAM:PF08280"
FT   misc_feature    356670..356936
FT                   /locus_tag="SEQ_0378"
FT                   /note="HMMPfam hit to PF05043, Mga helix-turn-helix domain,
FT                   score 6.7e-16"
FT                   /inference="protein motif:PFAM:PF05043"
FT   misc_feature    356976..357617
FT                   /locus_tag="SEQ_0378"
FT                   /note="HMMPfam hit to PF08270, M protein trans-acting
FT                   positive regulator (M, score 5.7e-32"
FT                   /inference="protein motif:PFAM:PF08270"
FT   CDS_pept        358593..359270
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0379"
FT                   /product="putative CAAX amino terminal protease family
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92518"
FT                   /db_xref="GOA:C0MAH9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAH9"
FT                   /protein_id="CAW92518.1"
FT                   /translation="MDTIKRHRAAVLVMLYIIAVYLYRQVSNVIELPPLLNTFLFYGRH
FT                   LLIFALGICWLYRADYQRDWRQFSTKWVKNTLWVLVIFAVLYVANILLSSLPLEESSNA
FT                   AVLANRYNASEGFETVIFILVVSIIGPFNEELIFRKILIGEGQSGTGMLLARLLGSSLL
FT                   FGLVHIYSFSELSSIVVYGGLGLLLGLVYVWKKNIYFSTVAHILNNGIGYVFILLELLG
FT                   VLR"
FT   misc_feature    join(358611..358664,358692..358760,358818..358886,
FT                   358929..358988,359049..359108,359121..359174,
FT                   359193..359261)
FT                   /locus_tag="SEQ_0379"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SEQ0379 by TMHMM2.0 at aa 7-24, 34-56, 76-98, 113-132,
FT                   153-172, 177-194 and 201-223"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    358953..359240
FT                   /locus_tag="SEQ_0379"
FT                   /note="HMMPfam hit to PF02517, CAAX amino terminal protease
FT                   family, score 7.3e-19"
FT                   /inference="protein motif:PFAM:PF02517"
FT   CDS_pept        complement(join(359528..359779,359783..359902))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0380"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   40. Similar to Streptococcus pyogenes serotype M1 putative
FT                   repressor-phage associated (transcriptional regulator)
FT                   UniProt:Q99Y57 (EMBL:AE006612 (124 aa) fasta scores:
FT                   E()=2.5e-32, 85.593% id in 118 aa;putative DNA-binding
FT                   protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92519.1"
FT   misc_feature    complement(join(359702..359779,359783..359869))
FT                   /locus_tag="SEQ_0380"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3.2e-07"
FT                   /inference="protein motif:PFAM:PF01381"
FT   CDS_pept        360060..360338
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0381"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92521"
FT                   /db_xref="GOA:C0MAI1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI1"
FT                   /protein_id="CAW92521.1"
FT                   /translation="MRGGGKILSKATLKELRIAQKKTQKELSALTGISVRTLARYEKDV
FT                   QKLRRAKYEKLRGIAEALTISVDDIFFGRRFGFYEIKSACLLIAFLL"
FT   misc_feature    360096..360269
FT                   /locus_tag="SEQ_0381"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   6.8e-11"
FT                   /inference="protein motif:PFAM:PF01381"
FT   misc_feature    360123..360188
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1876.000, SD 5.58 at aa 22-43, sequence
FT                   KTQKELSALTGISVRTLARYEK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        360492..360884
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92523"
FT                   /db_xref="GOA:C0MAI2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI2"
FT                   /protein_id="CAW92523.1"
FT                   /translation="MLTEEMKEMIAEQLAMVVTVDNEGNPNIGPKRSMRLLDDETLVYN
FT                   ENTGGQTCSNIQANGKIEVAYVNREQLRGYRFVGRAEIITEGPVFEAAKEWAEGKMGAP
FT                   KAAGLIHIESVYSLHSGAEAGKKVSK"
FT   misc_feature    360495..360755
FT                   /locus_tag="SEQ_0382"
FT                   /note="HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate
FT                   oxidase, score 6.2e-20"
FT                   /inference="protein motif:PFAM:PF01243"
FT   CDS_pept        complement(360990..363275)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0383"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92524"
FT                   /db_xref="GOA:C0MAI3"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008252"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR015251"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036313"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAI3"
FT                   /protein_id="CAW92524.1"
FT                   /translation="MRYNQLSYIPTSLETAVAELQALGFAVQQEQAPKENFAIFLRKLF
FT                   FHFQDTDYPLSHMIASKDLDLLTFLTSDATLTKEVFDLVALQVLGFIPAVDFTDAQDFI
FT                   QKIGFPIVFDSQQLLLNLHQLLATRQKSGVTLIDSLVSQGLLPMDNCYHYFNGKALATF
FT                   DTTSLIREVVYVEAPLDTDQDGQLDLIKVNIIRPKASTAIPSMMTASPYHQGINETAND
FT                   KKLHRMEGELSPKAPRRITVEPTDFQPLATKPSRLPVNECQETFSHISSYTLNDYFLAR
FT                   GFANLYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSHKRDYQIKADWSN
FT                   GLVATTGKSYLGTMSTGLATTGVDGLAVIIAEAAISSWYDYYRENGLVCSPGGYPGEDL
FT                   DVLTELTYSRNLLPGDYLRHNDHYQQLLSQQSQALERQSGNYNQFWHDRNYLPQADRIK
FT                   CEVVYTHGLQDWNVKPRQVYNIFNALPDSLGKHLFLHHGEHVYMHNWQSIDFREAMNAL
FT                   LCQKMLGQNNGFTLPTIIWQDNQKEQTWKELTAFGGHSKRQIALGDDHVLIDNHYGEED
FT                   FKRYSKDFRAFKAELFEGKANQAVIDILLEEDLPINGQACLKLKLKSSENKGILAAQLL
FT                   DYGKKKRFADIPAILELDSIDNGQQFAREALKELPFKDSPYRVVTKGVLNLQHRSDLLT
FT                   IEDIPNDQWMTITFHLQPTIYHMAKGDTLRVVLYTTDFEHTIRDNSNYALTLDLEQSYL
FT                   LIPTDEEE"
FT   misc_feature    complement(361014..361733)
FT                   /locus_tag="SEQ_0383"
FT                   /note="HMMPfam hit to PF08530, X-Pro dipeptidyl-peptidase
FT                   C-terminal n, score 6.6e-78"
FT                   /inference="protein motif:PFAM:PF08530"
FT   misc_feature    complement(361773..362726)
FT                   /locus_tag="SEQ_0383"
FT                   /note="HMMPfam hit to PF02129, X-Pro dipeptidyl-peptidase
FT                   (S15 family), score 6.7e-151"
FT                   /inference="protein motif:PFAM:PF02129"
FT   CDS_pept        complement(363296..363955)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0384"
FT                   /product="Crp family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92526"
FT                   /db_xref="GOA:C0MAI4"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI4"
FT                   /protein_id="CAW92526.1"
FT                   /translation="MNHQILQRYIDSHNFPIIEKGYHKYLTFESLEEDFTYILKEGIVK
FT                   QSVLSKYGMEFNLRYVTGLEITSVLNTGYSKDMREPYNVRIESETASFYKVRHSTFLRD
FT                   ISEDIELQGYVKDFYHYRLQKSMKKMQCMLTNGRIGAISTQIYDLMTLFGRPLANGHIL
FT                   IDFIITNEELGKFCGISTASSVSRLLKQLKKEGIIQINDQHIIITNLEKLKDNIVF"
FT   misc_feature    complement(363362..363460)
FT                   /locus_tag="SEQ_0384"
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp family, score 0.00017"
FT                   /inference="protein motif:PFAM:PF00325"
FT   CDS_pept        364124..365323
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0385"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92528"
FT                   /db_xref="GOA:C0MAI5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI5"
FT                   /protein_id="CAW92528.1"
FT                   /translation="MEDKLFNKHFIGITVLNFIVYMVYYLFTVIIAFVATKELGAKTSE
FT                   AGLATGIYILGTLLARLIFGKQLEVFGRRLVLRGGAIFYLLTTLAYFFMPTIGMMYFVR
FT                   LFNGFGYGVVSTATNTIVTAYIPASKRGEGINFYGLSTSLAAAIGPFVGTFMLDNLHID
FT                   FRMIIILCSVLIAVVVLGAFAFPVTDIALNSEQLAKTKSWTVDSFIERKALFITLIAFL
FT                   MGIAYASVLGFQKLYTTDIHLTTVGAYFFVVYALIITITRPAMGRLMDVKGEQWVLYPS
FT                   YLFLALGLFLLGSVTSSLPYLLSGALIGFGYGTFMSCGQAASIKGVEEHRFNTAMSTYM
FT                   IGLDLGLGAGPYLLGLIKDMLLGSGVQSFHQLFWLAGLIPAACAVMYFLKTQAKAIDKG
FT                   "
FT   misc_feature    join(364160..364228,364256..364315,364349..364417,
FT                   364445..364504,364523..364591,364619..364687,
FT                   364748..364816,364844..364912,364949..365008,
FT                   365021..365089,365126..365194,365237..365290)
FT                   /locus_tag="SEQ_0385"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SEQ0385 by TMHMM2.0 at aa 13-35, 45-64, 76-98, 108-127,
FT                   134-156, 166-188, 209-231, 241-263, 276-295, 300-322,
FT                   335-357 and 372-389"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    365045..365077
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        365343..365795
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0386"
FT                   /product="universal stress protein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92530"
FT                   /db_xref="GOA:C0MAI6"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI6"
FT                   /protein_id="CAW92530.1"
FT                   /translation="MISKYKRILAAVDGSYESELAVEKAINVALRNDAVLLLAHVIDVK
FT                   AYQGDAMVSDYVFDTQEEHAKEVLRYYEKMARGRGVSSIKKIIERGNPKKLLASDIPEK
FT                   EQADLIMVGATGLNTFERLLIGSTSEYILRHAKKDLLVVRNCEKTL"
FT   misc_feature    365352..365774
FT                   /locus_tag="SEQ_0386"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 4.6e-21"
FT                   /inference="protein motif:PFAM:PF00582"
FT   CDS_pept        365897..366745
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0387"
FT                   /product="glycerol facilitator-aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92532"
FT                   /db_xref="GOA:C0MAI7"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI7"
FT                   /protein_id="CAW92532.1"
FT                   /translation="MEITWTVKYITEFIATAFLIILGNGAVANVDLKGTKGNRSGWLVI
FT                   AFGYGLGVMMPALMFGNVSGNHINPAFTFGLAVSGLFPWAHVLQYVLAQLLGAMFGQLV
FT                   VVAVYKPYFVQTDNPNNILGSFSTISAVDDGDKSSRKAAYINGFLNEFVGSFVLFFGAM
FT                   ALTKNYFGVELVGKLVEAGYDQTTAATQISPYVTGSLAVAHLGIGFLVMTLVTSLGGPT
FT                   GPALNPARDLGPRLVHHFLPKSVLGQAKGDSKWWYSWVPVAAPVLAAVAAVAAFKFLYI
FT                   K"
FT   misc_feature    365897..366724
FT                   /locus_tag="SEQ_0387"
FT                   /note="HMMPfam hit to PF00230, Major intrinsic protein,
FT                   score 2.6e-14"
FT                   /inference="protein motif:PFAM:PF00230"
FT   misc_feature    join(365909..365977,366020..366088,366107..366175,
FT                   366323..366391,366482..366550,366671..366739)
FT                   /locus_tag="SEQ_0387"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0387 by TMHMM2.0 at aa 5-27, 42-64, 71-93, 143-165,
FT                   196-218 and 259-281"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    366095..366121
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS_pept        367238..367993
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92533"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032702"
FT                   /db_xref="InterPro:IPR032703"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI8"
FT                   /protein_id="CAW92533.1"
FT                   /translation="MTLFDNIVFKTPVLRVNNRDLNIAFYQKNLGLRLVSEENAISIFS
FT                   SWGQGQERFVIEESPAARTRVVDGPKKVNTIVIKTTAPKDIEQLLAHGVDYDLIFKGKK
FT                   GYAFEVTSPEGDRFLLHAEDDIKELDIVDDVPAIDKEADFRGLSQFSFDLIVLNVLDDE
FT                   QSRAFYQSIFGDCLPVTLEFNREAGQDLTIVPHVTWDLEILEFQVSDSYDLLALKTYLE
FT                   DKGCQVYLDKKARVLVLSDPSQIEIWFVK"
FT   CDS_pept        367990..368931
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0389"
FT                   /product="putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92534"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU7"
FT                   /protein_id="CAW92534.1"
FT                   /translation="MTLEVIEKVSQQIQEGLYHGASLALFRCGGWQEHYIGTLDGQRPV
FT                   TKGLVYDLASVSKVVGVATVCIAMINSGALALDTPLRHYYPDAQKLEVTLRQLLTHTSG
FT                   LDPYIPNRDQLNAQQLRAAMHQLQVKDDKTFHYTDVNFLLLGFMLEHLHGKSLDELFQE
FT                   MVFTPFGMTETSFGPRPEAVPTVKGVLDGEVHDPKAKVLGNHAGSAGLFSTIRDLERFI
FT                   EHYLKESFSDRLFQSYSRQEKPRSLGWSLEGDWISHTGYTGPFIMLNKKEQQAAIFLTN
FT                   RTYDKDDRALWIKERRQLRDAIHRTFDRNSPR"
FT   misc_feature    368014..368889
FT                   /locus_tag="SEQ_0389"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   1.3e-52"
FT                   /inference="protein motif:PFAM:PF00144"
FT   misc_feature    368140..368187
FT                   /note="PS00146 Beta-lactamase class-A active site."
FT                   /inference="protein motif:Prosite:PS00146"
FT   CDS_pept        complement(369681..372005)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0391"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92536"
FT                   /db_xref="GOA:C0MAU8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU8"
FT                   /protein_id="CAW92536.1"
FT                   /translation="MATVKTNADVFEKAWEGFKGTDWKEKASISRFVQANYTPYDGDES
FT                   FLAGVTERSLHIKKVIEETKAHYEATRFPYDTRPTSIADIPAGFIDKDKELIFGIQNDE
FT                   LFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKHVTTVNDGIFRAYTSNIRRARHA
FT                   HTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAITEIDEESIRLREEINLQY
FT                   QALGEVVKLGDLYGVDVRRPAENVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLDIF
FT                   AERDLARGTFTESEIQEFVDDFVLKLRTVKFARTKAYDALYSGDPTFITTSMAGMGNDG
FT                   RHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYAFRRYCMHMSHKHSSIQYEGVTT
FT                   MAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKDYK
FT                   VFDIDPVTDDVLDFDTVKANFEKSLDWLTDTYVDALNIIHYMTDKYNYEAVQMAFLPSH
FT                   QRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSNEL
FT                   AEWLIEAYTTRLRSHKLYKNAEATVSLLTITSNVAYSKQTGNSPVHRGVYLNEDGTTNL
FT                   SQLEFFSPGANPSNKAKGGWLQNLNSLASLDFSYAADGISLTTQVSPRALGKTHDEQVE
FT                   NLVTILDGYFENGGQHVNLNVMDLNDVYDKIMAGEDVIVRISGYCVNTKYLTPEQKTEL
FT                   TQRVFHEVLSMDDAAEAISGK"
FT   misc_feature    complement(369777..370085)
FT                   /locus_tag="SEQ_0391"
FT                   /note="HMMPfam hit to PF01228, Glycine radical, score
FT                   3.1e-41"
FT                   /inference="protein motif:PFAM:PF01228"
FT   misc_feature    complement(369786..369812)
FT                   /note="PS00850 Glycine radical signature."
FT                   /inference="protein motif:Prosite:PS00850"
FT   misc_feature    complement(370167..371966)
FT                   /locus_tag="SEQ_0391"
FT                   /note="HMMPfam hit to PF02901, Pyruvate formate lyase,
FT                   score 0"
FT                   /inference="protein motif:PFAM:PF02901"
FT   CDS_pept        372214..373317
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0392"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92538"
FT                   /db_xref="GOA:C0MAU9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAU9"
FT                   /protein_id="CAW92538.1"
FT                   /translation="MLIFPLINDTSRKIIHIDMDAFFAAVEERDNPELKGKPVVIGKNP
FT                   RESGGRGVVSTCNYEARRFGIHSAMSSKEAYERCPQAIFISGDHAKYRRIGYDIREIFK
FT                   RYTDQVEPVSIDEAYLDVTTNKLGIKSALKIARLIQHDIWNSLQLTCSAGVSYNKFLAK
FT                   LASDFEKPHGLTLVLPDDALPFLEKLPIEKFHGVGKRTVERLHEMGIYTGQDLLRVPEM
FT                   TLIDQFGRFGYELYRKARGISHSPVKPNRMRKSISSERTYAKLLYQEADIKAELSKHAR
FT                   RVADLLEANKKLGRIIVLKVRYADFTTLTKRVSLPELTRDARIIDQVARELFDSLEEHQ
FT                   AGIRLLGVTMTGLKDKVTDILLDLSFN"
FT   misc_feature    372262..373278
FT                   /locus_tag="SEQ_0392"
FT                   /note="HMMPfam hit to PF00817, impB/mucB/samB family, score
FT                   2.4e-103"
FT                   /inference="protein motif:PFAM:PF00817"
FT   CDS_pept        complement(373460..373945)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0393"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92540"
FT                   /db_xref="GOA:C0MAV0"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV0"
FT                   /protein_id="CAW92540.1"
FT                   /translation="MISYEQVRQALRTSTITIIIINAISMVITLFGLAGIFFLKSQLDK
FT                   PEFRAQFSAEQLRLFEVGISPFTIFMSVISLGLVVLTTVLCGFNLSKIKQGSTVSYVPY
FT                   IIGIVLYLISIVSQLFSQIEPVSMIIVLAELALYGFAFYKAKTLNEKDKDNPQSIEE"
FT   misc_feature    complement(join(373517..373573,373586..373654,
FT                   373673..373741,373832..373900))
FT                   /locus_tag="SEQ_0393"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0393 by TMHMM2.0 at aa 16-38, 69-91, 98-120 and 125-143"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(374041..376440)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0394"
FT                   /product="RecD/TraA family helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92542"
FT                   /db_xref="GOA:C0MAV1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV1"
FT                   /protein_id="CAW92542.1"
FT                   /translation="MEHFFTGTVDRIIFDNASNFFKILLLAIEDTDSDFDEADIVITGT
FT                   MAEIIEGEAYTFWGELTQHPRYGQQLRLSRYQKAKPTSAGLVSYFSSEHFKGIGQKTAE
FT                   KIIALYGNNPIDEILKNPSRLNEISSLSKANREAFVAKLKANYGTEQVIAALADLGLAN
FT                   RFAFQLFDKYKEEAVHIVKDNPYQLIEDIQGFGFKLADSLAEQLGIESASPKRFRAALL
FT                   HCLLEQSIKRGDTYIQARELLALTISLLEDTRPVECDPAIVANQLTQLIDEGKVMTIGT
FT                   RVFDSSLYYAEDGIQKHLTRLLQQPLTKEPSQDTIDQEIQAIQEELAITYDKIQKQAIS
FT                   QALTSKVFILTGGPGTGKTTVIRGILQAYASLYQIDLKQKDIPIILAAPTGRAARRMNE
FT                   LTGLASATIHRHLGLNGDNDYQAMEDYLDCDLLIVDEFSMVDTWLANQLLTAINSNTQL
FT                   IIVGDSDQLPSVGPGQVLADLLKVDRIPHITLDKIFRQSEESTIVDLANHIRQGILAPD
FT                   FCQKKADRSYFEAQAPFIPGMMTKIVQAALKSGIPAEEIQILAPMYKGLAGINSLNQLM
FT                   QNLLNPLANQTEFLFNETAFRKGDKVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQD
FT                   EIIMDFDGTEIVYPRNEWLKITLAYAMSIHKSQGSEFQVVILPVTRQSGRLLQRNLIYT
FT                   AITRSKSKLIMLGEIAAFEEAIKKEGDKRHTYLVQRLQVAEADDHTAAASVKESNQSSL
FT                   SVMPATSPQKEQEQPLYLLTPHNFLAIDPMIGLTEDDMLTFFKKKS"
FT   misc_feature    complement(375364..375387)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        complement(376669..377268)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0395"
FT                   /product="putative signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92543"
FT                   /db_xref="GOA:C0MAV2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV2"
FT                   /protein_id="CAW92543.1"
FT                   /translation="MKQFIKEWGAFTLFILLFGLSRLFLWQPVKVDGHSMDPTLAHGER
FT                   LIIFNKAKIDRFDIVVASEEDENGQRKEIVKRVVGMPGDKLSYRNDTLYINNKKTKEPY
FT                   LDTYLTSFKKDKLQSTYAYSDLFQELAENAAAFTVNSEGKTEFDITVPKGEYFLLGDDR
FT                   IVSRDSREVGSFKKQDIVGEVKFRFWPLNKINLFPR"
FT   misc_feature    complement(376975..377181)
FT                   /locus_tag="SEQ_0395"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24-like, score
FT                   1.3e-20"
FT                   /inference="protein motif:PFAM:PF00717"
FT   misc_feature    complement(377005..377043)
FT                   /note="PS00760 Signal peptidases I lysine active site."
FT                   /inference="protein motif:Prosite:PS00760"
FT   misc_feature    complement(377149..377172)
FT                   /note="PS00501 Signal peptidases I serine active site."
FT                   /inference="protein motif:Prosite:PS00501"
FT   sig_peptide     complement(377170..377268)
FT                   /locus_tag="SEQ_0395"
FT                   /note="Signal peptide predicted for SEQ0395 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.720) with cleavage site
FT                   probability 0.296 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(377191..377250)
FT                   /locus_tag="SEQ_0395"
FT                   /note="1 probable transmembrane helix predicted for SEQ0395
FT                   by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(377293..378252)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0396"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92545"
FT                   /db_xref="GOA:C0MAV3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV3"
FT                   /protein_id="CAW92545.1"
FT                   /translation="MHGMISHNRTFYVKIMFMDTLVFKINSQVSSSLIKQLAPYRISNA
FT                   NPYVRLAAKKDGVTLMLYTSGKLVLQGRQAAKLAQELDLQETPADQRPAPSSAQDIPLI
FT                   GSDEVGNGSYFGGIAVVASFVQPEEHALLRQLGVDDSKNLNDKSIAQIAPVLKKHIQHR
FT                   ALLLSPKKYNEMVGKGKPYNAVSVKVALHNQAIFLLLNDGARPEKIVIDAFTSQANYDK
FT                   YLQQEKNHFRNPLTFEEKAEGKYLAVAVSSIIARQLFLDNLDKLSQDLGYRLPSGAGRP
FT                   SDQIASQILAAYGMAGLEHCAKLHFANTKKAQALLKKQ"
FT   misc_feature    complement(377326..377943)
FT                   /locus_tag="SEQ_0396"
FT                   /note="HMMPfam hit to PF01351, Ribonuclease HII, score
FT                   4.7e-62"
FT                   /inference="protein motif:PFAM:PF01351"
FT   CDS_pept        378319..378630
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92547"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV4"
FT                   /protein_id="CAW92547.1"
FT                   /translation="MKNINRYKLTFGEKTLTLTTDKDNLFMEEVDRVAKEKYQAIKERL
FT                   PEADDETVAILMTINTLSAQLSREIEIEKIEAEIVELREKALAGIQEKASQADTDEVS"
FT   CDS_pept        378627..379175
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0398"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92549"
FT                   /db_xref="GOA:C0MAV5"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV5"
FT                   /protein_id="CAW92549.1"
FT                   /translation="MMLSVLILLLLSWSFYIGYNRGLILQTFYCFGALVSLLFAHHGYK
FT                   ALAGKLALWVPYSNPAEGAATLFFKDINIFELDKVYYAGIAFFILSTVGYAVVRLAGVL
FT                   VHLAPVDYFDGFEAKLASGLLAVMVSVLFLSMALTVLATIPMPFIQGRLHGSLLSRLLV
FT                   EHCPFISSILRQLWVTAIL"
FT   misc_feature    378630..379151
FT                   /locus_tag="SEQ_0398"
FT                   /note="HMMPfam hit to PF02674, Colicin V production
FT                   protein, score 2.4e-44"
FT                   /inference="protein motif:PFAM:PF02674"
FT   misc_feature    join(378630..378683,378693..378746,378864..378932,
FT                   378990..379058)
FT                   /locus_tag="SEQ_0398"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0398 by TMHMM2.0 at aa 2-19, 23-40, 80-102 and 122-144"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        379248..381584
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0399"
FT                   /product="putative DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92550"
FT                   /db_xref="GOA:C0MAV6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MAV6"
FT                   /protein_id="CAW92550.1"
FT                   /translation="MEKKILEQLEFEKVKEQFWPYLQTEQGQLELDLLEPIANKDKIQA
FT                   YFTELEEMAAIFVEHHHFALGGLSDVSESMQRLDLEADLSIQELLAVKKLLQVSAEVCR
FT                   FYADLENVDLVALKALFEKIESFPSLQGSLQAINDAGFVEGFASPELESIRRQISNKEH
FT                   ASRQLLQDILKKQAAYLSESLIASRNGRSVLPVKNTYRHKVAGVVHDMSASGSTVYIEP
FT                   RALVSLNEELTQLQTDERHEIGRILHELSEQLRPHSRSLRNNAWLLGHLDLVRAKYLYM
FT                   QAKQATVPVISDDKSLQLLNARHPLIQNPVANDLHFANDLAVIVITGPNTGGKTIMLKT
FT                   LGLAQVMAQSGLPILADKGSRVAVFNGIYADIGDEQSIEQSLSTFSSHMTHIVEILNQA
FT                   DSDSLILFDELGAGTDPQEGASLAMAILEQLRLTNIKTMATTHYPELKAYGIETAYVEN
FT                   ASMAFDNVSLKPTYRFMQGVPGRSNAFDIARRLGLAEHIVKEAQAMTATDHDVNRIIEQ
FT                   LEQQTLESRKRLEHIKEVEQDNLKFNRAVKKLYNEFSHAKDKELEKAALEAREIVDIAL
FT                   AESDSILSQLHEKAELKPHEIIEAKHRLKQLAPEQSLSQNKVLKKAKKWRAPRVGDDII
FT                   VTAYGQRGTLLAQLKDKRWEAQVGLIKLTLKEDEFSLVKLKEEAQQPKKRAVKVVKKAA
FT                   TGKGPRARLDLRGKRYEEAMQELDAFIDQALLNNMSQVDIIHGIGTGVIREAVGKYLRR
FT                   NKHVKSFGYAPQNAGGSGCTIANLG"
FT   misc_feature    380103..380810
FT                   /locus_tag="SEQ_0399"
FT                   /note="HMMPfam hit to PF00488, MutS domain V, score
FT                   5.9e-15"
FT                   /inference="protein motif:PFAM:PF00488"
FT   misc_feature    380229..380252
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    381354..381581
FT                   /locus_tag="SEQ_0399"
FT                   /note="HMMPfam hit to PF01713, Smr domain, score 4.1e-35"
FT                   /inference="protein motif:PFAM:PF01713"
FT   misc_feature    381531..381563
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(381924..383243)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0400"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92552"
FT                   /db_xref="GOA:C0MAV7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV7"
FT                   /protein_id="CAW92552.1"
FT                   /translation="MEAYELIVIGFGKAGKTLAAKMAQLGKRVALIEQSPTMYGGTCIN
FT                   IGCIPTKALITAAEHNASFADAMAHKDTVVHRLRQKNEQLLAQSGVTLYNGKASFVSNK
FT                   TIQVEAGQERILLEGKHIVINTGAVSNRFPIPGLADSQHVVDSTGILALTEQPQRLAII
FT                   GAGNIGLEVASLYASLGSEVTMYEAAPAILGRYEPVVAELAQDYLEKAGVTFKLSATVE
FT                   LIANDEAGRVLVTANGKTEAFDCLLYAMGRKPATQGLGLENTDIKLDDRYAVVVDDYCQ
FT                   TTVEGLYAVGDVNGGPQFTYTSLDDFRIVFGQLTGTSQYNHKDRGYLPTTVFIEPPLSQ
FT                   IGLTEKEAKEQGLPYKANELLVANMPRAHVNNDLRGIFKVIVNTETNEILGATLFANNS
FT                   HEYINLIKMAMDNQIPYTYLKNQLFTHPSMAENLNDVFNL"
FT   misc_feature    complement(381933..382262)
FT                   /locus_tag="SEQ_0400"
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidored, score 2.9e-27"
FT                   /inference="protein motif:PFAM:PF02852"
FT   misc_feature    complement(382350..383231)
FT                   /locus_tag="SEQ_0400"
FT                   /note="HMMPfam hit to PF07992, Pyridine
FT                   nucleotide-disulphide oxidored, score 3e-50"
FT                   /inference="protein motif:PFAM:PF07992"
FT   misc_feature    complement(382353..383231)
FT                   /locus_tag="SEQ_0400"
FT                   /note="HMMPfam hit to PF01134, Glucose inhibited division
FT                   protein A, score 0.00044"
FT                   /inference="protein motif:PFAM:PF01134"
FT   misc_feature    complement(382491..382769)
FT                   /locus_tag="SEQ_0400"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidored, score 3.5e-28"
FT                   /inference="protein motif:PFAM:PF00070"
FT   misc_feature    complement(383094..383126)
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT                   /inference="protein motif:Prosite:PS00076"
FT   misc_feature    complement(383193..383216)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        383423..383737
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0401"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92554"
FT                   /db_xref="GOA:C0MAV8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV8"
FT                   /protein_id="CAW92554.1"
FT                   /translation="MAHIVTDATFEAETNEGLVLVDFWATWCGPCLMQAPILDQLAAEI
FT                   DEAELKIVKLDVDDNPNTAQQFGIMSIPTLLFKKDGKVVKQVAGVHTKDQIKAIVAELS
FT                   "
FT   misc_feature    383423..383731
FT                   /locus_tag="SEQ_0401"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 4.3e-32"
FT                   /inference="protein motif:PFAM:PF00085"
FT   misc_feature    383480..383536
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        complement(383983..385104)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0402"
FT                   /product="putative cell surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92556"
FT                   /db_xref="GOA:C0MAV9"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAV9"
FT                   /protein_id="CAW92556.1"
FT                   /translation="MNKKSARRRRKNLITKLAMTSALTLGVGAATTLAGQTEVRADNIL
FT                   RLDMTDKEAVEKFANELKNEVHKNYRGSNTWQKLTLILNGYQNLREQIETELKNSEQKV
FT                   KELNDKVNSETQGKQELQNQLEKEKEELETLKKELEAEKAKGTGETEKLQKEIEAKNAM
FT                   ISDLQKQLEETKQRVQEFEAEVGKLMAEKADLQTKLNEQEQLNAKLQKEIEDLKAQIEK
FT                   LKHCQDTPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPGPKPEPKPEPKPGPKPE
FT                   PKPEPKPGPKPGPKPEPKPGPKPEPKPEPKPEPKPEAKKPEQPKPMTKPGAKKPEQSLP
FT                   STGDIRNPFFTPAAIAIMIAAGTIAIPKRKEED"
FT   misc_feature    complement(383992..384114)
FT                   /locus_tag="SEQ_0402"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   0.00015"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    complement(384073..384090)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   sig_peptide     complement(384985..385104)
FT                   /locus_tag="SEQ_0402"
FT                   /note="Signal peptide predicted for SEQ0402 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.448 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(385000..385068)
FT                   /locus_tag="SEQ_0402"
FT                   /note="1 probable transmembrane helix predicted for SEQ0402
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(385324..385590)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0404a"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0404a"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92558"
FT                   /db_xref="GOA:C0MB76"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB76"
FT                   /protein_id="CAW92558.1"
FT                   /translation="MKLTNALCLVAATAALALAPINTSTGQTNTVLASQKSTGHCTHTR
FT                   SGWFKCPDGGSYYDESYDTHSSWLIWLYGAFYSAWEIITSWFK"
FT   CDS_pept        complement(385875..387023)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0404"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92559"
FT                   /db_xref="GOA:C0MB77"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB77"
FT                   /protein_id="CAW92559.1"
FT                   /translation="MIDLNDYGITMWDQDTIASFRRTLLAWYDQEKRDLPWRRTKDPYH
FT                   IWVSEIMLQQTQVVTVIPYYERFLDWFPTVEALACADEERLLKAWEGLGYYSRVRNMQK
FT                   AAQQIMTDFGGIFPSSHADITKLKGIGPYTAGAISSIAFDLPEPAVDGNVMRVMARLFE
FT                   INYDIGDPKNRKIFQAVMEVLIDPERPGDFNQALMDLGTDIEAAKNPRPDESPVRFFCA
FT                   AYRHGTYDKYPIKEPKKKPRPIQVQAFVIRDSKGRLLLEKNTQGRLLGGFWAFPLIETK
FT                   LVSQQLTLFEDSPIVLETMSQTTLFEERYGLMPIWSQATFPQVKHTFSHQKWTIELCEG
FT                   FTDSMPLAPDRELVWVAIEDMAAYPMATPQKKMLEAYLKKQS"
FT   misc_feature    complement(386601..386690)
FT                   /locus_tag="SEQ_0404"
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix motif,
FT                   score 2e-06"
FT                   /inference="protein motif:PFAM:PF00633"
FT   CDS_pept        387194..387337
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0405"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus mutans hypothetical protein
FT                   UniProt:Q8DTE7 (EMBL:AE014133 (125 aa) fasta scores:
FT                   E()=2.9e-12, 72.340% id in 47 aa;putative hypothetical
FT                   phage protein (fragment)"
FT   CDS_pept        387609..387740
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0406"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92562"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB78"
FT                   /protein_id="CAW92562.1"
FT                   /translation="MKAYRDYQLWPKERSKQYKLEIPVIERTYAMLRFNKGRYKNGD"
FT   CDS_pept        388399..388689
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0408"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92564"
FT                   /db_xref="GOA:C0MB79"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MB79"
FT                   /protein_id="CAW92564.1"
FT                   /translation="MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATIVESKDWEK
FT                   RRLAYEINDFREGLYHIVNLEATDAVALNEFDRLSKINGDILRHMIVKLDA"
FT   misc_feature    388402..388680
FT                   /locus_tag="SEQ_0408"
FT                   /note="HMMPfam hit to PF01250, Ribosomal protein S6, score
FT                   2.7e-28"
FT                   /inference="protein motif:PFAM:PF01250"
FT   CDS_pept        388708..389196
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0409"
FT                   /product="single strand binding protein (SSB)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92566"
FT                   /db_xref="GOA:C0MB80"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB80"
FT                   /protein_id="CAW92566.1"
FT                   /translation="MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRAFKSQNGERE
FT                   ADFINCVIWRQQAENLANWAKKGALIGITGRIQTRNYENQQGQRVYVTEVVADNFQMLE
FT                   SRATREANSSGSYGGGFNSSPATNSYSAPAQQTPNFGRDGSPFGGSNPMDISDDDLPF"
FT   misc_feature    388711..389016
FT                   /locus_tag="SEQ_0409"
FT                   /note="HMMPfam hit to PF00436, Single-strand binding
FT                   protein family, score 4.7e-32"
FT                   /inference="protein motif:PFAM:PF00436"
FT   misc_feature    389059..389130
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00583"
FT   CDS_pept        389355..389594
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0410"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92568"
FT                   /db_xref="GOA:C0MB81"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MB81"
FT                   /protein_id="CAW92568.1"
FT                   /translation="MAQQRRGGFKRRKKVDFIAANKIEYVDYKDTELLSRFVSERGKIL
FT                   PRRVTGTSAKNQRKVTTAIKRARVMALMPYVNED"
FT   misc_feature    389412..389573
FT                   /locus_tag="SEQ_0410"
FT                   /note="HMMPfam hit to PF01084, Ribosomal protein S18, score
FT                   6.2e-34"
FT                   /inference="protein motif:PFAM:PF01084"
FT   misc_feature    389430..389501
FT                   /note="PS00057 Ribosomal protein S18 signature."
