(data stored in ACNUC7421 zone)

EMBL: FM209186

ID   FM209186; SV 1; circular; genomic DNA; STD; PRO; 6601757 BP.
XX
AC   FM209186;
XX
PR   Project:PRJEA31101;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Pseudomonas aeruginosa LESB58 complete genome sequence
XX
KW   complete genome.
XX
OS   Pseudomonas aeruginosa LESB58
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-6601757
RA   Thomson N.R.;
RT   ;
RL   Submitted (02-SEP-2008) to the INSDC.
RL   Thomson N.R., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1101/gr.086082.108 .
RX   PUBMED; 19047519.
RA   Winstanley C., Langille M.G., Fothergill J.L., Kukavica-Ibrulj I.,
RA   Paradis-Bleau C., Sanschagrin F., Thomson N.R., Winsor G.L., Quail M.A.,
RA   Lennard N., Bignell A., Clarke L., Seeger K., Saunders D., Harris D.,
RA   Parkhill J., Hancock R.E., Brinkman F.S., Levesque R.C.;
RT   "Newly introduced genomic prophage islands are critical determinants of in
RT   vivo competitiveness in the Liverpool Epidemic Strain of Pseudomonas
RT   aeruginosa";
RL   Genome Res. 18:0(2008).
XX
DR   MD5; 18fcf5e09eb4f58c30a58ed5e7c5dfb5.
DR   BioSample; SAMEA1705916.
DR   EnsemblGenomes-Gn; EBG00001116590.
DR   EnsemblGenomes-Gn; EBG00001116603.
DR   EnsemblGenomes-Gn; EBG00001116605.
DR   EnsemblGenomes-Gn; EBG00001116607.
DR   EnsemblGenomes-Gn; EBG00001116610.
DR   EnsemblGenomes-Gn; EBG00001116613.
DR   EnsemblGenomes-Gn; EBG00001116615.
DR   EnsemblGenomes-Gn; EBG00001116617.
DR   EnsemblGenomes-Gn; EBG00001116619.
DR   EnsemblGenomes-Gn; EBG00001116621.
DR   EnsemblGenomes-Gn; EBG00001116623.
DR   EnsemblGenomes-Gn; EBG00001116625.
DR   EnsemblGenomes-Gn; EBG00001116626.
DR   EnsemblGenomes-Gn; EBG00001116627.
DR   EnsemblGenomes-Gn; EBG00001116628.
DR   EnsemblGenomes-Gn; EBG00001116629.
DR   EnsemblGenomes-Gn; EBG00001116630.
DR   EnsemblGenomes-Gn; EBG00001116631.
DR   EnsemblGenomes-Gn; EBG00001116632.
DR   EnsemblGenomes-Gn; EBG00001116633.
DR   EnsemblGenomes-Gn; EBG00001116634.
DR   EnsemblGenomes-Gn; EBG00001116635.
DR   EnsemblGenomes-Gn; EBG00001116636.
DR   EnsemblGenomes-Gn; EBG00001116637.
DR   EnsemblGenomes-Gn; EBG00001116638.
DR   EnsemblGenomes-Gn; EBG00001116639.
DR   EnsemblGenomes-Gn; EBG00001116640.
DR   EnsemblGenomes-Gn; EBG00001116641.
DR   EnsemblGenomes-Gn; EBG00001116642.
DR   EnsemblGenomes-Gn; EBG00001116643.
DR   EnsemblGenomes-Gn; EBG00001116644.
DR   EnsemblGenomes-Gn; EBG00001116645.
DR   EnsemblGenomes-Gn; EBG00001116646.
DR   EnsemblGenomes-Gn; EBG00001116647.
DR   EnsemblGenomes-Gn; EBG00001116648.
DR   EnsemblGenomes-Gn; EBG00001116649.
DR   EnsemblGenomes-Gn; EBG00001116650.
DR   EnsemblGenomes-Gn; EBG00001116651.
DR   EnsemblGenomes-Gn; EBG00001116652.
DR   EnsemblGenomes-Gn; EBG00001116653.
DR   EnsemblGenomes-Gn; EBG00001116654.
DR   EnsemblGenomes-Gn; EBG00001116655.
DR   EnsemblGenomes-Gn; EBG00001116656.
DR   EnsemblGenomes-Gn; EBG00001116657.
DR   EnsemblGenomes-Gn; EBG00001116658.
DR   EnsemblGenomes-Gn; EBG00001116659.
DR   EnsemblGenomes-Gn; EBG00001116660.
DR   EnsemblGenomes-Gn; EBG00001116661.
DR   EnsemblGenomes-Gn; EBG00001116662.
DR   EnsemblGenomes-Gn; EBG00001116663.
DR   EnsemblGenomes-Gn; EBG00001116664.
DR   EnsemblGenomes-Gn; EBG00001116665.
DR   EnsemblGenomes-Gn; EBG00001116666.
DR   EnsemblGenomes-Gn; EBG00001116667.
DR   EnsemblGenomes-Gn; EBG00001116668.
DR   EnsemblGenomes-Gn; EBG00001116669.
DR   EnsemblGenomes-Gn; EBG00001116670.
DR   EnsemblGenomes-Gn; EBG00001116671.
DR   EnsemblGenomes-Gn; EBG00001116672.
DR   EnsemblGenomes-Gn; EBG00001116673.
DR   EnsemblGenomes-Gn; EBG00001116674.
DR   EnsemblGenomes-Gn; EBG00001116675.
DR   EnsemblGenomes-Gn; EBG00001116676.
DR   EnsemblGenomes-Gn; EBG00001116677.
DR   EnsemblGenomes-Gn; EBG00001116678.
DR   EnsemblGenomes-Gn; EBG00001116679.
DR   EnsemblGenomes-Gn; EBG00001116680.
DR   EnsemblGenomes-Gn; EBG00001116681.
DR   EnsemblGenomes-Gn; EBG00001116682.
DR   EnsemblGenomes-Gn; EBG00001116683.
DR   EnsemblGenomes-Gn; EBG00001116684.
DR   EnsemblGenomes-Gn; EBG00001116685.
DR   EnsemblGenomes-Gn; EBG00001116686.
DR   EnsemblGenomes-Gn; EBG00001116687.
DR   EnsemblGenomes-Gn; EBG00001116688.
DR   EnsemblGenomes-Gn; EBG00001116689.
DR   EnsemblGenomes-Gn; EBG00001116690.
DR   EnsemblGenomes-Gn; EBG00001116691.
DR   EnsemblGenomes-Gn; EBG00001116692.
DR   EnsemblGenomes-Gn; EBG00001116693.
DR   EnsemblGenomes-Gn; EBG00001116694.
DR   EnsemblGenomes-Gn; EBG00001116695.
DR   EnsemblGenomes-Gn; EBG00001116696.
DR   EnsemblGenomes-Gn; EBG00001116697.
DR   EnsemblGenomes-Gn; EBG00001116698.
DR   EnsemblGenomes-Gn; EBG00001116699.
DR   EnsemblGenomes-Gn; EBG00001116700.
DR   EnsemblGenomes-Gn; EBG00001116701.
DR   EnsemblGenomes-Gn; EBG00001116702.
DR   EnsemblGenomes-Gn; EBG00001116703.
DR   EnsemblGenomes-Gn; EBG00001116704.
DR   EnsemblGenomes-Gn; EBG00001116705.
DR   EnsemblGenomes-Gn; EBG00001116706.
DR   EnsemblGenomes-Gn; EBG00001116707.
DR   EnsemblGenomes-Gn; EBG00001116708.
DR   EnsemblGenomes-Gn; EBG00001116709.
DR   EnsemblGenomes-Gn; EBG00001116710.
DR   EnsemblGenomes-Gn; EBG00001116711.
DR   EnsemblGenomes-Gn; EBG00001116712.
DR   EnsemblGenomes-Gn; EBG00001116713.
DR   EnsemblGenomes-Gn; EBG00001116714.
DR   EnsemblGenomes-Gn; EBG00001116715.
DR   EnsemblGenomes-Gn; EBG00001116716.
DR   EnsemblGenomes-Gn; EBG00001116717.
DR   EnsemblGenomes-Gn; EBG00001116718.
DR   EnsemblGenomes-Gn; EBG00001116719.
DR   EnsemblGenomes-Gn; EBG00001116720.
DR   EnsemblGenomes-Gn; EBG00001116721.
DR   EnsemblGenomes-Gn; EBG00001116722.
DR   EnsemblGenomes-Gn; EBG00001116723.
DR   EnsemblGenomes-Gn; EBG00001116724.
DR   EnsemblGenomes-Gn; EBG00001116725.
DR   EnsemblGenomes-Gn; EBG00001116726.
DR   EnsemblGenomes-Gn; EBG00001116727.
DR   EnsemblGenomes-Gn; EBG00001116728.
DR   EnsemblGenomes-Gn; EBG00001116729.
DR   EnsemblGenomes-Gn; EBG00001116730.
DR   EnsemblGenomes-Gn; EBG00001116731.
DR   EnsemblGenomes-Gn; EBG00001116732.
DR   EnsemblGenomes-Gn; EBG00001116733.
DR   EnsemblGenomes-Gn; EBG00001116734.
DR   EnsemblGenomes-Gn; EBG00001116735.
DR   EnsemblGenomes-Gn; EBG00001116736.
DR   EnsemblGenomes-Gn; EBG00001116737.
DR   EnsemblGenomes-Gn; EBG00001116738.
DR   EnsemblGenomes-Gn; EBG00001116739.
DR   EnsemblGenomes-Gn; EBG00001116740.
DR   EnsemblGenomes-Gn; EBG00001116741.
DR   EnsemblGenomes-Gn; EBG00001116742.
DR   EnsemblGenomes-Gn; EBG00001116743.
DR   EnsemblGenomes-Gn; EBG00001116744.
DR   EnsemblGenomes-Gn; EBG00001116745.
DR   EnsemblGenomes-Gn; EBG00001116746.
DR   EnsemblGenomes-Gn; EBG00001116747.
DR   EnsemblGenomes-Gn; EBG00001116748.
DR   EnsemblGenomes-Gn; EBG00001116749.
DR   EnsemblGenomes-Gn; EBG00001116750.
DR   EnsemblGenomes-Gn; EBG00001116751.
DR   EnsemblGenomes-Gn; EBG00001116752.
DR   EnsemblGenomes-Gn; EBG00001116753.
DR   EnsemblGenomes-Gn; EBG00001116754.
DR   EnsemblGenomes-Gn; EBG00001116755.
DR   EnsemblGenomes-Gn; EBG00001116756.
DR   EnsemblGenomes-Gn; EBG00001116757.
DR   EnsemblGenomes-Gn; EBG00001116758.
DR   EnsemblGenomes-Gn; EBG00001116759.
DR   EnsemblGenomes-Gn; EBG00001116760.
DR   EnsemblGenomes-Gn; EBG00001116761.
DR   EnsemblGenomes-Gn; EBG00001116762.
DR   EnsemblGenomes-Gn; PLES_00541.
DR   EnsemblGenomes-Gn; PLES_00551.
DR   EnsemblGenomes-Gn; PLES_02592.
DR   EnsemblGenomes-Gn; PLES_05712.
DR   EnsemblGenomes-Gn; PLES_06472.
DR   EnsemblGenomes-Gn; PLES_06473.
DR   EnsemblGenomes-Gn; PLES_06474.
DR   EnsemblGenomes-Gn; PLES_06475.
DR   EnsemblGenomes-Gn; PLES_06476.
DR   EnsemblGenomes-Gn; PLES_06502.
DR   EnsemblGenomes-Gn; PLES_06503.
DR   EnsemblGenomes-Gn; PLES_06504.
DR   EnsemblGenomes-Gn; PLES_06512.
DR   EnsemblGenomes-Gn; PLES_08072.
DR   EnsemblGenomes-Gn; PLES_09011.
DR   EnsemblGenomes-Gn; PLES_09841.
DR   EnsemblGenomes-Gn; PLES_11492.
DR   EnsemblGenomes-Gn; PLES_12781.
DR   EnsemblGenomes-Gn; PLES_12791.
DR   EnsemblGenomes-Gn; PLES_12801.
DR   EnsemblGenomes-Gn; PLES_16922.
DR   EnsemblGenomes-Gn; PLES_18042.
DR   EnsemblGenomes-Gn; PLES_18043.
DR   EnsemblGenomes-Gn; PLES_19192.
DR   EnsemblGenomes-Gn; PLES_19252.
DR   EnsemblGenomes-Gn; PLES_19253.
DR   EnsemblGenomes-Gn; PLES_19254.
DR   EnsemblGenomes-Gn; PLES_19255.
DR   EnsemblGenomes-Gn; PLES_19652.
DR   EnsemblGenomes-Gn; PLES_19653.
DR   EnsemblGenomes-Gn; PLES_19654.
DR   EnsemblGenomes-Gn; PLES_20282.
DR   EnsemblGenomes-Gn; PLES_22112.
DR   EnsemblGenomes-Gn; PLES_22452.
DR   EnsemblGenomes-Gn; PLES_22453.
DR   EnsemblGenomes-Gn; PLES_22454.
DR   EnsemblGenomes-Gn; PLES_22982.
DR   EnsemblGenomes-Gn; PLES_23462.
DR   EnsemblGenomes-Gn; PLES_23691.
DR   EnsemblGenomes-Gn; PLES_23761.
DR   EnsemblGenomes-Gn; PLES_25012.
DR   EnsemblGenomes-Gn; PLES_25292.
DR   EnsemblGenomes-Gn; PLES_25293.
DR   EnsemblGenomes-Gn; PLES_25294.
DR   EnsemblGenomes-Gn; PLES_25821.
DR   EnsemblGenomes-Gn; PLES_26042.
DR   EnsemblGenomes-Gn; PLES_26081.
DR   EnsemblGenomes-Gn; PLES_26091.
DR   EnsemblGenomes-Gn; PLES_26111.
DR   EnsemblGenomes-Gn; PLES_26201.
DR   EnsemblGenomes-Gn; PLES_26331.
DR   EnsemblGenomes-Gn; PLES_26861.
DR   EnsemblGenomes-Gn; PLES_27122.
DR   EnsemblGenomes-Gn; PLES_27232.
DR   EnsemblGenomes-Gn; PLES_28011.
DR   EnsemblGenomes-Gn; PLES_28021.
DR   EnsemblGenomes-Gn; PLES_28041.
DR   EnsemblGenomes-Gn; PLES_29001.
DR   EnsemblGenomes-Gn; PLES_29031.
DR   EnsemblGenomes-Gn; PLES_32971.
DR   EnsemblGenomes-Gn; PLES_32981.
DR   EnsemblGenomes-Gn; PLES_33031.
DR   EnsemblGenomes-Gn; PLES_35222.
DR   EnsemblGenomes-Gn; PLES_35322.
DR   EnsemblGenomes-Gn; PLES_35323.
DR   EnsemblGenomes-Gn; PLES_35324.
DR   EnsemblGenomes-Gn; PLES_35325.
DR   EnsemblGenomes-Gn; PLES_35801.
DR   EnsemblGenomes-Gn; PLES_36981.
DR   EnsemblGenomes-Gn; PLES_36991.
DR   EnsemblGenomes-Gn; PLES_37972.
DR   EnsemblGenomes-Gn; PLES_43112.
DR   EnsemblGenomes-Gn; PLES_43372.
DR   EnsemblGenomes-Gn; PLES_43932.
DR   EnsemblGenomes-Gn; PLES_44102.
DR   EnsemblGenomes-Gn; PLES_44103.
DR   EnsemblGenomes-Gn; PLES_44104.
DR   EnsemblGenomes-Gn; PLES_45951.
DR   EnsemblGenomes-Gn; PLES_46051.
DR   EnsemblGenomes-Gn; PLES_46152.
DR   EnsemblGenomes-Gn; PLES_46602.
DR   EnsemblGenomes-Gn; PLES_46603.
DR   EnsemblGenomes-Gn; PLES_46604.
DR   EnsemblGenomes-Gn; PLES_46605.
DR   EnsemblGenomes-Gn; PLES_46606.
DR   EnsemblGenomes-Gn; PLES_49052.
DR   EnsemblGenomes-Gn; PLES_49242.
DR   EnsemblGenomes-Gn; PLES_49243.
DR   EnsemblGenomes-Gn; PLES_49254.
DR   EnsemblGenomes-Gn; PLES_49642.
DR   EnsemblGenomes-Gn; PLES_50241.
DR   EnsemblGenomes-Gn; PLES_50552.
DR   EnsemblGenomes-Gn; PLES_50592.
DR   EnsemblGenomes-Gn; PLES_50731.
DR   EnsemblGenomes-Gn; PLES_50752.
DR   EnsemblGenomes-Gn; PLES_50753.
DR   EnsemblGenomes-Gn; PLES_50754.
DR   EnsemblGenomes-Gn; PLES_50755.
DR   EnsemblGenomes-Gn; PLES_50756.
DR   EnsemblGenomes-Gn; PLES_51312.
DR   EnsemblGenomes-Gn; PLES_51313.
DR   EnsemblGenomes-Gn; PLES_51711.
DR   EnsemblGenomes-Gn; PLES_51862.
DR   EnsemblGenomes-Gn; PLES_53232.
DR   EnsemblGenomes-Gn; PLES_53233.
DR   EnsemblGenomes-Gn; PLES_55402.
DR   EnsemblGenomes-Gn; PLES_55512.
DR   EnsemblGenomes-Gn; PLES_57642.
DR   EnsemblGenomes-Gn; PLES_57643.
DR   EnsemblGenomes-Gn; PLES_57644.
DR   EnsemblGenomes-Gn; PLES_57645.
DR   EnsemblGenomes-Gn; PLES_57646.
DR   EnsemblGenomes-Gn; PLES_58481.
DR   EnsemblGenomes-Gn; PLES_59621.
DR   EnsemblGenomes-Tr; EBT00001708246.
DR   EnsemblGenomes-Tr; EBT00001708247.
DR   EnsemblGenomes-Tr; EBT00001708248.
DR   EnsemblGenomes-Tr; EBT00001708249.
DR   EnsemblGenomes-Tr; EBT00001708250.
DR   EnsemblGenomes-Tr; EBT00001708251.
DR   EnsemblGenomes-Tr; EBT00001708252.
DR   EnsemblGenomes-Tr; EBT00001708253.
DR   EnsemblGenomes-Tr; EBT00001708254.
DR   EnsemblGenomes-Tr; EBT00001708255.
DR   EnsemblGenomes-Tr; EBT00001708256.
DR   EnsemblGenomes-Tr; EBT00001708257.
DR   EnsemblGenomes-Tr; EBT00001708258.
DR   EnsemblGenomes-Tr; EBT00001708259.
DR   EnsemblGenomes-Tr; EBT00001708260.
DR   EnsemblGenomes-Tr; EBT00001708261.
DR   EnsemblGenomes-Tr; EBT00001708262.
DR   EnsemblGenomes-Tr; EBT00001708263.
DR   EnsemblGenomes-Tr; EBT00001708264.
DR   EnsemblGenomes-Tr; EBT00001708265.
DR   EnsemblGenomes-Tr; EBT00001708266.
DR   EnsemblGenomes-Tr; EBT00001708267.
DR   EnsemblGenomes-Tr; EBT00001708268.
DR   EnsemblGenomes-Tr; EBT00001708269.
DR   EnsemblGenomes-Tr; EBT00001708270.
DR   EnsemblGenomes-Tr; EBT00001708271.
DR   EnsemblGenomes-Tr; EBT00001708272.
DR   EnsemblGenomes-Tr; EBT00001708273.
DR   EnsemblGenomes-Tr; EBT00001708274.
DR   EnsemblGenomes-Tr; EBT00001708275.
DR   EnsemblGenomes-Tr; EBT00001708276.
DR   EnsemblGenomes-Tr; EBT00001708277.
DR   EnsemblGenomes-Tr; EBT00001708278.
DR   EnsemblGenomes-Tr; EBT00001708279.
DR   EnsemblGenomes-Tr; EBT00001708280.
DR   EnsemblGenomes-Tr; EBT00001708281.
DR   EnsemblGenomes-Tr; EBT00001708282.
DR   EnsemblGenomes-Tr; EBT00001708283.
DR   EnsemblGenomes-Tr; EBT00001708284.
DR   EnsemblGenomes-Tr; EBT00001708285.
DR   EnsemblGenomes-Tr; EBT00001708286.
DR   EnsemblGenomes-Tr; EBT00001708287.
DR   EnsemblGenomes-Tr; EBT00001708288.
DR   EnsemblGenomes-Tr; EBT00001708289.
DR   EnsemblGenomes-Tr; EBT00001708290.
DR   EnsemblGenomes-Tr; EBT00001708291.
DR   EnsemblGenomes-Tr; EBT00001708292.
DR   EnsemblGenomes-Tr; EBT00001708293.
DR   EnsemblGenomes-Tr; EBT00001708294.
DR   EnsemblGenomes-Tr; EBT00001708295.
DR   EnsemblGenomes-Tr; EBT00001708296.
DR   EnsemblGenomes-Tr; EBT00001708297.
DR   EnsemblGenomes-Tr; EBT00001708298.
DR   EnsemblGenomes-Tr; EBT00001708299.
DR   EnsemblGenomes-Tr; EBT00001708300.
DR   EnsemblGenomes-Tr; EBT00001708301.
DR   EnsemblGenomes-Tr; EBT00001708302.
DR   EnsemblGenomes-Tr; EBT00001708303.
DR   EnsemblGenomes-Tr; EBT00001708304.
DR   EnsemblGenomes-Tr; EBT00001708305.
DR   EnsemblGenomes-Tr; EBT00001708306.
DR   EnsemblGenomes-Tr; EBT00001708307.
DR   EnsemblGenomes-Tr; EBT00001708308.
DR   EnsemblGenomes-Tr; EBT00001708309.
DR   EnsemblGenomes-Tr; EBT00001708310.
DR   EnsemblGenomes-Tr; EBT00001708311.
DR   EnsemblGenomes-Tr; EBT00001708312.
DR   EnsemblGenomes-Tr; EBT00001708313.
DR   EnsemblGenomes-Tr; EBT00001708314.
DR   EnsemblGenomes-Tr; EBT00001708315.
DR   EnsemblGenomes-Tr; EBT00001708316.
DR   EnsemblGenomes-Tr; EBT00001708317.
DR   EnsemblGenomes-Tr; EBT00001708318.
DR   EnsemblGenomes-Tr; EBT00001708319.
DR   EnsemblGenomes-Tr; EBT00001708320.
DR   EnsemblGenomes-Tr; EBT00001708321.
DR   EnsemblGenomes-Tr; EBT00001708322.
DR   EnsemblGenomes-Tr; EBT00001708323.
DR   EnsemblGenomes-Tr; EBT00001708324.
DR   EnsemblGenomes-Tr; EBT00001708325.
DR   EnsemblGenomes-Tr; EBT00001708326.
DR   EnsemblGenomes-Tr; EBT00001708327.
DR   EnsemblGenomes-Tr; EBT00001708328.
DR   EnsemblGenomes-Tr; EBT00001708329.
DR   EnsemblGenomes-Tr; EBT00001708330.
DR   EnsemblGenomes-Tr; EBT00001708331.
DR   EnsemblGenomes-Tr; EBT00001708332.
DR   EnsemblGenomes-Tr; EBT00001708333.
DR   EnsemblGenomes-Tr; EBT00001708334.
DR   EnsemblGenomes-Tr; EBT00001708335.
DR   EnsemblGenomes-Tr; EBT00001708336.
DR   EnsemblGenomes-Tr; EBT00001708337.
DR   EnsemblGenomes-Tr; EBT00001708338.
DR   EnsemblGenomes-Tr; EBT00001708339.
DR   EnsemblGenomes-Tr; EBT00001708340.
DR   EnsemblGenomes-Tr; EBT00001708341.
DR   EnsemblGenomes-Tr; EBT00001708342.
DR   EnsemblGenomes-Tr; EBT00001708343.
DR   EnsemblGenomes-Tr; EBT00001708344.
DR   EnsemblGenomes-Tr; EBT00001708345.
DR   EnsemblGenomes-Tr; EBT00001708346.
DR   EnsemblGenomes-Tr; EBT00001708347.
DR   EnsemblGenomes-Tr; EBT00001708348.
DR   EnsemblGenomes-Tr; EBT00001708349.
DR   EnsemblGenomes-Tr; EBT00001708350.
DR   EnsemblGenomes-Tr; EBT00001708351.
DR   EnsemblGenomes-Tr; EBT00001708352.
DR   EnsemblGenomes-Tr; EBT00001708353.
DR   EnsemblGenomes-Tr; EBT00001708354.
DR   EnsemblGenomes-Tr; EBT00001708355.
DR   EnsemblGenomes-Tr; EBT00001708356.
DR   EnsemblGenomes-Tr; EBT00001708357.
DR   EnsemblGenomes-Tr; EBT00001708358.
DR   EnsemblGenomes-Tr; EBT00001708359.
DR   EnsemblGenomes-Tr; EBT00001708360.
DR   EnsemblGenomes-Tr; EBT00001708361.
DR   EnsemblGenomes-Tr; EBT00001708362.
DR   EnsemblGenomes-Tr; EBT00001708363.
DR   EnsemblGenomes-Tr; EBT00001708364.
DR   EnsemblGenomes-Tr; EBT00001708365.
DR   EnsemblGenomes-Tr; EBT00001708366.
DR   EnsemblGenomes-Tr; EBT00001708367.
DR   EnsemblGenomes-Tr; EBT00001708368.
DR   EnsemblGenomes-Tr; EBT00001708369.
DR   EnsemblGenomes-Tr; EBT00001708370.
DR   EnsemblGenomes-Tr; EBT00001708371.
DR   EnsemblGenomes-Tr; EBT00001708372.
DR   EnsemblGenomes-Tr; EBT00001708373.
DR   EnsemblGenomes-Tr; EBT00001708374.
DR   EnsemblGenomes-Tr; EBT00001708375.
DR   EnsemblGenomes-Tr; EBT00001708376.
DR   EnsemblGenomes-Tr; EBT00001708377.
DR   EnsemblGenomes-Tr; EBT00001708378.
DR   EnsemblGenomes-Tr; EBT00001708379.
DR   EnsemblGenomes-Tr; EBT00001708380.
DR   EnsemblGenomes-Tr; EBT00001708381.
DR   EnsemblGenomes-Tr; EBT00001708382.
DR   EnsemblGenomes-Tr; EBT00001708383.
DR   EnsemblGenomes-Tr; EBT00001708384.
DR   EnsemblGenomes-Tr; EBT00001708385.
DR   EnsemblGenomes-Tr; EBT00001708386.
DR   EnsemblGenomes-Tr; EBT00001708387.
DR   EnsemblGenomes-Tr; EBT00001708388.
DR   EnsemblGenomes-Tr; EBT00001708389.
DR   EnsemblGenomes-Tr; EBT00001708390.
DR   EnsemblGenomes-Tr; EBT00001708391.
DR   EnsemblGenomes-Tr; EBT00001708392.
DR   EnsemblGenomes-Tr; EBT00001708393.
DR   EnsemblGenomes-Tr; EBT00001708394.
DR   EnsemblGenomes-Tr; PLES_00541.
DR   EnsemblGenomes-Tr; PLES_00551.
DR   EnsemblGenomes-Tr; PLES_02592-1.
DR   EnsemblGenomes-Tr; PLES_05712-1.
DR   EnsemblGenomes-Tr; PLES_06472-1.
DR   EnsemblGenomes-Tr; PLES_06473-1.
DR   EnsemblGenomes-Tr; PLES_06474-1.
DR   EnsemblGenomes-Tr; PLES_06475-1.
DR   EnsemblGenomes-Tr; PLES_06476-1.
DR   EnsemblGenomes-Tr; PLES_06502-1.
DR   EnsemblGenomes-Tr; PLES_06503-1.
DR   EnsemblGenomes-Tr; PLES_06504-1.
DR   EnsemblGenomes-Tr; PLES_06512-1.
DR   EnsemblGenomes-Tr; PLES_08072-1.
DR   EnsemblGenomes-Tr; PLES_09011.
DR   EnsemblGenomes-Tr; PLES_09841.
DR   EnsemblGenomes-Tr; PLES_11492-1.
DR   EnsemblGenomes-Tr; PLES_12781.
DR   EnsemblGenomes-Tr; PLES_12791.
DR   EnsemblGenomes-Tr; PLES_12801.
DR   EnsemblGenomes-Tr; PLES_16922-1.
DR   EnsemblGenomes-Tr; PLES_18042-1.
DR   EnsemblGenomes-Tr; PLES_18043-1.
DR   EnsemblGenomes-Tr; PLES_19192-1.
DR   EnsemblGenomes-Tr; PLES_19252-1.
DR   EnsemblGenomes-Tr; PLES_19253-1.
DR   EnsemblGenomes-Tr; PLES_19254-1.
DR   EnsemblGenomes-Tr; PLES_19255-1.
DR   EnsemblGenomes-Tr; PLES_19652-1.
DR   EnsemblGenomes-Tr; PLES_19653-1.
DR   EnsemblGenomes-Tr; PLES_19654-1.
DR   EnsemblGenomes-Tr; PLES_20282-1.
DR   EnsemblGenomes-Tr; PLES_22112-1.
DR   EnsemblGenomes-Tr; PLES_22452-1.
DR   EnsemblGenomes-Tr; PLES_22453-1.
DR   EnsemblGenomes-Tr; PLES_22454-1.
DR   EnsemblGenomes-Tr; PLES_22982-1.
DR   EnsemblGenomes-Tr; PLES_23462-1.
DR   EnsemblGenomes-Tr; PLES_23691.
DR   EnsemblGenomes-Tr; PLES_23761.
DR   EnsemblGenomes-Tr; PLES_25012-1.
DR   EnsemblGenomes-Tr; PLES_25292-1.
DR   EnsemblGenomes-Tr; PLES_25293-1.
DR   EnsemblGenomes-Tr; PLES_25294-1.
DR   EnsemblGenomes-Tr; PLES_25821.
DR   EnsemblGenomes-Tr; PLES_26042-1.
DR   EnsemblGenomes-Tr; PLES_26081.
DR   EnsemblGenomes-Tr; PLES_26091.
DR   EnsemblGenomes-Tr; PLES_26111.
DR   EnsemblGenomes-Tr; PLES_26201.
DR   EnsemblGenomes-Tr; PLES_26331.
DR   EnsemblGenomes-Tr; PLES_26861.
DR   EnsemblGenomes-Tr; PLES_27122-1.
DR   EnsemblGenomes-Tr; PLES_27232-1.
DR   EnsemblGenomes-Tr; PLES_28011.
DR   EnsemblGenomes-Tr; PLES_28021.
DR   EnsemblGenomes-Tr; PLES_28041.
DR   EnsemblGenomes-Tr; PLES_29001.
DR   EnsemblGenomes-Tr; PLES_29031.
DR   EnsemblGenomes-Tr; PLES_32971.
DR   EnsemblGenomes-Tr; PLES_32981.
DR   EnsemblGenomes-Tr; PLES_33031.
DR   EnsemblGenomes-Tr; PLES_35222-1.
DR   EnsemblGenomes-Tr; PLES_35322-1.
DR   EnsemblGenomes-Tr; PLES_35323-1.
DR   EnsemblGenomes-Tr; PLES_35324-1.
DR   EnsemblGenomes-Tr; PLES_35325-1.
DR   EnsemblGenomes-Tr; PLES_35801.
DR   EnsemblGenomes-Tr; PLES_36981.
DR   EnsemblGenomes-Tr; PLES_36991.
DR   EnsemblGenomes-Tr; PLES_37972-1.
DR   EnsemblGenomes-Tr; PLES_43112-1.
DR   EnsemblGenomes-Tr; PLES_43372-1.
DR   EnsemblGenomes-Tr; PLES_43932-1.
DR   EnsemblGenomes-Tr; PLES_44102-1.
DR   EnsemblGenomes-Tr; PLES_44103-1.
DR   EnsemblGenomes-Tr; PLES_44104-1.
DR   EnsemblGenomes-Tr; PLES_45951.
DR   EnsemblGenomes-Tr; PLES_46051.
DR   EnsemblGenomes-Tr; PLES_46152-1.
DR   EnsemblGenomes-Tr; PLES_46602-1.
DR   EnsemblGenomes-Tr; PLES_46603-1.
DR   EnsemblGenomes-Tr; PLES_46604-1.
DR   EnsemblGenomes-Tr; PLES_46605-1.
DR   EnsemblGenomes-Tr; PLES_46606-1.
DR   EnsemblGenomes-Tr; PLES_49052-1.
DR   EnsemblGenomes-Tr; PLES_49242-1.
DR   EnsemblGenomes-Tr; PLES_49243-1.
DR   EnsemblGenomes-Tr; PLES_49254-1.
DR   EnsemblGenomes-Tr; PLES_49642-1.
DR   EnsemblGenomes-Tr; PLES_50241.
DR   EnsemblGenomes-Tr; PLES_50552-1.
DR   EnsemblGenomes-Tr; PLES_50592-1.
DR   EnsemblGenomes-Tr; PLES_50731.
DR   EnsemblGenomes-Tr; PLES_50752-1.
DR   EnsemblGenomes-Tr; PLES_50753-1.
DR   EnsemblGenomes-Tr; PLES_50754-1.
DR   EnsemblGenomes-Tr; PLES_50755-1.
DR   EnsemblGenomes-Tr; PLES_50756-1.
DR   EnsemblGenomes-Tr; PLES_51312-1.
DR   EnsemblGenomes-Tr; PLES_51313-1.
DR   EnsemblGenomes-Tr; PLES_51711.
DR   EnsemblGenomes-Tr; PLES_51862-1.
DR   EnsemblGenomes-Tr; PLES_53232-1.
DR   EnsemblGenomes-Tr; PLES_53233-1.
DR   EnsemblGenomes-Tr; PLES_55402-1.
DR   EnsemblGenomes-Tr; PLES_55512-1.
DR   EnsemblGenomes-Tr; PLES_57642-1.
DR   EnsemblGenomes-Tr; PLES_57643-1.
DR   EnsemblGenomes-Tr; PLES_57644-1.
DR   EnsemblGenomes-Tr; PLES_57645-1.
DR   EnsemblGenomes-Tr; PLES_57646-1.
DR   EnsemblGenomes-Tr; PLES_58481.
DR   EnsemblGenomes-Tr; PLES_59621.
DR   EuropePMC; PMC2612960; 19047519.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC2976230; 20817796.
DR   EuropePMC; PMC3067716; 21227987.
DR   EuropePMC; PMC3948848; 24614163.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4155085; 25168460.
DR   EuropePMC; PMC4158028; 20580808.
DR   EuropePMC; PMC4378225; 25527250.
DR   EuropePMC; PMC5840502; 29229490.
DR   EuropePMC; PMC5898933; 28446558.
DR   EuropePMC; PMC5910555; 29678129.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01372; CRISPR-DR59.
DR   RFAM; RF01665; P13.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01672; P2.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01677; P35.
DR   RFAM; RF01678; P37.
DR   RFAM; RF01679; P36.
DR   RFAM; RF01680; P5.
DR   RFAM; RF01681; P4.
DR   RFAM; RF01682; P8.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02243; Xoo8.
DR   RFAM; RF02276; Hammerhead_II.
DR   SILVA-LSU; FM209186.