FT                   /inference="protein motif:Prosite:PS00057"
FT   repeat_region   389746..391174
FT                   /note="ISSeq3"
FT   repeat_region   389754..389765
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        389800..390315
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0412"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92570"
FT                   /db_xref="GOA:C0MB82"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB82"
FT                   /protein_id="CAW92570.1"
FT                   /translation="MTLSYEDKVQTYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    389854..389919
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    389962..390243
FT                   /locus_tag="SEQ_0412"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    390121..390159
FT                   /locus_tag="SEQ_0412"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   CDS_pept        390339..391142
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0413"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92572"
FT                   /db_xref="GOA:C0M6L9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6L9"
FT                   /protein_id="CAW92572.1"
FT                   /translation="MLEILDLSRSTYYYQVKQLAQEDKDMDLKELIQGIYDEHHGNYGY
FT                   RRIHLELRNRGFIVNHKKVQRLMTVMGLKARIRRKRKYSSYKGEVGKKADNLIKRQFEG
FT                   SKPYEKCYTDVTEFTLPEGKLYLSPVLDGYNSEIIDFTLSRSPDLKQVQTMLEKAFPAD
FT                   SYNGTILHSDQGWQYQHQSYHHFLETKGIRPSMSRKGNSPDNGMMESFFGILKSEMFYG
FT                   LETTYQSLNELEQAITDYIFYYNNKRIKAKLKGLSPVQYRTKSFH"
FT   misc_feature    390645..391127
FT                   /locus_tag="SEQ_0413"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   1.1e-37"
FT                   /inference="protein motif:PFAM:PF00665"
FT   repeat_region   complement(391155..391166)
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        complement(391294..391944)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0414"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92573"
FT                   /db_xref="GOA:C0MB84"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB84"
FT                   /protein_id="CAW92573.1"
FT                   /translation="MDLQQLTKKNQEFIHIATNQLIKDGKTDDDIKALLEEVIPTILEN
FT                   QKKGITARSLYGAPTAWAASFSKEANQKEATPKNTNPWLMWLDTSLLFIGIVGLLNSIM
FT                   TFFNTNTTVTGLVSLLALGFGGGASMYATYYFVYRHMGKDKSLRPSWFKVIGALTLAML
FT                   AWITLYSATAFLPKALNPQLPPVALLITGALAIGLRYLLQRKYNIQNTMAPQR"
FT   misc_feature    complement(391312..391944)
FT                   /locus_tag="SEQ_0414"
FT                   /note="HMMPfam hit to PF06570, Protein of unknown function
FT                   (DUF1129), score 2.5e-135"
FT                   /inference="protein motif:PFAM:PF06570"
FT   misc_feature    complement(join(391339..391398,391426..391494,
FT                   391531..391599,391627..391695))
FT                   /locus_tag="SEQ_0414"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0414 by TMHMM2.0 at aa 84-106, 116-138, 151-173 and
FT                   183-202"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(392203..393147)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0415"
FT                   /product="CorA-like Mg2+ transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92575"
FT                   /db_xref="GOA:C0MB85"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB85"
FT                   /protein_id="CAW92575.1"
FT                   /translation="MKQMFLSSAIEFKEIETFEPGAWIKLVNPSQEESIAIADQFNIDI
FT                   SDLRAPLDVEETSRIAVEDDYTLIIVDVPVYEERNNKSYYVTMPLGIIVTESAVITTCL
FT                   HDMTLFDQFHKRKVKNFYTFMKTRFVFQILYRNAELFLTALRTIDRQSERLEAQLEAAT
FT                   RNEELIDMMELEKSIVYLKASLKFNERIVKKLSSSTSSLKKYIEDEDLLEDTLIETQQA
FT                   IEMAGIYENVLNAMTETTASIINNNQNTIMKTLALMTMALDIPTVIFSAYGMNFQDNWL
FT                   PLNGLSHAFWYIVLLATLLSSFVVIYFIRKKWF"
FT   misc_feature    complement(392206..393087)
FT                   /locus_tag="SEQ_0415"
FT                   /note="HMMPfam hit to PF01544, CorA-like Mg2+ transporter
FT                   protein, score 2.6e-07"
FT                   /inference="protein motif:PFAM:PF01544"
FT   misc_feature    complement(join(392221..392289,392317..392385))
FT                   /locus_tag="SEQ_0415"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0415 by TMHMM2.0 at aa 255-277 and 287-309"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        393343..396165
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0416"
FT                   /product="UvrABC system protein A (UvrA protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92577"
FT                   /db_xref="GOA:C0MB86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB86"
FT                   /protein_id="CAW92577.1"
FT                   /translation="MQDKLIIRGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   IYAEGQRRYVESLSAYARQFLGNMEKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTE
FT                   INDYLRLLYARVGTPYCINGHGAITASSVEQIVEQVLELPERTRMQILAPLVRRKKGQH
FT                   KTVFEKIQKDGYVRVRVDGEIFDVSEVPALSKSKMHNIEVVIDRLVNKDGIRSRLFDSI
FT                   EAALRLGDGYLMIDTMDGNELLFSEYYSCPVCGFTVPELEPRLFSFNAPFGSCPTCDGL
FT                   GIKLEVDLDLVVPDPSKTLREGALAPWNPISSNYYPTMLEQAMQSFGVDMDKPFEQLSE
FT                   QEKELILYGSGDQEFHFHYVNDFGGERSIDIPFEGVVTNINRRYHETNSDYTRNVMRGY
FT                   MNELTCASCHGYRLNDQALCVRVGGEYGLTIGQVSELSIADHLQLLDRLELSDNESTIA
FT                   KPIIKEIHDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLSGVLYVLDEP
FT                   SIGLHQRDNDRLIDSLKKMRDLGNTLIVVEHDEDTMMQADWLIDVGPGAGDFGGQIVAS
FT                   GTPQQVARHKRSITGQYLSGRKSIPVPLERRAGNGRYIDIKGAAQNNLQNLDVRFPLEK
FT                   FIAVTGVSGSGKSTLVNSILKKAVAQRLNRNSEKPGKHRSITGIDHLERLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRELFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVPCDVCHGRRYNSETLEVHYKGKNIAEILDMTVDDALVFFSAIPKIARKIQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSLYILDEPTTGLHTDDIARL
FT                   LKVLERFVDDGNTVLVIEHNLDVIKSADHIIDLGPEGGVGGGQLVATGTPEEVAAVEES
FT                   YTGQYLKLKL"
FT   misc_feature    393436..393459
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    394555..394572
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    394807..394851
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    395242..396066
FT                   /locus_tag="SEQ_0416"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.5e-33"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    395263..395286
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    395629..395646
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    395830..395874
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        396456..397532
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0417"
FT                   /product="putative metallopeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92579"
FT                   /db_xref="GOA:C0MB87"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB87"
FT                   /protein_id="CAW92579.1"
FT                   /translation="MSSFLAQRLSNCQALLEKKGLEAILITNLTNIYYLTGFSGTSATV
FT                   FISPKRRVFITDSRYTLIAKASIEGFDIIESRTPLAEIAAILQADKLSSLAFEDQVSFS
FT                   FSQSLQAAFSEVTLLPQSGFIEALRLIKDASEIDIIAKACSISDKAFCDVLDFIKPGQT
FT                   SELEVANFLDFRMRQYGASGISFDTIAASGYRSAMPHGRATDKIIQQGETLTLDFGCYY
FT                   QHYVSDMTRTIHIGQVTDQEREIYELVLAANQALIAKAGAGMTYREFDAIPRQLITEAG
FT                   YGSHFTHGIGHGIGLDIHEDPFFAKTDQRLLAGMVVTDEPGIYLDGKYGVRIEDDLVIT
FT                   ETGCQVLTKAPKELIVLT"
FT   misc_feature    396867..397502
FT                   /locus_tag="SEQ_0417"
FT                   /note="HMMPfam hit to PF00557, metallopeptidase family M24,
FT                   score 3.4e-63"
FT                   /inference="protein motif:PFAM:PF00557"
FT   misc_feature    397317..397355
FT                   /note="PS00491 Aminopeptidase P and proline dipeptidase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00491"
FT   CDS_pept        397576..398037
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0418"
FT                   /product="putative cytidine and deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92581"
FT                   /db_xref="GOA:C0MB88"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C0MB88"
FT                   /protein_id="CAW92581.1"
FT                   /translation="MTDRLSWQDYFMANAELISKRSTCDRAFVGAVLVKDNRIIATGYN
FT                   GGVSATDNCNEAGHYMEEGHCIRTVHAEMNALIQCAKEGISTAGTEIYVTHFPCINCTK
FT                   ALLQAGICKITYKSHYRPHPFAIELMDKKGVAYVQHDVPQIILGGAVEP"
FT   misc_feature    397588..397929
FT                   /locus_tag="SEQ_0418"
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminas, score 1.2e-31"
FT                   /inference="protein motif:PFAM:PF00383"
FT   misc_feature    397786..397893
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT                   /inference="protein motif:Prosite:PS00903"
FT   repeat_region   complement(398044..398062)
FT                   /note="perfect repeat flanking IS element"
FT   repeat_region   complement(398063..399607)
FT                   /note="ISSeq2"
FT   CDS_pept        complement(398119..399516)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0419"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92582"
FT                   /db_xref="GOA:C0M7Y9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7Y9"
FT                   /protein_id="CAW92582.1"
FT                   /translation="MIESKKYLVIKAVCEGKKQKNRACVELGLSKRQVNRLILAYREKG
FT                   KSAFVHGNRSKRPTHAMSLETKRRIIEKYQSYGDLRPNVVHFCELLAEEENIAYSDTTV
FT                   RKLLYQAGFLSPKTQRATKRRLKQEAKQKKREAEKRGSKLPTASNFFEEPDKAHPSRAR
FT                   KKFKGELIQMEASQFPWFGQQETHLHVAIDDASGDIVGAYFDTQETLNGYYHVLEQILE
FT                   VHGIPFQFLTDKRTVFTYASSQSKKIEEDTFTQFGYACHQLGIAIETSSIPQAKGRVER
FT                   LNQTLQSRLPIDLQRNQITSISQANRYLKRWIKRFNKQFGGLASESVFEKAPKPAQRNL
FT                   LLARISERVIDSGHHIRYQNNFYLPVEGDKKIYFTRKTKALVIEAFDGDIYLNIADNIY
FT                   ATRKLPKHEKHSKEFEMVPKTKKERRKYIPPQSHPWKLASFKQYLHKIGKSYEEFKRER
FT                   NTSQPQL"
FT   misc_feature    complement(398527..399030)
FT                   /locus_tag="SEQ_0419"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   6.4e-17"
FT                   /inference="protein motif:PFAM:PF00665"
FT   misc_feature    complement(399376..399399)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   repeat_region   complement(399612..399630)
FT                   /note="perfect repeat flanking IS element"
FT   CDS_pept        399699..400256
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0420"
FT                   /product="elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92583"
FT                   /db_xref="GOA:C0MBK0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MBK0"
FT                   /protein_id="CAW92583.1"
FT                   /translation="MIEASKLRAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVR
FT                   TGSTFDTTYRPDEKFEQAIIETVPAQYLYKMDETAYFMNTETYDQYEIPVANVEQELLY
FT                   ILENSDVKIQFYGTEVIGVQVPTTVELTVTETQPSIKGATVTGSGKPATLETGLVVNVP
FT                   DFIEVGQKLIINTAEGTYVSRA"
FT   misc_feature    399705..399878
FT                   /locus_tag="SEQ_0420"
FT                   /note="HMMPfam hit to PF08207, Elongation factor P (EF-P)
FT                   KOW-like domain, score 1.5e-18"
FT                   /inference="protein motif:PFAM:PF08207"
FT   misc_feature    399897..400061
FT                   /locus_tag="SEQ_0420"
FT                   /note="HMMPfam hit to PF01132, Elongation factor P (EF-P)
FT                   OB domain, score 4.3e-12"
FT                   /inference="protein motif:PFAM:PF01132"
FT   misc_feature    400146..400205
FT                   /note="PS01275 Elongation factor P signature."
FT                   /inference="protein motif:Prosite:PS01275"
FT   CDS_pept        400299..400688
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92585"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBK1"
FT                   /protein_id="CAW92585.1"
FT                   /translation="MTTENIGEIVISPRVLEVITGIATMQVEGVHSLHNKNMADTFNKA
FT                   SLGKGVYLQTEENGTVNADIYVYLQYGVKVPAVSMAIQRAVKSAVYDMAEVTISYVNIH
FT                   VEGIVPEKTPKPEMKSLFDEDFLDD"
FT   misc_feature    400311..400625
FT                   /locus_tag="SEQ_0421"
FT                   /note="HMMPfam hit to PF03780, Protein of unknown function
FT                   (DUF322), score 7.5e-41"
FT                   /inference="protein motif:PFAM:PF03780"
FT   CDS_pept        400681..401133
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0422"
FT                   /product="N utilization substance protein B homolog (NusB
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92587"
FT                   /db_xref="GOA:C0MBK2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0MBK2"
FT                   /protein_id="CAW92587.1"
FT                   /translation="MTKHFQHSRRDLRERAFQALFAMEMGGDFLPASQFAYDYDKEAAD
FT                   DKQPSELPVFLLNLVNGVMDHKAELDEVIKKNLKTSWSIERLTVVDKTMLRLGLFEMTL
FT                   FEETPDRVALNEIIEIAKKYSDDTSAKFINGLLSQFVSDESAAVTE"
FT   misc_feature    400708..401112
FT                   /locus_tag="SEQ_0422"
FT                   /note="HMMPfam hit to PF01029, NusB family, score 1.3e-29"
FT                   /inference="protein motif:PFAM:PF01029"
FT   misc_feature    400921..400950
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        401332..401598
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92589"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6R6"
FT                   /protein_id="CAW92589.1"
FT                   /translation="MSDTITSSPVAASAAISELVGVDTSRVHQQSVAFSVTKGIAGMEK
FT                   GRQVSNQLLQAVSDFSQAVLIQANKFPQLAAKLEKRDLEEATR"
FT   CDS_pept        join(401610..401795,401799..401969)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0424"
FT                   /note="CDS contains a nonsense mutation (ochre) in
FT                   comparison to SZO16200;conserved hypothetical protein
FT                   (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92591.1"
FT   CDS_pept        join(401960..402838,402842..403366)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0426"
FT                   /note="CDS contains a nonsense mutation (opal) in
FT                   comparison to SZO16190;conserved hypothetical protein
FT                   (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92593.1"
FT   CDS_pept        403363..403869
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0428"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92594"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6R9"
FT                   /protein_id="CAW92594.1"
FT                   /translation="MKRKILLLMMLLVGVFIFSKRYELYYFFQGKEYLRPNESIELAVR
FT                   PKYEQIEYSSDLYLESDEKVLLKLEGRDIWSEYIYRRTDSYLSKIGYRYSITEQVIEKY
FT                   DSTKDNGVVIVEAGHKGATIDGDGLIVPLKGKRKYSVTEDHDYSITITNLSDQPVAFRA
FT                   IVADR"
FT   sig_peptide     403363..403425
FT                   /locus_tag="SEQ_0428"
FT                   /note="Signal peptide predicted for SEQ0428 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.714 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(404246..405211)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0429"
FT                   /product="putative sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92596"
FT                   /db_xref="GOA:C0MBY7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBY7"
FT                   /protein_id="CAW92596.1"
FT                   /translation="MVAKLTDVAALAGVSPTTVSRVINKKGYLSQKTIDKVNKAMRELG
FT                   YKPNNLARSLQGKSPQLIGLIFPNISNIFYAELIEHLEIELFKQGYKAIICNSENNPIK
FT                   ERDYLEMLAANQVDGIISSSHNLGIDDYERVEAPIVAFDRNLAPHIPIISSDNFEGGKL
FT                   AAKTLQKHGCQKMIMITGNDHSDSPTGLRQLGFNYQLKKGADIIKLPNDLSSIRREMEI
FT                   KSILATRRPDGIFASDDLTAILIMKVAGQLGIAIPDNLKLIGYDGTAFIEHYFPQLTTI
FT                   KQPIKEIASLTVEVLLKKIGNEKTSKDYVLPITLLPGGSL"
FT   misc_feature    complement(404255..405034)
FT                   /locus_tag="SEQ_0429"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 3.4e-05"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    complement(405035..405058)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(405128..405205)
FT                   /locus_tag="SEQ_0429"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.2e-10"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    complement(405140..405205)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1960.000, SD 5.86 at aa 3-24, sequence
FT                   AKLTDVAALAGVSPTTVSRVIN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(405143..405199)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS_pept        complement(405216..406655)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0430"
FT                   /product="putative sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92598"
FT                   /db_xref="GOA:C0MBY8"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C0MBY8"
FT                   /protein_id="CAW92598.1"
FT                   /translation="MDLPRSIRYRPYQEWSKEAYQAIQQKVAQSLWRSHFHIEARTGLL
FT                   NDPNGFSYFAGSFQLFYQNWPFGAAHGLKQWVHTTSTDLVHFTETKTRLLPDHQNDSHG
FT                   AYSGSAYPIGDKLFLCYTGNVRSKDWVRHPLQIGAWMDQSGHITKCEQVLIDKPDDVTE
FT                   HFRDPQLFTYQDQLYAIIGAQNLQQQGIIKLYKANNNDVTSWQFVADLDFDDSGTAYMI
FT                   ECPNLVFIEDKPVLIFCPQGLAKSELDYQNIYPNTYKVFQTFDPKRRKLLGGGPIQNLD
FT                   FGFEAYATQAFNSPDGRVLAVSWIGLPDIDYPTDKYAYQGALSLVKELRLKNGRLHQAP
FT                   VPALSKLRDKAQPFQNKKNSSNCYELALTIEAQQATELLLFADTQHKGLKLTVDTCKGQ
FT                   LTIDRSKAGAQYAQEFGAKRSCQIPVNRATLNIYVDKSILEIFVNQGEAVLTSRVFPNE
FT                   GQSGIELLKGQVSGYYYEMRY"
FT   misc_feature    complement(405318..405566)
FT                   /locus_tag="SEQ_0430"
FT                   /note="HMMPfam hit to PF08244, Glycosyl hydrolases family
FT                   32 C termi, score 2.2e-13"
FT                   /inference="protein motif:PFAM:PF08244"
FT   misc_feature    complement(405636..406547)
FT                   /locus_tag="SEQ_0430"
FT                   /note="HMMPfam hit to PF00251, Glycosyl hydrolases family
FT                   32 N termi, score 1.4e-127"
FT                   /inference="protein motif:PFAM:PF00251"
FT   CDS_pept        406932..408815
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0431"
FT                   /product="putative sucrose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92600"
FT                   /db_xref="GOA:C0M679"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C0M679"
FT                   /protein_id="CAW92600.1"
FT                   /translation="MDNHQIAKEVIEALGGRENVRSVAHCATRLRVMVHDEGKINKEKA
FT                   EAIDKVKGAFFNSGQYQLIFGTGTVNSIYDEVVALGLPAALAGEQKEQVVKSGNAFQRA
FT                   IRTFGDVFVPIIPAIVAIGLFMGVRGLLTQPAVMEFFGIHDYGDNFLMYTRILTDTAFV
FT                   YLPALVAWSAFRVFGGNPIIGIVLGLMLVSNELPNAWVVASGGDVKPLTFFGFVPVVGY
FT                   QGTVLPAFFVGLVGAKLEKWLHKRVPDALDLLATPFLTFAIMSALGLFVIGPIFHSLEN
FT                   LVLAGTQAVLGLPFGIAGLVIGGVQQLIVVTGIHHIFNFLEAQLVANTGKDPFNAYLTA
FT                   ATAAQAGATLAVAVKTKSAKLKGLAFPSALSALLGITEPAIFGVNLRYPKVFVSGLIGG
FT                   AAGGWVAGILGIAGTGFGITVLPGALLYLNGQLLQYLVTLLVGLGLAFVIAYIWGFKDK
FT                   SDQEAPATQVKSEPAQKASAAEELLSPVAGELIDLSSVADPVFSSGSMGQGVAIKPEGR
FT                   ILCSPVDGRVEAALETGHAYVIKSDKGAEILLHIGIDTVSMAGEGFETFVKVGQMVKAG
FT                   DALGSFDIARIQQAGLDTTTMLLVTNSADVHAVQILAQGKVTVGSPVILVK"
FT   misc_feature    406950..407054
FT                   /locus_tag="SEQ_0431"
FT                   /note="HMMPfam hit to PF00367, phosphotransferase system,
FT                   EIIB, score 9.1e-19"
FT                   /inference="protein motif:PFAM:PF00367"
FT   misc_feature    406986..407039
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS01035"
FT   misc_feature    407256..408128
FT                   /locus_tag="SEQ_0431"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase system,
FT                   EIIC, score 1.1e-45"
FT                   /inference="protein motif:PFAM:PF02378"
FT   misc_feature    join(407262..407327,407385..407453,407472..407540,
FT                   407568..407636,407691..407759,407802..407870,
FT                   407931..407993,408021..408089,408102..408170,
FT                   408228..408296)
FT                   /locus_tag="SEQ_0431"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0431 by TMHMM2.0 at aa 111-132, 152-174, 181-203,
FT                   213-235, 254-276, 291-313, 334-354, 364-386, 391-413 and
FT                   433-455"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    407826..407918
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    408360..408758
FT                   /locus_tag="SEQ_0431"
FT                   /note="HMMPfam hit to PF00358,
FT                   phosphoenolpyruvate-dependent sugar phosph, score 1.4e-66"
FT                   /inference="protein motif:PFAM:PF00358"
FT   misc_feature    408561..408599
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00371"
FT   CDS_pept        409044..412100
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0432"
FT                   /product="endoglycosidase (EndoS)"
FT                   /EC_number="3.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92602"
FT                   /db_xref="GOA:C0M680"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C0M680"
FT                   /protein_id="CAW92602.1"
FT                   /translation="MEKQVLVKKTLKCVCAAALMVAILAAQHDSLIRVKAEDKVVQTSP
FT                   SVSAIDDLHYLSENSKKEFKEGLSKAGEVPEKLKDILSKAQQADKQAKVLAEMKVPEKI
FT                   AMKPLKGPLYGGYFRTWHDKTSDPAEKDKVNSMGELPKEVDLAFVFHDWTKDYSFFWQE
FT                   LATKHVPTLNKQGTRVIRTIPWRFLAGGDHSGIAEDTQKYPNTPEGNKALAKAIVDEYV
FT                   YKYNLDGLDVDIERDSIPKVNGKESNENIQRSIAVFEEIGKLIGPKGADKSRLFIMDST
FT                   YMADKNPLIERGAQYIDLLLVQVYGTQGEKGDWDPVARKPEKTMEERWESYSKYIRPEQ
FT                   YMVGFSFYEENAGSGNLWYDINERKDDHNPLNSEIAGTRAERYAKWQPKTGGVKGGIFS
FT                   YAIDRDGVAHQPKKVSDDEKRTNKAIKDITDGIVKSDYKVSKALKKVMENDKSYELIDQ
FT                   KDFPDKALREAVIAQVGSRRGDLERFNGTLRLDNPDIKSLEGLNKLKKLAKLELIGLSQ
FT                   ITKLDSLVLPANAKPTKDTLANVLEAYDSAKKEETKAIPQVALTISGLTGLKELNLAGF
FT                   DRDSLAGIDAASLTSLEKVDLSSNKLDLAAGTENRQILDTMLATVTKHGGVSEKTFVFD
FT                   HQKPTGLYPDTYGTKSLQLPVANDTIDLQAKLLFGTVTNQGTLINSEADYKAYQEQEIA
FT                   GHRFVDSSYDYKAFAVTYKDYKIKVTDSTLGVTDHKDLSTSKEETYKVEFFSPTNSTKP
FT                   VHEAKVVVGAEKTMMVNLAEGATVIGGDADPTNAKKVFDGLLNNDTTILSTSNKASIIF
FT                   ELKEPGLVKYWRFFNDSKISKADCIKEAKLEAFVGHLEAGSKVKDSLEKSSKWVTVSDY
FT                   SGEDQEFSQPLNNIGAKYWRITVDTKGGRYNWPSLPELQIIGYQLPAADLVMAMLATAE
FT                   ELSQQKDKFSQEQLKELEVKIAALKAALDSKMFNADAINASTADLKAYVDKLLADRTDQ
FT                   EKVAKAAKVEQPVATDIKENTEPENPKTD"
FT   sig_peptide     409044..409151
FT                   /locus_tag="SEQ_0432"
FT                   /note="Signal peptide predicted for SEQ0432 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.930 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    409722..409748
FT                   /note="PS01095 Chitinases family 18 active site."
FT                   /inference="protein motif:Prosite:PS01095"
FT   CDS_pept        412457..413341
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0433"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92604"
FT                   /db_xref="GOA:C0M681"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C0M681"
FT                   /protein_id="CAW92604.1"
FT                   /translation="MKTLLGSIEAGGTKFVCAVGDRDFAVVDKVQFPTTSPKETIERTI
FT                   AYFKQFEADLASIAIGSFGPIDIDPKSATYGYITTTPKPGWANVDLLGQLTAAFAIPFY
FT                   VTTDVNSSAYGEAISRPDVDSLVYYTIGTGIGAGAIQKGEFIGGLGHTEAGHTYVMQHL
FT                   DDVANAFLGVCPFHRGCLEGMAAGPSLEARAGIKGELLDQKAAVWDIQAFYIAQAAVQA
FT                   TLLYRPQVIVFGGGVMAQEHMLVRVQEAFTRLINGYLPVADVREYLVTPAVAGNGSATL
FT                   GNFALAKLIAEKS"
FT   misc_feature    412475..413026
FT                   /locus_tag="SEQ_0433"
FT                   /note="HMMPfam hit to PF00480, ROK family, score 1.2e-69"
FT                   /inference="protein motif:PFAM:PF00480"
FT   misc_feature    412847..412924
FT                   /note="PS01125 ROK family signature."
FT                   /inference="protein motif:Prosite:PS01125"
FT   CDS_pept        413445..414401
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0434"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92605"
FT                   /db_xref="GOA:C0M682"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0M682"
FT                   /protein_id="CAW92605.1"
FT                   /translation="MRITMSEPLFLTSCMHDKIWGGTKLREVFGYELPTETTGEYWAIS
FT                   AHPNGVSTVSSGSYQGQRLDQLYAERPELFGNPKEKVFPLLTKILDANDWLSVQVHPDD
FT                   AYGLAHEGELGKTECWYIISAEEGAEIVYGHHASSKQELRAMIEAGNWEELLTRVPVKA
FT                   GDFFYVPSGTMHAIGKGILILETQQSSDTTYRVYDFDRRDAEGQLRELHIEKSIDVLTI
FT                   GKPENSTPATLELEHLVSTCLVSNPFFTVYKWEIDQAVSMKQSAPYLLVSVLAGQGSLT
FT                   IDQAVYELQKGMHFILPNDVTSWSFDGQLEMIVSHPN"
FT   misc_feature    413469..414395
FT                   /locus_tag="SEQ_0434"
FT                   /note="HMMPfam hit to PF01238, Phosphomannose isomerase
FT                   type I, score 7.5e-98"
FT                   /inference="protein motif:PFAM:PF01238"
FT   CDS_pept        414777..417305
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0435"
FT                   /product="putative preprotein SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92607"
FT                   /db_xref="GOA:C0M683"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M683"
FT                   /protein_id="CAW92607.1"
FT                   /translation="MSNILRKVIENDKGELRKLEKIAKKVESYADYMESLSDKDLQAKT
FT                   PEFKQRYQNGETLEQLLPEAFAVVREAARRVLGLYPYRVQIMGGVVLHNGDVPEMRTGE
FT                   GKTLTATMPVYLNALAGEGVHVITVNEYLSTRDATEMGEVYSWLGLSVGINLAAKSPAE
FT                   KREAYLCDITYSTNSEVGFDYLRDNMVVRQEDMVQRPLNFALVDEVDSVLIDEARTPLI
FT                   VSGAVSSETNQLYIRADMFVKTLDSVDYIIDVPTKTIGLSDSGIDKAESYFNLSNLYDI
FT                   ENVALTHFVDNALRANYIMLLDIDYVVSEEGEILIVDQFTGRTMEGRRFSDGLHQAIEA
FT                   KEGVRIQEESKTSASITYQNMFRMYKKLAGMTGTAKTEEEEFREVYNMRIIPIPTNRPI
FT                   ARIDHTDLLYATLNSKFKAVVADVKARYEKGQPVLVGTVAVETSDLISKKLVEAGIPHE
FT                   VLNAKNHFKEAQIIMNAGQRGAVTIATNMAGRGTDIKLGEGVRELGGLCVIGTERHESR
FT                   RIDNQLRGRSGRQGDPGESQFYLSLEDELMRRFGTDRIKAFLDRMNNDDEDIVIKSRML
FT                   SRQVESAQKRVEGNNYDTRKQVLQYDDVMREQREIIYANRRDVITANRDLGPEIKAMIK
FT                   RTIDRAVDAHSRTNRKDAIDAIVTFARTSIVPEETIGAKELRGLKDDQIKDKLYQRALE
FT                   IYDKQLSKLRDQDAILEFQKVLILMIVDNKWTEHIDALDQLRNAVGLRGYAQNNPVVEY
FT                   QSEGFKMFQDMIGAIEFDVTRTMMKAQIHEQERERAIQYATTTAAQNIQSQAIGADFDS
FT                   SADFSRVERNDACPCHSGKKFKNCHGRKAF"
FT   misc_feature    414789..415925
FT                   /locus_tag="SEQ_0435"
FT                   /note="HMMPfam hit to PF07517, SecA DEAD-like domain, score
FT                   1.7e-199"
FT                   /inference="protein motif:PFAM:PF07517"
FT   misc_feature    415452..415793
FT                   /locus_tag="SEQ_0435"
FT                   /note="HMMPfam hit to PF01043, SecA preprotein
FT                   cross-linking domain, score 3.3e-61"
FT                   /inference="protein motif:PFAM:PF01043"
FT   misc_feature    416121..416369
FT                   /locus_tag="SEQ_0435"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 0.015"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    416217..416264
FT                   /note="PS01312 Protein secA signatures."
FT                   /inference="protein motif:Prosite:PS01312"
FT   misc_feature    416484..417119
FT                   /locus_tag="SEQ_0435"
FT                   /note="HMMPfam hit to PF07516, SecA Wing and Scaffold
FT                   domain, score 7.9e-68"
FT                   /inference="protein motif:PFAM:PF07516"
FT   misc_feature    417237..417299
FT                   /locus_tag="SEQ_0435"
FT                   /note="HMMPfam hit to PF02810, SEC-C motif, score 3.7e-07"
FT                   /inference="protein motif:PFAM:PF02810"
FT   misc_feature    417249..417266
FT                   /note="PS00200 Rieske iron-sulfur protein signature 2."
FT                   /inference="protein motif:Prosite:PS00200"
FT   CDS_pept        417421..417777
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0436"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92609"
FT                   /db_xref="GOA:C0M6I4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6I4"
FT                   /protein_id="CAW92609.1"
FT                   /translation="MIVGHGIDLQDISAIEKVYLRNARFARKVLTDKELALFEQFSHHR
FT                   KMTYLAGRWAGKEAFSKAMGTGIGQLTFQDIEIINDSKGRPVITKSPFQGKAFISISHS
FT                   GGYVQASVILEDLA"
FT   misc_feature    417436..417639
FT                   /locus_tag="SEQ_0436"
FT                   /note="HMMPfam hit to PF01648, 4'-phosphopantetheinyl
FT                   transferase superfami, score 1.2e-14"
FT                   /inference="protein motif:PFAM:PF01648"
FT   CDS_pept        417774..418874
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0437"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92611"
FT                   /db_xref="GOA:C0M6I5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M6I5"
FT                   /protein_id="CAW92611.1"
FT                   /translation="MISSLHRPTVARVDLEAIRANIDHIHQHIPKKVRTYAVVKANAYG
FT                   HGAVAVSKAVEDQVDGYCVSNLDEALELRQAGIDKEILILGVILASELQLAIKHQLTIT
FT                   VASLEWLELAKKESVDFSQLHVHVKVDSGMGRIGVRSLAEANQLISILSDMGVQLDGIF
FT                   THFATADDSDHAMFDKQLTFFKQLVEQLDKRPALVHASNSATSLWHSETIFNAIRLGIV
FT                   IYGLNPSGNSLSLPCPLKEALSLESRLVHVKQIQAGDSVGYGASYVAAEPEYVGTLPIG
FT                   YADGWTRNMQGFKVLVEGEFCDIIGRVSMDQLTIRLPKAYPIGTKVTLIGQQGKQVITA
FT                   TDVADYRGTINYEVLCLLSDRIPREY"
FT   misc_feature    417795..418460
FT                   /locus_tag="SEQ_0437"
FT                   /note="HMMPfam hit to PF01168, Alanine racemase, N-terminal
FT                   domain, score 2.2e-93"
FT                   /inference="protein motif:PFAM:PF01168"
FT   misc_feature    417882..417914
FT                   /note="PS00395 Alanine racemase pyridoxal-phosphate
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00395"
FT   misc_feature    418497..418871
FT                   /locus_tag="SEQ_0437"
FT                   /note="HMMPfam hit to PF00842, Alanine racemase, C-terminal
FT                   domain, score 1e-66"
FT                   /inference="protein motif:PFAM:PF00842"
FT   repeat_region   complement(419017..419103)
FT                   /note="perfect repeat flanking IS element"
FT   repeat_region   419103..419119
FT                   /note="perfect inverted repeat flanking IS element"
FT   repeat_region   complement(join(419110..419848,421278..422452))
FT                   /note="ISSeq4"
FT   CDS_pept        complement(join(419180..419848,421278..422333))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0438"
FT                   /note="CDS is disrupted by the insertion of the an IS
FT                   element after codon 352;transposase (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92612.1"
FT   repeat_region   complement(419849..421277)
FT                   /note="ISSeq3"
FT   repeat_region   419857..419868
FT                   /note="perfect inverted repeat flanking IS element"
FT   CDS_pept        complement(419881..420684)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0439"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92614"
FT                   /db_xref="GOA:C0M6I7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6I7"
FT                   /protein_id="CAW92614.1"
FT                   /translation="MLEILDLSRSTYYYQVKQLAQEDKDMDLKELIQGIYDEHHGNYGY
FT                   RRIHLELRNRGFIVNHKKVQRLMTVMGLKARIRRKRKYSSYKGEVGKKADNLIKRQFEG
FT                   SKPYEKCYTDVTEFTLPEGKLYLSPVLDGYNSEIIDFTLSRSPDLKQVQTMLEKAFPAD
FT                   SYNGTILHSDQGWQYQHQSYHHFLETKGIRPSMSRKGNSPDNGMMESFFGILKSEMFYG
FT                   LETTYQSLNELEQAITEYIFYYNNKRIKAKLKGLSPVQYRTKSFH"
FT   misc_feature    complement(419896..420378)
FT                   /locus_tag="SEQ_0439"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   8.8e-38"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS_pept        complement(420708..421223)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0440"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92616"
FT                   /db_xref="GOA:C0M663"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0M663"
FT                   /protein_id="CAW92616.1"
FT                   /translation="MTLSYEDKVQIYELRHIGKSIKCLSEKFSIAESDLKYMIRLIDRY
FT                   GLAIVQKGKNSYYSPELKQEIIDKVLIDGQSQKQTSLDYALPNSSMLSRWIAQYKKNGY
FT                   TILEKRRGRPPKMGRQPKKTLEQMTELERLQKELDYLRAENAVLKKLREYRLRDEAKLK
FT                   EQQKSSKN"
FT   misc_feature    complement(420780..421061)
FT                   /locus_tag="SEQ_0440"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 0.00062"
FT                   /inference="protein motif:PFAM:PF01527"
FT   misc_feature    complement(420864..420902)
FT                   /locus_tag="SEQ_0440"
FT                   /note="HMMPfam hit to PF02178, no description, score 0.21"
FT                   /inference="protein motif:PFAM:PF02178"
FT   misc_feature    complement(421104..421169)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1140.000, SD 3.07 at aa 19-40, sequence
FT                   KSIKCLSEKFSIAESDLKYMIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   repeat_region   complement(421258..421269)
FT                   /note="perfect inverted repeat flanking IS element"
FT   repeat_region   complement(422436..422452)
FT                   /note="perfect inverted repeat flanking IS element"
FT   repeat_region   complement(422452..422538)
FT                   /note="perfect repeat flanking IS element"
FT   CDS_pept        422579..423994
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0442"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92618"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6I9"
FT                   /protein_id="CAW92618.1"
FT                   /translation="MRKNKLLRMIMLMTLLVPHLETARVLAEDTGAEASQVPATANEAA
FT                   IAQTGESTSTAAATSATDNSSSTTETTPNSGEPGATGSSSNTASSGSASGSTGQSTPTS
FT                   PAASPQPAPEVATQASQPALNIVPAAPTVDLSLTLALPSVNTYAAYVTHWSGQSAYTHN
FT                   LLSRRYGIKAEQLDSFLKSTKIKYDEKRINGAALLQWEKKSGLDVRAIVAIAMTESELG
FT                   TKGNATLLGSNMFGYALFDLDSKKPNQFNDELAIVKLTQETIIKNSNLNFEQQDQKADK
FT                   FAKKQLNFASDGGLYFTDTNGIGKRRAEIMEKLDAWIDQHGGTPEIPAELKIQSSSSFA
FT                   VVPTGYKLSKSYDILSYQASSYAWGQCTWYVYNRAKELGYQFDSFMGNGGDWRFKSGYS
FT                   ISKEPKVGYAVSFAPGQAGADGLYGHVSIVEDVRKDGSILISESNCLGLGQISYRTFTA
FT                   EQANQLTYVVGKS"
FT   sig_peptide     422579..422659
FT                   /locus_tag="SEQ_0442"
FT                   /note="Signal peptide predicted for SEQ0442 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.611 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    423617..423982
FT                   /locus_tag="SEQ_0442"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 1.2e-45"
FT                   /inference="protein motif:PFAM:PF05257"
FT   CDS_pept        join(424196..425521,425521..427947)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0443"
FT                   /note="CDS contains a frameshift after codon 442. Similar
FT                   to Streptococcus pyogenes serotype M3 putative
FT                   fe3+-siderophore transport protein. UniProt:Q1JA52
FT                   (EMBL:CP000261 (1277 aa) fasta scores: E()=3.5e-212,
FT                   57.956% id in 1282 aa;putative iron transport-associated
FT                   protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92620.1"
FT   sig_peptide     424196..424279
FT                   /pseudo
FT                   /locus_tag="SEQ_0443"
FT                   /note="Signal peptide predicted for SEQ0443 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.415 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    424370..424561
FT                   /locus_tag="SEQ_0443"
FT                   /note="HMMPfam hit to PF07550, Protein of unknown function
FT                   (DUF1533), score 0.00011"
FT                   /inference="protein motif:PFAM:PF07550"
FT   misc_feature    424769..424972
FT                   /locus_tag="SEQ_0443"
FT                   /note="HMMPfam hit to PF07550, Protein of unknown function
FT                   (DUF1533), score 1.9e-13"
FT                   /inference="protein motif:PFAM:PF07550"
FT   misc_feature    425258..425569
FT                   /locus_tag="SEQ_0443"
FT                   /note="HMMPfam hit to PF05031, Iron Transport-associated
FT                   domain, score 4.4e-06"
FT                   /inference="protein motif:PFAM:PF05031"
FT   misc_feature    425758..425796
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT                   /inference="protein motif:Prosite:PS00018"
FT   misc_feature    425869..425937
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   0.25"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    425941..426009
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   0.38"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    426013..426081
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   1.3"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    426085..426153
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   0.9"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    426229..426294
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   1"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    426370..426438
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   1.4"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    426442..426510
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   1.6"
FT                   /inference="protein motif:PFAM:PF00560"
FT   misc_feature    427063..427554
FT                   /locus_tag="SEQ_0444"
FT                   /note="HMMPfam hit to PF05031, Iron Transport-associated
FT                   domain, score 1.2e-30"
FT                   /inference="protein motif:PFAM:PF05031"
FT   misc_feature    427870..427929
FT                   /locus_tag="SEQ_0444"
FT                   /note="1 probable transmembrane helix predicted for SEQ0444
FT                   by TMHMM2.0 at aa 767-786"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        428176..429081
FT                   /transl_table=11
FT                   /gene="shp"
FT                   /locus_tag="SEQ_0445"
FT                   /product="heme-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92622"
FT                   /db_xref="GOA:C0M6J1"
FT                   /db_xref="InterPro:IPR020985"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6J1"
FT                   /protein_id="CAW92622.1"
FT                   /translation="MKIINEEHMIKRLFKKLMGGLVVLLVCLAAIGGKAYADKGELYSC
FT                   VIRRDYRHPVSGQIEDSGGEHAFEIGQGMVEGTVYSNGMLEVTSAGDLYLTFRMSLADF
FT                   SGNYQFWVQPGGTGAFQAAAYSVTKVGTDTNGTTKDIAIALPDVNTVVRGSMYVEPMGR
FT                   EVVFYLSPSELQEGYSGDMVASFAAGEAKTDHAVTAPAKADEKKAPSKPDSKDAKSAPN
FT                   PSARPVGQSSSPKKQSNPSKKGQAVGLSTSLDKSKQESSQKPVNNPLPVLVYYVPTALL
FT                   LSGALVLFIKKKRKNNEESH"
FT   sig_peptide     428176..428286
FT                   /gene="shp"
FT                   /locus_tag="SEQ_0445"
FT                   /note="Signal peptide predicted for SEQ0445 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(428212..428271,428986..429045)
FT                   /gene="shp"
FT                   /locus_tag="SEQ_0445"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0445 by TMHMM2.0 at aa 13-32 and 271-290"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        429065..429949
FT                   /transl_table=11
FT                   /gene="htsA"
FT                   /locus_tag="SEQ_0446"
FT                   /product="heme-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92624"
FT                   /db_xref="GOA:C0M6Z4"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR019957"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z4"
FT                   /protein_id="CAW92624.1"
FT                   /translation="MKKVIKLIGLAVLSLVLSACVDQHPRAEKKADKERIVATSVAVVD
FT                   ICDRLSLDLVGVCDSKLYQLPKRYDAVKRIGLPMNPDMEVIASLKPTWILSPNSLQNDL
FT                   EPKYQQLDTEYGFLNLTSLEGMYQSIDDLGDLFDRKKEAKRLRADYEEFYRAFKKKHKG
FT                   QKKPRVLILMGLPGSYLIATNKSYVGNLLELAGGENVYHSEDKEFLSANPEDMLQQQPE
FT                   LILRTAHAIPDKVKDMFDKEFAENDIWKHFEAVKSQQVYDLDNTLFGMSAKFNYKEALN
FT                   HLSQIFYGAKEVK"
FT   sig_peptide     429065..429151
FT                   /gene="htsA"
FT                   /locus_tag="SEQ_0446"
FT                   /note="Signal peptide predicted for SEQ0446 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.530 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    429092..429124
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    429161..429865
FT                   /gene="htsA"
FT                   /locus_tag="SEQ_0446"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 3.5e-29"
FT                   /inference="protein motif:PFAM:PF01497"
FT   CDS_pept        429951..430973
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0447"
FT                   /product="putative iron/heme permease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92626"
FT                   /db_xref="GOA:C0M6Z5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z5"
FT                   /protein_id="CAW92626.1"
FT                   /translation="MQQGSQYSDQVTAARKRTTRLVYMVLLLMLLFGLMLYAVSVGGLS
FT                   VSYQRIFNGLFVAYDSEVALIYDLRFPRIVIALLAGAGIATSGVLFQAILKNPISDPAI
FT                   IGVCSGASFMVLLSSLLLPQLLFYGPLLSFVGGCVSFLMIYTLSWKKGLQPIRIILTGI
FT                   AINALFLGLSRAITDFSKTSNPFVNALLSGNISQKTWADVGVLWPYTVLGLLLAIGLAR
FT                   QCDLLLLNDGLIRNLGIDSNYLRLGISLVAVLLAAVSTSIVGVVSFLGLIVPHIGRLLV
FT                   GSKHSYLIPFSALLGAFVFLLADTLGRQLCYPLEISPAVIMSIVGGPYFIYLLRRSDVI
FT                   "
FT   sig_peptide     429951..430079
FT                   /locus_tag="SEQ_0447"
FT                   /note="Signal peptide predicted for SEQ0447 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.674) with cleavage site
FT                   probability 0.380 between residues 43 and 44"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(430011..430079,430155..430223,430257..430316,
FT                   430326..430394,430413..430481,430545..430613,
FT                   430695..430763,430806..430859,430878..430946)
FT                   /locus_tag="SEQ_0447"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SEQ0447 by TMHMM2.0 at aa 21-43, 69-91, 103-122, 126-148,
FT                   155-177, 199-221, 249-271, 286-303 and 310-332"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    430038..430958
FT                   /locus_tag="SEQ_0447"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,
FT                   score 1.1e-86"
FT                   /inference="protein motif:PFAM:PF01032"
FT   misc_feature    430332..430364
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        430970..431752
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0448"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92628"
FT                   /db_xref="GOA:C0M6Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z6"
FT                   /protein_id="CAW92628.1"
FT                   /translation="MSHEQGLIRVEDLSFTYRDRPILDRLSFTIPKGKITTIMGANGCG
FT                   KSTLLGLLTKNIPVKSGQIFLEGQAISSISLKQFAQKVAVVHQDNQAVADLLVGDLVAV
FT                   ASQAHRRFFKGSSQEDDDIVAWALEVTNLRELAFREMQELSGGEKQRVWIAMALAQKTG
FT                   VLVLDEPTTYLDIKYQLDILALIKKINQELGMTIIMVLHDINQALAVSDCVLGLQKGAI
FT                   YAQGSPQEVLDQAFVEAVFGVSLPFIEKQDRRFVLTTL"
FT   misc_feature    431066..431629
FT                   /locus_tag="SEQ_0448"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.7e-49"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    431087..431110
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    431399..431443
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        431798..433561
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0449"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92630"
FT                   /db_xref="GOA:C0M6Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z7"
FT                   /protein_id="CAW92630.1"
FT                   /translation="MNDTTEKISRAKKKMLLRRLKERIAPKRFLLYVSAFLSWLQFLMR
FT                   LMSFYLIAKQFTAFLAGQALQLTRLLVILLILNAVGFGLAMIAKQLQGLASQFARDSLK
FT                   QSFFDAFIAMDGQFDQQSTEADVLTVASQGIDSLDTYYSYYLSLAMLTAFNCTTVLLLV
FT                   FLIYPIGGLVFILSLPLIPISIVAMQKRSKRIMNHYWSTYMDVGNLFMDDLKGLNTLYS
FT                   YQADERYEESFVNKAEAFRKATMQLLGFQLQAVGYMDAVMYLGIGLSGFLAVQALSAGG
FT                   ISFFDFLFFILIATEFFAPIREQGYGMHLVMMNTKMADQIFGFLDSVEAVDQDKGVALP
FT                   AFDRIDIQDLSFSHGEKALLRDITMTIKKGELTAVAGVSGQGKTSLAQLLLKRYQADSG
FT                   QIFLGDVTIDLASKQAINQEILYVSDQSTLLNMSIYENLAMAAQLTRKELLSWIDEHGI
FT                   LSFIYWLPDGIDTIVGENGCHLSAGQRQQVICARALLSQRSCYIFDEATSSLDAENEAA
FT                   IHRLLQQLAKQAIVIVITHKMKYLKQADQVLFLSPEQSASLASPRELYRHHLAYRQLVD
FT                   TQVELEANLYG"
FT   misc_feature    join(431882..431950,431993..432061,432224..432292,
FT                   432302..432361,432575..432643)
FT                   /locus_tag="SEQ_0449"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0449 by TMHMM2.0 at aa 29-51, 66-88, 143-165, 169-188
FT                   and 260-282"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    431984..432106
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    432905..433456
FT                   /locus_tag="SEQ_0449"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.1e-40"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    432926..432949
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        433554..435236
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0450"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92632"
FT                   /db_xref="GOA:C0M6Z8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z8"
FT                   /protein_id="CAW92632.1"
FT                   /translation="MVKSDYSTYRLVLRLLAMMKHLLAWIALAVMFAVLGFVLTVGIPT
FT                   SLAYLGLEVMAGHAITFKWLYLFVAMALLRGLVRYGEHYFGHFVAFHSLAAFRRIVFKK
FT                   LRALSPARLDSQDSGHLLKMIGEDIEALEVFFAHTLAPICTAFISASLMAYYLWQVSWK
FT                   LALGAIVTYVLLAVIIPVYFSNVLQSLLKKQNEGRRAYVSSFLESLRSVKDLLQFQSIE
FT                   KRFKLLSNQSKHVNALDRQVAQAQFLQMAITFLALGLSILTFAYVTLFELSQQTVTFAG
FT                   GLLAFVAFTASFAPFLELGRLPLGFKRAMNAARNVFQLLDEEALVDKGDQRISSVTRIA
FT                   VEDLTFAYPKHQETIYHHLSVAFEKKGIIGIQGESGSGKSTLMKIIMKWYNWQAGHIFL
FT                   SEVDSQTLNAASLQANFAYVPQNAQLFQQTLRDNITLGRKDISDDDIMELAEACGMKER
FT                   ILACDEGLDTLVRGSADFSAGEAQRLELMRALLKRADCYIFDEPTSNLDSLNEAIFIDL
FT                   IKKHCRGMVFLISHRPSTLACADQLFCVRNGFLKEVNNERVNH"
FT   sig_peptide     433554..433697
FT                   /locus_tag="SEQ_0450"
FT                   /note="Signal peptide predicted for SEQ0450 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.963) with cleavage site
FT                   probability 0.412 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(433614..433682,433719..433787,433806..433859,
FT                   433956..434024,434043..434102,434295..434363,
FT                   434382..434450)
FT                   /locus_tag="SEQ_0450"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SEQ0450 by TMHMM2.0 at aa 21-43, 56-78, 85-102, 135-157,
FT                   164-183, 248-270 and 277-299"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    434649..435197
FT                   /locus_tag="SEQ_0450"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.8e-39"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    434670..434693
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        435217..435810
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0451"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92633"
FT                   /db_xref="GOA:C0M6Z9"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:C0M6Z9"
FT                   /protein_id="CAW92633.1"
FT                   /translation="MKGLTIKDIMTTGAFAALYFVCVGLGAMLSILFDRSGNMLYAPAF
FT                   AALLGGPVYMLLIAKLQTFGPISLVGIIMGSFFFLTGHFFASMLPAILFGCLADGIALL
FT                   GKYQSRLVNLLSYLVFAFVNSGPIILMWLLKDAYIQSLLARGKDMAYVNRIMYDFTVAN
FT                   VSWFVGVVLLCALVGGLFGQYLLKKHFAKSGMLL"
FT   sig_peptide     435217..435354
FT                   /locus_tag="SEQ_0451"
FT                   /note="Signal peptide predicted for SEQ0451 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.724) with cleavage site
FT                   probability 0.631 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(435244..435312,435331..435399,435442..435510,
FT                   435547..435615,435706..435774)
FT                   /locus_tag="SEQ_0451"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0451 by TMHMM2.0 at aa 10-32, 39-61, 76-98, 111-133 and
FT                   164-186"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    435472..435504
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        435807..436487
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0452"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92635"
FT                   /db_xref="GOA:C0M700"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C0M700"
FT                   /protein_id="CAW92635.1"
FT                   /translation="MRLDVRTKLLLLILANACFFFRIDGWLGTMIIGVLLGILFWLGQG
FT                   RLAIGMTLLYALLLALSVLPLHVLPAYLFRLLSFAAVAGQLLYPSVLAALIFVKTTTAY
FT                   ELVHGLRKWHVPEVCLLTLAVMLRFLPKIRQEGKIIRQSLKIRGIFLDSWAIVRQPRRY
FT                   MEYLLVPLLMSLLRSSQDLTIASLTKGLAIKKGASECFVSHLSWKDWGVQIWIFVTIAY
FT                   MVLQ"
FT   misc_feature    435810..436403
FT                   /locus_tag="SEQ_0452"
FT                   /note="HMMPfam hit to PF02361, Cobalt transport protein,
FT                   score 4.7e-05"
FT                   /inference="protein motif:PFAM:PF02361"
FT   misc_feature    join(435864..435932,435945..436013,436032..436100,
FT                   436143..436199)