DR   SILVA-SSU; FM209186.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6601757
FT                   /organism="Pseudomonas aeruginosa LESB58"
FT                   /strain="LESB58"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:557722"
FT   CDS_pept        483..2027
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PLES_00001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24728"
FT                   /db_xref="GOA:B7V0N6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0N6"
FT                   /protein_id="CAW24728.1"
FT                   /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQTHVAPPPPVA
FT                   PPPAPVQPVSAAPVVVPREELPPVTTAPSVSSDPYEPEEPSIDPLAAAMPAGAAPAVRT
FT                   ERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLYGGVG
FT                   LGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLI
FT                   DDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVA
FT                   VEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGR
FT                   PITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
FT                   ALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLLRTLTT"
FT   CDS_pept        2056..3159
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PLES_00011"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24729"
FT                   /protein_id="CAW24729.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVN
FT                   GGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRG
FT                   IRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFI
FT                   LSDSNSSALVHEADNDDSAYVVMPMRL"
FT   CDS_pept        3169..4278
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PLES_00021"
FT                   /product="RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24730"
FT                   /db_xref="GOA:B7V0N8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0N8"
FT                   /protein_id="CAW24730.1"
FT                   /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHL
FT                   LGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNAR
FT                   SAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRN
FT                   SWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSY
FT                   YRGWDKDRDLLEVLASSLLRDQQMGHTQAGPQRADLRIRLSGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLK
FT                   DGWRTDTPVSMFHVEHGKVSQTTTIGSEA"
FT   CDS_pept        4275..6695
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PLES_00031"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24731"
FT                   /protein_id="CAW24731.1"
FT                   /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVGETD
FT                   GSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFKYEGG
FT                   LKAFVEYLNTNKTAVNEVFHFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDASLHVNEHAPG
FT                   LSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLANESAMQGWLEKF
FT                   QARLTAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRDFFASNDYRSVSL
FT                   LGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQRYKGLGEMNPEQLW
FT                   ETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDV"
FT   CDS_pept        complement(7007..7780)
FT                   /transl_table=11
FT                   /gene="lptA"
FT                   /locus_tag="PLES_00041"
FT                   /product="lysophosphatidic acid acyltransferase, LptA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24732"
FT                   /protein_id="CAW24732.1"
FT                   /translation="MSTVQAIRTVLFYLLLSASAFVWGTLSFFIAPILPFRARYRFVVQ
FT                   NWCRFAIWLTRVVAGIRYEVRGLENIPEKPCVILSKHQSTWETFFLSGFFEPLSQVLKR
FT                   ELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIPVGQ
FT                   MGKFSRGSTALAVNAGLPVLPIAHNAGQYWPKAGWAKYPGTIQVVIGPAMHAEGEGPRA
FT                   IAELNQRAEAWVSETMAEISPIQQRVSHPEPSVVS"
FT   CDS_pept        complement(7792..8328)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00051"
FT                   /product="putative histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24733"
FT                   /protein_id="CAW24733.1"
FT                   /translation="MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSQAG
FT                   WTVAVATNQSGIARGYYDLAVLEAMHARLRELVAEQGGEVGLIVYCPHGPDDGCDCRKP
FT                   KPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLPEGT
FT                   LIFDDLAAVASALLQ"
FT   CDS_pept        8659..10365
FT                   /transl_table=11
FT                   /locus_tag="PLES_00061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24734"
FT                   /protein_id="CAW24734.1"
FT                   /translation="MKRLKKTLHLSSLSLASLALSSAALAAAPVMLDQGKEWTESHRQD
FT                   FYSRDQGSQVMPLPWLKALRQPDGTPFLADSLARYGYLPNPKAPAEGLPVGFTVAGTGA
FT                   RQMVGMTCSACHTRQIEVKGTAYRIDGGPAIVDFQAFLADLDRAVGPLTSDDAAFDAFA
FT                   KPILGANPPPGARDALLAAVKEWYEPYHTLIERALPKDTWGPARLDAVSMIFNRLTGLD
FT                   IGTAPPYLIPDNIKAADAPVRYPFLWNAARQNKTQWPGFAANGNDLLGLARNVGEVYGV
FT                   FATFHPQKSKFHLLGMDYLKINSANFHGLGKLEDLIKKIGPPKWPWAVDKHLARKGALI
FT                   FARKTDEGGCVECHGIRIKDLVLWDTPLRDVGSDSRQHAILDGQVQTGVMEGARMPFGQ
FT                   PLKATDGAFDVLAVAVAGSILQHFVPILGEKHDAKAAAVKPESVMTDETRQLLTAFQKP
FT                   VRTQADPYPYESRVLQGIWAAAPYLHNGSVPTLEELLKPAAERVESFPVGSAYDVDKVG
FT                   LAAQQTQFGSYVLKTTGCEQRDSGNSRCGHEYGTSLSAEEKRALLEYLKVL"
FT   CDS_pept        complement(10422..12476)
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PLES_00071"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24735"
FT                   /db_xref="GOA:B7V0P3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0P3"
FT                   /protein_id="CAW24735.1"
FT                   /translation="MSAKDFLVELGTEELPPKALNSLGEAFLSGIEKGLKAAGLSYAAA
FT                   RFYAAPRRLAVLVEQLAVQQPDRTVNLDGPPLQAAFDASGNPTQAALGFAKKCGVDLQQ
FT                   IDKSGPKLRFSQTIAGQPAAGLLPGIVEASLNELPIPKRMRWAARREEFVRPTQWLVML
FT                   FGDDVVECEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAERRELIA
FT                   KRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDKKQPLESF
FT                   NERLRNVVFQAQLGTVFEKAQRVSGLAAYIAERIGGNAQNASRAGILSKCDLATEMVGE
FT                   FPEMQGIAGYYYATHGGEAEDVALALNEQYMPRGAGAELPSTLTGAAVAVADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVNAAVEQYGDKVKAAGLAE
FT                   QVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAFRQLPEAEALAA
FT                   ANKRVSNILAKSEDEVPPNVDASLLVEAAEKALGSAVANAESEVAPLAAARDYRAALAR
FT                   LAALREPVDTFFADVMVNVDDAAVRANRYALLAKLRGSFLGVADISLLG"
FT   CDS_pept        complement(12476..13423)
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PLES_00081"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24736"
FT                   /db_xref="GOA:B7V0P4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0P4"
FT                   /protein_id="CAW24736.1"
FT                   /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSL
FT                   KAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLF
FT                   ELFDFYESEANRLIALELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   AVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
FT   CDS_pept        13528..14079
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PLES_00091"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24737"
FT                   /protein_id="CAW24737.1"
FT                   /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGLS
FT                   WITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRAKLNAARQNAQAWLE
FT                   LDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYAFMQ
FT                   ASGMVMDHTQDCDRYAQLVG"
FT   CDS_pept        14223..15110
FT                   /transl_table=11
FT                   /locus_tag="PLES_00101"
FT                   /product="probable 2-OH-lauroyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24738"
FT                   /protein_id="CAW24738.1"
FT                   /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREV
FT                   VRINLSKCFPELSETELEKLVGQSLMDIGRTLTESACAWIWPPEKSLRYIREVEGMEVL
FT                   EEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQLGNR
FT                   VAPSTPEGILSVIKEVKKGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGK
FT                   ARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLEVSVAAMSRELAKYVRAYPSQYMWSM
FT                   KRFKNRPDGEKKWY"
FT   CDS_pept        15195..15461
FT                   /transl_table=11
FT                   /locus_tag="PLES_00111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24739"
FT                   /protein_id="CAW24739.1"
FT                   /translation="MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVKHPDL
FT                   TQLPTGSVVTGQVQDLPIDAPILQMEVVRVDAEGVGLRFLSEA"
FT   CDS_pept        15608..16261
FT                   /transl_table=11
FT                   /locus_tag="PLES_00121"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24740"
FT                   /protein_id="CAW24740.1"
FT                   /translation="MSASSPAAWRGTLAGLIAFHIFIIIASNYLVQLPITLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLLGKGPARLVIARVMIPALIASYVVSVLFQEAAFRGFSALLEF
FT                   NTFVARISLASFLAYVLGQILDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFFVAF
FT                   WRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPQSNA"
FT   CDS_pept        complement(16323..16595)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24741"
FT                   /protein_id="CAW24741.1"
FT                   /translation="MSKQERSVPSYVEYPYEQAILYVHRNASANEMLESVQERLRALLG
FT                   LLHALERIEVRTGQGVPIQRVAHILVTLGGDALTLLTAAHRATTS"
FT   CDS_pept        complement(16887..17204)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00141"
FT                   /product="putative tetratricopeptide repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24742"
FT                   /protein_id="CAW24742.1"
FT                   /translation="MMIEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERAAEHLQRCVE
FT                   QDPKYSAGWKLLGKARQAAGDLAGARQAWEQGLATAATHGDKQAEKEMTVFLRKLDRAR
FT                   T"
FT   CDS_pept        complement(17353..18726)
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PLES_00151"
FT                   /product="potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24743"
FT                   /protein_id="CAW24743.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREPAY
FT                   LTRTGLFDNEAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAYYGG
FT                   PLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIRAVMG
FT                   EMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDSTIVLNG
FT                   SASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSKVIGRSIN
FT                   EIKLPPGTTIGALVRDEEVLIAHGDTRIESGDHVLLFLVDKKYIRDVERLFQAGLTFF"
FT   CDS_pept        complement(18754..20058)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00161"
FT                   /product="putative tRNA and rRNA cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24744"
FT                   /protein_id="CAW24744.1"
FT                   /translation="MNPRLAACQALAAVLAGRASLSGALPPQLDKVAPRDRGLTQELAF
FT                   GAARWQPRLQALAARLLQKPFKAADTDIHALLLIGLYQLLYTRIPPHAAIGETVGCADK
FT                   LKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALKQAWPEQLDALCA
FT                   ANNAHPPMTLRVNRRHGERDAYLAELAEAGIKARACDYSRDGIQLAAPRDVRELPGFAE
FT                   GRVSVQDEAAQLAAELLESAPGQRVLDACCAPGGKTCHLLETQPGLAEVVAVDLEESRL
FT                   VRVRENLQRLGLQASLVAADARATGEWWDGKPFQRILLDAPCSATGVIRRHPDIKLARK
FT                   PEDIAALAHLQGELLDALWPTLEVGGVLLYATCSVMPAENSDSIAAFLARTPGARELDL
FT                   PGPWGMKQPHGRQLLPQVEGHDGFYYAKLIKISAR"
FT   CDS_pept        complement(20055..20999)
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PLES_00171"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24745"
FT                   /db_xref="GOA:B7V0Q3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0Q3"
FT                   /protein_id="CAW24745.1"
FT                   /translation="MSQALRIVFAGTPEFAAEHLKALLDTPHRIVAVYTQPDRPAGRGQ
FT                   KLMPSAVKNLALEHGLPVMQPQSLRNAEAQAELAALRADLMVVVAYGLILPQAVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMQMEAGLDTGPMLLKVSTPISAAD
FT                   TGGSLHDRLAALGPKAVIEAIAGLAAGTLHGEIQDDALATYAHKLNKDEARLDWSRPAV
FT                   ELERQVRAFTPWPVCHTSLADAPLKVLGASLGQGSGAPGTILEASRDGLLVACGEGALR
FT                   LTRLQLPGGKPLAFADLYNSRREQFAAGQVLGQ"
FT   CDS_pept        complement(21054..21560)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PLES_00181"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24746"
FT                   /protein_id="CAW24746.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQ
FT                   HRQQA"
FT   CDS_pept        21699..22724
FT                   /transl_table=11
FT                   /locus_tag="PLES_00191"
FT                   /product="putative lysin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24747"
FT                   /protein_id="CAW24747.1"
FT                   /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISGK
FT                   FLRQPWKWPELWHANPQIQNPHLIYPGDTLSLVYVDGQPRLVLNRGESRGTIKLSPKIR
FT                   STPIAEAIPTIPLDKINSFLLANRIVDDEKTFTSAPYIVAGNAERIVSGTGDRIYARGK
FT                   FADGQPAYGIFRQGKVYIDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQEVRL
FT                   GDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGQRDGLAEGN
FT                   VLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYKKLSYALVLMASRPLSVTDRVQN
FT                   P"
FT   CDS_pept        22859..23947
FT                   /transl_table=11
FT                   /locus_tag="PLES_00201"
FT                   /product="putative Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24748"
FT                   /protein_id="CAW24748.1"
FT                   /translation="MKNHSPAELEARLRLHGLPELGPMRFLRLIEAFGSASSALAAPAG
FT                   AWRTLGVPAEAAAARRSPAVREAAGEALRWLEGPRRQLLMWDDPGYPALLAEVADAPPL
FT                   LYVEGAPETLERPQLAMVGSRRASPAGLGTARSFARSLAQGGFAITSGLALGIDGAAHE
FT                   GALEAGGATVAVLGTGLRRLYPRRHEALARRIVEGGGALVSELPLDSPPLPANFPRRNR
FT                   IISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDGALL
FT                   VESVGHVLEALRGWAQAEPAEAPAQPLPHPLLALLRAAPYTSEGLAAASGMTLPDVLAT
FT                   LSELELDGRVACEAGTWVHRSG"
FT   CDS_pept        23988..24545
FT                   /transl_table=11
FT                   /locus_tag="PLES_00211"
FT                   /product="putative translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24749"
FT                   /protein_id="CAW24749.1"
FT                   /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWVTG
FT                   VHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAILGGA
FT                   LGGRRNPSLIRDLVTGQVIRPA"
FT   CDS_pept        complement(24555..25532)
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="PLES_00221"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24750"
FT                   /protein_id="CAW24750.1"
FT                   /translation="MAKRIQFAAYGGPEVLEYRDYQPAEPGPREVRVRNRAIGLNFIDT
FT                   YYRSGLYPAPGLPSGLGSEGAGEVEAVGSEVTRFKVGDRVAYATGPLGAYSELHVLAEE
FT                   KLVHLPNGIDFEQAAAVMLKGLTTQYLLRQTYELRGGETILFHAAAGGVGLFACQWAKA
FT                   LGVQLIGTVSSPEKARLARQHGAWETIDYSHENVARRVLELTDGKKCPVVYDSVGKDTW
FT                   ETSLDCVAPRGLLVSFGNASGPVTGVNLGILSQKGSLYVTRPTLGSYADTPEKLQAMAD
FT                   ELFGLIERGDIRIEINQRFALAEAARAHTELAARRTTGSTVLLP"
FT   CDS_pept        25723..26640
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PLES_00231"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24751"
FT                   /db_xref="GOA:B7V0Q9"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0Q9"
FT                   /protein_id="CAW24751.1"
FT                   /translation="MTDHIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGGG
FT                   RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVP
FT                   TSHANVRFFCAEKEGEEPVWWFGGGFDLTPYYAHEEDCVHWHRVARDACAPFGADVYPR
FT                   YKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIVQRRK
FT                   HTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKP
FT                   EPGSEEARLTEYFLADRDWLAGQP"
FT   CDS_pept        26698..27522
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PLES_00241"
FT                   /product="shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24752"
FT                   /protein_id="CAW24752.1"
FT                   /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGEALVYDAQLAPLDDFPG
FT                   FARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLIRLADGRLRGDNTDGAG
FT                   LLRDLTANAGVELRGKRVLLLGAGGAVRGVLEPFLGECPAELLIANRTARKAVDLAERF
FT                   ADLGAVHGCGFAEVEGPFDLIVNGTSASLAGDVPPLAQSVIEPGRTVCYDMMYAKEPTA
FT                   FNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATV"
FT   CDS_pept        27633..28619
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="PLES_00251"
FT                   /product="phospholipase C, PlcB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24753"
FT                   /protein_id="CAW24753.1"
FT                   /translation="MKTFARLAAGLCICAIASQANAWSQPTHKNIVKDALAFMNSSYAT
FT                   EEMRQAYRFYVSAAGSEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASGIV
FT                   NYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKREDFDT
FT                   TEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLATYWFEQFRAAPSLQTIGYALHATGDVA
FT                   QPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQTGQVA
FT                   YARPEPFYDTSYETRLRVAKELIPESIALTVTVLTKGANSFDAPTAL"
FT   CDS_pept        28600..29886
FT                   /transl_table=11
FT                   /locus_tag="PLES_00261"
FT                   /product="putative peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24754"
FT                   /protein_id="CAW24754.1"
FT                   /translation="MHRLLSDRARGWRRALCGIVLGLLAWSAHGVPAKAPQDLRIDGEV
FT                   LPGRSIDLLEQALSRVKFNTDPQQLRRGLVENRLLARAVEDQLTAQSRADLDASVEIEA
FT                   GNLLEQVYGRRYREDLGPYLRQPRALSAERLREVLAPRSRGLVENSLLLDETQRREAAG
FT                   VELIGWQFPGQPAQVLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRIRRDYLWYRLA
FT                   RDGFGPAERQGVRTLVRDKLVRHRYLHQIGLYSDFHHESDALRELAGKVSDKDAEAYYR
FT                   RNLERYRNVAQVQAAHIRLADQASADKVYAELRGGLAFDEAVRRYSLADDRDRDPPGDL
FT                   GLIRPQDGRLDLLRKTALIQKADTVSQPMRIDGAFEIVRVRSRKDRQLPLDDRSVRFEV
FT                   NQAVAREQLAAQFETRLRNLLAGARVEGL"
FT   CDS_pept        29883..30485
FT                   /transl_table=11
FT                   /locus_tag="PLES_00271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24755"
FT                   /protein_id="CAW24755.1"
FT                   /translation="MKRWLGVALGCSGLAIALTCAGVLLAPADMAASSSSPSPARTVAA
FT                   LPAVDDRPPPLAPVRSQAAAPAYEAEPPAAELDREQAIQFMQMLRDEGDPRSPPLGGLQ
FT                   PRQGATAQELADPKQYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSAEEI
FT                   DEARAALGQLEMMRDKLQRESPQLLPGDSAPTSPAAP"
FT   CDS_pept        complement(30489..32042)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00281"
FT                   /product="probable sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24756"
FT                   /protein_id="CAW24756.1"
FT                   /translation="MWTRLLPFLAWLPGLHRGMLGREAWVGLNGAILALPQSMAYALIA
FT                   GLPAEYGLYAAMLPVAIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPLGSPQYVQAVL
FT                   LLTFLAGAFQWLLGVLRVGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLLGLAASGEGA
FT                   APGNGWRLLARFAEFDGPSLLVGGFSFALSLLVRRLRPRWPALLLGLLGGATLVWALPG
FT                   TFASVAHVQALSSALPGWSPLVFDSRSILDLLPAAVACGMLGLVTSLSIARALAARQGD
FT                   AFDANQEVRAQGLSNLLGPWLSASLSAGSFTRSGLNLEAGARSPLAGAFSALWVALLAV
FT                   LGARLIEHVPLPAMAAGILLIAWGLIDRPALRALYRSGRAECLVAGLTALATLLLPLQN
FT                   AIYAGVLASLVFYLRRTSTPRVLRQRNDEEEVLRIEGSIFFGACDYLQRLMRQCDRPRL
FT                   VLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQADEGCRLHYEG
FT                   "
FT   CDS_pept        complement(32047..32970)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00291"
FT                   /product="putative glycine betaine/L-proline ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24757"
FT                   /protein_id="CAW24757.1"
FT                   /translation="MNRLPTCLLAATLFLGSASLYAEDPACARVRLADPGWSDIAVTNA
FT                   TAAFLLESLGYQVKIDTLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHDKFVASGQVERL
FT                   GRNLDGTRFTLAVPRYVWDAGVHRFEDLAAQGQRFNRKLYGIGSGAPANQSIQKMIDAN
FT                   QFGLGDWKLVESSEQAMLAELGRAEKRQRWLVFLGWTPHPMNIRHDLRYLEGGEQYFGD
FT                   RGQVYTLARKGYAAQCPNPARLLANLRFDLDMENRLMSDALEGTATPASATRAWLKANP
FT                   QVLEAWLQGVTSRDGGDALAAVRGQP"
FT   CDS_pept        complement(32987..34498)
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="PLES_00301"
FT                   /product="choline sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24758"
FT                   /protein_id="CAW24758.1"
FT                   /translation="MKTSPNILFIMADQMAAPLLPLHDPRSVLRMPHLSRLAERAVVFD
FT                   SAYCNSPLCAPSRFTLVSGRLPTRIGAWDNAADFAADTPTYAHYLRNLGYRTALSGKMH
FT                   FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQLDF
FT                   DEEVVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYSIPASYWNLYRDEDIPLPRQRF
FT                   AQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQIGALLATLEECGLA
FT                   DDTIVVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPARFAPRRIGASVSTVDLLP
FT                   TLVELAGGQVDPRLPLEGRSLLPHLRDGSGHDEVIGEYTAEGTLSPLMMIRRGDYKFIY
FT                   SEQDPCLLYDLRNDPQERENLAASPAHRGTFEAFLDEARRRWDIPAITRAVLDSQRRRR
FT                   LVAAALARGRLASWDHQPWVDASQQYMRNHIDLDDLERRARFPQP"
FT   CDS_pept        34611..35525
FT                   /transl_table=11
FT                   /locus_tag="PLES_00311"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24759"
FT                   /protein_id="CAW24759.1"
FT                   /translation="MGERLMPLSLDLLRVFESAARQLSFTAAAEELGTTQPAVSQQIKR
FT                   LEKELATPLFQRVHRGIVLTDAGQLLLRHVAAGLETIDAGIAALGARQRHEVLQVATDY
FT                   AFAAYWLMPRLPRFHQAHPHLDVSLVTSERGLAGQRGDIDVAILFGDGRSKHGEAHRLF
FT                   REEVFPVCSPRLVEGLQLPLAKAHLARLPMLHLKPAQHARWFDWPALFEALAIDRQPIP
FT                   AVLSFDNYTLLIQAAIAGQGVAIGWRHLVDGLLEQGLLCRPIGESCLSRYGYYAVLPER
FT                   KRRQRLVDGFVDWLQAELQAGGA"
FT   CDS_pept        complement(35892..36257)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00321"
FT                   /product="putative histidine phosphotransfer domain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24760"
FT                   /protein_id="CAW24760.1"
FT                   /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKLRRAQERE
FT                   QTQELNELAHRLAGMASLIHAHAVERACHQLEIACGESSVRKLTDAVDDLVTALGELQC
FT                   ELHDWMTMTAPQGTAKS"
FT   CDS_pept        complement(36265..36888)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00331"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24761"
FT                   /protein_id="CAW24761.1"
FT                   /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARKK
FT                   SPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSKR
FT                   ENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLANGNT
FT                   NKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
FT   CDS_pept        complement(37074..37880)
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PLES_00341"
FT                   /product="tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24762"
FT                   /db_xref="GOA:B7V0S0"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V0S0"
FT                   /protein_id="CAW24762.1"
FT                   /translation="MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALDGGQTLARTLQMVREFRSGESETPLVLMGYFN
FT                   PIHHYGVERFIAEAKEVGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGDQRL
FT                   PTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAA
FT                   VARLADGVVVGSALIDRIAKARDNAQAVKDVLALCGELAEGVRNAR"
FT   CDS_pept        complement(37877..39085)
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PLES_00351"
FT                   /product="tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24763"
FT                   /protein_id="CAW24763.1"
FT                   /translation="MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPA
FT                   FQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLA
FT                   RRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVI
FT                   PVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQL
FT                   AEKEGRLPDSLVACIGGGSNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGV
FT                   PGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALE
FT                   AFHTCCRLEGIIPALESSHALAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQE
FT                   SKA"
FT   CDS_pept        39189..40076
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PLES_00361"
FT                   /product="transcriptional regulator TrpI"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24764"
FT                   /protein_id="CAW24764.1"
FT                   /translation="MSRDLPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVRLLE
FT                   DDLGVALFGKDGRGVKLTDSGVRLRDACGDAFERLRGVCAELRRQTAEAPFVLGVPGSL
FT                   LARWFIPRLDRLNRALPDLRLQLSTSEGEFDPRRPGLDAMLWFAEPPWPADMQVFELAP
FT                   ERMGPVVSPRLAQETGLAQAPAARLLQEPLLHTASRPQAWPAWAASQGLAAEALRYGQG
FT                   FEHLYYLLEAAVAGLGVAIAPEPLVRDDLAAGRLAAPWGFIETDARLALWVPARLHDPR
FT                   AGRLAQWLREQLAG"
FT   CDS_pept        40177..40392
FT                   /transl_table=11
FT                   /locus_tag="PLES_00371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24765"
FT                   /protein_id="CAW24765.1"
FT                   /translation="MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVD
FT                   TRGHIENGAVGHYQVTLKVGFRIANS"
FT   CDS_pept        40576..40803
FT                   /transl_table=11
FT                   /locus_tag="PLES_00381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24766"
FT                   /protein_id="CAW24766.1"
FT                   /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAYT
FT                   LEIVDKGSVTDKKVVGTCDGGTKEIVYQRG"
FT   CDS_pept        41100..42788
FT                   /transl_table=11
FT                   /locus_tag="PLES_00391"
FT                   /product="putative hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24767"
FT                   /protein_id="CAW24767.1"
FT                   /translation="MALHRLAFIFLCLPLMASAAPFTSPGDRDLIRDRQQRLLDEQRKR
FT                   LEELQQLPGKGAPAAADAYGDDERCFEIRRIELEGAGHLGESARRQLLAPYQGRCLGVG
FT                   QLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRIIVVEGRLEGLDSSALASPRELA
FT                   MSFPGRTGELLDLRELEQLVDQLSRLPSRQAQLELVPGSEVGGSRVRLKGERDKPWRVS
FT                   ATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLNLRANRDAVTDRWRHSDSQSLFYSLPW
FT                   GWWTFTYGYSQSDYRTRNEASGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQ
FT                   RTNNYVEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDFGWQQGIGALGAQGRGHPHA
FT                   GDPNARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGF
FT                   KDQTLTGDSGGYWRNQLRWRRAVEWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRM
FT                   SGNAIELDARGRYFAASVGFARSLERPSAIERREHPIYFRVDAFF"
FT   CDS_pept        42901..53511
FT                   /transl_table=11
FT                   /locus_tag="PLES_00401"
FT                   /product="probable hemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24768"
FT                   /protein_id="CAW24768.1"
FT                   /translation="MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQ
FT                   AGNGVPIVNIATPNGAGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKG
FT                   QAAQVILNQVTGGNRSTLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKP
FT                   IMDGQRLERFQVDGGDIVVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDV
FT                   QADSLQATPRAADGSEKPQLAIDSSALGGMYAGAIRLVGTEQGVGVKLAGDMAASGGDI
FT                   RIDASGKLSLAQASSQGDLKIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIA
FT                   LEAAHIDNAGVIEAGVEPDERRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQG
FT                   GSLKGATVRVDGGHLDNRGGKLLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDN
FT                   RGGQVIGLNDLEVGAATLDNGQQGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSL
FT                   DNRGGKLIGDDLLVVASGAIDNRLGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLG
FT                   GLLDNRDEGNLLSQGAQRVTVGQLDNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLS
FT                   ATGGAFDNRDGGSASGKAGVRVEVASLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKG
FT                   DLQATLGSLAQQGGELVSEKTLKVAADTLDNSQSGLIAANGGIAIEARQVDNRAGEISS
FT                   TSKVAVNAREQLDNRGGKVIGDSGLRLTVQRLLNQAKGVLAGRDGLSLDGGELFNGDGG
FT                   RLDSQNSLSVSLGGVLDNQGGALVSEGSLTARAARLDNRGGTFSSAGALALTSQAALDN
FT                   QGGRLLSDAGVTLKGASLDNSRSGVISAKGAVDIRTGVLDNSRNGGIGSNAGITLVAAR
FT                   LDNGQQGRVSAKGLLDANLKGLDQRGGGVLVSETGVTLDLNGGTLVNRDGGLIATPGAL
FT                   LLRQLGAVDNGAGGEISSDRAFTLAAASLDNRGGRLIGADSLTLRIAQALDNSLAGVIS
FT                   GTAGLDIAAARLDNSAKGTLASRAGIDLRVDGALDNHAEGTVSGARLTLASASLDNSGK
FT                   GLLSGDAGLTVVTGALDNAEGGQLISQGVLDVSSADLDNRGGALSGKQSLRLSAANLDN
FT                   RGGLLTSDGELELTAGRVDSADGGEISARGDLRLTVERLVQRQGRLIGERGVSLDLRGG
FT                   DLDNQGGLISARGPLSIERLNVLDNRQGGEISSQQGFELLARRIDNGQQGRIISAGKLR
FT                   LDADALGNAGAGLLSGWQGLTVTGGSLDNSAGGTLSSKDGELAISLGGALENHGQGALV
FT                   SKGAQRIDAASLDNAQGIVSGESDVTLSIVGKLDNGQGGLVSAQRALSFERDDTLLNNA
FT                   GGRINGGSLLLKGASLDNSDGQLISQGRLDAILGGALVNTGAARLASGGDLLLRSASVD
FT                   NRGGKLVSQGLLEITTGSLDNSASGTLASQADMSLRLVGGALRNQQDGLIFSQAGALEV
FT                   QAGSLDNRQGTLQAQGDNRLRIGGALDNQGGRLDSRAGNLDLQSGSLDNGAGGVLNSAK
FT                   GWLKLVTGLFDNSAGVTQAQSLEIRAGQGVRNQQGHLSALGGDNRIVTADFDNQGGGLY
FT                   ASGLLSLDGQRFLNQGAAAGQGGKVGAGRIDFSLAGALANRFGQLESESELHLRAAAID
FT                   NSGGSLRALGRSGSTRLVAGGLNNAYGVLESANQDLDLQLGSLANAGGRILHTGNGTFG
FT                   LDSGQVIRAGGELTSNGLLDIRASEWTNSSVLQAGRLNLDIGTFRQTAEGKLLAVQSFT
FT                   GRGGDWSNDGLLASDGSLRLELSGGYRGNGRATSLGDFALNAASLDLGNAASLAGGANV
FT                   TLGAGNLLVNRGRITAAGDLVASAASLNNYGTLGGGGNLRLNAPALLNERGLLFSGADM
FT                   TLRAGDITNLYGDVYSLGRLDIARDDAGNRAASLRNLSGVIESGKDFSLRASLIENRRA
FT                   VLESKSGLYTAKMEQTACIEGVNAGDCSGKRNAIWTITQRDKTEVTASSAMGQLLAGGD
FT                   FAIDGGTLNNLSSLIGSGGNLTANLEVLDNQGLETGELETIRVLRTARGGDIGGIDQKS
FT                   RNFTNLYWYQSANFDPARASEIPAALNAILSDWSFEYEFPSKGPTPISSGDQSYAAVIQ
FT                   AAGDVTVNASTRIDNGVTRPGYTFVGSGRQVGDSAVGGSGVSVVVPLTSQLPPDLARRQ
FT                   VNPVTLPGFSLPQGDNGLFRLSSRFAEDGNGSAALGAGADRTQGGSGVSVGQQGAGNVA
FT                   GTWQGQGVRVDGLAGAANVQGQGGSTLGGSLPGVARVQGVPGNATPSASHKYLIETNPA
FT                   LTELKQFLNSDYLLSGLGMNPDDSKKRLGDGLYEQRLIRDAVVARTGQRYIDGLSSDEA
FT                   LFRYLMDNAIAYKDKLQLQLGVGLSAEQMAVLTHDIVWLEEVEVNGEKVLAPVVYLAQA
FT                   EGRLAPNGALIQGRDVKLVSGGDLHNVGTLRARNDLSATADNLDNSGLIEAGKRLDLLA
FT                   GDSIRNRQGGVIAGRDVSLTALTGDVINERSVTRYDSALDGRTWERSFADSAARVEAAN
FT                   SLNVQAGRDIANLGGVLQSRGDLSLDAGRDVTVAAIEDRQGQTRWNTSRLQSVTQLGAE
FT                   VSAGRDLNVSAGRDLSAVASALEARRDIALSAGRDVTLAAAANEEHAYSKTRKVTYQED
FT                   KVAQQGTRVDAGGDLAINAGQDLRLIASQASAGDEAYLVAGDKLELLAANDSNYYLYDK
FT                   KKKGDFGRKETRRDEVTDVKAVGSQISSGGDLTLLSGGDQTYQGAKLESGNDLAIVSGG
FT                   AVTFEAVKDLHQESHEKSKGDLAWQSSKGKGQTDETVRQSQIVAQGNLAIKAVEGLKID
FT                   LKHIDQKTVSQTIDAMVQADPQLAWLKEAEQRGDVDWRMVQEVHDSWKYSNSGMGPATQ
FT                   IAVAIAAAAIGGMAAAGALSGAGVGASSFAMGAGVGAAGSLSGTAAVSLINNKGDLGKV
FT                   LKDSFSSDSLKQIAIASLTGGLTAEYFDGILQTKTDPLTGKVTVDLSSLSGVGRFAANQ
FT                   AMQNATSTVLSQALGQGGSLNEALKSALYNSFAAAGFNFVGDIGQEYSLKPGDPSMVTM
FT                   HALMGGLAAQVSGGDFATGAAAAGANEALVAKLDQAFKSLSPENREAMVTMGSQLVGVL
FT                   AAAVRDPDVTGKALESAAWVAKNSTQYNFLNHQDVADLDNALQKCKSQGNCRQVEEEFK
FT                   ARSDENRRRLNGCVAAGNCAEIRAEIDAGSTALNELVARQETANPGGSDSDIAYGFLMG
FT                   RNVVDWTTAGQLHLEQTANLWWNGNPQWQKEVGAYLDQTGFNPFGIGVPAMGGAAGKVS
FT                   AKALMNALKAGELPKGEVAPGKANLPTIGALADAEAGMPYTHPVKPGAKGAVIPKGFSN
FT                   ADDFARFGTDAREGLAKAGYGNVEPILQGSAITGQSFKTGQAFDVGRVSDFDIALAGSE
FT                   LLQRAQSLGIGLRSGGTRTGPLSGRDLQALGLKDLARKLSAQAGREVNFMIYDSAATAA
FT                   SRAPSLVLPK"
FT   CDS_pept        54289..54918
FT                   /transl_table=11
FT                   /locus_tag="PLES_00411"
FT                   /product="conserved hypothetical protein"
FT                   /note="orf00060"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24769"
FT                   /protein_id="CAW24769.1"
FT                   /translation="MVFAEDEDYQRYLSDLRDLKDAFGIKVYAFCLMTNHVHLLLAPGD
FT                   SLSGLAQLMKTLAARTTRYRNRLEGRSGTLWESRYKSSVVQSDAYLLACCRYIELNPVR
FT                   ARMVDDVAAYPWSSYGLRADWLKEPNWLDMDPCFIELGQTAEERYRRYVTFMKEAIPAE
FT                   ELRLIREAVQRGQLTGNQRFVDEIERVAGVRIERRGQGRPRLEQEK"
FT   CDS_pept        55207..55740
FT                   /transl_table=11
FT                   /locus_tag="PLES_00421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24770"
FT                   /protein_id="CAW24770.1"
FT                   /translation="MNSSCQHVLCGLVDFSKKLPDNIVKVKKGMAFFVERSALYSLSIL
FT                   KLLFFVSVNSGAKKIFFCFLVAQKNKFEISSVYEVDLLEVNFTEIENRLCSLYEEHVLV
FT                   GEVGRIVAFSDMVSWVLYEEVLEEIGVLVMLDETKSVYSNFDFGEFVSREFMMEQADLG
FT                   LYRKEYVDKLISNY"
FT   CDS_pept        56359..56754
FT                   /transl_table=11
FT                   /locus_tag="PLES_00431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24771"
FT                   /protein_id="CAW24771.1"
FT                   /translation="MPVLALRLTALAALAISVSGCVMEAYGSRARSDAQSWIGLPIQDV
FT                   IKRFGEPERVTGDAARQKYVWKEYENYSHDYDYTYYEQGHGNTPNSSVLNQKTGTANQS
FT                   GYYTCIYEFFADASGRVVDATARGECR"
FT   CDS_pept        complement(57019..58428)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00441"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24772"
FT                   /protein_id="CAW24772.1"
FT                   /translation="MRLHRGGEPDGYRRQRRALGGRRTAVRAPRGRLLLWCAQARRHPL
FT                   SRRMESSMTLSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLLGG
FT                   FATLLAGELGSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSLALT
FT                   EQRLLAAAGGIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQGYGP
FT                   WAFFNPYLTWWMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLTLARLR
FT                   ERMPDALLACALLATSALMFPRILVEIGAIHPALLKELALPFAATTLVYLGGTLFHALR
FT                   GGRASQEAPDEPGLRNPFELLPAMRFAALLSAILLLVEVGRRLFGDAGIYAVALLSGLA
FT                   DVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLVVLVGGKRLALQTLPFSLA
FT                   GLLVGALLILL"
FT   CDS_pept        58592..59965
FT                   /transl_table=11
FT                   /gene="exoT"
FT                   /locus_tag="PLES_00451"
FT                   /product="exoenzyme T"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24773"
FT                   /protein_id="CAW24773.1"
FT                   /translation="MHIQSSQQNPSFVAELSQAVAGRLGQVEARQVATPREAQQLAQRQ
FT                   EAPKGEGLLSRLGAALARPFVAIIEWLGKLLGSRAHASTQAPLSRQDAPPAASLSAAEI
FT                   KQMMLQKALPLTLGGLGKASELATLTAERLVKDHTRLASGDGALRSLATALVGIRDGSR
FT                   IEASRTQAARLLEQSVGGIALQQWGTAGGAASQHVLSASPEQLREIAVQLHAAMDKVAL
FT                   LRHAVESEVKGEPVDKALADGLVEHFGLEAEQYLGEHPDGPYSDAEVMALGLYTNGEYQ
FT                   HLNRSLRQGRELDAGQALIDRGMSAAFEKSGPAEQVVKTFRGTQGRDAFEAVKEGQVGH
FT                   DAGYLSTSRDPGVARSFAGQGTITTLFGRSGIDVSEISIEGDEQEILYDKGTDMRVLLS
FT                   AKDGQGVTRRVLEEATLGERSGHGEGLLDALDLATGTDRSGKPQEQDLRLRMRGLDLA"
FT   CDS_pept        60461..61147
FT                   /transl_table=11
FT                   /locus_tag="PLES_00461"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24774"
FT                   /protein_id="CAW24774.1"
FT                   /translation="MSHSAKKTLLPLLAVATLAGLAGCATETSTALPVQQVESVNRPYS
FT                   GVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSEIQ
FT                   QEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNIVNI
FT                   STSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAVDSGA
FT                   WKPQNQ"
FT   CDS_pept        61178..61531
FT                   /transl_table=11
FT                   /locus_tag="PLES_00471"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24775"
FT                   /protein_id="CAW24775.1"
FT                   /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGESK
FT                   EAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSIGKDDQMVREFETEKALFPESATY
FT                   MDFLLNNARGGAR"
FT   CDS_pept        61684..62193
FT                   /transl_table=11
FT                   /locus_tag="PLES_00481"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24776"
FT                   /protein_id="CAW24776.1"
FT                   /translation="MKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQ
FT                   VSPAKLREIYGADAALYVTVSDYGTRYMVISSATIVTASAKLVDLRSGTTLWTGSATAS
FT                   SEEGNGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRS
FT                   PRYGSD"
FT   CDS_pept        complement(62208..62591)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00491"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24777"
FT                   /protein_id="CAW24777.1"
FT                   /translation="MSFAQNLLRLRQQNALTQRQMAERLGVTVSQLRHFETKGGHPSLV
FT                   VLQTIAGRFAVPLDWLVCQRSERQALPEDLRLQFEAIGRLRLDERRAIRALLDDLIRQY
FT                   MAKRNAAAKPLPAACTEATETSP"
FT   CDS_pept        complement(62873..64534)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24778"
FT                   /protein_id="CAW24778.1"
FT                   /translation="MRYARHASRYSLFTLAVSAALLPGAGWAANGDLAGARKPPSVACS
FT                   WNREAALSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFAKRLCAADG
FT                   RTPVSSYAKALKLVTEEGRALWRAAVDRAQGRRAIPAGALPASDDRMLYWTRLYMTRTL
FT                   RQWAPSFHLGKAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVFTLGT
FT                   PGTANTGLRNGNPSGATALALDGREFRLADGSLLRIEAYLLPVSYDPFNRGMQEDTLGP
FT                   WFRPGPRRVDASITISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADSALPNYVLPLG
FT                   SVTNPGTAPISLRGSGCNINPPRRWLGYDSASRWRQNLPAQLSKASLPVRQLLAADTWR
FT                   GIERPPGATSQAAEGFDVTWHTNYDFFPDCANPRTENVPTNGVMNAMPDPSLVLPPNRR
FT                   ICARNGGGGDYLSNESAYRNTVLRDAFRLEIPAGHIHVPVMNNYYTGVPASGGGARNDN
FT                   AISDARYEAYRSAIVAQTRALLVGVGNALAQGAQAD"
FT   CDS_pept        66108..67940
FT                   /transl_table=11
FT                   /gene="phzH"
FT                   /locus_tag="PLES_00521"
FT                   /product="potential phenazine-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24779"
FT                   /protein_id="CAW24779.1"
FT                   /translation="MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNAL
FT                   LGHRRLAVIDLSGGVQPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRSDT
FT                   EVVLHAYLQWGERCCEYLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLLFGS
FT                   EIKSILAHPEFAARLDAVGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQAKLRR
FT                   YWEVRRQEHADDLQSTVQRTRELVTRALGAQLHADVPVCSLLSGGLDSTALTGIAQRIA
FT                   KAEHGGDINSFSVDFVGQAEQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIDNAELVC
FT                   ERAREEVFRAKDVPFTFGDMDTSLHLMFGEIRRHSTVAISGEGADELFGGYGWFRDPQA
FT                   VAAARFPWASRVRLPAGFIDAGFNRRCDLLQYQQASYDDGLRQVEHLAGDSPEERRMRE
FT                   FSHLHLKRWMVLLLERKDRLSMCNGLEVRVPYTDHELVEYVYNVPWSIKSRDGEEKWLL
FT                   KRACADYVPEAVLKRRKSPYPTSANLGYERFLRGSVRRLLEDAANPVFGIVSREFLAAE
FT                   LEHPEGYFNTQVSRHNLETALALEGWLRLYGLSA"
FT   CDS_pept        complement(67993..68421)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24780"
FT                   /protein_id="CAW24780.1"
FT                   /translation="MDLRPSHVHVFPPSRDLPAATSPHRETLLRSGCAWNGSLYLGYPL
FT                   GQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGCLM
FT                   NIIHRLIAGAEPVEALLFHAGVEGMPVGLGERGEMPDA"
FT   CDS_pept        complement(68630..68884)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PLES_00541"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="orf00076"
FT                   /db_xref="PSEUDO:CAW24781.1"