FT                   /locus_tag="SEQ_0452"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0452 by TMHMM2.0 at aa 20-42, 47-69, 76-98 and 113-131"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        436484..437878
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0453"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92637"
FT                   /db_xref="GOA:C0M701"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M701"
FT                   /protein_id="CAW92637.1"
FT                   /translation="MIKAKQLQFSYTNRRQTACELRDCQIEAGQFIVLCGQSGSGKSTF
FT                   LKLLNGLIPDYFSGQLQGSLKVLSHQAGQASVEVLSRQVSSVFQNPASQFFYREVKHEL
FT                   VFPCENQGLEPALILERLDTLAADFDIKDLLEADMLKLSGGQKQRVAIAAAIMQGTAIM
FT                   VFDEPTANLDHASVAAVKAYLKQLKAAGKTIIVAEHRLHYLLDLADHFYYFSAGRLERV
FT                   LSPKDLLALPDQEREELGLRRCELTAVTKALRAKTVFEHYDPEHALQIKQLEVKAGSRV
FT                   LYHLNQLSFGAGQITGITGANGLGKSQLALYLAGIFEAKEAKISYLGVTLPAKDRLSIT
FT                   SLVLQDVGLQLFSETVEKELNLGHHRHQATDDLVNRLGLSQLLDKHPASLSGGEQQRVM
FT                   IAASLLSDKEIVILDEPSSGLDLLQMQALVSLLKELKQQKKVVIVISHDEELLDQACDS
FT                   IYQLSR"
FT   misc_feature    436568..437134
FT                   /locus_tag="SEQ_0453"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.8e-43"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    436577..436618
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT                   /inference="protein motif:Prosite:PS00675"
FT   misc_feature    436589..436612
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    436907..436951
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    437360..437869
FT                   /locus_tag="SEQ_0453"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-30"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    437381..437404
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    437651..437695
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        438242..440257
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0454"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92639"
FT                   /db_xref="GOA:C0M702"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C0M702"
FT                   /protein_id="CAW92639.1"
FT                   /translation="MLLKSSIANLKGLGPKSAEKFQKLGIYQIKDLLLYYPFRYEDFKS
FT                   KSALELLDGEKAVLTGRVVTPPSVQYYGFKRNRLSFKLKQGELVISVSFFNQPYLLEKI
FT                   VLDQEVAIFGRWDQKKAALTGMKLLMTLEDDLQPVYHVAQGISQPTLIKAIRSAFDSGA
FT                   LAQLEENLPEPLIQKYRLLPRQAAVYAMHFPKHMEDYKQALRRIKFEEFFYFQMNLQVL
FT                   KLANKAEGNGLAIPFHQQAVAKKIAALPFSLTRAQQRSLEEILADMTSGAHMNRLLQGD
FT                   VGSGKTVIASLAMYAAQTAGFQSALMVPTEILAEQHYDSLCQLFPDLSIALLTSGMKAA
FT                   EKRAALSAIADGSVDMIVGTHALIQDAVTYHKLGLVITDEQHRFGVNQRRLFREKGNNP
FT                   DVLMMTATPIPRTLAITAYGEMDVSIIDELPAGRKPIITRWVKHRQLDSVLAWVKTELA
FT                   KGTQAYVISPLIEESETLDLKNAVALEAELKDYFKASASVALMHGKMKADDKEMIMQRF
FT                   KAKEIDVLVSTTVIEVGVNVPNATIMLIMNADRFGLSQLHQLRGRVGRGSKQSYAILVA
FT                   DPKTDSGKERMTIMTTTNDGFVLAEADLKLRGSGEIFGTRQSGLPEFKTADIVEDYHIL
FT                   EEARRVAAEIVAAKDWQLDPRWAPILANLRVADQFD"
FT   misc_feature    439001..439489
FT                   /locus_tag="SEQ_0454"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
FT                   score 2.4e-34"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    439079..439102
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    439712..439942
FT                   /locus_tag="SEQ_0454"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 1.9e-21"
FT                   /inference="protein motif:PFAM:PF00271"
FT   CDS_pept        complement(440377..441342)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0455"
FT                   /product="putative L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92641"
FT                   /db_xref="GOA:C0M703"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:C0M703"
FT                   /protein_id="CAW92641.1"
FT                   /translation="MKEILVLHTGGTISMQADEAGKVSPNQNNPMNQVGLSLEHIHLTV
FT                   VDFLNLPSPHITPHHMLKMYHYIQQRASQFDAVVITHGTDTLEETAYFLDTMVLPVELP
FT                   IVITGAMRSANEIGSDGIYNYLTALRVASHEKAKGKGVLVVMNDEIHAAKYVTKTHTTN
FT                   VSTFQTPTHGPLGVVMKDDLLFFKTAEPRVRFELRHISGTVPIIKAYAGMGDGSILSLL
FT                   TPDRIQGLVIEALGAGNVPPLAVSELEKLIASGIPVVLVSRCFNGIAEPVYAYRGGGAS
FT                   LKRAGVMFVKELNAPKARLKLLIALNAGLTGQELKDYIEG"
FT   misc_feature    complement(440395..441336)
FT                   /locus_tag="SEQ_0455"
FT                   /note="HMMPfam hit to PF00710, Asparaginase, score
FT                   2.3e-142"
FT                   /inference="protein motif:PFAM:PF00710"
FT   misc_feature    complement(441301..441327)
FT                   /note="PS00144 Asparaginase / glutaminase active site
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00144"
FT   CDS_pept        441414..442802
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0456"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92643"
FT                   /db_xref="GOA:C0M704"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR017223"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0M704"
FT                   /protein_id="CAW92643.1"
FT                   /translation="MTIKAVFFDIDGTLLNDRKNVQKTTQRAIQQLKKQGIMVGLATGR
FT                   GPAFVQPFLENFGLDFAVTYNGQYILTRDKVLYQNQLPKSTIYKIIRYASDKKREISLG
FT                   TASGLAGSRIIDMGTSPFGQMVSSIVPRSLVKTVEGSFKNLIRRFKPQSFSNLVTIMRE
FT                   PIYQIVLVASVDDTQKIKERFPHIKVTRSSPYSLDLISSGQSKIKGIERLGEMFGFELS
FT                   EVMAFGDSDNDLEMLSGVGVGVAMGNAEAVVKSGAHFTTASNNNDGISKALAHYGLIHF
FT                   DVEKSFKSRDDNFNKVKDFHRLMDGDTIETPRGYSLKEAGYRADFKVEELVEFLYAASQ
FT                   GDKHRFSQALIDLHAALDKAAKKVQAKEHPESPLVGQVDALTDLLYFTYGSFVLMGVDP
FT                   QPIFETVHEANMGKIFPDGKAHFDPITHKIQKPDDWQERYAPESAIKKELDKQLQKSLQ
FT                   RLEK"
FT   misc_feature    441417..442247
FT                   /locus_tag="SEQ_0456"
FT                   /note="HMMPfam hit to PF05116, Sucrose-6F-phosphate
FT                   phosphohydrolase, score 4.2e-05"
FT                   /inference="protein motif:PFAM:PF05116"
FT   misc_feature    441420..442163
FT                   /locus_tag="SEQ_0456"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 2.1e-10"
FT                   /inference="protein motif:PFAM:PF00702"
FT   misc_feature    441426..441461
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    441429..442232
FT                   /locus_tag="SEQ_0456"
FT                   /note="HMMPfam hit to PF08282, haloacid dehalogenase-like
FT                   hydrolase, score 2.3e-80"
FT                   /inference="protein motif:PFAM:PF08282"
FT   misc_feature    441624..441689
FT                   /note="Predicted helix-turn-helix motif with score 986.000,
FT                   SD 2.55 at aa 71-92, sequence LTRDKVLYQNQLPKSTIYKIIR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    442092..442160
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS_pept        complement(443088..443540)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0457"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92644"
FT                   /db_xref="GOA:C0M705"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0M705"
FT                   /protein_id="CAW92644.1"
FT                   /translation="MSQTYERIMVAIDGSHGSELAFHKGVNVALRNGAALILTHVVDTR
FT                   ALQSVATFDSYIYDKLEQEAKEVLGDFEKQAREAGLTEVKQVIEFGNPKTLLAHDIPDK
FT                   EEVDLIMVGATGLNTFERLLIGSSSEYILRHAKVDLLVVREHDKTL"
FT   misc_feature    complement(443109..443531)
FT                   /locus_tag="SEQ_0457"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 9.6e-21"
FT                   /inference="protein motif:PFAM:PF00582"
FT   CDS_pept        443827..445041
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0458"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92646"
FT                   /db_xref="GOA:C0M7E4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7E4"
FT                   /protein_id="CAW92646.1"
FT                   /translation="MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAA
FT                   FGFEAPDEVIRDLILNARSSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIDDIYLGNGV
FT                   SELISMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGHAVHYLCDEEAEWYPDIADIKA
FT                   KITERTKAIVIINPNNPTGALYPREVLEEIVAIAREHQLIIFADEIYDRLVMDGGEHIA
FT                   IASLAPDVFCVSMNGLSKSHRIAGFRVGWMVLSGPKRHVRGYIEGLNMLANMRLCSNVL
FT                   AQQVVQTSLGGRQSVDELLLPGGRIFEQRNFIYQAINAIPGLSAVKPKAGLYLFPKIDR
FT                   NMYRIDDDEEFVLQLLKQEKVMLVHGRGFNWKEPDHFRVVYLPTVEELADVQEKITHVL
FT                   KQYKR"
FT   misc_feature    443923..445011
FT                   /locus_tag="SEQ_0458"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 1.2e-45"
FT                   /inference="protein motif:PFAM:PF00155"
FT   misc_feature    443995..444780
FT                   /locus_tag="SEQ_0458"
FT                   /note="HMMPfam hit to PF01212, Beta-eliminating lyase,
FT                   score 0.0012"
FT                   /inference="protein motif:PFAM:PF01212"
FT   CDS_pept        445213..445995
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0459"
FT                   /product="GTP-sensing transcriptional pleiotropic
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92648"
FT                   /db_xref="GOA:C0M7E5"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7E5"
FT                   /protein_id="CAW92648.1"
FT                   /translation="MPNLLEKTRKITSILQRSVDSLETELPYNTMASRLADIIDCNACI
FT                   INGGGSLLGYAMKYKTNTDRVEEFFETRQFPDAYVKAASRVYDTEANLSVENELTIFPI
FT                   ESKDIYPDGLTTIAPIYGGGMRLGTLIIWRNDNEFSDDDLVLVEISSTVVGIQLLNLQT
FT                   ENLEETIRKQTVVNMAINTLSYSEMKAVAAILSELDGNEGRLTASVIADRIGITRSVIV
FT                   NALRKLESAGIIESRSLGMKGTYLKVINEGIFDKLKEF"
FT   misc_feature    445219..445776
FT                   /locus_tag="SEQ_0459"
FT                   /note="HMMPfam hit to PF06018, CodY GAF-like domain, score
FT                   4.3e-121"
FT                   /inference="protein motif:PFAM:PF06018"
FT   misc_feature    445780..445938
FT                   /locus_tag="SEQ_0459"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.00042"
FT                   /inference="protein motif:PFAM:PF08279"
FT   misc_feature    445813..445989
FT                   /locus_tag="SEQ_0459"
FT                   /note="HMMPfam hit to PF08222, CodY helix-turn-helix
FT                   domain, score 3.5e-38"
FT                   /inference="protein motif:PFAM:PF08222"
FT   misc_feature    445825..445890
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1428.000, SD 4.05 at aa 205-226, sequence
FT                   LTASVIADRIGITRSVIVNALR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        446612..447169
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0460"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92649"
FT                   /db_xref="GOA:C0M7E6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7E6"
FT                   /protein_id="CAW92649.1"
FT                   /translation="MKALISIDYTNDFVADDGSLTAGAPAQVISEAMASVVEAAFEAGY
FT                   YIFFAIDAHEEGDSFHPEAALFPPHNIIGTRGRDLYGPLMTVYTRYQQDQRVFWLDKRH
FT                   YSAFSGTDLDIRLRERGVTTLVLTGVLTDICVLHTAIDAYKLGYKLEIITSAVASNSTE
FT                   NHQWALNHCRTVLGAKLLDRLS"
FT   misc_feature    446615..447157
FT                   /locus_tag="SEQ_0460"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family,
FT                   score 1e-16"
FT                   /inference="protein motif:PFAM:PF00857"
FT   CDS_pept        447643..447945
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0461"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92651"
FT                   /db_xref="GOA:C0M7E7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7E7"
FT                   /protein_id="CAW92651.1"
FT                   /translation="MKISEEEVRHVAALSKLSFSESETTEFATTLSKIVDMVELLNEVD
FT                   TTGVAITTTMADKKNIMRADIAEAGVDRKLLFQNVPEKENHFIKVPAILDDGGDA"
FT   misc_feature    447697..447912
FT                   /locus_tag="SEQ_0461"
FT                   /note="HMMPfam hit to PF02686, Glu-tRNAGln amidotransferase
FT                   C subunit, score 3.3e-14"
FT                   /inference="protein motif:PFAM:PF02686"
FT   CDS_pept        447945..449411
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0462"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92653"
FT                   /db_xref="GOA:C0M7E8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7E8"
FT                   /protein_id="CAW92653.1"
FT                   /translation="MSFNHHTIEELHELLVAKDISAVELTKATLEDIKAREEAVGSFIT
FT                   IACEAALKQAAALDAKGIDPDNVMSGIPLAVKDNISTKGILTTAASKMLYNYEPIFDAT
FT                   AVANAYDKDMIVIGKTNMDEFAMGGSTETSYFKKTKNAWDHSRVPGGSSGGSATAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGVVGLKPTYGAVSRYGLIAFGSSLDQIGPFAPTVRENA
FT                   QLLSVIAGSDRKDSTSAPVQIADYTIKIGQDIKGMKIALPKEYLGEGIDPKIKETVLAA
FT                   AKHFEKLGAIIEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGFRAADAKSLEDI
FT                   YVKTRSQGFGDEVKRRIMLGTFSLSSGYYDAYFKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPTAAFELDTLNHDPVAMYLADLLTIPVNLAGLPAISIPAGFADGLPVGLQLIGPKY
FT                   SEEVIYQVAVAFEATTDYHKQQPMIFGGDR"
FT   misc_feature    448014..449336
FT                   /locus_tag="SEQ_0462"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 1.4e-184"
FT                   /inference="protein motif:PFAM:PF01425"
FT   CDS_pept        449411..450850
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0463"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92655"
FT                   /db_xref="GOA:C0M7E9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7E9"
FT                   /protein_id="CAW92655.1"
FT                   /translation="MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNASTNVIDWSFP
FT                   GVLPVMNKGVIDAGIKAALALNMSIHQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IDITLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEAFGTKTELKNLNSFSNV
FT                   RKGLEFEVERQAKILRSGGVIRQETRRYDEASKGTILMRVKEGAADYRYFPEPDLPLFE
FT                   IDDAWIEDMRAELPRFPADRRASYINALGLSAYDAGQLTATKALSDFFEQAVALGGDPK
FT                   QVSNWLQGEMAQFLNAEGKTIDQIALTPENLVEMIAIITDGTISSKIAKKVFVHLAKHG
FT                   GSARAYVEKAGLVQISDPAVLIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQIAQQLLAQELQKLLD"
FT   misc_feature    449411..450130
FT                   /locus_tag="SEQ_0463"
FT                   /note="HMMPfam hit to PF02934, PET112 family, N terminal
FT                   region, score 1.5e-143"
FT                   /inference="protein motif:PFAM:PF02934"
FT   misc_feature    450179..450385
FT                   /locus_tag="SEQ_0463"
FT                   /note="HMMPfam hit to PF01162, PET112 family, C terminal
FT                   region, score 2.8e-29"
FT                   /inference="protein motif:PFAM:PF01162"
FT   misc_feature    450389..450832
FT                   /locus_tag="SEQ_0463"
FT                   /note="HMMPfam hit to PF02637, GatB/Yqey domain, score
FT                   1.9e-58"
FT                   /inference="protein motif:PFAM:PF02637"
FT   CDS_pept        451079..452023
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0464"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92657"
FT                   /db_xref="GOA:C0M7F0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7F0"
FT                   /protein_id="CAW92657.1"
FT                   /translation="MSRNGKGSTMILLAGIAWGLSGVSGQYLIAHGVGINALTSLRLII
FT                   SGLVLSAMAYVRQREAVISLLKDKRLLRELLIYSLFGLTLNQYAYLLAIRYSNAGTATV
FT                   LQYLSPILVLVYLSFKSRRLPAVGESCAICLAILGTVIMACHGDLSHLAINPIGLFWGL
FT                   FAAVTYAYCVIKPAKLIADWGSLLIVGLAMLMGGVIFPILTRAWQYPLAMTYGNLRALF
FT                   GIIGIGTIFAYTFFLKGASIIGPIKATLLASIEPVASVCFAIILMKEIFHPIDLLGMAL
FT                   ILIAVLVISLRDLLLTKRKKQLALNIKRPPSSD"
FT   sig_peptide     451079..451174
FT                   /locus_tag="SEQ_0464"
FT                   /note="Signal peptide predicted for SEQ0464 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.970) with cleavage site
FT                   probability 0.330 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(451097..451165,451175..451243,451301..451360,
FT                   451373..451432,451451..451519,451532..451600,
FT                   451625..451693,451721..451789,451826..451879,
FT                   451907..451966)
FT                   /locus_tag="SEQ_0464"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0464 by TMHMM2.0 at aa 7-29, 33-55, 75-94, 99-118,
FT                   125-147, 152-174, 183-205, 215-237, 250-267 and 277-296"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    451124..451513
FT                   /locus_tag="SEQ_0464"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 1.6e-12"
FT                   /inference="protein motif:PFAM:PF00892"
FT   misc_feature    451481..451513
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    451565..451951
FT                   /locus_tag="SEQ_0464"
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 1.3e-16"
FT                   /inference="protein motif:PFAM:PF00892"
FT   CDS_pept        452074..452313
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0465"
FT                   /product="transglycosylase associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92659"
FT                   /db_xref="GOA:C0M7F1"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7F1"
FT                   /protein_id="CAW92659.1"
FT                   /translation="MVWSLIVGAIIGMVAGRITEKSHSMGCFTMTAAGLIGSAVGQKLF
FT                   GDWGIQLAGMAVFPSILGAAIVIIVASALFGKKQ"
FT   misc_feature    join(452077..452130,452230..452298)
FT                   /locus_tag="SEQ_0465"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0465 by TMHMM2.0 at aa 2-19 and 53-75"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    452164..452301
FT                   /locus_tag="SEQ_0465"
FT                   /note="HMMPfam hit to PF04226, Transglycosylase associated
FT                   protein, score 1.8e-12"
FT                   /inference="protein motif:PFAM:PF04226"
FT   CDS_pept        452510..453625
FT                   /transl_table=11
FT                   /gene="sfs"
FT                   /locus_tag="SEQ_0466"
FT                   /product="fibronectin-binding protein Sfs"
FT                   /note="Previously sequenced as Streptococcus equi
FT                   fibronectin-binding protein Sfs UniProt:Q9X6F4
FT                   (EMBL:AF136451 (371 aa) fasta scores: E()=1.8e-153,
FT                   100.000% id in 371 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92661"
FT                   /db_xref="InterPro:IPR022263"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7F2"
FT                   /protein_id="CAW92661.1"
FT                   /translation="MRKTEGRFRTWKSKKQWLFAGAVVTSLLLGAALVFGGLLGSLGGS
FT                   SHQARPKEQPVSSIGDDDKSHKSSSDSMVSRPPKKDNLQPKPSDQPTNHQHQATSPSQP
FT                   TAKSSGHHGNQPQSLSVNSQGNSSGQASEPQAIPNQGPSQPLGLRGGNSSGSGHHHQPQ
FT                   GKPQHLDLGKDNSSPQPQPKPQGNSPKLPEKGLNGENQKEPEQGERGEAGPPLSGLSGN
FT                   NQGRPSLPGLNGENQKEPEQGERGEAGPPSTPNLEGNNRKNPLKGLDGENKPKEDLDGK
FT                   GLSGENDESPKLKDEHPYNHGRRDGYRVGYEDGYGGKKHKGDYPKRFDESSPKEYNDYS
FT                   QGYNDNYGNGYLDGLADRGGKRGYGYSYNPD"
FT   sig_peptide     452510..452653
FT                   /gene="sfs"
FT                   /locus_tag="SEQ_0466"
FT                   /note="Signal peptide predicted for SEQ0466 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.437 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    452558..452626
FT                   /gene="sfs"
FT                   /locus_tag="SEQ_0466"
FT                   /note="1 probable transmembrane helix predicted for SEQ0466
FT                   by TMHMM2.0 at aa 17-39"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        453874..454155
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92662"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7F3"
FT                   /protein_id="CAW92662.1"
FT                   /translation="MRRCAMKAIITVVGKDNQGIVAGVSGQIAALGLNIDDISQTVLDD
FT                   YFTMMAIVSSSEKQDFAHLREVLQAYGKQLQVTINIQSAAIFDAMHNI"
FT   misc_feature    453895..454113
FT                   /locus_tag="SEQ_0467"
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 0.0033"
FT                   /inference="protein motif:PFAM:PF01842"
FT   CDS_pept        454170..455507
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92664"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7F4"
FT                   /protein_id="CAW92664.1"
FT                   /translation="MDIRQVRETVEMIEEQHFDIRTITMGISLLDCIDSDIDRAAAKIY
FT                   QKITTKAANLVAVGDDIAAELGIPIVNKRVSVTPIALIGAATDAEDYLSLAKALDQAAC
FT                   DIGVDFIGGFSALVQKGYQKGDKILIESIPQALAQTQKVCASVNVGSTRSGINMTAVAD
FT                   MGRIIKETAKASEIGAAKLVVFANAVEDNPFMAGAFHGVGEADTVINVGVSGPGVVKRA
FT                   LEKVRGESFDVLAETVKKTAFKITRIGQLVGQMASERLGVGFGVVDLSLAPTPAVGDSV
FT                   ARVLEEMGLEIVGTHGTTAALALLNDAVKKGGVMACNRVGGLSGAFIPVSEDEGMIAAV
FT                   QGGSLNLEKLEAMTAICSVGLDMIAIPEETPSETIAAMIADEAAIGVINQKTTAVRIIP
FT                   KGKEGDMIAFGGLLGTAPVMAVNPHSSADFIARGGQIPAPIHSFKN"
FT   misc_feature    454170..455504
FT                   /locus_tag="SEQ_0468"
FT                   /note="HMMPfam hit to PF05167, Uncharacterized ACR
FT                   (DUF711), score 2.2e-270"
FT                   /inference="protein motif:PFAM:PF05167"
FT   CDS_pept        455582..456289
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0469"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92666"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7F5"
FT                   /protein_id="CAW92666.1"
FT                   /translation="MTKTRLYIVRHGKTMFNTIGRAQGWSDTPLTKAGEEGIRELGLGL
FT                   KAAGIPFKAAFSSDSGRTMQTMEIILRKSENEFLPYTRDKRIREWCFGSLDGAYDSELF
FT                   LGVLPRTKAFENRDNLRDVPYSELAESIVEVDTANWAEPWEVLSKRIYEGFEAIALAVE
FT                   NAGGGNAIVVSHGMTIGTFMWLIDPDREKQYIDNGSVTVVEYENGQFTIKTIGDMSYRY
FT                   RGREIIESIRDEE"
FT   misc_feature    455594..456127
FT                   /locus_tag="SEQ_0469"
FT                   /note="HMMPfam hit to PF00300, Phosphoglycerate mutase
FT                   family, score 2.5e-37"
FT                   /inference="protein motif:PFAM:PF00300"
FT   CDS_pept        456279..457022
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0470"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92668"
FT                   /db_xref="GOA:C0M7T5"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T5"
FT                   /protein_id="CAW92668.1"
FT                   /translation="MKNNTIRVLLQALVVLLFLSGVYLFIKPEKQAVGPKANQTVPAPK
FT                   AAKQAKKTTDLPKVSTTDWQLVLVNRDHPQEEMSPELVEINGIPIDKRIEQETADFLAA
FT                   AQTIEPQEHLIAGYRSVVQQEELYQSYIAQELANDPSLTQEAAEALVRKYAQPAGTSEH
FT                   QTGLAIDMSTVDNLNASDPKVAQEIQKIAPQFGFILRYPKGKQTSTGIEYEDWHYRYVG
FT                   KASALYITAHSLSLEEYLTRLKEKK"
FT   sig_peptide     456279..456371
FT                   /locus_tag="SEQ_0470"
FT                   /note="Signal peptide predicted for SEQ0470 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.681 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    456297..456356
FT                   /locus_tag="SEQ_0470"
FT                   /note="1 probable transmembrane helix predicted for SEQ0470
FT                   by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    456537..456947
FT                   /locus_tag="SEQ_0470"
FT                   /note="HMMPfam hit to PF02557, D-alanyl-D-alanine
FT                   carboxypeptidase, score 1.8e-50"
FT                   /inference="protein motif:PFAM:PF02557"
FT   CDS_pept        457019..457591
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0471"
FT                   /product="putative N-acetyl-muramidase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92670"
FT                   /db_xref="GOA:C0M7T6"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T6"
FT                   /protein_id="CAW92670.1"
FT                   /translation="MRKRLKFSYFLVFLVFIMVALIGPLLFNAKGTSASQEMSVPYTER
FT                   QFIQLVAKEVKPLAKNYGIRPSILIGQIILETNYGRTLLAAKYHNLFSLQPAPGQASIS
FT                   LKKQAASKHKTAYAIYRDREDSIRAYLSWLSQGTGEEKKLYQSLATEKGYKKPAKSLQT
FT                   YRYSDDKGYAQRLVQLIEARGLTSYDD"
FT   sig_peptide     457019..457120
FT                   /locus_tag="SEQ_0471"
FT                   /note="Signal peptide predicted for SEQ0471 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.362 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    457037..457105
FT                   /locus_tag="SEQ_0471"
FT                   /note="1 probable transmembrane helix predicted for SEQ0471
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    457169..457573
FT                   /locus_tag="SEQ_0471"
FT                   /note="HMMPfam hit to PF01832, Mannosyl-glycoprotein
FT                   endo-beta-N-ace, score 0.002"
FT                   /inference="protein motif:PFAM:PF01832"
FT   CDS_pept        458041..459075
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0472"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92671"
FT                   /db_xref="GOA:C0M7T7"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7T7"
FT                   /protein_id="CAW92671.1"
FT                   /translation="MITERQSNILNLIVDLFTQTHEPVGSKALQSLIASSSATIRNDMA
FT                   KLEKLGLLEKAHTSSGRMPSAAGFKYFVEHSLNLGSIDEQDLYQLVKAFDFEAFKLEDV
FT                   LLRASQMLSDTTGYTAAILDVEPARQRLTGFDIVQLSSHDALAVLSLDESKPLTVQFAI
FT                   PKNFMNRDLLVLKGIVADRLLGKDVMTVHYKLRTEIPQIVQKYFTVTDNVLDLFDYIFV
FT                   GLFRETIFVSGKVAALDYAGLATYQFLDEEQRLALSIRQSLSEEEMATVQVADSSEPAL
FT                   ANVTLLTYKFLIPYRGFGLLSLIGPVDMDYRRSVSLINVIGQLLAVKLRDYYRYLNSNH
FT                   YEVH"
FT   misc_feature    458341..458985
FT                   /locus_tag="SEQ_0472"
FT                   /note="HMMPfam hit to PF01628, HrcA protein C terminal
FT                   domain, score 1.8e-52"
FT                   /inference="protein motif:PFAM:PF01628"
FT   misc_feature    458785..458838
FT                   /locus_tag="SEQ_0472"
FT                   /note="HMMPfam hit to PF02809, no description, score 0.59"
FT                   /inference="protein motif:PFAM:PF02809"
FT   CDS_pept        459120..459689
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0473"
FT                   /product="GrpE protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92673"
FT                   /db_xref="GOA:C0M7T8"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7T8"
FT                   /protein_id="CAW92673.1"
FT                   /translation="MSKKPKEELKDQEDILDEAAEEAVEPVEEADQSAELIADEAAEEP
FT                   SELELALQRAEDFENKYLRAHAEMQNIQRRANEERQSLQRYRSQDLAKKILPSLDNLER
FT                   ALAVEGLTDDVKKGLEMVQESLVQALKEEGIEEVPVEAFDHNLHMAVQTLPADDDHPAD
FT                   SIAQVFQKGYKLHERLLRPAMVVVYN"
FT   misc_feature    459168..459686
FT                   /locus_tag="SEQ_0473"
FT                   /note="HMMPfam hit to PF01025, GrpE, score 2.9e-59"
FT                   /inference="protein motif:PFAM:PF01025"
FT   misc_feature    459546..459680
FT                   /note="PS01071 grpE protein signature."