FT   CDS_pept        complement(68957..69178)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PLES_00551"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="orf00079"
FT                   /db_xref="PSEUDO:CAW24782.1"
FT   CDS_pept        complement(69217..69723)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24783"
FT                   /protein_id="CAW24783.1"
FT                   /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDAR
FT                   LAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEGIR
FT                   EEQLDGAEERNVTLKVRGQEISFNGRDFLFGFALPNFFFHVTTAYAILRHNGVELGKMD
FT                   FLGGA"
FT   CDS_pept        complement(69789..70709)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00571"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24784"
FT                   /protein_id="CAW24784.1"
FT                   /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWVG
FT                   ARLLHRSTRRLSLTDAGAELLPQCREMLAVADAMQATGQTRRDSPRGTLRITSSLSFAQ
FT                   AWLTRAAAAFVERYPGTAIDLQVNSQVVNLVEERIDLALRIANQLDPNLIARRLGECRS
FT                   VICAAPDYLRRHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLSANES
FT                   TVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQMPPALR
FT                   ALLDFLVERMAADPHWDEAGPLALA"
FT   CDS_pept        70817..71704
FT                   /transl_table=11
FT                   /locus_tag="PLES_00581"
FT                   /product="putative metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24785"
FT                   /protein_id="CAW24785.1"
FT                   /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFAV
FT                   SSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKTLSTIYISHGDPDFYFGLDVLKAA
FT                   FPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHALKV
FT                   VDLKGPSPDRTVLWIPSLKTVVGGVLVESGSHVWTADTQTQASRQAWVAMLDRIEALQP
FT                   RRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLPGEEGL
FT                   ELSAKVLKGEMQWP"
FT   CDS_pept        71767..72471
FT                   /transl_table=11
FT                   /locus_tag="PLES_00591"
FT                   /product="putative protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24786"
FT                   /protein_id="CAW24786.1"
FT                   /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMTD
FT                   ANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEA
FT                   LDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACAGEPLRAHFA
FT                   DSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRALLETQLCLAGGSGAVGG
FT                   AAAPLCRIDGCA"
FT   CDS_pept        72555..73010
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PLES_00601"
FT                   /product="osmotically inducible protein OsmC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24787"
FT                   /protein_id="CAW24787.1"
FT                   /translation="MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFN
FT                   TRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAIT
FT                   AVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
FT   CDS_pept        73121..73354
FT                   /transl_table=11
FT                   /locus_tag="PLES_00611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24788"
FT                   /protein_id="CAW24788.1"
FT                   /translation="MKTIGLGIAALLFSATALAAPKPCEELKAEIETKIQSAGVTSYTL
FT                   EIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
FT   CDS_pept        complement(73366..73803)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24789"
FT                   /protein_id="CAW24789.1"
FT                   /translation="MRPLTRLVPLALLLLAGCAGPLPQPDPQMAWVELRSAPANTLLAE
FT                   RLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDGFE
FT                   AGRRYRLEVRPQLRRALALLSDERGEVVARSNFQTSRCPPY"
FT   CDS_pept        complement(73860..74276)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00631"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24790"
FT                   /protein_id="CAW24790.1"
FT                   /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLDTQPDADLAAVEV
FT                   DDKSWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQRY
FT                   RLEAGHIGFRPWAKLYDQDNRELARGREGRCAKV"
FT   CDS_pept        74368..75495
FT                   /transl_table=11
FT                   /locus_tag="PLES_00641"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24791"
FT                   /protein_id="CAW24791.1"
FT                   /translation="MLVGRRAVRVLCYVPPMPRRLRHPLADLRLPRWVPCLALLALSGC
FT                   STVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRERLAKAEKARQFASERLGLPDN
FT                   RSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYSEAAARAEAARQRA
FT                   LGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLATLIFHELAHQKFYLRDDTAFNES
FT                   FATFVEQEGTRQWREYRGLPPADGREEKRREQFTALVLASRARLEALYAGPLDDAAKRA
FT                   GKAAEFQRLRREYAALSQREWGGESPFKAWIDAPFNNAKLLPFGLYDQWVAAFAVLFRQ
FT                   VGGNWPAFYARVRALGQLPLAERQAALQRLAAAAP"
FT   CDS_pept        complement(75503..76486)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24792"
FT                   /protein_id="CAW24792.1"
FT                   /translation="MTDNPFATPTAPVQPPAREVPATTQPYAFIAVLALVTCLSFAVSL
FT                   GIQWYNDIGEIRQRFSEHLQLMAPHWFTGLVFYAAANLLVLHAYREKRQLVEFRPLALL
FT                   LIGYGLLNLVCGMLAGIGLAPLTLPFYQWVTAQSSYGVWLMAFNEAMSWVYLLLGSLLP
FT                   LGLVLLGSRVNSPRLAEGEEARVAAWQVALGAALCFATLCFKLMQFLPYALLRYDEPWL
FT                   YGLYLSGVALPAALLFGAVCTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVGGGLAL
FT                   LMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLATRWCYADQLAA"
FT   CDS_pept        complement(76519..77184)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00661"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24793"
FT                   /protein_id="CAW24793.1"
FT                   /translation="MRDATLRYPNILFDLDGTLTDPREGITRSVQFALARLGIDEPDLA
FT                   RLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRVTGLYENRVFDGIPELLEALVG
FT                   RGHTLYVATSKPGVFAREIARHFAFDRHFKAIYGSELDGTRTHKDELIRHLLDSEGLAA
FT                   EHCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVLESH"
FT   CDS_pept        complement(77177..77719)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00671"
FT                   /product="putative carbonic anhydrases"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24794"
FT                   /protein_id="CAW24794.1"
FT                   /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGADSSVWPLVVIRG
FT                   DMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNRVLV
FT                   GMGSIVMDGAVIEDQVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFTYTA
FT                   GNYVKLKDLHIAEDYHA"
FT   CDS_pept        77797..79842
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PLES_00681"
FT                   /product="oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24795"
FT                   /protein_id="CAW24795.1"
FT                   /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLETQ
FT                   REQPTWKGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTELGQ
FT                   NRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSRLSE
FT                   LGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEFPSYY
FT                   AVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLGFANYA
FT                   ELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCTELQSWDAGYYAE
FT                   KLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADVRLFEILE
FT                   NGEHVGRFYFDLYARANKRGGAWMDGARDRRRDAQGRLIDPVAYLVCNFTPAVNGKPAL
FT                   LTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENWCWEPEGLAL
FT                   ISAHYETGEALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHGDGRSVLQVLE
FT                   GIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGVFNPD
FT                   TGRAFREAILARGGSREPMLLFVDFRGREPSIDALLRHSGLVGEAA"
FT   CDS_pept        79839..80114
FT                   /transl_table=11
FT                   /locus_tag="PLES_00691"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24796"
FT                   /protein_id="CAW24796.1"
FT                   /translation="MSPAITRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYAD
FT                   TLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
FT   CDS_pept        80203..81261
FT                   /transl_table=11
FT                   /locus_tag="PLES_00701"
FT                   /product="putative DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24797"
FT                   /protein_id="CAW24797.1"
FT                   /translation="MSAPLPPRGRGTASNPLNRFAPTHSEAFDDGWEQDVPPIQLTEVR
FT                   EEIARTVISRNQSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGIDFETRLIAK
FT                   SNVASALEQELSKPGYRCAPINLGANTDPYQPLERERRLTRQVLEVLLRFRHPLTIVTK
FT                   GSLILRDLDLLRELAEQNLVAVMISLTTLDDELKRILEPRAAAPSARLRAIRTLSGNGI
FT                   PVGVLCSPMIPMVNDMELERLLQAARDAGARSAAYMLLRLPREVGPLFEEWLAAHYPQR
FT                   AEHVMSLVRQCRGGEVYDSRFGHRFRGQGPFADLLAQRFAVAMKRLGLDRREGFGLDCS
FT                   RFAVPGAQMALF"
FT   CDS_pept        complement(81491..82405)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24798"
FT                   /protein_id="CAW24798.1"
FT                   /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAE
FT                   YYPSCYEPVSHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGAL
FT                   AGGAAGYYMEKQKQISDDRARIGSYGTDVDRSTVEINRSVAYAKSAQSCYQSQFKALLD
FT                   GRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENISNYTQAYEKDLQQVGVPR
FT                   AEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASQGQ
FT                   GMIREVCNSPDMGDWAPPSCAKA"
FT   CDS_pept        complement(82467..84179)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24799"
FT                   /protein_id="CAW24799.1"
FT                   /translation="MFEKAILPLALGACLAFAAPAWAEGDSPDNPKPLADDVALPLPCG
FT                   GEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPA
FT                   WQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDVPDG
FT                   MAARLPKVNLSRFDAERFGAVYSAWLLKNHPELLPVSGRGKNPEDGGIGFVRLPTEVEW
FT                   EFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLPVGMKR
FT                   PNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYP
FT                   LFAADGSEQRNETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQ
FT                   LDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIR
FT                   LTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTRYTDAVIQAQ
FT                   FQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLASSGR"
FT   CDS_pept        complement(84172..85371)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00731"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24800"
FT                   /protein_id="CAW24800.1"
FT                   /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYGL
FT                   VSTLTERLERAPSVREIIPVGGARYRAEDIAALAARADVAFAVPRTRQIAATADLSGGG
FT                   ETALSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRMDGQ
FT                   AQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVAAYGWPGKAGETPRAR
FT                   IYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVAALAIG
FT                   GAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSAVFGLFLAGLLYAA
FT                   TAGALNHLFDNQSGEFVCRLLPSHYLTALLATLLCSVLAAASGGWRAARIEAAEGLRDV
FT                   "
FT   CDS_pept        complement(85371..86090)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00741"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24801"
FT                   /protein_id="CAW24801.1"
FT                   /translation="MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGKS
FT                   TLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLAALRRQHCGYVLQSGGLL
FT                   EFLDVRRNIGLPCALLGAPSAERVQALAERLEIGDQLDKKPAALSVGQRQRVAIARALA
FT                   HAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEVLAIR
FT                   WQREADDSVGACLEEVG"
FT   CDS_pept        complement(86087..89185)
FT                   /transl_table=11
FT                   /gene="ppkA"
FT                   /locus_tag="PLES_00751"
FT                   /product="serine/threonine protein kinase PpkA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24802"
FT                   /protein_id="CAW24802.1"
FT                   /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAA
FT                   DPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPE
FT                   LGLVYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQV
FT                   GFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEP
FT                   LPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGS
FT                   PRASNPPPAEPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPP
FT                   LPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLSSGDAPSAADPAPLGQTPADKPQQ
FT                   QTPVADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYA
FT                   RKQVGGSPWLRVGASSNGEGDGWLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVE
FT                   RLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPA
FT                   QLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVRE
FT                   VIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSS
FT                   QVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNE
FT                   AEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVN
FT                   AFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIGYAMQMEFLGRRDPVR
FT                   APQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLIVDAAKRTQTSPKDFFQ
FT                   EIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWLSLSVAEQQD
FT                   FIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP"
FT   CDS_pept        complement(89193..89921)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00761"
FT                   /product="probable phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24803"
FT                   /protein_id="CAW24803.1"
FT                   /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPEAGLWVVADGMGG
FT                   HAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLV
FT                   LLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNALISEEEARHHPRANV
FT                   VTRAVGVHEQLELSEATLHVLPGDSFLLCSDGLNKTADDSELRDVLSHSDPYAVVRSLV
FT                   HLGLTRGAPDNITALVVRAF"
FT   CDS_pept        complement(89931..90611)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24804"
FT                   /protein_id="CAW24804.1"
FT                   /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELG
FT                   AAWLDAYLTSPLWRFAIAPGLLGGEAVTGVVMPSIDRVGRYFPLTVACLLPANADLGGL
FT                   VGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAV
FT                   TPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFP
FT                   GIPG"
FT   CDS_pept        complement(90608..93913)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24805"
FT                   /protein_id="CAW24805.1"
FT                   /translation="MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSER
FT                   RNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAV
FT                   LLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERA
FT                   AHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALD
FT                   DGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGE
FT                   FLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRS
FT                   YFIERLFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQS
FT                   YIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLG
FT                   EESASVYRKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKA
FT                   WISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQR
FT                   VYDRVKRQRLPKDMPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTA
FT                   SLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNV
FT                   TQAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSL
FT                   VGQEEEGTREQPRQVDSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSA
FT                   MAGASGDSLLGDAKNQVAAAASRVALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQLN
FT                   AAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAGGVMDTYFRQYLQPYVDTS
FT                   ASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPTVRFELKPVTMDAAISQ
FT                   FILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFRL
FT                   LDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL"
FT   CDS_pept        complement(94135..95484)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24806"
FT                   /protein_id="CAW24806.1"
FT                   /translation="MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGD
FT                   PYTPPPMASLAPLSGRGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQ
FT                   FEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEK
FT                   VFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTR
FT                   GEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKR
FT                   IHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELF
FT                   ASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEV
FT                   ADLLGATTGDAGRFTAEGRSDTEPVASNANAEGRARNRRVEITVFAEGAQ"
FT   CDS_pept        complement(95491..96825)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24807"
FT                   /protein_id="CAW24807.1"
FT                   /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGF
FT                   SELKLDDALLTQGKLAIVSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPL
FT                   KRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGLGEY
FT                   AAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALAGRVV
FT                   ASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQR
FT                   RPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLI
FT                   DNASFVLVVRADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPY
FT                   HAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
FT   CDS_pept        complement(96841..97305)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00811"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24808"
FT                   /protein_id="CAW24808.1"
FT                   /translation="MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQ
FT                   AAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDE
FT                   QTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP"
FT   CDS_pept        complement(97350..98837)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24809"
FT                   /protein_id="CAW24809.1"
FT                   /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPER
FT                   LVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQ
FT                   LGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDT
FT                   KPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPPPAGGAPLIPADW
FT                   DPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQP
FT                   QPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEG
FT                   LVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVA
FT                   DSFEDLKAHQLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSF
FT                   TELYAKILREAEDDFQELFGREFSRAYEEHSARLRRS"
FT   CDS_pept        99205..100239
FT                   /transl_table=11
FT                   /locus_tag="PLES_00831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24810"
FT                   /protein_id="CAW24810.1"
FT                   /translation="MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDA
FT                   VLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLDGLADGLLLVRELLGQY
FT                   WDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAG
FT                   LQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIESGVAERVGSAQGLDL
FT                   GPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAAADEQGGAAPVAAVAAPAPRASGEIAN
FT                   REDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRG
FT                   PESE"
FT   CDS_pept        100328..100846
FT                   /transl_table=11
FT                   /locus_tag="PLES_00841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24811"
FT                   /protein_id="CAW24811.1"
FT                   /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMAD
FT                   LAGKPAEPQAAVADRKFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESM
FT                   DDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALASAP
FT                   KPKDDEPQA"
FT   CDS_pept        100859..102355
FT                   /transl_table=11
FT                   /locus_tag="PLES_00851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24812"
FT                   /protein_id="CAW24812.1"
FT                   /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAV
FT                   RTLAEHALEQTSLISNDAIKSIESIIAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYL
FT                   VNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCL
FT                   VGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTT
FT                   PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWAN
FT                   SAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCR
FT                   FAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVE
FT                   EVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
FT   CDS_pept        102431..102919
FT                   /transl_table=11
FT                   /locus_tag="PLES_00861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24813"
FT                   /protein_id="CAW24813.1"
FT                   /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGG
FT                   GGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKE
FT                   VLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA"
FT   CDS_pept        103087..103932
FT                   /transl_table=11
FT                   /locus_tag="PLES_00871"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24814"
FT                   /protein_id="CAW24814.1"
FT                   /translation="MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRS
FT                   QPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVF
FT                   AGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAW
FT                   LADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVA
FT                   LLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
FT                   "
FT   CDS_pept        103934..104443
FT                   /transl_table=11
FT                   /locus_tag="PLES_00881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24815"
FT                   /protein_id="CAW24815.1"
FT                   /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVL
FT                   RDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATF
FT                   EPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQ
FT                   GERRRT"
FT   CDS_pept        104440..106299
FT                   /transl_table=11
FT                   /locus_tag="PLES_00891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24816"
FT                   /protein_id="CAW24816.1"
FT                   /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPY
FT                   VERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGAL
FT                   SSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPAAVLGRLAASE
FT                   PRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN
FT                   AWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRALR
FT                   RCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVI
FT                   VDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSK
FT                   QRRKGPRSTYVGSETFVALVDANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFT
FT                   LEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGAAALRELLRL
FT                   YGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTGVFLL
FT                   GAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
FT   CDS_pept        106263..107309
FT                   /transl_table=11
FT                   /locus_tag="PLES_00901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24817"
FT                   /protein_id="CAW24817.1"
FT                   /translation="MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLG
FT                   HSVRLADDPLRLGQKPDCTFAPSTLASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTE
FT                   YARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAALSG
FT                   RGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQWLELP
FT                   ERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWVA
FT                   EYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPH
FT                   EHKEKEHE"
FT   CDS_pept        107302..110010
FT                   /transl_table=11
FT                   /locus_tag="PLES_00911"
FT                   /product="probable ClpA/B-type chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24818"
FT                   /protein_id="CAW24818.1"
FT                   /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQI
FT                   LQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGS
FT                   LMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPENGLS
FT                   ASDGFNAGAAPGEASGALAPSAMGKQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLV
FT                   DILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGAS
FT                   MKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLR
FT                   TVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEKHHQVQILDE
FT                   ALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELA
FT                   IIRRESAIGVATAERQRNAETLLAEERERLSALEQRWAEEKRLVDELLETRARLRAAAE
FT                   AVDAGGVPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEPLILPTVDYQAVASVVA
FT                   DWTGIPVGRMARNEIETVLNLDRHLKKRIIGQDHALEMIAKRIQTSRAGLDNPSKPIGV
FT                   FMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEG
FT                   GVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTT
FT                   NAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAI
FT                   SRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMIDAILTNTLLPDMSRE
FT                   FLTRMLEGKPLAGVRISSRDNQFHYDFAEAE"
FT   CDS_pept        110057..111988
FT                   /transl_table=11
FT                   /locus_tag="PLES_00921"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24819"
FT                   /protein_id="CAW24819.1"
FT                   /translation="MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPN
FT                   LPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTS
FT                   DCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEG
FT                   IYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPG
FT                   SLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQA
FT                   QHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQF
FT                   ESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQ
FT                   SNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPY
FT                   ELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVG
FT                   HDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSV
FT                   VEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQA
FT                   MFPPPAKG"
FT   CDS_pept        complement(112103..112387)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24820"
FT                   /protein_id="CAW24820.1"
FT                   /translation="MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRS
FT                   LDRSALHRLTLGSIAVKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP"
FT   CDS_pept        complement(112384..113676)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24821"
FT                   /protein_id="CAW24821.1"
FT                   /translation="MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGG
FT                   LAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDV
FT                   SATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQDTFIGGP
FT                   TERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAIGGLMMGGMALLG
FT                   DLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNLD
FT                   HDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAP
FT                   QGNWYTLSPRVQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWS
FT                   VKGQSYPAKGGAQQLFSNEKGSFGLLPREGS"
FT   CDS_pept        complement(113692..114126)
FT                   /transl_table=11
FT                   /locus_tag="PLES_00951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24822"
FT                   /protein_id="CAW24822.1"
FT                   /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDAS
FT                   QGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVF
FT                   IERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPRPTPS"
FT   CDS_pept        114380..116605
FT                   /transl_table=11
FT                   /locus_tag="PLES_00961"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24823"
FT                   /protein_id="CAW24823.1"
FT                   /translation="MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISE
FT                   NPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLT
FT                   RTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLME
FT                   QEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREV
FT                   QSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEA
FT                   LQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVG
FT                   AQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETH
FT                   WVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVG
FT                   SNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADR
FT                   SESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLV
FT                   TGAASIRMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN"
FT   CDS_pept        116633..117082
FT                   /transl_table=11
FT                   /locus_tag="PLES_00971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24824"
FT                   /protein_id="CAW24824.1"
FT                   /translation="MSVEIHLPGATTALPARLDGVVIGVLLDVPDAAAPVVAYPGCPSE
FT                   HGLAAATTTQLSRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEALAQLDGERLEFSAE
FT                   REIVLRCGKASITLTRAGKVIIRGAYLSSRSTGVNRIKGGSVQIN"
FT   CDS_pept        117012..118211
FT                   /transl_table=11
FT                   /locus_tag="PLES_00981"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24825"
FT                   /protein_id="CAW24825.1"
FT                   /translation="MAPIFPAAPPGSTGSRAVRCRSTERGGPDMELLNATPLAAAYNQG
FT                   LDAEGRESLVVIAKGSFDLPLDGREARLLDEQQTLLMVDEFYGEPGFSAPRRECEFVPF
FT                   KPFCDVLVLGSAQAPGGRPVQQLTAGIRVGRVSKALTVHGPRQWEPGLLGAGAGVAQPF
FT                   QSQDISYASAFGGSHASPDNPGFMDCYMANPAGCGWFPRSADTAEIVGTPMPATEKLGE
FT                   PVDSPHGRFTPMALGPLGRHWQARVGFAGRYDDAWLAERFPFLPADFDERYFQSAPADQ
FT                   WTDHLRGGEEVLLLNLTGEERAAFRVPRREVPVTFFLKKGGHETAQARIDTLLVDCDAR
FT                   RVEVTWRIRRPLKRNLFEIAQVLVGSKSAAWWRARELGKDYYPSLAALVRSRQAEEDEA
FT                   "
FT   CDS_pept        118208..119245
FT                   /transl_table=11
FT                   /locus_tag="PLES_00991"
FT                   /product="Putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_00991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24826"
FT                   /protein_id="CAW24826.1"
FT                   /translation="MSQVLSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGGE
FT                   WLVGAPVMLPEPSSGYAQLVGMAAMAIAECVAGLPAEDIREMPLLLGVAEVDRPGRLAG
FT                   LEQPLLQAIEERLGYRFHERSCVIPRGRVSAAVALLNARKLIEQGCSKVLIAGVDSYLT
FT                   AATLAAYQERDRLLGSHCQDGFIPGEGAAAVLVTAACASEEPQLLCLGLGFGVEKATVE
FT                   SEGLPLRADGLTQAVKAAFADCGFGYELVDYRLADLPGDQYYFKEAALALSRTLRVRKE
FT                   RVELWSPADCIGECGAMTGPALLCIALAASRKGYAHGPQVLCHSGNDAGERAAVVLGYQ
FT                   RVRAN"
FT   CDS_pept        119246..120193
FT                   /transl_table=11
FT                   /locus_tag="PLES_01001"
FT                   /product="hypothetical protein"
FT                   /note="orf00150"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24827"
FT                   /protein_id="CAW24827.1"
FT                   /translation="MANQVYANGRELSCKSASGKSIASFPDVCFTPPQAPPTPLGVPVP
FT                   YPNTGMSKDTTRGSRTVRITRKEVMLKNKSHFKKSYGDEAGRAPKKGIITSTNTGKVYF
FT                   TSWSMDVKIEGLNVVRHLDLTTHNHNPSPGNTATWPHTSKMKAAFKPGGKCAGMEHLRL
FT                   QPYSKACPSTAGGGAQTGHHLIPGRCMRGKAGYSHSKAPVICVSRGNQHQGSHKRCHAK
FT                   FDPVELDHFDKGKPFKYETARNTAAASAGGALSPPRELTKKEKECVAFQLDQYYKAKPK
FT                   KGPGCTTATNLRASGAAGKVIPPARSAPAPAGRP"
FT   CDS_pept        120204..121118
FT                   /transl_table=11
FT                   /locus_tag="PLES_01011"
FT                   /product="hypothetical"
FT                   /note="orf00151"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24828"
FT                   /protein_id="CAW24828.1"
FT                   /translation="MAKSETALYFTNVIAIGPQEALLAGHLYLEGAEPSVTRVMMIDQD
FT                   DWFHVYDIPEVVYSALQRSPRRGQQKGDYCFLGRAGLLREHPSGQSSTDATLDIDNVYL
FT                   MDLCEVDGELYACGTQNQVLRQNKGVWQRIDQGLYVPLGDEVTACLNGIDGFSRDDVYA
FT                   VGDAGAIWHWDGKGWQASAAPTNLPLYCVHCAADGTVYIGGSGGILLRGSAQVGWTDIG
FT                   DRDLCSEVLENMVEFAGKLYVTATDQLLEYDGTRLSETKVPVQGKKAYYAIDAKPEVMW
FT                   VVGDECVLSYDGGTWQRHVCPEN"
FT   CDS_pept        121125..122357
FT                   /transl_table=11
FT                   /locus_tag="PLES_01021"
FT                   /product="hypothetical protein"
FT                   /note="orf00153"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24829"
FT                   /protein_id="CAW24829.1"
FT                   /translation="MNVAAVIDQHVEEAGFLAGLRDHAVRAPHYDLAHLLDLDNRIEAH
FT                   LDALQIGGLRSLDLVLKALDTNAEGEVFVAAILVFRGTNGTALAQLCEHLRRFPEGARF
FT                   FAAALGWLDWDQARPWVERLLASPEPLFRAIGLAACGMHRHDPGPALLSALGHADPAVL
FT                   ARAARTAGELRRRDLMANIRAYRAHDDPSLRFWANWATAQMGDEEALGPLRAFAGQPGP
FT                   FQLPATMVLLAWQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQMRDES
FT                   LARVAGEAFSLITGADLALLDLELEALPDYDPGPNDDPDDEDVALDDDENLSWPEAERV
FT                   SAWWRDNGARFVAGRAYLLGEPLGEARCRQVLRDGQQRQRMAAACLLARFVPNLPLFPT
FT                   GAPVRRQLDLF"
FT   CDS_pept        122733..123461
FT                   /transl_table=11
FT                   /locus_tag="PLES_01031"
FT                   /product="probable carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24830"
FT                   /protein_id="CAW24830.1"
FT                   /translation="MPDRMRGVKSDSPEQESADDALKRIVDGFQHFRREVFPEQQALFK
FT                   KLANSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEY
FT                   AVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDCGAS
FT                   HDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQGRFL
FT                   PLDGEHPVPMATPAPRYLNS"
FT   CDS_pept        123672..125243
FT                   /transl_table=11
FT                   /locus_tag="PLES_01041"
FT                   /product="probable sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24831"
FT                   /protein_id="CAW24831.1"
FT                   /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMLPAK
FT                   GLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQLLA
FT                   GRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAAFAA
FT                   LGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLALDVR
FT                   RVEVPANLGEAIDWLRPADLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLHDGPRS
FT                   DMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLLAFVLLL
FT                   GSLLRQIPVASLAGVLVYTGVKLVDFKALGNLSRYGRMPMLVYAATALAIVFTDLLTGV
FT                   LVGFALTLLKLVLKAARLKIALRYTGEHEAELRLSGAATFLKVPALSRVLDEVKPGTTL
FT                   HVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRGSVGLGGARNG
FT                   GAVSPG"
FT   CDS_pept        125380..125976
FT                   /transl_table=11
FT                   /locus_tag="PLES_01051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24832"
FT                   /protein_id="CAW24832.1"
FT                   /translation="MVDGFVQPVGEGFADQLVGHQVGHGGVQRDQRLAEMGDVAVVHFF
FT                   HQAVRQVGFVEQGVEAVVAGEQRRRGEEELLGDLQHRLDPFLDAGFAGHAVGGVEQVRY
FT                   LFDVGVDEAGEYVFRVLALRLDGAMQAGQAAGYQISQVTVAGFAEVRLLDEFTEGSGVH
FT                   GVSHTTGMVKKRRNIAGGARRLRRDCHNRFVVMRG"
FT   CDS_pept        126240..127364
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="PLES_01061"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24833"
FT                   /protein_id="CAW24833.1"
FT                   /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMT
FT                   IFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPA
FT                   TRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQDQIHNRQAKDEHYL
FT                   LEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRG
FT                   QCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKV
FT                   YHTICAACHQAEGQGMPPMFPALKGSKIVTGPKEHHLEVVFNGVPGTAMAAFGKQLNEV
FT                   DLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
FT   CDS_pept        127374..128966
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="PLES_01071"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24834"
FT                   /protein_id="CAW24834.1"
FT                   /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSFM
FT                   MFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPL
FT                   MIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHSVTF
FT                   FIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFAR
FT                   KPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTGVKVFNW
FT                   VTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRGGKPAPAKPWDGAEGLEWSIPSP
FT                   APYHTFSTPPEVK"
FT   CDS_pept        128977..129531
FT                   /transl_table=11
FT                   /locus_tag="PLES_01081"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24835"
FT                   /protein_id="CAW24835.1"
FT                   /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPLYDVMCRALGINGK
FT                   TAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARNPS
FT                   DKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDVRHV
FT                   TLAYTLFDITARKPPVPVAGR"
FT   CDS_pept        129542..130429
FT                   /transl_table=11
FT                   /gene="coIII"
FT                   /locus_tag="PLES_01091"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24836"
FT                   /protein_id="CAW24836.1"
FT                   /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHKESH
FT                   GPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAAFF
FT                   GALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWKLPL
FT                   INTILLVTSSFTVTFAHHALKKNKRGPLKAWLALTVLLGIAFLILQAEEYVHAYNELGL
FT                   TLGAGIYGSTFFMLTGFHGAHVTLGALILGIMLIRILRGHFDAEHHFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVI"
FT   CDS_pept        complement(130445..130654)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24837"
FT                   /protein_id="CAW24837.1"
FT                   /translation="MLKVAIVLLLLATLVSLFSGLFFLVKDQGHGSRVVNSLTVRVVLA
FT                   AATLALVAWGFYSGELNSHAPWHF"
FT   CDS_pept        130670..131464
FT                   /transl_table=11
FT                   /locus_tag="PLES_01111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24838"
FT                   /protein_id="CAW24838.1"
FT                   /translation="MGGFMQYSQRLGEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLW
FT                   LGTWQLQRADEKRALLASYEARRGAEPVSPGQLEGLRDPAYVRVRLHGRFDQRHTLLLD
FT                   NRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVAWTDRRSPPTLETPDRVLLLDAWTYLP
FT                   PPGGLHLADAPAGGWPRLVTQLDIPALWQAFGRAGLPWEIRLEAGDASFDTDWPLVSMP
FT                   PERHTGYAVQWFALATALLALYLYLGVRRAREKNHESRDSDA"
FT   CDS_pept        131439..132017
FT                   /transl_table=11
FT                   /locus_tag="PLES_01121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24839"