FT                   /inference="protein motif:Prosite:PS01071"
FT   CDS_pept        460094..461923
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0474"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92675"
FT                   /db_xref="GOA:C0M7T9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7T9"
FT                   /protein_id="CAW92675.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVAANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDFLVAEFKKENGIDL
FT                   SQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGAAGPLHLEMSLSRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQHIVIKSNDGLSEEEIERMMKDAEANAEADAKRKEEVDLKNEVDQAIFATE
FT                   KTIKETEGKGFDTERDAAQTALDELKKAQESGDLDDMKAKLEALNEKAQALAVKMYEQA
FT                   AAAQQAQAGAEGAADTGSTNSGDDVVDGEFTEK"
FT   misc_feature    460103..461815
FT                   /locus_tag="SEQ_0474"
FT                   /note="HMMPfam hit to PF00012, Hsp70 protein, score 0"
FT                   /inference="protein motif:PFAM:PF00012"
FT   misc_feature    460112..460135
FT                   /note="PS00297 Heat shock hsp70 proteins family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00297"
FT   misc_feature    460589..460630
FT                   /note="PS00329 Heat shock hsp70 proteins family signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS00329"
FT   misc_feature    461012..461056
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3."
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        462080..463216
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0475"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92677"
FT                   /db_xref="GOA:C0M7U0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U0"
FT                   /protein_id="CAW92677.1"
FT                   /translation="MNNTEYYDRLGVSKDASADDIKRAYRKMSKKYHPDINKEPGAEQK
FT                   YKDVQEAYETLSDSQKRAAYDQYGAAGANGGFGGGAGGFGGFDGGGFGGFEDIFSSFFG
FT                   GGGMRNPNAPRQGDDLQYRVNLSFEEAVFGTEKEVSYHRESTCSTCAGSGAKPGTSPTT
FT                   CRKCHGSGVINVDTQTPLGMMRRQVTCDVCHGSGQEIKEPCHTCHGTGHEKKVHKVSVK
FT                   IPAGVETGQQIRLQGQGEAGFNGGPYGDLFVILNVLPSKQFERNGSTIYYSLNISFVQA
FT                   ALGDTVDIPTVHGDVAMSIPAGTQTGKVFRLKGKGAPKLRGGGQGDQHVTVNIVTPTKL
FT                   NEAQKEALKAFAEASGEKPIAPKKKGFFDKVKDALEDI"
FT   misc_feature    462092..462277
FT                   /locus_tag="SEQ_0475"
FT                   /note="HMMPfam hit to PF00226, DnaJ domain, score 6.7e-33"
FT                   /inference="protein motif:PFAM:PF00226"
FT   misc_feature    462215..462274
FT                   /note="PS00636 Nt-dnaJ domain signature."
FT                   /inference="protein motif:Prosite:PS00636"
FT   misc_feature    462329..462376
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    462479..462733
FT                   /locus_tag="SEQ_0475"
FT                   /note="HMMPfam hit to PF00684, DnaJ central domain (4
FT                   repeats), score 2.7e-33"
FT                   /inference="protein motif:PFAM:PF00684"
FT   misc_feature    462518..462592
FT                   /note="PS00637 CXXCXGXG dnaJ domain signature."
FT                   /inference="protein motif:Prosite:PS00637"
FT   misc_feature    462569..462586
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    462647..462664
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    462770..463135
FT                   /locus_tag="SEQ_0475"
FT                   /note="HMMPfam hit to PF01556, DnaJ C terminal region,
FT                   score 2.5e-66"
FT                   /inference="protein motif:PFAM:PF01556"
FT   CDS_pept        463536..464327
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0476"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92678"
FT                   /db_xref="GOA:C0M7U1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U1"
FT                   /protein_id="CAW92678.1"
FT                   /translation="MTFQNIIFELEEDLAILTLNRPEVSNGFNIPACQEILEAIRLVKD
FT                   NPSLRFLVIKAKGKVFSVGGDLVEMQNAVERDDVQSLVRIAELVQDISFAIKQLPKPVI
FT                   LCADGAVAGAAFNIALAVDFCIASTQTKFIQAFVNVGLAPDAGGLFLLTRAVGLNRATH
FT                   LVMTGEGVTAEKGLEYGFVYRAAESDKLDKTCSQLLKRLRRGSSNSYAGMKSLVWQSFF
FT                   AGWEDYAQKELAIQEELAFKEDFKEGVRAYGDRRRPNFRGK"
FT   misc_feature    463578..464096
FT                   /locus_tag="SEQ_0476"
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 1.9e-23"
FT                   /inference="protein motif:PFAM:PF00378"
FT   CDS_pept        464407..464841
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0477"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92680"
FT                   /db_xref="GOA:C0M7U2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U2"
FT                   /protein_id="CAW92680.1"
FT                   /translation="MEYNKINQYLVDIFNRILVIEEMSLKTSQFNDVSLKEMHTIEIIG
FT                   KYQQVTPSDIARELMVTLGTVTTSLNKLELKGYIERTRSSVDRRVVYLSLTKKGRLLDR
FT                   LHARFHKNMVGHVIADMNEDEMQALLRGLGNLHQFLEDLV"
FT   misc_feature    464503..464811
FT                   /locus_tag="SEQ_0477"
FT                   /note="HMMPfam hit to PF03965, Penicillinase repressor,
FT                   score 0.0016"
FT                   /inference="protein motif:PFAM:PF03965"
FT   misc_feature    464503..464712
FT                   /locus_tag="SEQ_0477"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 2.9e-19"
FT                   /inference="protein motif:PFAM:PF01047"
FT   misc_feature    464554..464619
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1065.000, SD 2.81 at aa 50-71, sequence
FT                   VTPSDIARELMVTLGTVTTSLN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    464560..464589
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS_pept        464841..465815
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0478"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92682"
FT                   /db_xref="GOA:C0M7U3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M7U3"
FT                   /protein_id="CAW92682.1"
FT                   /translation="MVFSKISQVAHYTPKQVISNDDLSQIMDTSHEWISSRTGIEKRHI
FT                   STVEMTSDLAIRVAEQLLAGSGYDATALDFIIVATISPDASMPSTAAKVQAAIGATNAF
FT                   AFDMTAACSGFVFALAMADKLIASGAYQRGLVIGAETLSKIIDWQDRSTAVLFGDGAGG
FT                   VLLEASEQQHFLAEALHTDGAQGQSLTSGQSSLRSPFSQGQEVNSFLQMDGRAIFDFAI
FT                   RDVSRSITAIIEQSGLAKEELDYLLLHQANRRILDKMAKKIGMPREKFLENMMHYGNTS
FT                   AASIPILLSESVQNGQLKLDGSQHILLSGFGGGLTWGSLIVKI"
FT   misc_feature    465156..465389
FT                   /locus_tag="SEQ_0478"
FT                   /note="HMMPfam hit to PF08545,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 7.3e-47"
FT                   /inference="protein motif:PFAM:PF08545"
FT   misc_feature    465537..465812
FT                   /locus_tag="SEQ_0478"
FT                   /note="HMMPfam hit to PF08541,
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)], score 5.3e-45"
FT                   /inference="protein motif:PFAM:PF08541"
FT   CDS_pept        465873..466097
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0479"
FT                   /product="acyl carrier protein (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92684"
FT                   /db_xref="GOA:C0M7U4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U4"
FT                   /protein_id="CAW92684.1"
FT                   /translation="MAVFEKVQEIIVEELGKDAEEVTLETTFDDLDADSLDVFQVISEI
FT                   EDAFDIQIETEEGLNTVGDLVAYVEEKTK"
FT   misc_feature    465885..466079
FT                   /locus_tag="SEQ_0479"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 5.1e-12"
FT                   /inference="protein motif:PFAM:PF00550"
FT   CDS_pept        466292..467278
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0480"
FT                   /product="enoyl-ACP reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92686"
FT                   /db_xref="GOA:C0M7U5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U5"
FT                   /protein_id="CAW92686.1"
FT                   /translation="MKTRITELLNIDYPIFQGGMAWVADGDLAGAVSNAGGLGIIGGGN
FT                   APKEVVKANIDRVKAITDKPFGVNIMLLSPFADDIVDLVIEEGVKVVTTGAGNPGKYME
FT                   RLHEAGIIVIPVVPSVALAKRMEKLGVDAVIAEGMEAGGHIGKLTTMTLVRQVVDAVSI
FT                   PVIAAGGIADGRGAAAAFMLGAEAVQVGTRFVVAKESNAHQSFKDKILKAKDIDTVISA
FT                   QVVGHPVRSIKNKLTSAYAKAEKEFLADRKAASDIEEMGAGALRNAVIDGDVINGSVMA
FT                   GQIAGLIRAEESCEAILKDIYYGAAAVISQEAKRWQALAADDKNETI"
FT   misc_feature    466295..467203
FT                   /locus_tag="SEQ_0480"
FT                   /note="HMMPfam hit to PF03060, 2-nitropropane dioxygenase,
FT                   score 1.3e-107"
FT                   /inference="protein motif:PFAM:PF03060"
FT   misc_feature    466784..466846
FT                   /note="PS00912 Dihydroorotate dehydrogenase signature 2."
FT                   /inference="protein motif:Prosite:PS00912"
FT   CDS_pept        467291..468211
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0481"
FT                   /product="putative malonyl CoA-acyl carrier protein
FT                   transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92688"
FT                   /db_xref="GOA:C0M7U6"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U6"
FT                   /protein_id="CAW92688.1"
FT                   /translation="MTKTAFLFAGQGAQTLGMTRDLYDQYAIARDTFDQASQLLGYDLR
FT                   KLIDTDQDRLNQTAYTQPAILTASVSIYRILTSYGVHPDMVAGLSLGEYSALVAAGVLS
FT                   FETALELVAKRGRFMEEAAPAGSGKMVAVMNTEARLIEEACQEASSVGVVSPANYNTPG
FT                   QIVIGGTAEAVNAALEILKAKGVKRLIPLNVSGPFHTALLAPASQRLAEELSKIQFQDF
FT                   DLPLVGNTEAKVMEKDRIAELLARQVMEPVRFYDSIEVMKANGITQFVEIGPGRVLTGF
FT                   IKKIDKKLLCSSVEDMPSLQLYLGK"
FT   misc_feature    467303..468208
FT                   /locus_tag="SEQ_0481"
FT                   /note="HMMPfam hit to PF00698, Acyl transferase domain,
FT                   score 2.4e-16"
FT                   /inference="protein motif:PFAM:PF00698"
FT   CDS_pept        468228..468962
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0482"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92690"
FT                   /db_xref="GOA:C0M7U7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U7"
FT                   /protein_id="CAW92690.1"
FT                   /translation="MEIKGKNVFITGSTRGIGLAMAHQFAGLGANIVLNGRSAISDELV
FT                   ETFKDYGVKVVPISGDVSEGADAKRMVDEAIEQLGSVDILINNAGITNDKLMLKMSEED
FT                   FERVLKINLTGAFNMTQSVLKPMTKARQGAIINVSSVVGLTGNIGQANYAASKAGLIGF
FT                   TKSVAREVAARGIRVNAIAPGFIESDMTGVLSEKMQEQILNQIPMKRIGKGQEVAQAAS
FT                   FLASQDYITGQVLAIDGGMTMQ"
FT   misc_feature    468243..468743
FT                   /locus_tag="SEQ_0482"
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 4e-47"
FT                   /inference="protein motif:PFAM:PF00106"
FT   misc_feature    468255..468890
FT                   /locus_tag="SEQ_0482"
FT                   /note="HMMPfam hit to PF07993, Male sterility protein,
FT                   score 0.0008"
FT                   /inference="protein motif:PFAM:PF07993"
FT   misc_feature    468645..468731
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00061"
FT   misc_feature    468693..468740
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   CDS_pept        468978..470210
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0483"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92692"
FT                   /db_xref="GOA:C0M7U8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U8"
FT                   /protein_id="CAW92692.1"
FT                   /translation="MTLNRVVVTGYGVTSPIGHTPEEFWSSLKAGHIGIKPITKFDTSD
FT                   FAVKNAAEIQDFPFDKYFVKKDLNRFDMYSLYALYAATEAIEHAGLDIEAIDSDRFGVI
FT                   VASGIGGIQEIEEQVIRLHEKGPKRVKPMTLPKALPNMAAGNVAMKLNAQGVCKSINTA
FT                   CASSNDAIGDAFRTIKFGLQDVMMVGGSEAAITKFAIAGFQSLTALSTTEDPSRSSIPF
FT                   DKDRNGFIMGEGSGMLVLESLEHAQKRGATILAEIVGYGNTCDAYHMTSPHPEGLGARK
FT                   AINLALQEAGIDAAAIDYVNAHGTSTPANEKGESQAIVAVLGKEVPVSSTKSFTGHLLG
FT                   AAGAVEAIATIEAIRHNYVPMTAGTKELSDDIEANVIFGQGKEADIRYAMSNTFGFGGH
FT                   NAVLAFKRWED"
FT   misc_feature    468987..469715
FT                   /locus_tag="SEQ_0483"
FT                   /note="HMMPfam hit to PF00109, Beta-ketoacyl synthase,
FT                   N-terminal do, score 6.8e-65"
FT                   /inference="protein motif:PFAM:PF00109"
FT   misc_feature    469440..469490
FT                   /note="PS00606 Beta-ketoacyl synthases active site."
FT                   /inference="protein motif:Prosite:PS00606"
FT   misc_feature    469455..469511
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00098"
FT   misc_feature    469737..470201
FT                   /locus_tag="SEQ_0483"
FT                   /note="HMMPfam hit to PF02801, Beta-ketoacyl synthase,
FT                   C-terminal do, score 6.3e-59"
FT                   /inference="protein motif:PFAM:PF02801"
FT   CDS_pept        470212..470685
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0484"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92693"
FT                   /db_xref="GOA:C0M7U9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C0M7U9"
FT                   /protein_id="CAW92693.1"
FT                   /translation="MNIQEIKDLMAQFDASSLREFSFKSSDGELLFSKNEHRPMAAPAP
FT                   EPVTLHQEVAPISLTQEIVSKQESIPASSGLQEPEGEVVDSPLVGVAYLAAGPDKPPFV
FT                   TVGDSVKKGQTLLIVEAMKVMNEIPAPCDGIVTEILVANEDVVEFGQGLVRIK"
FT   misc_feature    470455..470679
FT                   /locus_tag="SEQ_0484"
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 7.4e-25"
FT                   /inference="protein motif:PFAM:PF00364"
FT   CDS_pept        470682..471104
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0485"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92695"
FT                   /db_xref="GOA:C0M854"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M854"
FT                   /protein_id="CAW92695.1"
FT                   /translation="MMDIKQIQEALPHRYPMLLVDRILEASDDEIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKEENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TARFIKRRGTIAVVEAKAEVDGKLAASGTLTFAFGQ"
FT   misc_feature    470712..471080
FT                   /locus_tag="SEQ_0485"
FT                   /note="HMMPfam hit to PF07977, FabA-like domain, score
FT                   1.5e-68"
FT                   /inference="protein motif:PFAM:PF07977"
FT   CDS_pept        471138..472502
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0486"
FT                   /product="biotin carboxylase subunit of acetyl-CoA
FT                   carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92697"
FT                   /db_xref="GOA:C0M855"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C0M855"
FT                   /protein_id="CAW92697.1"
FT                   /translation="MFNKILIANRGEIAVRIIRAARELGISTVAVYSEADREALHTILA
FT                   DQAICIGPSRSKESYLNMNSVLSAAVVTGAQAIHPGFGFLSENSKFVTMCEEMNIKFIG
FT                   PSGAVMDKMGDKINARAEMIKAGVPVIPGSDGEVYNAQEALEIARQIGYPVMLKAAAGG
FT                   GGKGIRKVESEADLEAAFNAASQEALGAFGNGAMYLEKVIYPARHIEVQILGDSQGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGTTLRQRMGEAAVRAAKAVSYENAGTIEFLLDEA
FT                   SGDFYFMEMNTRVQVEHPVTEFVTGVDIVKEQLRIAAGLPLSVRQEDIVITGHAIECRI
FT                   NAENPSFNFAPSPGKITDLYLPSGGVGLRIDSAVYSGYTIPPYYDSMIAKIIVHGDNRF
FT                   DALMKMQRALFELEIEGIMTNIDFQMDLISDKQVIAGDYDTSFLMETFLPSYNKD"
FT   misc_feature    471138..471476
FT                   /locus_tag="SEQ_0486"
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain,, score 6.9e-43"
FT                   /inference="protein motif:PFAM:PF00289"
FT   misc_feature    471480..472127
FT                   /locus_tag="SEQ_0486"
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain,, score 4.3e-95"
FT                   /inference="protein motif:PFAM:PF02786"
FT   misc_feature    471594..471638
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00866"
FT   misc_feature    471909..471959
FT                   /note="PS00238 Visual pigments (opsins) retinal binding
FT                   site."
FT                   /inference="protein motif:Prosite:PS00238"
FT   misc_feature    471996..472019
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00867"
FT   misc_feature    472146..472469
FT                   /locus_tag="SEQ_0486"
FT                   /note="HMMPfam hit to PF02785, Biotin carboxylase
FT                   C-terminal domain, score 2.4e-53"
FT                   /inference="protein motif:PFAM:PF02785"
FT   CDS_pept        472511..473377
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0487"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92699"
FT                   /db_xref="GOA:C0M856"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M856"
FT                   /protein_id="CAW92699.1"
FT                   /translation="MALFSKKDKYIRITPNNSLKSSVSRNVPEVPDELFAKCPACKHMI
FT                   YQKDLGPAKICPTCSYNFRISAQERLTLTVDEGSFQELFTDIETKDPLRFPDYQAKLQK
FT                   ARQATGLHEAVLTGTALVKGQRLALAIMDSHFIMASMGTVVGEKITRLFELAISERLPV
FT                   VIFTASGGARMQEGIMSLMQMAKVSAAIKKHSNAGLFYLTILTDPTTGGVTASFAMEGD
FT                   MIIAEPQSLVGFAGRRVIETTVRENLPDDFQKAEFLKEHGFVDAIVKRTDLRDRIAHLV
FT                   AFHGGVS"
FT   CDS_pept        473374..474144
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0488"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92701"
FT                   /db_xref="GOA:C0M857"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M857"
FT                   /protein_id="CAW92701.1"
FT                   /translation="MTDVARILKEARDQGRMTALDYASLIFDEFMELHGDRQFADDGSI
FT                   VGGIAYLADQPVTVIGIQKGKNLQDNLARNFGQPHPEGYRKALRLMKQAEKFGRPVITF
FT                   INTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADQVWM
FT                   LENTMYAVLSPEGFASILWKDGSRATEAAELMKITAAELYQMGVIDRIIPERGYFSSEI
FT                   VEMIKSHLIDEITQLQAKPLEELLDQRYQRFRKY"
FT   misc_feature    473377..473658
FT                   /locus_tag="SEQ_0488"
FT                   /note="HMMPfam hit to PF03255, Acetyl co-enzyme A
FT                   carboxylase carboxyltrans, score 7.3e-22"
FT                   /inference="protein motif:PFAM:PF03255"
FT   CDS_pept        complement(474376..475653)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0489"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92703"
FT                   /db_xref="GOA:C0M858"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M858"
FT                   /protein_id="CAW92703.1"
FT                   /translation="MLDLKRIRTDFDTVAAKLKTRGVSEAILTSLKALDEQRRTLLVQT
FT                   EELKAQRNIASAAIAQAKRQKEDASQQIADMQQLAANIKAIDAKLADIDQEITGIITVL
FT                   PNTPHDSVPIGADEEDNVEIHRWGKPRQFDFDIKAHWDLGEALDILDWERGAKVTGARF
FT                   LFYKNLGARLERALYNFMLDEHLKEGYQEIIPPYMVNHDSMFGTGQYPKFKEDTFELDG
FT                   TNFVLIPTAEVPLTNYYRGDIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKPETSYEELEKMTANAEHILQKLKLPYRVLALCTGDMGFSAAKTYDLEVWI
FT                   PAQNTYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEVLRPYMGGLEVIKPR"
FT   misc_feature    complement(474625..475137)
FT                   /locus_tag="SEQ_0489"
FT                   /note="HMMPfam hit to PF00587, tRNA synthetase class II
FT                   core domain (G,, score 9.3e-70"
FT                   /inference="protein motif:PFAM:PF00587"
FT   misc_feature    complement(474802..474876)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    complement(475330..475653)
FT                   /locus_tag="SEQ_0489"
FT                   /note="HMMPfam hit to PF02403, Seryl-tRNA synthetase
FT                   N-terminal domain, score 2.4e-44"
FT                   /inference="protein motif:PFAM:PF02403"
FT   CDS_pept        476307..477305
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0490"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92704"
FT                   /db_xref="GOA:C0M859"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0M859"
FT                   /protein_id="CAW92704.1"
FT                   /translation="MFMIVITHVLGKGGLRSTVEGEADSYFIVTWMIQVLVYGAVNCYA
FT                   LISGYVGIKSPYKYSKIVNIWVQVFFYSFLMTLLFALFGFPVSLENWRQALFPIVSGNY
FT                   WYITAYFGLLIFMPMINGGLNTLSNKQLGRLVLLVFAIFSLIPALMNQQVDEFSLSKGF
FT                   EMTWLIILYIIGAYLRRIELSRFSHKLLIAVYMGSLVVTYIMKFMVGNIWYWYVSPSLT
FT                   LGAIALFILFAKLKLTSETLLLRFIVIVSPTTLGIYLVHLHPLLVKFIIRDFAEPFVNA
FT                   PILLYPLLIFGVGIVIYFLSFLVEQARLMLFKKLGFQNLLKWVDKKIPFAD"
FT   misc_feature    join(476397..476465,476499..476567,476610..476678,
FT                   476697..476756,476799..476855,476874..476933,
FT                   476943..477011,477030..477092,477150..477218)
FT                   /locus_tag="SEQ_0490"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SEQ0490 by TMHMM2.0 at aa 31-53, 65-87, 102-124, 131-150,
FT                   165-183, 190-209, 213-235, 242-262 and 282-304"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(477626..478009)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92706"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:C0M860"
FT                   /protein_id="CAW92706.1"
FT                   /translation="MAQSLNQRVILQTTAVSYLGIGGKVGKILLGDKALEFYNDKNVED
FT                   FIQIPWTAINQIGANVSGKKVSRHFEIFTDQGKFLFASKDSGKILKVARETIGNDKVIK
FT                   LPTLVQTIIAKLFHHQKKDKKSH"
FT   misc_feature    complement(477644..478009)
FT                   /locus_tag="SEQ_0491"
FT                   /note="HMMPfam hit to PF06115, Domain of unknown function
FT                   (DUF956), score 2.8e-75"
FT                   /inference="protein motif:PFAM:PF06115"
FT   CDS_pept        complement(478143..479054)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0492"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system (PTS), IID component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92708"
FT                   /db_xref="GOA:C0M861"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:C0M861"
FT                   /protein_id="CAW92708.1"
FT                   /translation="MTEQIKLTKADRKRVWWRSQFLQGSWNYERMQNMGWAYALIPALK
FT                   KLYTTKEDRAAALERHMEFFNTHPYVAAPIIGVTLALEEERANGTAIDNAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGALGASLAQTGNLVGPLLFFFGWNIIRMAFLWYTQEFGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVSINFTINLPGKQLSEGAYVVF
FT                   PEGAVKGAELKSILGQAMGGMSLDKVQSQTLQGQLDSLIPGLAGLLLTFLCMWLLKKKV
FT                   SPIAIIIALFAFGIIAHLLHIM"
FT   misc_feature    complement(join(478149..478205,478224..478277,
FT                   478446..478514,478614..478682))
FT                   /locus_tag="SEQ_0492"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0492 by TMHMM2.0 at aa 125-147, 181-203, 260-277 and
FT                   284-302"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(479070..479879)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0493"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system (PTS), IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92710"
FT                   /db_xref="GOA:C0M862"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C0M862"
FT                   /protein_id="CAW92710.1"
FT                   /translation="MSDISLISAILVVIVAFFAGLEGILDQFQMHQPLVACTLIGLVTG
FT                   HLEAGVMLGGTLQMLALGWANIGAAVAPDAALASVAAAIIMVKGGDFTQKGITFAYSTA
FT                   IPLAVAGLFLTMIVRTISTVLVHAGDKAALEGNFSAIERFHFAALLLQGLRIAVPAALL
FT                   VAVPTEAVQSVLKAMPAWLNEGMQIGGAMVVAVGYALVINMMATREVWPFFALGFALAA
FT                   VTQLTLIAMGVIGVAIAFIYLNLSKQGGNGGGRAGSADPIGDILEDY"
FT   misc_feature    complement(join(479151..479219,479262..479321,
FT                   479382..479450,479517..479585,479619..479687,
FT                   479715..479783,479817..479870))
FT                   /locus_tag="SEQ_0493"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SEQ0493 by TMHMM2.0 at aa 4-21, 33-55, 65-87, 99-121,
FT                   144-166, 187-206 and 221-243"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(479154..479870)
FT                   /locus_tag="SEQ_0493"
FT                   /note="HMMPfam hit to PF03609, PTS system sorbose-specific
FT                   iic component, score 2.2e-137"
FT                   /inference="protein motif:PFAM:PF03609"
FT   CDS_pept        complement(480050..481042)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0494"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system (PTS), IIAB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92712"
FT                   /db_xref="GOA:C0M863"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:C0M863"
FT                   /protein_id="CAW92712.1"
FT                   /translation="MGIGIIIASHGKFAEGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YGHFNNAIAQFDADDEILVLADLWSGSPFNQASRVAGENPDRKMAIITGLNLPMLIQAY
FT                   TERLMDANAGVEQVAANIIKESKDGIKALPEELNPVEEASTANGGGQALQGAIPKGTVI
FT                   GDGKLKINLARIDTRLLHGQVATAWTPASKADRIIVASDSVAKDELRKQLIKQAAPGGV
FT                   KANVVPINKLIEASKDPRFGNTHALILFETVQDALRAIEGGVEIKELNVGSIAHSTGKT
FT                   MVNNVLSMDKDDVAAFEKLRDLGVSFDVRKVPNDSKKNLFELIQKANVQ"
FT   misc_feature    complement(480086..480538)
FT                   /locus_tag="SEQ_0494"
FT                   /note="HMMPfam hit to PF03830, PTS system sorbose subfamily
FT                   IIB componen, score 7.2e-87"
FT                   /inference="protein motif:PFAM:PF03830"
FT   misc_feature    complement(480674..481036)
FT                   /locus_tag="SEQ_0494"
FT                   /note="HMMPfam hit to PF03610, PTS system fructose IIA
FT                   component, score 9.2e-55"
FT                   /inference="protein motif:PFAM:PF03610"
FT   CDS_pept        complement(join(481394..481822,481822..482205))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0495"
FT                   /note="CDS contains a frameshift after codon 128.
FT                   Frameshift occurs at a poly T pentamer. Similar to
FT                   Streptococcus pyogenes serotype M18 hypothetical protein
FT                   Spym18_1809 UniProt:Q8NZP0 (EMBL:AE010088 (270 aa) fasta
FT                   scores: E()=3.1e-86, 83.704% id in 270 aa;putative haloacid
FT                   dehalogenase-like hydrolase (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92714.1"
FT   misc_feature    complement(481726..482190)
FT                   /locus_tag="SEQ_0496"
FT                   /note="HMMPfam hit to PF08282, haloacid dehalogenase-like
FT                   hydrolase, score 5.2e-06"
FT                   /inference="protein motif:PFAM:PF08282"
FT   CDS_pept        482464..483924
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0497"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92716"
FT                   /db_xref="GOA:C0M865"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:C0M865"
FT                   /protein_id="CAW92716.1"
FT                   /translation="MEKFFKLKENGTTVSTELMAGVTTFFAMSYILFVNPSILSAAGMP
FT                   SQAVFLATIIAAAISTLIMGLFANVPYALAPGMGLNAFFTYTVVFSLGFSWQEALAIVF
FT                   LCGLFNIFITVTKLRKSIIKAIPVSLQHAIGGGIGVFVAYLGFKNANLITFSLSSAEIV
FT                   TVNGVEPAKATAETFANGVFSVNANGGVVPAISTFTDPSVLLAVFGLLLTAVLVLKNVR
FT                   GAILIGITVTTLAGIPIGVVDLSAVNFADNHISSAFAELGTTFLAAFGGMASLFSDSSR
FT                   LPLVLMTIFAFSLSDTFDTIGTFVGTGRRTGIFSEEDERALENSSGFSSKMDRALFADA
FT                   IGTSIGALFGTSNTTTYVESAAGIAEGGRTGLTAVSTAVCFVLSVLLLPIVGIVPAAAT
FT                   APALIIVGVMMVSSFLDVDWSDFDVALPSFFAAFFMALCYSISYGVAGSFIFYCLVKLV
FT                   KGKTKEIHPILWGATFLFVLNFIILALL"
FT   sig_peptide     482464..482634
FT                   /locus_tag="SEQ_0497"
FT                   /note="Signal peptide predicted for SEQ0497 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.968) with cleavage site
FT                   probability 0.654 between residues 57 and 58"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    482506..483804
FT                   /locus_tag="SEQ_0497"
FT                   /note="HMMPfam hit to PF00860, Permease family, score
FT                   3.8e-09"
FT                   /inference="protein motif:PFAM:PF00860"
FT   misc_feature    join(482521..482589,482608..482676,482734..482802,
FT                   482836..482904,483049..483117,483136..483204,
FT                   483232..483291,483598..483702,483760..483828,
FT                   483865..483918)
FT                   /locus_tag="SEQ_0497"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SEQ0497 by TMHMM2.0 at aa 20-42, 49-71, 91-113, 125-147,
FT                   196-218, 225-247, 257-276, 379-413, 433-455 and 468-485"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        484290..484733
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0498"
FT                   /product="putative P-loop hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92718"
FT                   /db_xref="GOA:C0M866"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M866"
FT                   /protein_id="CAW92718.1"
FT                   /translation="MFYSKNENELIAYGQGIGRQLKAGDVLVLTGDLGAGKTTLTKGVA
FT                   KGLGIDQMIKSPTYTIAREYEGRLPLYHLDVYRIGDDPDSIDLDDFIFGGGVTVIEWGE
FT                   LLAKGTLHDYLEILITKTETGRQVDYLAHGHRSEALLEELKHV"
FT   misc_feature    484317..484673
FT                   /locus_tag="SEQ_0498"
FT                   /note="HMMPfam hit to PF02367, Uncharacterised P-loop
FT                   hydrolase UPF0079, score 5.1e-39"
FT                   /inference="protein motif:PFAM:PF02367"
FT   misc_feature    484380..484403
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS_pept        484726..485253
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0499"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92720"
FT                   /db_xref="GOA:C0M867"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0M867"
FT                   /protein_id="CAW92720.1"
FT                   /translation="MSEQVVTIEEAKASDASALITLIKEAADETDFITGTEDVIAATVE
FT                   VLECFLEASQESLTDICLLLKVGDILAGLLNIAGKAYRETSYVGDCFMLVLKPYRNHGL
FT                   GQLLMETTLDWARETKQLCALELEVQARNTCAYHIYEKYGFKIEGVKRKDVKSRNGDYQ
FT                   DVYLMRKYLERE"
FT   misc_feature    484912..485163
FT                   /locus_tag="SEQ_0499"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 2.9e-11"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS_pept        485254..486516
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0500"
FT                   /product="LytR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92721"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C0M868"
FT                   /protein_id="CAW92721.1"
FT                   /translation="MKIGKKIFLMLTAIVLLTLGAMGVYLTNAYTFSTGELSKTFKDFA
FT                   TSSKKSDAIQQTEPFSILLMGVDTGSSHRTSTWQGNSDSMILVTINPKTKKTTMTSLER
FT                   DILITLSGPNDNEMNGAEAKLNAAYAAGGAQMAIMTVQDLLNITIDKYVQINMQGLIDL
FT                   VNAVGGITVTNEFDFPISIADNEPEYQATVAPGTHKINGEQALVYARMRYDDPEGDYGR
FT                   QKRQREVIQKVLKKILALNSISSYRKILSAVSGNMQTNIEISSRTIPNLLGYTDALKNI
FT                   KTYQLKGEGATLSDGGSYQIVTSDHLLEIQNRIRAELGLEKLSQLKTTATVYENLYGSL
FT                   KTQSTQDSSYYYNSGSLPAYTDSSTQYSTYSSETSSSSSYQDTTAGTQESGAANVTPSP
FT                   QADSPAEQQSSGATTGTPAAP"
FT   sig_peptide     485254..485346
FT                   /locus_tag="SEQ_0500"
FT                   /note="Signal peptide predicted for SEQ0500 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.693 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    485272..485340
FT                   /locus_tag="SEQ_0500"
FT                   /note="1 probable transmembrane helix predicted for SEQ0500
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    485494..485970
FT                   /locus_tag="SEQ_0500"
FT                   /note="HMMPfam hit to PF03816, Cell envelope-related
FT                   transcriptional a, score 5.6e-79"
FT                   /inference="protein motif:PFAM:PF03816"
FT   CDS_pept        complement(486686..486982)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="Possible gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pyogenes serotype M18 hypothetical
FT                   protein Spym18_1739. UniProt:Q8NZU2 (EMBL:AE010084 (118 aa)
FT                   fasta scores: E()=2.9e-15, 51.546% id in 97 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92723"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F1"
FT                   /protein_id="CAW92723.1"
FT                   /translation="MTLKTMTTIGLTSVLAYQVYRKRHQIKETLVAMQTSKKAIQADVD
FT                   RIKANLAIIQKEARTLQAAGTELAYKWQAFNQEAQAHLTEIQQRMSKYQQETP"
FT   CDS_pept        complement(486979..487398)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0502"
FT                   /product="HIT-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92725"
FT                   /db_xref="GOA:C0M8F2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F2"
FT                   /protein_id="CAW92725.1"
FT                   /translation="MENCIFCSIISGEIPSSKVYEDEQVLAFLDISQTTAGHTLLIPKK
FT                   HVRNILAMDAETASQTFERLPKIARAIQKATGATAMNIINNNEELAGQTVFHAHVHLVP
FT                   RYSQEDGIAIQYTTHEPDFPALAALAQQISQEISQ"
FT   misc_feature    complement(487075..487389)
FT                   /locus_tag="SEQ_0502"
FT                   /note="HMMPfam hit to PF01230, HIT domain, score 1.7e-38"
FT                   /inference="protein motif:PFAM:PF01230"
FT   CDS_pept        complement(487851..488294)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0504"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92727"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F3"
FT                   /protein_id="CAW92727.1"
FT                   /translation="MNLSRFLTFGLVSLSALSISGLVQTEAKANEWQTIFEKPQEVVIT
FT                   DGWQTISEKPQEVSTANEWQVSSEEAQESVPDKFSQNEDPSLWAVPDKFSQNEDPSLWA
FT                   VPDKFSQNEDPSLWAVPDKFSQNEDPSLWAVPDKFSQNEDPSL"
FT   sig_peptide     complement(488208..488294)
FT                   /locus_tag="SEQ_0504"
FT                   /note="Signal peptide predicted for SEQ0504 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.476 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        488831..489556
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0506"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92729"
FT                   /db_xref="GOA:C0M8F4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F4"
FT                   /protein_id="CAW92729.1"
FT                   /translation="MLNIENVTGGYLNIPVLKDISFSVGNGELVGLIGLNGAGKSTTIN
FT                   EIIGFLKPYKGRISIDGLTLAEHEADYRKKIGFIPETPSLYEELTLAEHINTVAMAYDI
FT                   DVELAHKRAEPFLELFRLTDKLDWFPVHFSKGMKQKVMIICAFVIDPSLFILDEPFLGL
FT                   DPLAIADLIKALEVEKAKGKSILMSTHVLDSAEKMCDRFVILHQGQVRAQGTLADLQAV
FT                   FGDASASLNDIYLALTKEG"
FT   misc_feature    488909..489454
FT                   /locus_tag="SEQ_0506"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2e-44"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    488930..488953
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    489227..489271
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        489560..490594
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0507"
FT                   /product="ABC transporter protein EcsB"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92731"
FT                   /db_xref="GOA:C0M8F5"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F5"
FT                   /protein_id="CAW92731.1"
FT                   /translation="MKALFRKRRQEFQHKHTKYLPYVFNDHFVLVLLFLLGFILFQYSQ
FT                   LLKHFPANPLPIQLGLLIAVLFLLNLGSVATYLEKADQHFLLTKEAEVIAHIRSAERLS
FT                   FILWSSLQTVLLLPLFPLFQRLGVSLLAFVLLLGVLVLAKRLLLKRKVASFLSSKGLDW
FT                   EKAIAFEADRQQAILKFYALFTNVKGISTKVKERPYLNPILKLIKADSKKVWTNLYLRA
FT                   FLRSSDYLGLWLRLLLLSCLSLAFISNPYLAVGLALVFHYLSLFQLLSLYHHYDYHYMS
FT                   GLYPTKPQHKQRNLLSLLRQLSGLMLIVNLVLCRSWQNALVLIVAMGLLNLLYLPYKLK
FT                   KMID"
FT   misc_feature    489560..490585
FT                   /locus_tag="SEQ_0507"
FT                   /note="HMMPfam hit to PF05975, Bacterial ABC transporter
FT                   protein EcsB, score 5.2e-146"
FT                   /inference="protein motif:PFAM:PF05975"
FT   sig_peptide     489560..489715
FT                   /locus_tag="SEQ_0507"
FT                   /note="Signal peptide predicted for SEQ0507 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.681) with cleavage site
FT                   probability 0.631 between residues 52 and 53"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(489614..489682,489725..489793,489866..489925,
FT                   489935..490003,490244..490303,490316..490384,
FT                   490445..490498,490508..490564)
FT                   /locus_tag="SEQ_0507"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SEQ0507 by TMHMM2.0 at aa 19-41, 56-78, 103-122, 126-148,
FT                   229-248, 253-275, 296-313 and 317-335"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        490657..491448
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0508"
FT                   /product="phosphotransferase enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92732"
FT                   /db_xref="GOA:C0M8F6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F6"
FT                   /protein_id="CAW92732.1"
FT                   /translation="MTTTEQDLVLTPLRGKSGKAYKGTYPNGESVFIKLNTTPILPALA
FT                   KEQIAPQLLWAKRMGNGDMMSAQEWLNGRTLTREDMNSKQIVHILLRLHKSKQLVNQLL
FT                   QLNYKIENPYDLLVDFEQNAPLQIQQNSYLQAIVKELKRSLPEFRSEVATIVHGDIKHS
FT                   NWVITTSGMIFLVDWDCVRLTDRMYDVAYLLSHYIPRSRWADWLSYYGYKNNDKVMQKI
FT                   IWYAQFSYLTQILRCFDKRDMEHVNQEIYALRKFREMFRKK"
FT   misc_feature    490681..491331
FT                   /locus_tag="SEQ_0508"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 3.1e-31"
FT                   /inference="protein motif:PFAM:PF01636"
FT   CDS_pept        491448..492083
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0509"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92734"
FT                   /db_xref="GOA:C0M8F7"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8F7"
FT                   /protein_id="CAW92734.1"
FT                   /translation="MRVRKRKGAQEHLENNPHYVILEPEAAKGRWCEVFGNDHPIHIEV
FT                   GSGKGAFITGMALKNPEINYIGIDIQLSVLSYALDKVLASQAPNVRLLRVDGSSLTNYF
FT                   DAGEVDMMYLNFSDPWPKSRHEKRRLTYKSFLDTYKQILPENGEIHFKTDNRGLFEYSL
FT                   ASFSQYGMTLKQVWLDLHASDYQGNVMTEYEARFAKKGQIIYRLEATF"
FT   misc_feature    491529..492074
FT                   /locus_tag="SEQ_0509"
FT                   /note="HMMPfam hit to PF02390, Putative methyltransferase,
FT                   score 7.6e-57"
FT                   /inference="protein motif:PFAM:PF02390"
FT   tRNA            492143..492229
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="SEQ__t33"
FT                   /product="transfer RNA-Ser"
FT                   /note="tRNA Ser anticodon GGA, Cove score 57.61"
FT   CDS_pept        complement(492276..492365)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0509a"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pyogenes serotype M1 phi5005.3
FT                   integrase UniProt:Q48X40 (EMBL:CP000017 (359 aa) fasta
FT                   scores: E()=7.5e-08, 79.310% id in 29 aa;putative integrase
FT                   (fragment)"
FT   CDS_pept        492423..492503
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0509b"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Streptococcus pyogenes serotype M6 transposase
FT                   UniProt:Q5XBP0 (EMBL:CP000003 (74 aa) fasta scores:
FT                   E()=3.8e-06, 73.077% id in 26 aa;putative transposase
FT                   (fragment)"
FT   CDS_pept        complement(492707..492853)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0511"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Lactobacillus plantarum integral membrane protein
FT                   UniProt:Q88TN7 (EMBL:AL935260 (183 aa) fasta scores:
FT                   E()=0.5, 42.222% id in 45 aa;putative membrane protein
FT                   (fragment)"
FT                   /db_xref="PSEUDO:CAW92738.1"
FT   misc_feature    complement(492728..492796)
FT                   /locus_tag="SEQ_0511"
FT                   /note="1 probable transmembrane helix predicted for SEQ0511
FT                   by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        493461..493955
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0514"
FT                   /note="Probable gene remnant. CDS lacks appropriate
FT                   translational start site;conserved hypothetical protein
FT                   (fragment)"
FT   misc_feature    493548..493940
FT                   /locus_tag="SEQ_0514"
FT                   /note="HMMPfam hit to PF02576, Uncharacterised BCR, YhbC
FT                   family COG0779, score 3.9e-53"
FT                   /inference="protein motif:PFAM:PF02576"
FT   CDS_pept        494065..495219
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0515"
FT                   /product="putative N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92741"
FT                   /db_xref="GOA:C0M8F9"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8F9"
FT                   /protein_id="CAW92741.1"
FT                   /translation="MSKEMLEAFRILEEEKHIDKADIIEAVTESLKSAYKRRYGQAESC
FT                   VIEFNDKTADFQVFTVREVVEEVFDSRLEISLNDALAISSAYELGDKIRFEESVSEFGR
FT                   VAAQSAKQTIMERMRRQMREITFNEYKQHEGEIMTGTVERFDQRFIYVNLGSLEAQLSH
FT                   QDQIPGETFKSHDRIDVYVYKVENNPKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEI
FT                   MSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRYDAKTGLEIPVE
FT                   ENIDVIQWVDDPAEFIYNAIAPAEVDMVLFDDDDLKRATVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEYERLEAEKEAAMTEAVATEELLTNEEV"
FT   misc_feature    494074..494439
FT                   /locus_tag="SEQ_0515"
FT                   /note="HMMPfam hit to PF08529, NusA N-terminal domain,
FT                   score 1.2e-56"
FT                   /inference="protein motif:PFAM:PF08529"
FT   misc_feature    494455..494655
FT                   /locus_tag="SEQ_0515"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain, score
FT                   0.0001"
FT                   /inference="protein motif:PFAM:PF00575"
FT   misc_feature    495016..495165
FT                   /locus_tag="SEQ_0515"
FT                   /note="HMMPfam hit to PF00013, KH domain, score 0.029"
FT                   /inference="protein motif:PFAM:PF00013"
FT   CDS_pept        495235..495531
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92743"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8G0"
FT                   /protein_id="CAW92743.1"
FT                   /translation="MPKVKKIPLRKSLVSGEIIDKRDLLRIVKNKEGQIFIDPTGKQNG
FT                   RGAYIKLDNQEALMAKKKQVFNRSFSMEVPESFYDEVIAHVDHKVKRRELGLE"
FT   misc_feature    495253..495492
FT                   /locus_tag="SEQ_0516"
FT                   /note="HMMPfam hit to PF04296, Protein of unknown function
FT                   (DUF448), score 1.6e-34"
FT                   /inference="protein motif:PFAM:PF04296"
FT   CDS_pept        495524..495826
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0517"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92745"
FT                   /db_xref="GOA:C0M8P6"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039107"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P6"
FT                   /protein_id="CAW92745.1"
FT                   /translation="MNSLNRLSHLIGLAQRAKKVISGEELVIKAIRHQEVNLVFLANDA
FT                   GPNITKKVTDKSNYYNVEVSTVFSALELSAALGKPRKVVAIADAGFSKKMRTLMK"
FT   misc_feature    495536..495811
FT                   /locus_tag="SEQ_0517"
FT                   /note="HMMPfam hit to PF01248, Ribosomal protein
FT                   L7Ae/L30e/S12e/Gadd4, score 2.1e-21"
FT                   /inference="protein motif:PFAM:PF01248"
FT   CDS_pept        495846..498716
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0518"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92747"
FT                   /db_xref="GOA:C0M8P7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8P7"
FT                   /protein_id="CAW92747.1"
FT                   /translation="MSKKRLHEIAKEIGKSSKEVVERAKSLGLDVKSHASSVEEADANK
FT                   IASSFSAGVTKNVQAGSAKDKQVAEQKAKAAKATTPQPAASKAAEKPAAATQEASQPVA
FT                   VKPKSRNFKAEREARAKEQVARRQAGQNRSNDRKSDYRQLGRSQGQQTERAGHKSQNQQ
FT                   RDRRFDNRPSSGNNRNDGHRQAGNRDKNRSFNANSRQQDTGRQGQTQAGAPKIDFKARA
FT                   AALKAEQNAEYARQRESRFREQEEAKRLEQQARQEAKAAALKAQTEDKKHREASAKATE
FT                   SVASMAAASVAKPVDKRRKKQNRPDKGHDRDHGLEDGQKKNKKSWNSQNQVRNQKNSNW
FT                   NNNKKNKKGKHHKNSNTAPKPVTERKFHELPKEFEYSEGMTVAEIAKRIKREPAEIVKK
FT                   LFMMGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDEADIERFFTDDSYLNPENIVER
FT                   APVVTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHA
FT                   AFTSMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPE
FT                   RVISELAEHGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIG
FT                   TVIEARLDKGKGAVATLLVQQGTLHVQDPIVVGNTFGRVRAMTNDLGRRVKSAEPSTPV
FT                   SITGLNETPMAGDHFAVYADEKAARAAGEERAKRALLKQRQNTQRVSLDNLFDTLKAGE
FT                   IKTVNVIIKADVQGSVEALAASLLKIDVEGVRVNVVHSAVGAINESDVTLAEASNAVII
FT                   GFNVRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPEYQEKMLGEAIIRET
FT                   FKVSKVGTIGGFMVVNGKVTRDSSVRVIRDSVVIFDGKLASLKHYKDDVKEIGNAQEGG
FT                   LMIEGFNDIKVDDTIEAYVMEEITRK"
FT   misc_feature    495846..496004
FT                   /locus_tag="SEQ_0518"
FT                   /note="HMMPfam hit to PF04760, Translation initiation
FT                   factor IF-2, N-ter, score 2.5e-13"
FT                   /inference="protein motif:PFAM:PF04760"
FT   misc_feature    496974..497129
FT                   /locus_tag="SEQ_0518"
FT                   /note="HMMPfam hit to PF04760, Translation initiation
FT                   factor IF-2, N-ter, score 3.6e-22"
FT                   /inference="protein motif:PFAM:PF04760"
FT   misc_feature    497022..497051
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   misc_feature    497214..497717
FT                   /locus_tag="SEQ_0518"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 9.9e-55"
FT                   /inference="protein motif:PFAM:PF00009"
FT   misc_feature    497223..497552
FT                   /locus_tag="SEQ_0518"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 3.8e-08"
FT                   /inference="protein motif:PFAM:PF01926"
FT   misc_feature    497241..497264
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    497784..497975
FT                   /locus_tag="SEQ_0518"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 6.1e-11"
FT                   /inference="protein motif:PFAM:PF03144"
FT   CDS_pept        498906..499256
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0519"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92749"
FT                   /db_xref="GOA:C0M8P8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8P8"
FT                   /protein_id="CAW92749.1"
FT                   /translation="MTNHRIDRVGMEIKREVNEILHKKVRDPRVQGVTITEVQMLGDLS
FT                   VAKVYYTIMSDLASDNQKAEIGLKKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNK
FT                   IDQLLRELEKKQ"
FT   misc_feature    498918..499232
FT                   /locus_tag="SEQ_0519"
FT                   /note="HMMPfam hit to PF02033, Ribosome-binding factor A,
FT                   score 2.8e-27"
FT                   /inference="protein motif:PFAM:PF02033"
FT   CDS_pept        complement(499328..500347)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0520"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92751"
FT                   /db_xref="GOA:C0M8P9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8P9"
FT                   /protein_id="CAW92751.1"
FT                   /translation="MTYLKRQLILLALLLTAIGSQTIVQASTRSWKSWFIEQYFWLKRD
FT                   KSYYAEQDENTFYNYVKSAGEKSNQGFNLTQNEVNGTLKTEYRDNMQVHSWNENSTNPS
FT                   NQKVILYLHGGSYLNNPTSYHIDMLKTLSTSLDAKIVLPIYPKAPTYTYDVAMPRLVSL
FT                   YQDILKSTNNNANNITIMGDSAGGGLALGLALALKNEDIKQPKDIILLSPWLDVTLSNP
FT                   EIPNYEASDPILSAWGLRIVGDIWARRGENNTKHPYVSPIYGDTSNLAPITMFVGTHEI
FT                   FYPDITKFDGMLKQKGHKHQLFVGEKMNHVYPIYPIEEAKTAQYQIIDTIKKEYEPQK"
FT   misc_feature    complement(499406..500023)
FT                   /locus_tag="SEQ_0520"
FT                   /note="HMMPfam hit to PF07859, alpha/beta hydrolase fold,
FT                   score 5e-29"
FT                   /inference="protein motif:PFAM:PF07859"
FT   sig_peptide     complement(500270..500347)
FT                   /locus_tag="SEQ_0520"
FT                   /note="Signal peptide predicted for SEQ0520 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        500595..501029
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0521"
FT                   /product="putative negative regulator of copper transport
FT                   operon"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92752"
FT                   /db_xref="GOA:C0M8Q0"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q0"
FT                   /protein_id="CAW92752.1"
FT                   /translation="MDTISDAEWEVMRVVWANGSMKSSEIIAILHEKHHWSDSTVKTLI
FT                   GRLVKKKALRADRQGRSYIYQSLLDQDRRQLAMLRERLDGMCQRHHSRLLLALLKDTPM
FT                   TLEDIQAFQLLLEAKKVGAVSHVRCDCVPGQCHCQKKERI"
FT   misc_feature    500604..500948
FT                   /locus_tag="SEQ_0521"
FT                   /note="HMMPfam hit to PF03965, Penicillinase repressor,
FT                   score 9.3e-45"
FT                   /inference="protein motif:PFAM:PF03965"
FT   CDS_pept        501026..503260
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0522"
FT                   /product="copper-transporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92754"
FT                   /db_xref="GOA:C0M8Q1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q1"
FT                   /protein_id="CAW92754.1"
FT                   /translation="MIVKETYLLEGMHCTSCALAIEQAVKQLPGVEGAAVDVTTEKLSV
FT                   SYSTDSLSSAELIQAVRKAGYRAELLDETNMRGQLERLEEQASNEWYRFLWSALFSLPL
FT                   LYLAMGPMLGLVLPVALAPQSHAISYGLVQLLLTLPVLFLNRQYYENGFKALIKKRPNM
FT                   DSLVTLATSFAFIYSSYSCFKIVAGAAQFAHQLYFESVVVILTLITLGSYLEGRTKGRA
FT                   SQAIQKLMSLRVTDVRVIREGALQLIPLEQVTNEDICFIQPGERVAVDGLIVEGQSTVD
FT                   ESMLTGESLPVDKVTGDSVFAGTINGQGALRVKPSRLGNDTLLSQIIELVEQAQQAKAP
FT                   IAALADRVSGVFVPIVLSLSLLSFLFWLFVMRESFDFALTIAIAVLIIACPCALGLATP
FT                   TAIMVGSGRAAEQGILFKGGDILEKAYQVRTIVFDKTGTLTEGQAQLQRIIPLAASEKQ
FT                   GLQEVASLEQYSQHPLGEALVRVAQEKGYDLLAVTDFQSLVGLGVTGVIDQHRLAVGNS
FT                   ELMSQQGIAISAAQTYAEQAALKGQTVVYYAKDNQLCALLLIADRLKADSKAAIRALQD
FT                   LGLQTVMLTGDNALTAQAIANEVGIDQVFSQVLPAQKAQIIADLKASGQLVAMVGDGIN
FT                   DAPALTLADIGISIGSGTDIAIEAADVILMTSAVRDVVECLELSRQTIRVVKQNLFWAF
FT                   SYNSLMIPVAMGILHVFGGPLLSPMLAGFAMSLSSISVVLNALRLRHKKW"
FT   misc_feature    501041..501235
FT                   /locus_tag="SEQ_0522"
FT                   /note="HMMPfam hit to PF00403, Heavy-metal-associated
FT                   domain, score 1.7e-15"
FT                   /inference="protein motif:PFAM:PF00403"
FT   misc_feature    501050..501139
FT                   /note="PS01047 Heavy-metal-associated domain."
FT                   /inference="protein motif:Prosite:PS01047"
FT   misc_feature    join(501308..501376,501404..501457,501518..501586,
FT                   501599..501667,502067..502135,502163..502231,
FT                   503090..503158,503168..503236)
FT                   /locus_tag="SEQ_0522"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SEQ0522 by TMHMM2.0 at aa 95-117, 127-144, 165-187,
FT                   192-214, 348-370, 380-402, 689-711 and 715-737"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    501539..501571
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    501632..502297
FT                   /locus_tag="SEQ_0522"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 1.2e-94"
FT                   /inference="protein motif:PFAM:PF00122"
FT   misc_feature    502163..502195
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    502307..502984
FT                   /locus_tag="SEQ_0522"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 2.2e-35"
FT                   /inference="protein motif:PFAM:PF00702"
FT   misc_feature    502325..502345
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:Prosite:PS00154"
FT   CDS_pept        503704..503817
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92756"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q2"
FT                   /protein_id="CAW92756.1"
FT                   /translation="MLFFLAQHETEKVSITSNQKEQLNHGQAKTACEEQAE"
FT   CDS_pept        504131..505081
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0524"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92758"
FT                   /db_xref="GOA:C0M8Q3"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q3"
FT                   /protein_id="CAW92758.1"
FT                   /translation="MNENTKRLTDPIVLEKSRAIEASPEHHQKLEQIKSEMSGNARKNN
FT                   LGWLAMVIGAIILYGMVDRSLALFLIIFVGGLVWPRLKTFKTANELSYVDHFLLPVLQE
FT                   ALPDVKIDYYSGIELSLLKLATPSSRWYDSNCHIIFGDDMQTEFCNLYAYHEENEDDNW
FT                   HRVTDFNGQVLLAKYHTAIKGYIRIVPTQKGFLGREKVHSGYKAKLKGEVQLEMEDIRF
FT                   NETYNVYCTDELSARMLLNPYMLAVLDEWREEMPVAVYMNGDTVVVSFYSGQQLLKTPS
FT                   SRGAIEKLSLSSEYENIQDKLVKMYRLLDTLNHQL"
FT   misc_feature    504263..504316
FT                   /locus_tag="SEQ_0524"
FT                   /note="1 probable transmembrane helix predicted for SEQ0524
FT                   by TMHMM2.0 at aa 45-62"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        505100..505645
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0525"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92759"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q4"
FT                   /protein_id="CAW92759.1"
FT                   /translation="MTSSMLTLILCMTILWLIGVRNKLERYRIVIEESKRNVDIALEKR
FT                   YDTISEMLKIAKSYAKHEEKVFTELVKLRQGLSLEETNDVMRTQEQALNEVFAVGEAYP
FT                   EMRSSEQFLSLQNEIAKENAALAAAKRIVNSNISLFNQAVVAFPVSIVASLINIKQMTF
FT                   LDIDLDHKKSLDQLDYTI"
FT   misc_feature    505100..505636
FT                   /locus_tag="SEQ_0525"
FT                   /note="HMMPfam hit to PF04011, LemA family, score 1.2e-08"
FT                   /inference="protein motif:PFAM:PF04011"
FT   misc_feature    join(505112..505159,505505..505573)
FT                   /locus_tag="SEQ_0525"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0525 by TMHMM2.0 at aa 5-20 and 136-158"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        complement(506061..506843)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0526"
FT                   /product="lactose phosphotransferase system repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92761"
FT                   /db_xref="GOA:C0M8Q5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q5"
FT                   /protein_id="CAW92761.1"
FT                   /translation="MLKRERLLTIMEKVNANGFITVTDIMESLRVSDMTARRNLDELAR
FT                   AGKLVRIRGGAQSISMPQKLERSNTEKLTVQIEAKKEIARYASQLINDGETIFIGPGTT
FT                   LECLAEALINRHIRIITNSLPVFTILNKSKTVDLILIGGEYRAITGAFVGSLASQTILS
FT                   LKFAKAFISCNGIYKNDIATYSENEGVIQRLACDNAIEKYLLADNQKFNAYDFYSFYHL
FT                   DNIDAIITDSKISDSVKERYRQFAKLLIARPADNQVSS"
FT   misc_feature    complement(506151..506615)
FT                   /locus_tag="SEQ_0526"
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   proteins, deoR family, score 5.3e-67"
FT                   /inference="protein motif:PFAM:PF00455"
FT   misc_feature    complement(506658..506828)
FT                   /locus_tag="SEQ_0526"
FT                   /note="HMMPfam hit to PF08220, DeoR-like helix-turn-helix
FT                   domain, score 9.1e-15"
FT                   /inference="protein motif:PFAM:PF08220"
FT   misc_feature    complement(506673..506828)
FT                   /locus_tag="SEQ_0526"
FT                   /note="HMMPfam hit to PF08279, HTH domain, score 0.0011"
FT                   /inference="protein motif:PFAM:PF08279"
FT   CDS_pept        506979..507404
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0527"
FT                   /product="galactose-6-phosphate isomerase LacA subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92763"
FT                   /db_xref="GOA:C0M8Q6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004783"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8Q6"
FT                   /protein_id="CAW92763.1"
FT                   /translation="MTIILGADAHGNDLKEAIKGFLQQEGFDVTDVTAIADDFVDNTLA
FT                   VARALKADEESLGIMIDAYGAGPFMVATKIKGMVAAEVSDERSAYMTRGHNNARMITMG
FT                   AEIVGQELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA"
FT   misc_feature    507150..507392
FT                   /locus_tag="SEQ_0527"
FT                   /note="HMMPfam hit to PF02502, Ribose/Galactose Isomerase,
FT                   score 9.3e-45"
FT                   /inference="protein motif:PFAM:PF02502"
FT   CDS_pept        507420..507935
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0528"
FT                   /product="galactose-6-phosphate isomerase LacB subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92765"
FT                   /db_xref="GOA:C0M8Q7"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004784"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M8Q7"
FT                   /protein_id="CAW92765.1"
FT                   /translation="MKIAIGCDHIVTDEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIF
FT                   GKRVGEAVANGLADLGVCICGTGVGITNAVNKVPGIRSALVRDMTTALYAKEELNANVI
FT                   GFGGKITGELLMCDIIEAFIKADYKETEENKKLIAKIAHLESHNANQEDPDFFTEFLDK
FT                   WDRGDYHD"
FT   misc_feature    507600..507845
FT                   /locus_tag="SEQ_0528"
FT                   /note="HMMPfam hit to PF02502, Ribose/Galactose Isomerase,
FT                   score 3.3e-42"
FT                   /inference="protein motif:PFAM:PF02502"
FT   CDS_pept        507945..508877
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0529"
FT                   /product="tagatose-6-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92766"
FT                   /db_xref="GOA:C0M8Q8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005926"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C0M8Q8"
FT                   /protein_id="CAW92766.1"
FT                   /translation="MILTVTLNPSIDISYPLNRLTLDTVNRVDRTTKTAGGKGLNVTRV
FT                   LAEAGQSVVATGFIGGKLGDFVIHQLQEQGISNQFFKIKGETRNCIAVLHEGMQTEILE
FT                   AGPYIDMDEAEGFLNHMSIIAKQFDVLTFSGSLPKGLAAHYYQDLITMARVYGSKVVLD
FT                   CSGAPLKAVLAGKDKPTVIKPNLEELEDLIGQPVTLDEERLISLLSQPLFEGIEWIIVS
FT                   LGAQGAFAKHHNRFYRVTIPKIEVVNPVGSGDATVAGIAWALAEGDDDETLLKKANVLG
FT                   MLNAQETRTGHVNMAHFDELFDRIQVEEV"
FT   misc_feature    507957..508835
FT                   /locus_tag="SEQ_0529"
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase, score 2.1e-58"
FT                   /inference="protein motif:PFAM:PF00294"
FT   misc_feature    508050..508124
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00583"
FT   misc_feature    508686..508727
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00584"
FT   CDS_pept        508879..509148
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lacD"
FT                   /locus_tag="SEQ_0530"
FT                   /note="Probable gene remnant. The CDS appears to be
FT                   truncated at the C-terminus. Similar to the N-terminal
FT                   region of Streptococcus pyogenes serotype M18 tagatose
FT                   1,6-diphosphate aldolase 1 LacD1 UniProt:P63704
FT                   (EMBL:AE010082 (325 aa) fasta scores: E()=2.2e-20, 77.528%
FT                   id in 89 aa;putative tagatose 1,6-diphosphate aldolase
FT                   (fragment)"
FT   CDS_pept        509226..509633
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lacG"
FT                   /locus_tag="SEQ_0531"
FT                   /note="Probable gene remnant. The CDS appears to be
FT                   truncated at the N-terminus. Similar to C-terminus of
FT                   Staphylococcus aureus (strain MSSA476)
FT                   6-phospho-beta-galactosidase LacG UniProt:Q6G7C5
FT                   (EMBL:BX571857 (470 aa) fasta scores: E()=5.7e-41, 80.597%
FT                   id in 134 aa;6-phospho-beta-galactosidase (fragment)"
FT                   /db_xref="PSEUDO:CAW92769.1"
FT   misc_feature    509226..509624
FT                   /gene="lacG"
FT                   /locus_tag="SEQ_0531"
FT                   /note="HMMPfam hit to PF00232, Glycosyl hydrolase family,
FT                   score 3.8e-08"
FT                   /inference="protein motif:PFAM:PF00232"
FT   CDS_pept        509844..510716
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0532"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92771"
FT                   /db_xref="InterPro:IPR025389"
FT                   /db_xref="UniProtKB/TrEMBL:C0M942"
FT                   /protein_id="CAW92771.1"
FT                   /translation="MKKVMMSLLILATATLGACQASHQSDQPKQEQKEPQAKKGRLFLS
FT                   NMNSAKSQQEVRAALSHQLKEANVNAFMAGVQEYNSLVGKTGLTGAFTYQKQPDYDVVA
FT                   IDELWSQKQGNFIGTNCRINTFMLLKDSMTIAPTSSDDTLLFMDEDAITTSQLFTQAET
FT                   ERFKQLFSRVKTEATKDIQVHAKHMQEHFSAVSFNGPAKMLAVVIHDQLDGDYLFIGHV
FT                   GVLVEYKSKYLFVEKLSFQEPYQAILFDQKQDCYQYLYHKYKTYQTKTSAEPFLMENNK
FT                   AVNLASYRS"
FT   sig_peptide     509844..509915
FT                   /locus_tag="SEQ_0532"
FT                   /note="Signal peptide predicted for SEQ0532 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.660 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    509868..509900
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        510877..511491
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0533"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92772"
FT                   /db_xref="GOA:C0M943"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C0M943"
FT                   /protein_id="CAW92772.1"
FT                   /translation="MTIDMWELLSIIGTIAFALSGAIVAMEEEFDVLGIFILGFVTAFG
FT                   GGAIRNTLIGLPIEALWGQRPEFACAFIAIILIMLFPKLVAKGWVRAAVLTDAIGLAAF
FT                   SVQGALHAVRLAQPLSAVIVAAVLTGAGGGVVRDVLAGRKPTVLRSEIYAGWSIIAALV
FT                   LYFKLATSNVECYLLVVLLTVMRMIGNKRQWHLPKIKWKED"
FT   misc_feature    join(510889..510957,510970..511038,511075..511134,
FT                   511144..511212,511231..511299,511357..511425)
FT                   /locus_tag="SEQ_0533"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0533 by TMHMM2.0 at aa 5-27, 32-54, 67-86, 90-112,
FT                   119-141 and 161-183"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    510892..511149
FT                   /locus_tag="SEQ_0533"
FT                   /note="HMMPfam hit to PF03458, UPF0126 domain, score
FT                   1.7e-27"
FT                   /inference="protein motif:PFAM:PF03458"
FT   misc_feature    511153..511410
FT                   /locus_tag="SEQ_0533"
FT                   /note="HMMPfam hit to PF03458, UPF0126 domain, score
FT                   6.5e-33"
FT                   /inference="protein motif:PFAM:PF03458"
FT   CDS_pept        511496..512320
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0534"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92774"
FT                   /db_xref="GOA:C0M944"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0M944"
FT                   /protein_id="CAW92774.1"
FT                   /translation="MIQLIAIDLDGTLLDSKKHIPKENIKAIQAAAQEGIKVVLCTGRP
FT                   QSGTRPYFEQLGLSDKEEYLILNNGCSTYRSPSWELLHYQSLTFSAIEHLYQLSQPFSD
FT                   IYLTLTGERDYLVIDSKVPDMVQADGDLVFTKVKATNLSQLSNSSQIIFQAMYMGEKAA
FT                   LDTFEALVREKLSASFSVVRSQETILEVMPECVTKASALKELTADLKLRPDQVMAIGDA
FT                   ANDLEMLAYAGLGVAMGNADEAIKKVADKVSLSNDQAGVAHAINQFALTKGS"
FT   misc_feature    511496..512305
FT                   /locus_tag="SEQ_0534"
FT                   /note="HMMPfam hit to PF05116, Sucrose-6F-phosphate
FT                   phosphohydrolase, score 0.00061"
FT                   /inference="protein motif:PFAM:PF05116"
FT   misc_feature    511499..512221
FT                   /locus_tag="SEQ_0534"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 9.3e-08"
FT                   /inference="protein motif:PFAM:PF00702"
FT   misc_feature    511508..512290
FT                   /locus_tag="SEQ_0534"
FT                   /note="HMMPfam hit to PF08282, haloacid dehalogenase-like
FT                   hydrolase, score 7.6e-78"
FT                   /inference="protein motif:PFAM:PF08282"
FT   misc_feature    512150..512218
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS_pept        complement(512731..513288)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0535"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92776"
FT                   /db_xref="GOA:C0M945"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:C0M945"
FT                   /protein_id="CAW92776.1"
FT                   /translation="MAGKPISKQSLQNLAHCNQESRRLTREAIEIALLSLLEKKPLGHI
FT                   TISELVARAGVSRNAFYRNYSSKEDILECLLTSVIRRIFRGLKAFDLKTQAYQAWLYLF
FT                   TEAKKEATLLSIIFNHHLQQLLTQMVTKRLRAYQKWQEKKLSHYALLFWSNAIVSVLSN
FT                   WISDDMVVPAEEMAAMGLPLLA"
FT   misc_feature    complement(513064..513204)
FT                   /locus_tag="SEQ_0535"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 3.3e-06"
FT                   /inference="protein motif:PFAM:PF00440"
FT   misc_feature    complement(513091..513156)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1203.000, SD 3.28 at aa 45-66, sequence
FT                   ITISELVARAGVSRNAFYRNYS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        513420..514262
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92778"
FT                   /db_xref="GOA:C0M946"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C0M946"
FT                   /protein_id="CAW92778.1"
FT                   /translation="MTWKIVSDSGCDIRALKSQSNHLRFERVPLTLQIGSDIFRDDDGL
FT                   DIDQMMETMYQSSKPATSSCPSPDAFLQAYRGADNVIAITITGTLSGSHNSARLAQNDL
FT                   LEENPNANIHVIDSLSAGGEMDLIVLELERLINQGLSFDEVVEKITAYQEKTRLVFVLA
FT                   KVDNLVKNGRLNKLIGKVIGLLNIRMVGQASKEGTLELLQKARGQKKAVSAVLEEIQKA
FT                   GYKGGRVFISHAKNPKICEQIAEKIRAIYPEAEIQTSPASGLCSFYAEAEGLLMGYEV"
FT   misc_feature    513624..514256
FT                   /locus_tag="SEQ_0536"
FT                   /note="HMMPfam hit to PF02645, Uncharacterized protein,
FT                   DegV family COG1307, score 3.9e-67"
FT                   /inference="protein motif:PFAM:PF02645"
FT   CDS_pept        complement(514868..515614)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0537"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92779"
FT                   /db_xref="GOA:C0M947"
FT                   /db_xref="InterPro:IPR041909"
FT                   /db_xref="UniProtKB/TrEMBL:C0M947"
FT                   /protein_id="CAW92779.1"
FT                   /translation="MRKPTKETHYLIISLLTIAIAGGAYLIFSSLSPKPATITTQSKGY
FT                   ELLTKAQALVKEAEDNPTKEAIAKAQKAINQLKKTQSKEELQARLTAISLKHNQEDVAI
FT                   KVLKAAEDNPSPELKEAAQKAISKLSDEAKKAALQARLDAIGLSKPSTAQPETATPAAE
FT                   KNIAPAPAAPQIKHTTPSSGGTTPAPNPKPSPKPNPQPSPSPAPENPEPTPSPNPQPNP
FT                   QPETNTPSPQPPATEQSENTAPAGQN"
FT   sig_peptide     complement(515489..515614)
FT                   /locus_tag="SEQ_0537"
FT                   /note="Signal peptide predicted for SEQ0537 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.978) with cleavage site
FT                   probability 0.489 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(515522..515590)
FT                   /locus_tag="SEQ_0537"
FT                   /note="1 probable transmembrane helix predicted for SEQ0537
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        515827..517446
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0538"
FT                   /product="putative Na+/Pi-cotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92781"
FT                   /db_xref="GOA:C0M948"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C0M948"
FT                   /protein_id="CAW92781.1"
FT                   /translation="MRFIFWGAVQGLGLFLFSIKYMGDDLQQAAGDKLRYYIDKYTSNP
FT                   FFGILVGIAMSALIQSSSGVTVITVGLVSAGLLTLQQAIGIVMGANIGTTVTSFLIGFK
FT                   LGDYALPMIFIGAACLFFTSNKKLNNLGRIIFGVGGIFFSLNLMGDAMDPLKSVSAFQH
FT                   YLATLGDKPFQGVFIGTALTMLIQSSAAIIGILQGLFSGGLLTLQGAIPILLGSNIGTC
FT                   ITAVLAAIGSNIAAKRVAAAHILFNVIGTVIFMILLMPFTSFMLWLQSVLALSPEMTIA
FT                   FSHGTFNITNTLLLLPFINTLAKLVTTLIPGEDEIVKYEALYLDRLLITQAPSIALGNA
FT                   HKELVHLASYAIQAFEASYSYIMTAEDKFGEKVRRYEKAVNTIDEELTTYLVDISNEAL
FT                   SPSENEVLAGLLDSSRDLERIGDHSESLATLIEGITAKQIGFSAAARGELTEMYHLTHC
FT                   LTLDAIRAIVDSDKALAQSIVERHRTIEQKERQLRKTHIERLNRGECTAQAGINFIDII
FT                   SHYTRITDHALNLAEKVLSGQL"
FT   misc_feature    join(515836..515889,515947..516006,516019..516087,
FT                   516121..516189,516217..516270,516343..516411,
FT                   516454..516522,516559..516627)
FT                   /locus_tag="SEQ_0538"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SEQ0538 by TMHMM2.0 at aa 4-21, 41-60, 65-87, 99-121,
FT                   131-148, 173-195, 210-232 and 245-267"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    515866..516339
FT                   /locus_tag="SEQ_0538"
FT                   /note="HMMPfam hit to PF02690, Na+/Pi-cotransporter, score
FT                   1.1e-74"
FT                   /inference="protein motif:PFAM:PF02690"
FT   misc_feature    516151..516183
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        517563..518711
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0539"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92783"
FT                   /db_xref="GOA:C0M949"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0M949"
FT                   /protein_id="CAW92783.1"
FT                   /translation="MTSYIKADCFYYPNEVKPAGYLELNNGTFGYWTATVDDQAEVIDY
FT                   TGYQIAPGLVDTHIHGYAGADVMDNSAEGLHAISEGLLSTGVTSFLPTTLTSTFEHLEQ
FT                   VSATVASVADQVKGAKIQGIYFEGPYFTEEYKGAQNPIYMKNPRLDEFAAWQKAAKGLI
FT                   KKIALAPERDGVEAFVSEVTKQGVTVALGHSNGTYTEAKKAVAAGASVWVHAYNGMRGL
FT                   THREPGMVGAVYNIPGTVAELICDGHHVSPVACDILMQQKGHEHVALITDCMRAGGSPD
FT                   GDYMLGEFPVIVENGTARLKDSGNLAGSILKLKDGIKNVVAWGIASPAEAIHMSSYVPA
FT                   ASVGIEDVCGQIKAGHAADFIVLDKDLELVATYLNGQKAFEA"
FT   misc_feature    517707..518654
FT                   /locus_tag="SEQ_0539"
FT                   /note="HMMPfam hit to PF01979, Amidohydrolase family, score
FT                   9e-06"
FT                   /inference="protein motif:PFAM:PF01979"
FT   CDS_pept        518798..519637
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0540"
FT                   /product="aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92785"
FT                   /db_xref="GOA:C0M950"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C0M950"
FT                   /protein_id="CAW92785.1"
FT                   /translation="MIKTVTMANGLAIPVLGFGTFKAADGEEAYQSTLAAIKAGYRHID
FT                   TAAIYHNEKSVGQAIRDSGVPREELFITTKLWNDAHSYDGAKAALAASLERLGLEYVDL
FT                   YLIHWPNPKALRDCWQAANAAAWSYMEEAVEAGLVRSIGVSNFMVHHLEALKQTATITP
FT                   AVNQIRLAPGCYQKETVDYCRRHHILLEAWGPLGQGEIFADDTMQALAKKYNKTVAQLA
FT                   LAWSIAEGFIPLPKSVHKERIVENMAIFDCEISPEDSERIRCLPGMSAIPDPDTKDF"
FT   sig_peptide     518798..518866
FT                   /locus_tag="SEQ_0540"
FT                   /note="Signal peptide predicted for SEQ0540 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.851) with cleavage site
FT                   probability 0.799 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    518816..519598
FT                   /locus_tag="SEQ_0540"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 7.6e-109"
FT                   /inference="protein motif:PFAM:PF00248"
FT   misc_feature    518915..518968
FT                   /note="PS00798 Aldo/keto reductase family signature 1."
FT                   /inference="protein motif:Prosite:PS00798"
FT   misc_feature    519185..519238
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT                   /inference="protein motif:Prosite:PS00062"
FT   misc_feature    519497..519544
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT                   /inference="protein motif:Prosite:PS00063"
FT   CDS_pept        519670..519891
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0541"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Lactobacillus salivarius subsp. salivarius (strain
FT                   ucc118) ABC transporter, ATP-binding protein UniProt:Q1WV92
FT                   (EMBL:CP000233 (661 aa) fasta scores: E()=0.0006, 48.485%
FT                   id in 66 aa;ABC transporter, ATP-binding protein
FT                   (fragment)"
FT                   /db_xref="PSEUDO:CAW92786.1"
FT   CDS_pept        520158..520691
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0542"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   (ICMT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92788"
FT                   /db_xref="GOA:C0M952"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C0M952"
FT                   /protein_id="CAW92788.1"
FT                   /translation="MIILLLMLLMFAIRLVFLKKSIKNEKAILANGGKEFGAQNTKFLT
FT                   LLHIMIYVFAVTEALLKQIKFDGISFLGLLLMIFSIAVLYEVTRILGDIWTVKLMLAKD
FT                   HKYVDHWLFKTVKHPNYFLNIAPELVGIALLCHAQITAMLLFPCYIIVIYLRIREENRL
FT                   LSEVIIPNGTRPKS"
FT   misc_feature    join(520287..520340,520359..520427,520548..520616)
FT                   /locus_tag="SEQ_0542"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0542 by TMHMM2.0 at aa 35-52, 59-81 and 122-144"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    520368..520655
FT                   /locus_tag="SEQ_0542"
FT                   /note="HMMPfam hit to PF04140, Isoprenylcysteine carboxyl
FT                   methyltransferase, score 3.1e-47"
FT                   /inference="protein motif:PFAM:PF04140"
FT   CDS_pept        521057..521968
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0543"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92790"
FT                   /db_xref="GOA:C0M953"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M953"
FT                   /protein_id="CAW92790.1"
FT                   /translation="MSNKLTFQEIILTLQQYWNDQGCMLMQAYDNEKGAGTMSPYTFLR
FT                   AIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLQSLERLG
FT                   IDPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATSPVTAEVTY
FT                   GLERLASYIQEVDSVYDIEWAPGVKYGEIFLQPEYEHSKYSFEVSNQDMLLENFEIFEK
FT                   EAERALAQGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRHLARSVAKTFVA
FT                   ERKKLGFPLLDDASRVALLAED"
FT   misc_feature    521075..521926
FT                   /locus_tag="SEQ_0543"
FT                   /note="HMMPfam hit to PF02091, Glycyl-tRNA synthetase alpha
FT                   subunit, score 2.8e-219"
FT                   /inference="protein motif:PFAM:PF02091"
FT   misc_feature    521540..521569
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS_pept        522334..524373
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0544"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92792"
FT                   /db_xref="GOA:C0M9J7"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9J7"
FT                   /protein_id="CAW92792.1"
FT                   /translation="MTKDLLVELGLEELPAYVVTPSEKQLVERMADFLKANRLSYDAIE
FT                   GFSTPRRLAVRVLGLADQQTDLTEDFKGPSKKIALDADGQFSKAAQGFVRGKGLTVDDI
FT                   EFREVKGEEYVYVTKHEAGKQAKDVLAAVPEVLASLTFPVSMHWANNSFDYIRPVHSLI
FT                   VLLDDEPLELDFLDIHSGRISRGHRFLGEETSITSADSYEADLRSQFVIASAKERQEMI
FT                   IAQIRAIEAEQKVQVDIDEDLLNEVLNLVEYPTAFMGSFDPKYLEIPEEVLVTSMKNHQ
FT                   RYFVVRDQAGKLMPNFISVRNGNAKHLQNVIKGNEKVLVARLEDGEFFWREDQKLSIED
FT                   LVAKLAHVTFHEKIGSVAEHMERTKVIAAFLADQAGLSEAEKSAVARAAQIYKFDLLTG
FT                   MVGEFDELQGIMGEKYALLTGEAAAVATAIREHYLPNSAEGELPETKVGAVLALADKLD
FT                   TLLSFFSVGLIPSGSNDPYALRRATQGIVRILEHFGWSIPMDKLIDSLYELSFDSLTYQ
FT                   HKAEVLDFICARVDKMMGSAIPKDIREAVLASSSFVVPELLARAEALAAASQLDTYKPA
FT                   VESLSRVFNLAKKAVDAVLIDASLFENDYERALAQAVDSLVLSGSAKEQLAQVFALSPV
FT                   IDDFFDHTMVMTEDEAIRRNRLALLAELVKKVETIAAFDRLNTK"
FT   misc_feature    522346..523992
FT                   /locus_tag="SEQ_0544"
FT                   /note="HMMPfam hit to PF02092, Glycyl-tRNA synthetase beta
FT                   subunit, score 5.2e-226"
FT                   /inference="protein motif:PFAM:PF02092"
FT   misc_feature    524059..524322
FT                   /locus_tag="SEQ_0544"
FT                   /note="HMMPfam hit to PF05746, DALR anticodon binding
FT                   domain, score 0.00022"
FT                   /inference="protein motif:PFAM:PF05746"
FT   CDS_pept        524910..525167
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92794"
FT                   /db_xref="GOA:C0M9J8"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0M9J8"
FT                   /protein_id="CAW92794.1"
FT                   /translation="MDPKKIARINELAKKKKTVGLTGPEKVEQAKLREEYIEGYRRSVR
FT                   HHIEGIKIVDEDGNDVTPEKLRQVQREKGLHGRSLDDPES"
FT   misc_feature    524916..525110
FT                   /locus_tag="SEQ_0545"
FT                   /note="HMMPfam hit to PF05979, Bacterial protein of unknown
FT                   function (DUF89, score 2.9e-42"
FT                   /inference="protein motif:PFAM:PF05979"
FT   CDS_pept        525696..525860
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0546"
FT                   /product="Streptolysin S precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92796"
FT                   /db_xref="InterPro:IPR019891"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9J9"
FT                   /protein_id="CAW92796.1"
FT                   /translation="MLQFASNILATSVAETTQVAPGGCCCCCSCCCCVSASWGNTTINN
FT                   NYGAAEPKA"
FT   CDS_pept        526088..527038
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0547"
FT                   /product="Streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92798"
FT                   /db_xref="GOA:C0M9K0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K0"
FT                   /protein_id="CAW92798.1"
FT                   /translation="MPFFSKEKQRSDNQSDLTREEARQLFEFNTNHLSLSTYHHQTVLK
FT                   TSKQLVAQHLMPDETDNLSQRFLMNYKANNNYLGFKTSVAEFFTDSAVTTFSNSDYFED
FT                   RANTIALPKAKKVSAALSTCITNRRSHRQFIDEEMPLQDLADLLYYACGVSSQAIIKEG
FT                   MTKTVALRNCASGGGLYPITLFFYARNVETLKDGFYEYLPYQHALRCHHLSDQEDIRAF
FT                   AEYGPITAENCNVILIYVYQYIKNTRKYGNQATAYAFIEAGEIAQNVQLVSTALVYGSV
FT                   DIGGYNKEYLQEKLGLDGLTQHVIHMTIIGNKESQ"
FT   CDS_pept        527035..528099
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0548"
FT                   /product="Streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92800"
FT                   /db_xref="InterPro:IPR019892"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K1"
FT                   /protein_id="CAW92800.1"
FT                   /translation="MKYQLNSNVRIVQFDDTFCFRKGLWDFNEAVLDIAQEPQALKEAY
FT                   YSIISDWFNGKVIDTDTYEKTLESDLFAKLSEVITALYYNDLLMLEDAYALEENIMKVL
FT                   TGNYHFIAESGQAKDTAPVLFISDSSYVNESAELLAKHLNLNLQVASDELKMLIQETDV
FT                   TSRLDALEHHRNMKCLSEKLADYQSIVICQGRLNIMMLRHLNEISVALKKQLVLGFVDG
FT                   PFIHACTLNPPHSADFDSLERRVLARLQDHTLYQRFASQQLPPTQPVSSSYVPLLNVLM
FT                   NLVVSEAFIIAQTGSSKFEGRLLSVYLPTLEIQVQDILKMSNSQTQGALTKLRYEDQQI
FT                   STREIVKKLLQEES"
FT   CDS_pept        528112..529470
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0549"
FT                   /product="Streptolysin S biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92802"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K2"
FT                   /protein_id="CAW92802.1"
FT                   /translation="MLHYYPSFNHILDKLKGLSGNRTGILNQSQVPICNHPHDVYLKSV
FT                   TGQMPDYHKQFIGELSQVSYHIIGYGSHYEEALIKYLGESIERYATVIAGELLSDRIVY
FT                   ASYKELSQTDPVMPLEYLQVFTQEQIDRCHDLHMIMCDKMVTQDDVLGWVKCPMFFEDK
FT                   EMYVPAQMLCVGYKTNQAVGEKHIIPGFSTGTASHTTLEAAMCNSLIEYIQIDSMMLSW
FT                   HTKKPCPRVIIDDPEILALLEEARLGKDSLYEIIPIDMTVGEDNPLYTFGIILKNKSNE
FT                   GPYLLFGVQAGLDPKHTLLRGIMEASAISYSYYYNLFYNPTSTQNAESDSPLFLDLDSN
FT                   VFYYAHPKDQELKWKAFEPLISGEVRLSDLTNHAGKDKKEDLKTLLAYTKKVSPNAVFL
FT                   DITPPEASEKGWYVTRVLTPELLEMCIPAFPFANHPRMRQFGGVTNAFVHPMP"
FT   misc_feature    528271..529380
FT                   /locus_tag="SEQ_0549"
FT                   /note="HMMPfam hit to PF02624, YcaO-like family, score
FT                   1.2e-07"
FT                   /inference="protein motif:PFAM:PF02624"
FT   CDS_pept        529445..530116
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0550"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92804"
FT                   /db_xref="GOA:C0M9K3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K3"
FT                   /protein_id="CAW92804.1"
FT                   /translation="MPLYTQCLNLCFLMATFCPSIAMQAIFGQGRDSYSFNLIGFLRAV
FT                   LVYYALVLTGIYLLSPPIKAPLGHSDGRLLIIGFILSFVVLFVEVAFLHLSRCWQKKEW
FT                   LPLVLSFVGTTQKWPQIGYPLVLACCEEITYRLIWFNILWLQWRLPIALVLLITSLCYA
FT                   LNHFLMGRSIFYAKILTGLIYGSIYYVSQSLWLVLLVHVGGNLWVEGLSHLQSMHKKVV
FT                   R"
FT   sig_peptide     529445..529528
FT                   /locus_tag="SEQ_0550"
FT                   /note="Signal peptide predicted for SEQ0550 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.830) with cleavage site
FT                   probability 0.483 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(529463..529531,529559..529627,529664..529732,
FT                   529883..529951,529988..530056)
FT                   /locus_tag="SEQ_0550"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SEQ0550 by TMHMM2.0 at aa 7-29, 39-61, 74-96, 147-169 and
FT                   182-204"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    529799..530080
FT                   /locus_tag="SEQ_0550"
FT                   /note="HMMPfam hit to PF02517, CAAX amino terminal protease
FT                   family, score 0.00021"
FT                   /inference="protein motif:PFAM:PF02517"
FT   misc_feature    529799..529831
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        530113..530799
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0551"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92805"
FT                   /db_xref="GOA:C0M9K4"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K4"
FT                   /protein_id="CAW92805.1"
FT                   /translation="MIIILALLSFLILVTLFLTSHKRRRLVRWHLRHIRAMSYQQWLDL
FT                   LLGLIQLGLVLVCLLFSDALALDGLLTFLGRVSFGWEIICYVLLYSIALVELTLLVLVL
FT                   LFDLMLKKDSRLLLGKMTWLAFKPDRAAASFLLLSLVTLVDAFCYLGLCLFLGKDSVAG
FT                   LTLVVLGYALVKACRYSGWLQQLLALCLFSVIGVWCVTAALLYGWLIGSLLLTLTYLLI
FT                   SFKEQR"
FT   misc_feature    join(530122..530175,530236..530304,530362..530430,
FT                   530512..530580,530590..530658,530677..530745)
FT                   /locus_tag="SEQ_0551"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0551 by TMHMM2.0 at aa 4-21, 42-64, 84-106, 134-156,
FT                   160-182 and 189-211"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        530822..531745
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0552"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92807"
FT                   /db_xref="GOA:C0M9K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K5"
FT                   /protein_id="CAW92807.1"
FT                   /translation="MSFVELKDVVKVYRGGKKAIDHVSLTIEEGRIYGLLGPNGAGKST
FT                   LINAILGLIPLNAGEVTVLQQSYKSIRKISSKIGYVPQDIAVYPDLTAYENVELFGSLY
FT                   GLKGSELKEQVLKSLEFVGLKSQASQFPSQFSGGMKRRLNIACALVHSPKLIIFDEPTV
FT                   GIDPQSRNHILESIRLLNEQGATVIYTTHYMEEVEALCDYIYIMDHGQVIEEGSQAELE
FT                   RRYESDFTKQIMVTVAADQAIDLSNKPNWRLMDNELEAVLLIEHEDIGSVVRQLTDAHI
FT                   AFSEIRHKHLNLEEIFLHLTGKKLRD"
FT   misc_feature    530909..531451
FT                   /locus_tag="SEQ_0552"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-66"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    530930..530953
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    531224..531268
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        531754..532881
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0553"
FT                   /product="ABC-2 type transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92809"
FT                   /db_xref="GOA:C0M9K6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K6"
FT                   /protein_id="CAW92809.1"
FT                   /translation="MILFHLIKKESLQIFRDRTALLMMVVFPILMILILSFAFKSSFNT
FT                   AATVPKLTVRYQLEGKETEYQKNFITFLKLLNKELHLEAKETKDIAKAKQKVSEGALTA
FT                   ALEVKSDQNIEVTTNSINQQNADLINMLVNIYVDNAKTYDSIANLYPEAISNIKKRKID
FT                   YIASSSVQTSKGMSSADYYAISMFTMITFYSIMSAMNLVLSDRQQGVASRIYLTGVSNS
FT                   AILLGKLIGGMLATAVQLTILYVFTRFVLRVNWGTNDWQIIGVTASLVYLSVAIGIGLA
FT                   TGIRNQSFLTVASNAVIPVFAFLGGSYIPLSTLNSALINQLSNISPIKWVNDSLFYLIF
FT                   GGQSNPIPVTLMVNLGIGTAFILFALVRMRKQVAA"
FT   sig_peptide     531754..531891
FT                   /locus_tag="SEQ_0553"
FT                   /note="Signal peptide predicted for SEQ0553 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.522 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(531811..531870,532297..532365,532426..532494,
FT                   532537..532605,532618..532686,532786..532854)
FT                   /locus_tag="SEQ_0553"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0553 by TMHMM2.0 at aa 20-39, 182-204, 225-247, 262-284,
FT                   289-311 and 345-367"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    532159..532773
FT                   /locus_tag="SEQ_0553"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 8.8e-07"
FT                   /inference="protein motif:PFAM:PF01061"
FT   CDS_pept        532878..533996
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0554"
FT                   /product="ABC-2 type transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92811"
FT                   /db_xref="GOA:C0M9K7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K7"
FT                   /protein_id="CAW92811.1"
FT                   /translation="MIPFIKALFIKIRRKKTSYITFILLPMLTTMLALSLSFIGGSQAK
FT                   IGILDKDKSQVSKQFVSQLKHNKKYQIYTRLEEKAIDQYLKAKTLEAVLTIEPGFGEKV
FT                   LKGDTQKIALRSIADSQITEWFKAQANYLLENYNIIGDAAAGNQEVFKKISAHNTKLSY
FT                   KVKEITLADRSQSKSVSSTTTGFLLILMLGSTSVLYGGILLDKSSQIYNRLVLSRLSSL
FT                   QYMLSYVCVGIVAFAIQIVIMLGLLRVANVSFYIPTAIVLLTFFLYSLLAIGFGLMIGA
FT                   VSKNAQQSSQLANLIVMPTSMLAGCLWPLSITPPYMQAIGKLLPQHWVLTIISTFQNGG
FT                   NLGEAWPYFLALFVAAMTLMVLASVLMKPLHR"
FT   sig_peptide     532878..533009
FT                   /locus_tag="SEQ_0554"
FT                   /note="Signal peptide predicted for SEQ0554 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.969 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(532935..533003,533421..533489,533550..533618,
FT                   533646..533714,533751..533819,533910..533978)
FT                   /locus_tag="SEQ_0554"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SEQ0554 by TMHMM2.0 at aa 20-42, 182-204, 225-247, 257-279,
FT                   292-314 and 345-367"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    533322..533891
FT                   /locus_tag="SEQ_0554"
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter,
FT                   score 1.2e-13"
FT                   /inference="protein motif:PFAM:PF01061"
FT   misc_feature    533763..533795
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(534129..535364)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0555"
FT                   /product="putative collagen and fibronectin-binding cell
FT                   surface-anchored protein FneE"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92812"
FT                   /db_xref="GOA:C0M9K8"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:C0M9K8"
FT                   /protein_id="CAW92812.1"
FT                   /translation="MRKTMKKMLAASTVCIIMSGSFIGGAARVLAEQYYGYDDGTKDGG
FT                   DWPVFLYVTPTNHPERKTDKEHCVYCFNRLNSSPELWESQFKDPSKLGIKLPIYEKKEG
FT                   DESLLRAKSQKPSDNLTSKLVTVLSNGYPNKTLGNLSEDQSRRLTQLAIWHFTDGYATN
FT                   HFKDGYHLNKDEDSELKKLIETAEKNFQTTAHTYSLNLYVTSSYNYSTGKFYQHLLGST
FT                   LTPKLPNPNPGPKPPGGNNPHHLPGENGQTKYPEGESGEAGAPKKPEPKPEPKPEPMPK
FT                   PEPKPQPEPMPEPKPDPQPKPEPKPQPEPKPEPKPQPVPKPDPEPMPDPEPKPQPEPMP
FT                   EPKPKPEPQPKPAPQPEVKPQKPTKPSNTTSQSSGKGLPRTNEAGSLMTGLGTGLLSLL
FT                   GLGFLTRRKRKD"
FT   misc_feature    complement(join(534153..534212,535272..535340))
FT                   /locus_tag="SEQ_0555"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SEQ0555 by TMHMM2.0 at aa 9-31 and 385-404"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(535014..535268)
FT                   /locus_tag="SEQ_0555"
FT                   /note="HMMPfam hit to PF08341, Fibronectin-binding protein
FT                   signal sequence, score 5.6e-09"
FT                   /inference="protein motif:PFAM:PF08341"
FT   sig_peptide     complement(535272..535364)
FT                   /locus_tag="SEQ_0555"
FT                   /note="Signal peptide predicted for SEQ0555 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.956 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(535678..536973)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0556"
FT                   /note="Probable gene remnant. CDS lacks an N-terminal
FT                   signal sequence, therefore it will not be processed
FT                   correctly. Similar to the C-terminal region of
FT                   Streptococcus equi subsp. equi collagen-like protein G SclG
FT                   UniProt:Q1I0L6 (EMBL:DQ158083 (397 aa) fasta scores:
FT                   E()=4.6e-25, 36.929% id in 241 aa;putative collagen-like
FT                   surface-anchored protein (fragment)"
FT   misc_feature    complement(535702..535761)
FT                   /locus_tag="SEQ_0556"
FT                   /note="1 probable transmembrane helix predicted for SEQ0556
FT                   by TMHMM2.0 at aa 395-414"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(535957..536136)
FT                   /locus_tag="SEQ_0556"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copies), score 1.6e-11"
FT                   /inference="protein motif:PFAM:PF01391"
FT   misc_feature    complement(536137..536316)
FT                   /locus_tag="SEQ_0556"
FT                   /note="HMMPfam hit to PF01391, Collagen triple helix repeat
FT                   (20 copies), score 1.3e-12"
FT                   /inference="protein motif:PFAM:PF01391"
FT   CDS_pept        complement(537102..538187)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0557"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92815"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA14"
FT                   /protein_id="CAW92815.1"
FT                   /translation="MTTRYFYKLLLTMLTLALGGFSLSACHSKISKPYQVAIFDKDHVR
FT                   TFMEKADSLVPVETISRTQHKLFERESFKQAKQGYFAKTREGNDLKVLLTHIDQASLEE
FT                   KVLHADGNDAYTSTTDGDYFYTTAVFADRIDCYKYDRHLKKQAHKSILNQDTINASNQF
FT                   LVIDDALYLLVSAVDIKSQQPKTELWKMDKSFTITDRIDLDESTAYLRMVNVGRTLYIT
FT                   QAADGILETGEPRPGNKVMTYDLDSGQKSYLMLHVNSPRAIYHHAKTNELIIENDQHYN
FT                   PDFAWTIYQLDTGEERTIRFEELAGQETSSPYFMMTSSNYYFLFPKRLYRYDCSNHQMT
FT                   CINLDQYGVTHAHALIAKPTP"
FT   sig_peptide     complement(538092..538187)
FT                   /locus_tag="SEQ_0557"
FT                   /note="Signal peptide predicted for SEQ0557 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.833) with cleavage site
FT                   probability 0.517 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(538110..538142)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        complement(538646..539275)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0558"
FT                   /product="CutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92817"
FT                   /db_xref="GOA:C0MA15"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA15"
FT                   /protein_id="CAW92817.1"
FT                   /translation="MIKEFCAENLTMLNQLTSQSVNRVELCDNLAVGGTTPSYGVIKEA
FT                   CDLLHDKQISVATMIRPRGGDFVYNDLELRAMEADILKAIEAGTDALVIGLLTKDNQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDLIARDQQIASLEQLIDYGFVRILLHGSSDTRSIYEN
FT                   IDHIKQLVKAAQHRIEIMIGGGVTADNCQELSQLTGTAIVHGTKII"
FT   misc_feature    complement(538649..539275)
FT                   /locus_tag="SEQ_0558"
FT                   /note="HMMPfam hit to PF03932, CutC family, score 2.5e-116"
FT                   /inference="protein motif:PFAM:PF03932"
FT   CDS_pept        539486..540040
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0559"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92819"
FT                   /db_xref="GOA:C0MA16"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA16"
FT                   /protein_id="CAW92819.1"
FT                   /translation="MEIRLAFPNELSQIMTVINSAKSALAQSGSSQWQKADGYPAYQDI
FT                   AADVLQGQGYVALLEGQIVAYAAVIDGQEDAYDKIYDGRWQHNHHRYVTFHRVAVLSDR
FT                   TGQGIAQTFLQGLIEGQHGPDFRIDTHEHNQVMRHIIEKLGFVYCGKVPIDGERLAYQK
FT                   IKKSHERAAYQEISEDSRYSY"
FT   misc_feature    539648..539926
FT                   /locus_tag="SEQ_0559"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.4e-05"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS_pept        540497..541009
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0560"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92821"
FT                   /db_xref="GOA:C0MA17"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA17"
FT                   /protein_id="CAW92821.1"
FT                   /translation="MWGGQILPLYECVYQSPLGKISLVATDVALIGAWFEGQRYFQAGI
FT                   KVQPIWQEQHALLKRACLWLDAYFERKPYPMLDCLSPQGTDFQRAVWRELQTIRWGETL
FT                   SYGELAKRLQCRSAQAVGGAIGRNPLSIFIPCHRVLAADGRLIGYAGGLEKKAWLLRHE
FT                   QISVNKE"
FT   misc_feature    540746..541000
FT                   /locus_tag="SEQ_0560"
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransferase, score 2e-39"
FT                   /inference="protein motif:PFAM:PF01035"
FT   misc_feature    540896..540916
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:Prosite:PS00374"
FT   CDS_pept        541013..541366
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0561"
FT                   /product="ArsC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92822"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA18"
FT                   /protein_id="CAW92822.1"
FT                   /translation="MITIYQYPKCSTCQKALAELKTLVSEVDIIDIKANPPKAEQLKQW
FT                   LEHSDYSLKSFFNTSGMRYRELGLKDKVNSLSVEEAAELLATDGMLIKRPILLQDNQVL
FT                   QVGYRTAYKDLGL"
FT   misc_feature    541025..541351
FT                   /locus_tag="SEQ_0561"
FT                   /note="HMMPfam hit to PF03960, ArsC family, score 1.8e-29"
FT                   /inference="protein motif:PFAM:PF03960"
FT   CDS_pept        complement(541442..542269)
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0562"
FT                   /product="exodeoxyribonuclease"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92824"
FT                   /db_xref="GOA:C0MA19"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA19"
FT                   /protein_id="CAW92824.1"
FT                   /translation="MKLISWNIDSLNAALTGESPRALLSRAVLDTLVAQDADIIAIQET
FT                   KLSAKGPTKKHLESLLGYFPNHLNVWRSSVEPARKGYAGTMFLYKKELNPIVTFPDIGA
FT                   PTTMDAEGRIITLEFNDFFVTQVYTPNAGDGLRRLEERQLWDQKYADYLAQLDAQKPVL
FT                   ATGDYNVAHKEIDLANPASNHRSPGFTDEERLGFTNLLNRGFTDTFRFIHGDIPNVYSW
FT                   WAQRSKTSKLNNTGWRIDYWLTSNRLIDKVSRSEMISSGERQDHTPILLEIDL"
FT   misc_feature    complement(541535..541570)
FT                   /note="PS00728 AP endonucleases family 1 signature 3."
FT                   /inference="protein motif:Prosite:PS00728"
FT   misc_feature    complement(542132..542161)
FT                   /note="PS00726 AP endonucleases family 1 signature 1."
FT                   /inference="protein motif:Prosite:PS00726"
FT   CDS_pept        542622..547526
FT                   /transl_table=11
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /product="chemokine protease ScpC"
FT                   /EC_number="3.4.21.96"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92826"
FT                   /db_xref="GOA:C0MA20"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA20"
FT                   /protein_id="CAW92826.1"
FT                   /translation="MEKKERFSLRKYKSGMVSVLIGILFLTGMGSVVAEEQGVSSAHVS
FT                   AGQHQESREVLSVSQASEGAAVNAQDIDSQSSKAEEKTEEAMATGLVSSEMEALTESNQ
FT                   SVKQQEESRELPPVNMDTHRWIKTEGAWNRGYKGQGKVIAVIDTGIDASHHAMRITNPA
FT                   AAKFTSKADIDQRKKAAGIQYGVWLSDKVVFAHNYVENNDKVKEIKDDPFEGLDDLDFD
FT                   VIVQQIDIRRNRPQSIEAPQETVIKLDDTSGGTIIDWQDTDDDSKYESHGMHVTGIAAG
FT                   NGLKAAAAGERFLGIAPEAQVMFMRVFTHDLMGTGDPLFIKAIEDAVALGADVINLSLG
FT                   SANGSQLNGNRALMAAIEKARQAGVSVVVAAGNERAFGSDHADPLVTNPDYGLVGAPSA
FT                   GRTPTSVASINNKVIIERLMTVEGLKDRADLNHGKAIYLESVDFKDIKTSLGFDVPYSF
FT                   VYVKALTKEGYQEREVSGKIVLVQRDPNRKYDDIIAEAKQYGAAGVLIFNNEPGKANRT
FT                   MRLSSKGMVLPSAFISHEFGMAMAALNGNGTGTLTFDAEVSKAISQKGNEMNYFSNWGL
FT                   TSDGYLKPDITAPGGDIYSTFNDDHYGSQSGTSMATPHIAGASLLVKQYLEALQPQLAK
FT                   DKLADLVKNILMSNAQIHINPKTNTTTSPRQQGAGLLNIETAVTSGLYLTGKDNYGSIS
FT                   LGNVTDQISFEVTIHNLSNQAKSLRYQTELLTDQVDTKEGRFALRSRSLKTYQGEQVDV
FT                   PAQGHKTITITLDASNFTEELSKQMPNGYYLEGFVRFVDSKDEHKDNINIPFVGFKGAF
FT                   ENLPVVEASIYELKAQGKTGFYFDSSGLKDEIYVGNHFTGLVTVGTDTNVSMTTIADNG
FT                   LHTLGTFRNKDGKFVLERNAVGYPVLAISPNGDNNQDFAAFKGVFLRKYQGLQARVYKG
FT                   TDTDRKELLWTSPSALQGDKNFNSDIRFAKSTTLLETGFSGKSLTGADLPDGKYHYVVS
FT                   YYPDVVGAKRQEMVFEVIVDRQTPELGTASYNPVTHRFRPSQWLDRGQAGVLRDSVFYL
FT                   ETKDDKPYTITINDGLKYVTVSDNKQFVERLADGSFVLPVDQVALGDFYYMVEDFAGNV
FT                   AIAKLGNHLPEKIGQAELALTLTDINAQHQLSYSDNLNMTAADTGLVTNEAELLIISRN
FT                   RPQSRLAKLGQTAVISPNDDGNKDFVAFKGLPHQVYQDLKVTVFAQEDTAMTSPIWSSQ
FT                   PGASVANVDSTAWYGTRASGARVMSGHYRYVVSYLDANGMPQAEAYAVTVSHQKPVITP
FT                   ASFQADGATEVFRPGPSKGQSPIGIVREEVFYLVKKDGRKFDLTVEDQLIRFKDNKVMI
FT                   AQNADGTYTIPKVEGVAEADYYYLVEDEAGQIAYMSLAALRAVGPDKGVVSVALALDVL
FT                   ENKKEPAFTYLIRDEQGKPIEQLDYFNSSANSLILPFGRYTVELLAYDNHLFELRSDNL
FT                   VSFSLDADTRLASVAFEMTRPIVASVWLLFNQVLPEGSRVSLKAANGQLISLAPSLYVP
FT                   SAYGKTLRQGSYEVLVELPEGYQLIGQGGLEVSHNGVIELTFEVIKAKQPQLEHQAGGL
FT                   THYTGSSITSSALTAQAVKKAQVLPSTGEQAAVNLVLLGLLSLGAAGSCQRQKKY"
FT   sig_peptide     542622..542723
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="Signal peptide predicted for SEQ0563 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.718 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    542622..542702
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="HMMPfam hit to PF04650, YSIRK type signal peptide,
FT                   score 3.6e-07"
FT                   /inference="protein motif:PFAM:PF04650"
FT   misc_feature    542655..542723
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="1 probable transmembrane helix predicted for SEQ0563
FT                   by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    542982..544631
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="HMMPfam hit to PF00082, Subtilase family, score
FT                   6.3e-41"
FT                   /inference="protein motif:PFAM:PF00082"
FT   misc_feature    543048..543083
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT                   /inference="protein motif:Prosite:PS00136"
FT   misc_feature    543432..543464
FT                   /note="PS00137 Serine proteases, subtilase family,
FT                   histidine active site."
FT                   /inference="protein motif:Prosite:PS00137"
FT   misc_feature    543966..544253
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="HMMPfam hit to PF02225, PA domain, score 4.2e-13"
FT                   /inference="protein motif:PFAM:PF02225"
FT   misc_feature    544440..544472
FT                   /note="PS00138 Serine proteases, subtilase family, serine
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00138"
FT   misc_feature    544698..545060
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="HMMPfam hit to PF06280, Domain of Unknown Function
FT                   (DUF1034), score 6.8e-46"
FT                   /inference="protein motif:PFAM:PF06280"
FT   misc_feature    547404..547520
FT                   /gene="scpC"
FT                   /locus_tag="SEQ_0563"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   8.2e-05"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    547428..547445
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    547473..547505
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS_pept        547701..549380
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0564"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92828"
FT                   /db_xref="GOA:C0MA21"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA21"
FT                   /protein_id="CAW92828.1"
FT                   /translation="MTKKVASLVLIGLDSLILAGFYWIYLPPMNVMSLEFWFFVILALI
FT                   LAMVSLFILSLFGLKKTVTSFFTQKSGRKDVTSGLSLKQLTGGIKWLGLALAVIIAGLS
FT                   LLLAVNTRMFRAKSYAHVIKVKDADFNKDFPDTDLSALALLDRDSAEKIGDTYLGTIDK
FT                   VSQFGISDEYRQITIGKLPYRVSPLEYKSFWKWLTNRKDGIGYYVKVNQTTGKAELVKL
FT                   NQPMKYSHSEFMFRDTMRHLRFQYPMTIFSDPSFEVDDDGNPYYVATTYAPKFGLSSQE
FT                   PTGVILLDAVSGKSQYYELKDVPKWVDRVYSADNVLERVNDYYTYQKGYWNTVFSQTDV
FT                   KQTTDSYNYITIGSDIYLYTGITSATADSSNLGFILVNMRTREVTNYKLPSATEASAMK
FT                   SAEGEVQEKKYTATAPTLVKLNDKAYYLISLKDGAGLIKSYALVDAEDYQQVTVNNDIQ
FT                   TLISQFTDKDTSSLSVSDTNDQKVKMITGQVEQLASQIISGTTVYYISSKGQIYKIKAS
FT                   SETSDRLPFLKVGDQFKAQLADDNYLNHMTIESSSADQAITE"
FT   misc_feature    join(547713..547781,547809..547877,547959..548027)
FT                   /locus_tag="SEQ_0564"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SEQ0564 by TMHMM2.0 at aa 5-27, 37-59 and 87-109"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        join(549915..550460,550460..550936)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0566"
FT                   /note="CDS contains a frameshift around codon 182. Similar
FT                   to Streptococcus equi M-like protein precursor emmszw60
FT                   UniProt:Q54071 (EMBL:U04620 (376 aa) fasta scores:
FT                   E()=3.4e-14, 34.615% id in 390 aa;SzPSe-like cell
FT                   surface-anchored protein (pseudogene)"
FT                   /db_xref="PSEUDO:CAW92830.1"
FT   sig_peptide     549915..550013
FT                   /pseudo
FT                   /locus_tag="SEQ_0566"
FT                   /note="Signal peptide predicted for SEQ0566 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.889 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    549951..550019
FT                   /locus_tag="SEQ_0566"
FT                   /note="1 probable transmembrane helix predicted for SEQ0566
FT                   by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    550805..550924
FT                   /locus_tag="SEQ_0567"
FT                   /note="HMMPfam hit to PF00746, Gram positive anchor, score
FT                   1.6e-11"
FT                   /inference="protein motif:PFAM:PF00746"
FT   misc_feature    550829..550846
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    550847..550915
FT                   /locus_tag="SEQ_0567"
FT                   /note="1 probable transmembrane helix predicted for SEQ0567
FT                   by TMHMM2.0 at aa 112-134"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        551322..552020
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0568"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92832"
FT                   /db_xref="GOA:C0MA23"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:C0MA23"
FT                   /protein_id="CAW92832.1"
FT                   /translation="MSKRKRKTYQVYEGLRCAMMLCFISGYVNAFTYMTQGRRFAGVQT
FT                   GNLLSFAIRLSERQFDQALQFLLPIIVFMIGQAFTYFMHCWANKHGLHWYLLSSFILTL
FT                   IALVTAILTPLLSSFFTVSALAFFASIQVDTFKTLRGASYANVMMTGNIKNAAYLLTKG
FT                   LYENNKELVHIGRNTLIIILSFALGVVCSTLLSLSYGEYALSPMLIPLCYVNYLLAQEF
FT                   YHHQVSLKND"
FT   sig_peptide     551322..551411
FT                   /locus_tag="SEQ_0568"
FT                   /note="Signal peptide predicted for SEQ0568 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.645) with cleavage site
FT                   probability 0.515 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(551355..551423,551514..551582,551601..551669,
FT                   551853..551921)
FT                   /locus_tag="SEQ_0568"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SEQ0568 by TMHMM2.0 at aa 12-34, 65-87, 94-116 and 178-200"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    551364..551978
FT                   /locus_tag="SEQ_0568"
FT                   /note="HMMPfam hit to PF06912, Protein of unknown function
FT                   (DUF1275), score 9e-76"
FT                   /inference="protein motif:PFAM:PF06912"
FT   CDS_pept        552238..554241
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0569"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92834"
FT                   /db_xref="GOA:C0MAI9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAI9"
FT                   /protein_id="CAW92834.1"
FT                   /translation="MTKKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMLGYDV
FT                   FYLTGLDEHGQKIQDKAQEAGLSPQAYVDGMAEEVKALWKLLDISYDKFIRTTGDYHEE
FT                   VVAAVFERLLAQDDIYLGTYSGWYSVSDEEFFTESQLAEVYRDEAGKVIGGVAPSGHEV
FT                   EWVSEESYFLRLSKYADRLVAFFKAQPDFIQPDGRMNEMLKNFIEPGLEDLAVSRTTFT
FT                   WGVPVPSNPKHVVYVWIDALLNYATALGYGQKDHANFDKFWSGRVFHMVGKDILRFHSI
FT                   YWPILLMMLDLPMPERLIAHGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRS
FT                   LPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGRVPAYVRNVTAFDADL
FT                   EQVVADHISEYHKQMEAVDYPRALEAVWTIISRTNKYIDETAPWVLAKAADSKEQLASV
FT                   MAHLAASLRVVAHLIQPFMMTTSAAIMEQLGLGAKYHLEELDLADLPTGVTVVAKGEPI
FT                   FPRLDMEAEIDYIKEQMTMSIAKPQEADWDPEKVALKSEKDTITFEAFDAVEIRVAEVK
FT                   EVSRVEGSEKLLRFRLDAGDGSDRQILSGIAAYYPNEQELVGKKVQIVANLKPRKMMKK
FT                   YISQGMLLSAEHDGKLTVLTVDPAVPNGTIIG"
FT   misc_feature    552298..552330
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    553945..554232
FT                   /locus_tag="SEQ_0569"
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain, score 2.8e-30"
FT                   /inference="protein motif:PFAM:PF01588"
FT   CDS_pept        554922..555935
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0570"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92836"
FT                   /db_xref="GOA:C0MAJ0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAJ0"
FT                   /protein_id="CAW92836.1"
FT                   /translation="MTQYYYDRSQSPIDYALSQTKKSLRSVNWNQLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLNSWRSLGEDWQRLITRTYTGLTLLDTVQATVGDVAQIQHSLTDH
FT                   EQVIYTNFAFMVAIHARSYGTIFSTLCSSQQIEEAHDWVVSTESLQERARVLIPYYTGD
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMPNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVAALSPEKQAEMKAFVFDLLYQLIDLEKAYLRELYDGFDLADDAIRFSVYNAGKFLQ
FT                   NLGYDSPFTEEETRISPEVFAQLSARADENHDFFSGNGSSYVMGVTEETIDDDWEF"
FT   misc_feature    554982..555818
FT                   /locus_tag="SEQ_0570"
FT                   /note="HMMPfam hit to PF00268, Ribonucleotide reductase,
FT                   small chain, score 3e-38"
FT                   /inference="protein motif:PFAM:PF00268"
FT   misc_feature    555429..555497
FT                   /locus_tag="SEQ_0570"
FT                   /note="1 probable transmembrane helix predicted for SEQ0570
FT                   by TMHMM2.0 at aa 170-192"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS_pept        555937..556344
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0571"
FT                   /product="putative ribonucleotide reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92838"
FT                   /db_xref="GOA:C0MAJ1"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAJ1"
FT                   /protein_id="CAW92838.1"
FT                   /translation="MAARVMLVYFSSRSNNTHRFVQKLDVRALRIPVTGEPLLVDEDYI
FT                   LIVPTYAAGGSDSKGAVPKQVIHFLNKANNRRHCKGVISSGNTNFGDTFAIAGPIIAQK
FT                   LQVPLLHQFELLGTQRDVIKVQAILAGDEAL"
FT   misc_feature    555958..556317
FT                   /locus_tag="SEQ_0571"
FT                   /note="HMMPfam hit to PF07972, NrdI Flavodoxin like, score
FT                   3e-73"
FT                   /inference="protein motif:PFAM:PF07972"
FT   CDS_pept        556391..558565
FT                   /transl_table=11
FT                   /locus_tag="SEQ_0572"
FT                   /product="ribonucleoside-diphosphate reductase alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SEQ_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAW92839"
FT                   /db_xref="GOA:C0MAJ2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C0MAJ2"
FT                   /protein_id="CAW92839.1"
FT                   /translation="MSQKESYLSLNALTRFKRADGTYHFDSDKEAVQRYLEEHVYPQSL
FT                   SFDSLEEKWRYLVAHDYYDQEILKAYSAECITEAFTYAYQQKFSFLSLMGAMKFYQSYA
FT                   LKTLDGSQYLEHFEDRAVMNALFLANGDPDLVRDLIDQILSGRFQPATPTFLNAGKKRR
FT                   GEYISCYLLRIEDNMESISRAIGTSLQLSKRGGGVALCLTNLREVGSPIKGIENQATGI
FT                   VPVMKLLEDSFSYANQLGQRQGAGAVYLNVHHPEILTFLDTKRENADEKIRIKSLALGV
FT                   VIPDITFQLARENKDMALFSPYDIKRVYGKDMSDIAITEEYDRLVANPAIKKTYISARK
FT                   LFQLIAELHFESGYPYLLFDDTVNKRNPHPQKGRIVMSNLCSEIAQVSTASTFEEDLTF
FT                   KQIGEDICCNLGSINIAEAMKHAVGFEQLIATSVRALDHVSRASDVSCAPSVEKGNAAN
FT                   HAVGLGAMNLHGFLATNHIFYDSAEAVDFTDLFFHTMAYYAFKASSQLAKEKGAFAGFE
FT                   QSTYADGSYFARYLTKEAKPKTAKVAALLERYGLRVPSVADWQELVATIQETGLANAHL
FT                   MAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGHLGRIYVPAYQISDDNYAYYERGAYEV
FT                   GPEPIINIVAAAQKHVDQAISLTLFMTDQATTRDLNRAYIHAFKLKCASIYYVRVRQDV
FT                   LEGSEQYEEDTIVALTDTNASGEACQSCML"
FT   misc_feature    556409..556654
FT                   /locus_tag="SEQ_0572"
FT                   /note="HMMPfam hit to PF08343, Ribonucleotide reductase
FT                   N-terminal, score 5.4e-35"
FT                   /inference="protein motif:PFAM:PF08343"
FT   misc_feature    556655..556879
FT                   /locus_tag="SEQ_0572"
FT                   /note="HMMP