FT                   /protein_id="CAW24839.1"
FT                   /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVP
FT                   QGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQVNIALG
FT                   REASRAGHALAASGELPADFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHG
FT                   NLVLRYDAKANGKKLLKDVQLLLKLSHIG"
FT   CDS_pept        132082..133155
FT                   /transl_table=11
FT                   /locus_tag="PLES_01131"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24840"
FT                   /protein_id="CAW24840.1"
FT                   /translation="MTGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPGC
FT                   YGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVRRG
FT                   RDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALRLSG
FT                   RFAARRYPAATRGLAGLALLLVIGQIALGGWVSSNYAAVACIDLPTCHGEWWPRMDFAN
FT                   GFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVWPTALM
FT                   LLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRAPAPSPQ
FT                   RVRRTLPPAQGSRLKAA"
FT   CDS_pept        133181..134095
FT                   /transl_table=11
FT                   /locus_tag="PLES_01141"
FT                   /product="probable cytochrome c oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24841"
FT                   /protein_id="CAW24841.1"
FT                   /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPLD
FT                   GFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALGFA
FT                   LLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAPPLL
FT                   GWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERYTKLH
FT                   ILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIKTFKYS
FT                   IVYLFLLFMALLVDHYLPLKLLL"
FT   CDS_pept        134121..134756
FT                   /transl_table=11
FT                   /locus_tag="PLES_01151"
FT                   /product="putative Sco1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24842"
FT                   /protein_id="CAW24842.1"
FT                   /translation="MTRVNKTVLVLVALVALVLGLTVHKVLTAQRQADPTVLLDAGIVI
FT                   LPQTRKVPALEFTNQDGQAVSTASLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKLPQ
FT                   EVRDDLQVVFISVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANAMSIPYIPAD
FT                   TSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
FT   CDS_pept        complement(134796..135248)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01161"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24843"
FT                   /protein_id="CAW24843.1"
FT                   /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDL
FT                   VGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAA
FT                   ERLWLDTPVYLSAQAHLQAYYGRYGFVAVTEVYLEDDIPHIGMRRA"
FT   CDS_pept        135380..135853
FT                   /transl_table=11
FT                   /locus_tag="PLES_01171"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24844"
FT                   /protein_id="CAW24844.1"
FT                   /translation="MRWEELSEQPCSLARVLAIVGDRWTLLVLRDCFLGVRRFDDFERS
FT                   LGVTRHVLADRLKRLVEAEILAKVPYQERPLREEYRLTEKGMELYPAILSLVNWGDRHL
FT                   AGVEGPPLEHVHKHCGQHMHGVLVCSECGEPLHARDVTVREGLFWKGRLLRRG"
FT   CDS_pept        136110..136838
FT                   /transl_table=11
FT                   /locus_tag="PLES_01181"
FT                   /product="probable short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24845"
FT                   /protein_id="CAW24845.1"
FT                   /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPLV
FT                   QAIRDQGGEALACGCDARQEQQVIDLFARIEGEVGALEAVIFNVGANVWFPITETTERV
FT                   YRKVWEMAAFGGFLTGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFALRAL
FT                   AQSMARELGPKGIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETYWQIH
FT                   CQPRDCWVHELDLRPWMETF"
FT   CDS_pept        136863..137450
FT                   /transl_table=11
FT                   /locus_tag="PLES_01191"
FT                   /product="putative 2-hydroxychromene-2-carboxylate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24846"
FT                   /protein_id="CAW24846.1"
FT                   /translation="MSKQIEFFFDFGSPTTYLAWTQLPRIAAAHGASIAWRPMLLGGVF
FT                   KATGNHSPIEVPAKGRYTLHDLARYAKRYGVPLAFNPAFPINTLTLMRGAQGYLGGEGF
FT                   QPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTEEAV
FT                   RRGVFGAPSFFVGDQLFFGQDRLDFVAEALAG"
FT   CDS_pept        137680..139029
FT                   /transl_table=11
FT                   /locus_tag="PLES_01201"
FT                   /product="probable dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24847"
FT                   /protein_id="CAW24847.1"
FT                   /translation="METPAMFIKRCSRSIFLQVVIGLVIGVICGVGIPDLAVQMKPLGD
FT                   GFIKLIKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYS
FT                   LGLGSGANIHLNELPAGDVALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQVLLF
FT                   SVLFGSALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDS
FT                   LSHLGALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELLIVMGTASSDAVLP
FT                   QVMRKLEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTQLAMTDLITIL
FT                   LVSLVTSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIGNC
FT                   VATVTIARWENDIDMPRAQAILDGRLEAPAKADGEPLKRSAVAGEGKLHG"
FT   CDS_pept        139078..139764
FT                   /transl_table=11
FT                   /locus_tag="PLES_01211"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24848"
FT                   /protein_id="CAW24848.1"
FT                   /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISRP
FT                   SLREAIMVLETLGVVRSLPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFIVG
FT                   IVAQSAGAAEISELRLLLLDLREAVEDGDPQALVEAYTAFHRRLVKLTSNPIFLSVSEQ
FT                   IGSALERSDNLVRRQPEYAEEILQEHDAILRAIRQHDSERASQAMRQHILNEGARLNID
FT                   LRLPQV"
FT   CDS_pept        139865..140599
FT                   /transl_table=11
FT                   /locus_tag="PLES_01221"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24849"
FT                   /protein_id="CAW24849.1"
FT                   /translation="MVGFEARTQQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKETL
FT                   GQIFRVSNGTIQRALTRLAEDGAVVMPPKEVASVARPDERQARQVLDARLLVESEVVRQ
FT                   LPAGLDPAALAELRALVDEEQACLAARDSAGLIRLAGRFHLRLAELTENPLLQGFVRGL
FT                   VARASLDIALNKGAVYTAEACAAQRALLDALEDGDSAAAAALMDAYLRGLFARMRFLPP
FT                   PTTDLREAFGMKAPRGEKRRRA"
FT   CDS_pept        140779..141189
FT                   /transl_table=11
FT                   /locus_tag="PLES_01231"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24850"
FT                   /protein_id="CAW24850.1"
FT                   /translation="MAYAEWIAVKVVVSKSIGTVGIRNATLQWGKFYRYTNKDDEISTE
FT                   EVSSMNVQAGSPQWIASCGRENASSGTQGSFDCYDGNTKMGTFSWDDPWKSGATNTWSF
FT                   TPASADYAGITSGGNATGTDIGEVTLTLGRFS"
FT   CDS_pept        complement(141221..142129)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01241"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24851"
FT                   /protein_id="CAW24851.1"
FT                   /translation="MDSLKGMAIFATVVGKGSMAAAAQSLGMTPSAVSQQIRKLESRAQ
FT                   VTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGFSG
FT                   TLITQALKPLLENHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGDWSS
FT                   VLCAAPAYLRQRAPINRPEQLTEVDWISLNTSNHLNHLTLSGPGGEVCKLRLEPRVAAN
FT                   GMLAVRQFTLDGLGVSYQPLPEVRDALNDGRLQQLLPEWRIPGLGIYAVTPRREAQPAK
FT                   VKVAIEALRRAFATDGDERWS"
FT   CDS_pept        complement(142429..142710)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01251"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24852"
FT                   /protein_id="CAW24852.1"
FT                   /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQ
FT                   VANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKEIQILRIDRVEITP"
FT   CDS_pept        complement(142707..142934)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01261"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24853"
FT                   /protein_id="CAW24853.1"
FT                   /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQW
FT                   QVAAIDEGLADANAGRLLEHTEIEKRWGLQ"
FT   CDS_pept        complement(143110..143730)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24854"
FT                   /protein_id="CAW24854.1"
FT                   /translation="MPTRVLRGLVAALPLFLAACSDSAPSSEEIARLLAERGFDKPACA
FT                   SSTLFKTFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLRRDGDSYDLTPAGREDYKPES
FT                   KAFCYSSGFDVSVRSVDPAKPDDYGPAVEKGWLVTVEVKPREVKDWAKNPEVLKQASLT
FT                   TLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
FT   CDS_pept        143831..144331
FT                   /transl_table=11
FT                   /locus_tag="PLES_01281"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24855"
FT                   /protein_id="CAW24855.1"
FT                   /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPGQ
FT                   GMEMRFMVKLRVQNPNDEPIEYNGIALDLDVNGQPLASGVSDQTGEVPRFGERVVSVPL
FT                   TVSAFSAFRQAWGLSNNAPTRGMPYVVKGKLAGGLFGTVRFSEKGTLDFSGPAVGAPKT
FT                   KGL"
FT   CDS_pept        144404..144745
FT                   /transl_table=11
FT                   /locus_tag="PLES_01291"
FT                   /product="putative alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24856"
FT                   /protein_id="CAW24856.1"
FT                   /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKV
FT                   IKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMK
FT                   LKSEFVRKV"
FT   CDS_pept        complement(144827..146254)
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="PLES_01301"
FT                   /product="gamma-aminobutyrate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24857"
FT                   /protein_id="CAW24857.1"
FT                   /translation="MSKVVLASQLPNKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGSG
FT                   HAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTIGW
FT                   LYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFEFWF
FT                   ALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLTTMFS
FT                   FMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLLIQVGS
FT                   YQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLAKRGDAPSVLKLTNTA
FT                   HVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQLRMRKQLQ
FT                   ASGQPIEFRMWLYPWLTWAVILFIVAALSIMLIMPEHRHEVFATALLTIFTVCLGLLNA
FT                   RRKPRLGEDYAGKTARV"
FT   CDS_pept        complement(146423..147916)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01311"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24858"
FT                   /protein_id="CAW24858.1"
FT                   /translation="MGTLHHLINGEMVADNGRSADVFNPSTGEAIHKVPLADGKTLQKA
FT                   IDAARAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELKRG
FT                   IENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAI
FT                   ACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKEAVDGLLQAPEVKAISF
FT                   VGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCM
FT                   AISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTGYIDSGV
FT                   AQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVRVNSLEEA
FT                   MQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFGGWKRSLFG
FT                   DLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
FT   CDS_pept        complement(148000..148287)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24859"
FT                   /protein_id="CAW24859.1"
FT                   /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVPL
FT                   TDGTLLLETPEGDRHAPLVAGQAYFRKAGVEHNVINASAHEVVFVETEIK"
FT   CDS_pept        complement(148287..149633)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01331"
FT                   /product="beta-alanine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24860"
FT                   /protein_id="CAW24860.1"
FT                   /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSWL
FT                   TDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIA
FT                   GLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAGTSL
FT                   GGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDASNIAA
FT                   VIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTP
FT                   DLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVACAAGLA
FT                   ALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPTVRP
FT                   FEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA"
FT   CDS_pept        149768..150685
FT                   /transl_table=11
FT                   /locus_tag="PLES_01341"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24861"
FT                   /protein_id="CAW24861.1"
FT                   /translation="MAKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRSA
FT                   ISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQHLR
FT                   GELNIGIINNLVTLPQMRITHALSALKGQGPQVRINIGMTTPNEIELGVLDGHLHVGVV
FT                   PLISPLSGLEYLPLYDEHAQLYCSRGHALFERADGDIAVDEVLAADAVAPSYRLPAEAQ
FT                   ARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFHYAIAL
FT                   TIVTRKGRRPNLVLERFLEAVAVS"
FT   CDS_pept        complement(150799..152169)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01351"
FT                   /product="probable guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24862"
FT                   /protein_id="CAW24862.1"
FT                   /translation="MNDAVPAGNFVPPLILHSDHGGSAMSSSAHRGRILHFLGDPAKLG
FT                   DKAWEYFEDGLLWIEHGHVRALDHATYLLPQLPADLPLEEHPQRLLLPGFVDCHVHYPQ
FT                   LGVIASYGTQLLDWLETHTFPAEQRFADAGYAAAQAELFLDELLRHGTTTALVFGTVHA
FT                   VSAEAFFQAAQKRRLRMIAGKVLMDRNAPPALCDTAASGYAESRALIERWHGNGRLQYA
FT                   VTPRFAPTSSPEQLAAAARLLDEYPGVYLHTHLSENLKEVAWVGELFPQAQDYLDVYHR
FT                   AGLVGERSVFAHGIHLSERECRCLAHKNAALAHCPSSNLFIGSGLFDLGRAQQYGIRVG
FT                   IGSDVGGGTSLSLLANLADAYKIQQLRGTSLDPFQALYLATLGGARALDLDGLVGNFLP
FT                   GREADFVALDLAATPMIAQSMEHARGLADTLFVLNTVGDDRAVAETWVMGERRHAKG"
FT   CDS_pept        152559..152699
FT                   /transl_table=11
FT                   /locus_tag="PLES_01361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24863"
FT                   /protein_id="CAW24863.1"
FT                   /translation="MECATTVHRETVDSGSTHGAAEHASVDRRGLSWKAGKPSIHGHHG
FT                   V"
FT   CDS_pept        153280..154851
FT                   /transl_table=11
FT                   /locus_tag="PLES_01371"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24864"
FT                   /protein_id="CAW24864.1"
FT                   /translation="MSAPSSFAPPRLELRGISKRYPGCLANDRIDLCIDAGEIHALLGE
FT                   NGAGKSTLMKIIYGVTRPDAGEIRWQGEPVQVRDPARARALGIGMVFQHFSLFETLSVA
FT                   ENIALALGAEAGSPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLMQDI
FT                   RLLILDEPTSVLTPREAEDLFVTLRRLAEEGCSVLFISHKLAEVRALCQRATVLRGGRV
FT                   AGQCVPAQCSDLELARLMVGDAEGLAAEYPKATGGAPFLQVRDLHWRNPDPFGVSFTGL
FT                   DLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRAQAERIRLGACAGAHLAPDARRRA
FT                   GQAFVPAERLGHGAVPEMSLADNALLTAFQQGLVKRGLVRRRKVLALAEEIIRRFAVKA
FT                   PGAGAPARSLSGGNLQKFILGREILQAPRLLVAAHPTWGVDVGAAALIHRALIALRDAG
FT                   TAILVVSEDLDELFLLSDRIAALCSGRLCPAVATASASPQQVGGWMAGQFEAPAAVAGA
FT                   VAQGSL"
FT   CDS_pept        154851..155948
FT                   /transl_table=11
FT                   /locus_tag="PLES_01381"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24865"
FT                   /protein_id="CAW24865.1"
FT                   /translation="MLLSLEPRGRQSRWMLLASPLLAGLLTLVCGALLFACLGHDPWQT
FT                   LHTVLVQPLSDLYGLGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLVGALAGSAV
FT                   AIQLLDWQSRWALAWVLLAGTAAGALWAGFAAWLRTRFNANEILTTIMLNYIALNLLLY
FT                   GVHGPLKDPDGFNFPQSALFGEASRLPALFEDSRVHLGALFGLLALAAVWVLAQRSFLG
FT                   FQVRVLGLDRRAAGFVGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQVSPGYG
FT                   YAAITVAFLGRLNPFGILCASLLMALLYLGGEAAQMSLNLPLALTGLFQGMMLFFLLAC
FT                   DVLILYRPRLHGRWRKRPALRDALA"
FT   CDS_pept        155970..156896
FT                   /transl_table=11
FT                   /locus_tag="PLES_01391"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24866"
FT                   /protein_id="CAW24866.1"
FT                   /translation="MDIDLLDNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMML
FT                   FGAVIGFMVAFSSGSLWLGALLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGVGL
FT                   SSFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLLRSR
FT                   AGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMTAG
FT                   RGWIALALVVFASWRVFRVLLGAWLFGLASILHLVAQGIGLSIPANLLAMLPYAATILV
FT                   LVLLSRDALRTRLYAPVSLGQPWKAGH"
FT   CDS_pept        157061..157624
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PLES_01401"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24867"
FT                   /protein_id="CAW24867.1"
FT                   /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTF
FT                   NCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPG
FT                   EVCPAKWKEGEKTLAPSLDLVGKI"
FT   CDS_pept        157769..159334
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PLES_01411"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24868"
FT                   /protein_id="CAW24868.1"
FT                   /translation="MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVG
FT                   LTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLD
FT                   ADVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEV
FT                   DIMNLQRASKLVPAKNTGELHEVQFESGGSLKAKTLILATGARWREMGVPGEQEYKAKG
FT                   VCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKL
FT                   YSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLK
FT                   GSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRT
FT                   SAPE"
FT   CDS_pept        complement(159414..160310)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24869"
FT                   /protein_id="CAW24869.1"
FT                   /translation="MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQI
FT                   ELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQ
FT                   WYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLTNSG
FT                   ILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDT
FT                   ADAPWTVIKSDDKKRARLNCIRHFLHSLDYPDKDRRIAHEPDPLLVGPASRVIEEDEKV
FT                   YAEAAAAPGHANLDIPA"
FT   CDS_pept        160768..162117
FT                   /transl_table=11
FT                   /locus_tag="PLES_01431"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24870"
FT                   /protein_id="CAW24870.1"
FT                   /translation="MSRTWIRNPLAIFTANGLDAAGGLVVEDGRIVELLGAGQQPAQPC
FT                   ASQFDASRHVVLPGLVNTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKLEL
FT                   ATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLGEKD
FT                   GGLPPQQTVQEAETILADSERLIARYHQRGDGARVQIALAPCSPFSVTPEIMRASAELA
FT                   ARHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAEEIRRL
FT                   GEAGTGICHCPSSNMRLASGICPTVELEAAGAPIGLGVDGSASNDASNMILEARQALYL
FT                   QRLRYGAERITPELALGWATRGSARLLGRSDIGELAPGKQADLALFKLDELRFSGSHDP
FT                   LSALLLCAADRADRVMVGGAWRVVDGAVEGLDLAALIARHREAASALIAG"
FT   CDS_pept        162225..163277
FT                   /transl_table=11
FT                   /gene="nuh"
FT                   /locus_tag="PLES_01441"
FT                   /product="nonspecific ribonucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24871"
FT                   /protein_id="CAW24871.1"
FT                   /translation="MSRAARPCNRFCSLLLGLALLMPASLPLSAAETVAPPSPRTLIID
FT                   TDPGADDVIALLFAMASPKELKIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVYAG
FT                   APRPLLRTPIYAADVHGSEGISGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTLAML
FT                   GPETNLALALTQAPDIVKGIREIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVLKSGA
FT                   PITMLPLDVTHKILTSPERIAKLRNLGNQAGKTVADILDAYVQYDIKYYGLKGGPVHDA
FT                   TVVAYLLKPSLFKGKRINVQVDSREGITFGQTVADWYGGLKQPANVEWINEGDAQGFFD
FT                   LLTERIARLP"
FT   CDS_pept        complement(163305..163931)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01451"
FT                   /product="putative nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24872"
FT                   /protein_id="CAW24872.1"
FT                   /translation="MNRSKGSSSRRTFLRLAALLLPAGALLGSLPGVRAAARPRKLYLA
FT                   GPDVFRADAVAHGEALKALCARYGFEGLYPLDNALPKQLAEPREQAAWIYRANIGLIER
FT                   ADAVLANLNFFRGAEPDSGTAFEVGYATALGKPVYGYVDDAGSYAERIRRHTPELIGED
FT                   PTRDRDGMTLEEFGLPLNLMLAVPATLVVGDAEQALRQLASRRHG"
FT   CDS_pept        complement(164053..164568)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01461"
FT                   /product="putative nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24873"
FT                   /protein_id="CAW24873.1"
FT                   /translation="MTAIYLAGPDVFRPDAEAHGETLKALCAEFGFVGLYPLDHALPAD
FT                   IREPAAQAAWIYRANVGLIERADCVLANLEPFRGSEPDSGTAFEVGYALALGKPVYAYL
FT                   SDAGAYAERLARLAPEWLGEHPGEDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREALRR
FT                   LAEELERA"
FT   CDS_pept        164807..165904
FT                   /transl_table=11
FT                   /locus_tag="PLES_01471"
FT                   /product="putative basic membrane protein (bmp)"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24874"
FT                   /protein_id="CAW24874.1"
FT                   /translation="MKHRRTQSRMSVLRRLAAVLGLGACALAAEAAEPLKIGFVYVGPV
FT                   GDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTSFG
FT                   YMNPTAKVARQFPKVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKIGYI
FT                   ASFPIPEVIRDINAIQLALDKYDPQAELKVMWVSTWFDPGKEADAANALIDQGVDVVFQ
FT                   HTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMDGTWKS
FT                   EDFWGGLAESTVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSGKERFAA
FT                   GVSATNADLASMNYYVEGIKADLPK"
FT   CDS_pept        165977..166939
FT                   /transl_table=11
FT                   /locus_tag="PLES_01481"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24875"
FT                   /protein_id="CAW24875.1"
FT                   /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPLP
FT                   AARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFDMA
FT                   LHLPAEHPDVRAGKSFYGPNRHPDLPGWEALLEGHYADMLALARTVLRALAIALGIEED
FT                   FFDRRFEQPVSVFRLIHYPPASARQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQNRQG
FT                   EWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVISPRGVHRYSMPFFAEPHMDTEIR
FT                   CLPGCFDADNPPKYPPTTCGDWLTSRFAQTYAYRRGETA"
FT   CDS_pept        167044..167994
FT                   /transl_table=11
FT                   /locus_tag="PLES_01491"
FT                   /product="probable adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24876"
FT                   /db_xref="GOA:B7V265"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V265"
FT                   /protein_id="CAW24876.1"
FT                   /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETL
FT                   RKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTD
FT                   RGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAV
FT                   GLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRA
FT                   FEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFG
FT                   GYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
FT   CDS_pept        168191..168736
FT                   /transl_table=11
FT                   /locus_tag="PLES_01501"
FT                   /product="probable sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24877"
FT                   /protein_id="CAW24877.1"
FT                   /translation="MPADGEAARRADLLKAFLAQRQRMESLVSRWVGCRATAADLVQEL
FT                   FLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDDWLPEQRQGEPVGPEQA
FT                   LEAGDQWRRVEAALRGLPERTRRIFLLNRIHGRTYAEIAQAMQLSQSAVEKHMMRALDA
FT                   CKASLAGPAGEQARSAQP"
FT   CDS_pept        168733..169728
FT                   /transl_table=11
FT                   /locus_tag="PLES_01511"
FT                   /product="probable transmembrane sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24878"
FT                   /protein_id="CAW24878.1"
FT                   /translation="MTRPDSDAAPYEPVLEQTAQAWLVRLRGTPDAATRRAFEDWLAQR
FT                   PAHAEAYARAEALWRLTEIPASRLAIEEADALEAYLRPRRASRNPRRWAYPLASVACLL
FT                   AMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQRRV
FT                   ELLRGAAALRVKRDALPFVVEAGEGRARVLGTEFEVRRGAGATRVTVLQGRVAVSAGTG
FT                   AGAAEEVLGAGQQVGFADGKLGRPVAIDAAAALAWRQGWLSFYRRPLAEVLDELARYYP
FT                   GRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
FT   CDS_pept        169876..172263
FT                   /transl_table=11
FT                   /locus_tag="PLES_01521"
FT                   /product="probable TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24879"
FT                   /protein_id="CAW24879.1"
FT                   /translation="MTPFPRFALRTLPALFLSLGCLAATVQAAEAVRYRFSQAAAPLAQ
FT                   ALNAFSRASGQTLLYTAELPPQATAPALHGSLVAEEALQRLLQGSGLRARRIDERTLTL
FT                   EPIPASGALDLDATTVSAAAPAQGYRPAANASISRGDAPLLEIPQAISVVPAQALQDQR
FT                   PRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTATADH
FT                   VEVLKGPASLLYGIQDPGGVVNVVSKKPQLQQANALTLRGSAYAHGRNGSGGQLDSTGP
FT                   LGDSGLAYRMILDHEDEDYWRDFGKSRETLVAPSLAWYGEDTTVNLSYEHREFTTPFDR
FT                   GTAIDPRTNRPLDIPRSRRLDEPFNITESRSELTRLDLERQLDDTWKAHFGYGYSRETY
FT                   DDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGTLQLAGMQHDLQFGMDHEKR
FT                   KIFRADLLRDSKTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYFQDSIHLDER
FT                   WILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSLYGSYTRSFKP
FT                   NSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRKKNVLVNELDGA
FT                   GNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLAAEVTEDPTLEGKRLQNVARNT
FT                   ASLSAVYELGQLFGGDRLRLGGGARYVGKRPGDPANSFDLPSYTVADAFASYDTRFGGH
FT                   GVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQVSTTVEF"
FT   CDS_pept        172639..173466
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="PLES_01531"
FT                   /product="transcriptional regulator PcaQ"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24880"
FT                   /protein_id="CAW24880.1"
FT                   /translation="MAVSQPAISKTLKELEEILGARLFERSKAGAELTEAGVTFLRYAG
FT                   PCVQALRDGVNTLRGHEAQVETVRVGVLSTVESLVVPEVIRRLHRRHGALVVSVATGPS
FT                   AYLLAQLKVGELDLVVGRMTDSPDIQGLTFEHLYSESMMLVVRPGHPLLAAPLGDLQRL
FT                   AEFPLVLPLAGTTIRRHADSLFVQWGIALAGQRLETLSPTLSRSYVLRSEAIWVAPRDA
FT                   VRLDVGNGELAELDLGIREPGGSVGLCHNAALPLPLGAQWFSAVLREVAAELH"
FT   CDS_pept        173601..174320
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="PLES_01541"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24881"
FT                   /protein_id="CAW24881.1"
FT                   /translation="MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLS
FT                   ETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQAN
FT                   AGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIH
FT                   VSISGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPGAAQSLIGRLDMSMANPMDCLAY
FT                   RFDIVLRGQRKTFFENA"
FT   CDS_pept        174331..174936
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="PLES_01551"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24882"
FT                   /protein_id="CAW24882.1"
FT                   /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREDA
FT                   PGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPERPFNSFGRTATTFDAGE
FT                   WTLHTVKPGVVRNAQGVPMAPHINVSLFARGINIHLQTRLYFDDETEANAACPVLNLIE
FT                   QAPRRDTLLARRCEVDGQLAYRFDIRIQGDNETVFFDF"
FT   CDS_pept        175143..175982
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="PLES_01561"
FT                   /product="transcriptional regulator PcaR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24883"
FT                   /protein_id="CAW24883.1"
FT                   /translation="MSELPEHPATLAPPTVLSPAKRIEAFTGDPNFMTSLARGLAVIHA
FT                   FQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGHAYLS
FT                   STPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGSRLPAY
FT                   CTSMGRILLAALDDDALHAYFGGVEMQAKTSRTLYTPETLLPCLVEIRRQGWCIVDQEL
FT                   EVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELESRFLPLLLEASRELSARLFT"
FT   CDS_pept        176135..177286
FT                   /transl_table=11
FT                   /locus_tag="PLES_01571"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux membrane fusion protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24884"
FT                   /protein_id="CAW24884.1"
FT                   /translation="MSDARGAFHSKGRWSRMALPAILCAGLLVGCGAEPPAEEHVRVLA
FT                   QTVKMAEFASATSITGDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQ
FT                   RSNVENAQAAVAAQQAQSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSLKAA
FT                   QAQLANARDLLSYTELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYES
FT                   LFSHDVDGQRITVSLLGKPEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEMSLGSV
FT                   VNASVAAPAEHSVVLPWSALSKVGEQPAVWLLDQQGKARLQPVRVARYASEKVVIDGGL
FT                   EAGQTVVTVGGQLLHPGQVVEVAQPPQPTQSTASRDAVGGGQP"
FT   CDS_pept        177283..178353
FT                   /transl_table=11
FT                   /locus_tag="PLES_01581"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux membrane fusion protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24885"
FT                   /protein_id="CAW24885.1"
FT                   /translation="MKPFSLAGLFGFALLLSGCGDEPQPAPPRPVLTVTVKTLKNDDLG
FT                   RFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLA
FT                   SAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLS
FT                   YTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFL
FT                   VSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVR
FT                   SVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGV
FT                   NSLKPGQKIKLDEDAR"
FT   CDS_pept        178350..181397
FT                   /transl_table=11
FT                   /locus_tag="PLES_01591"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24886"
FT                   /protein_id="CAW24886.1"
FT                   /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSFA
FT                   IKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDTTK
FT                   AGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLRDYV
FT                   EKVRLDIRSVKDLGKVQMIGAQNEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAVTPSG
FT                   VVEAGPERISVRTSGNFRSEKDLQAVNLRVNDRFYRLSDLASISRDFVDPPTSLFRYKG
FT                   EPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKAVGGFTR
FT                   ALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSLGALIIAL
FT                   GLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFVPIGLNASS
FT                   AGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKGRIAERFDSLLH
FT                   LAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQNSSIHETRAVM
FT                   DRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTKDLEARERVAAR
FT                   LRDRLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMGLAGVLDGNPNIG
FT                   DIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVTQVRDDIYLVNVIG
FT                   RAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWRRDRKPTITVKASLR
FT                   GEIQPTDLVARLAPEVKRFADGLPANYRIEVGGTVEESGKAEGPIAKVVPLMLFLMATF
FT                   LMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILGILALIGIIIRNSVILV
FT                   TQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGI
FT                   VAATLLTLIFLPALYVAWYRIPEPGR"
FT   CDS_pept        181596..182534
FT                   /transl_table=11
FT                   /locus_tag="PLES_01601"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24887"
FT                   /protein_id="CAW24887.1"
FT                   /translation="MDTLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHLQ
FT                   TRLLHRTTRRLALTEAGERYLERCRGILEDIEVAEAEAAGAHIRPCGRLRVQSLMGMGQ
FT                   HHLVPMIARYGALFPDVVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLGSIH
FT                   SVLCASPGYLQQHGVPRSVDDLERHVCLRLQDPAYPEGWIFADEQGERTVSPQNTFMVN
FT                   VAEVMAQAAKADLGIALLPSYVAAAALRNGELLRVLPGHAMHQRTIYALYPSRRYLDAK
FT                   IRTWVDLLQQELPQAFARDETTMQSSSYWAQ"
FT   CDS_pept        182650..182835
FT                   /transl_table=11
FT                   /locus_tag="PLES_01611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24888"
FT                   /protein_id="CAW24888.1"
FT                   /translation="MNRQILAAAILSLFSLAFSQAGFAEESSLMTNRMVDANQQAIEHQ
FT                   QELSASAAQAGARSDS"
FT   CDS_pept        183116..183268
FT                   /transl_table=11
FT                   /locus_tag="PLES_01621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24889"
FT                   /protein_id="CAW24889.1"
FT                   /translation="MESLKPDESKRLSIEESDCVPAGFQCPEIHWQDFPTPNFDCSYST
FT                   SSQGR"
FT   CDS_pept        183424..184758
FT                   /transl_table=11
FT                   /gene="opdC"
FT                   /locus_tag="PLES_01631"
FT                   /product="histidine porin OpdC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24890"
FT                   /protein_id="CAW24890.1"
FT                   /translation="MRNLFALTPMALALCTASAAWADEGEAKEGFIEGSSLQLLTRNYY
FT                   FNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTSIL
FT                   PITAPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTF
FT                   RGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGGTWGG
FT                   IEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNN
FT                   TYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQ
FT                   YDYDFVALGLPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYV
FT                   VQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF"
FT   CDS_pept        complement(184787..185584)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01641"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24891"
FT                   /protein_id="CAW24891.1"
FT                   /translation="MTMNGQPAELHRPIPTLARLPRPVYARAESLRAGSWTSRHRHAWV
FT                   QLSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAWAP
FT                   TRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPMPRE
FT                   PRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRLLASL
FT                   NALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
FT   CDS_pept        185662..187278
FT                   /transl_table=11
FT                   /locus_tag="PLES_01651"
FT                   /product="probable gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24892"
FT                   /protein_id="CAW24892.1"
FT                   /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGGN
FT                   AIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAAGH
FT                   ERMPLYGWTPVTVPGCPAAWGELSRRFGKLPFEQLLRPAIELARDGFPVSPVIARLWQS
FT                   GLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESFYRGE
FT                   LARAIVGHAERSGGYLRAEDLAGYQAKWVEPISLNYRGYDVWEIPPSGQGLIALMTLNI
FT                   LKGFEFGERDCARTWHRQLEAMKLAYVDGLHYISQPQSMRVSVEELLHEDYAASRRALI
FT                   GERALDPSPGQPRPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIALQNRGAE
FT                   FSLDPDHVNCLEPGKQTFHTIIPGFLSKDGVPLGPFGVMGAYMQPQGHVQMVMNLVDFG
FT                   LNPQAALDAPRWQWLGGLRVGIEHAAPRALAAELAQRGHQVEIAYDSTSYGRGQIVLRD
FT                   PASGVLCGGTEPRTDSQIAVW"
FT   CDS_pept        187950..188786
FT                   /transl_table=11
FT                   /locus_tag="PLES_01661"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24893"
FT                   /protein_id="CAW24893.1"
FT                   /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESL
FT                   TYLYGKNFKINPSIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITP
FT                   RLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYR
FT                   KPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLH
FT                   FNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF"
FT   CDS_pept        189028..190434
FT                   /transl_table=11
FT                   /locus_tag="PLES_01671"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24894"
FT                   /protein_id="CAW24894.1"
FT                   /translation="MHSEDQRPNDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPLV
FT                   IGSLLGLGEHLPYLISMALMVSGAGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAAGM
FT                   LVKQRGGGPEEILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVSLIK
FT                   VGITDLGGGAGATDFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVIGLALGTLAAW
FT                   ATGLFVPRALPELPLVSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTANCMLSR
FT                   QPLEGPAYLQRLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRHVGIYIG
FT                   GVLLALGLFPWVGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTPMDRRSVLIIAAS
FT                   FGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGITAILLNLLLPEERVAEAAQASAKGG
FT                   ALARWRKPLG"
FT   CDS_pept        190527..191192
FT                   /transl_table=11
FT                   /locus_tag="PLES_01681"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24895"
FT                   /protein_id="CAW24895.1"
FT                   /translation="MTLTVPAHDPAARDKPAGRIRQKNEEAILAAAEEEFARHGFKGTS
FT                   MNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDSTFNTLGVDDDPAEALARYIR
FT                   AKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMDPVD
FT                   PVHLIFLLWGSTQHYADFASQIGLVTGRKRMSRQDFAAAADNLVRIILKGCGLTPPAA"
FT   CDS_pept        191198..191788
FT                   /transl_table=11
FT                   /locus_tag="PLES_01691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24896"
FT                   /protein_id="CAW24896.1"
FT                   /translation="MPSTLQGLAEYREEIRKSRFHTIAAPVADEDEAQAFIAAHRDASA
FT                   GHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVAVLVSRWFGGIKLGTGGL
FT                   ARAYGGGAAKCLQQAPRSELVERCRVRFACAFADHALIKARSLALGASVAAEDYGADGV
FT                   VLTLELPVARFEALQALLVDLSRGQVRLQRLDA"
FT   CDS_pept        complement(191795..192502)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01701"
FT                   /product="putative GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24897"
FT                   /protein_id="CAW24897.1"
FT                   /translation="MRLERIARISDGFQSMAREQNLSLSERYHKQLRRLEKVARISDRY
FT                   QQMMRDLNLALKEASIRDPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQ
FT                   VNDTWGHDSGDRVLVEIARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVR
FT                   DSVRTLAVRVGTEALSVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAL
FT                   PPLPAPSRPAPAR"
FT   CDS_pept        complement(192629..193009)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24898"
FT                   /protein_id="CAW24898.1"
FT                   /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDW
FT                   VERFLAAGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNERV
FT                   AELAEEFREDCSFPFAIQAHDE"
FT   CDS_pept        complement(193036..193578)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24899"
FT                   /protein_id="CAW24899.1"
FT                   /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHAE
FT                   QAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLVER
FT                   DDGQSLVRSIQAIANLDKAALKAAYKEQLRRPRDSGCASGAGLGLLDIARKSSEPLAAS
FT                   LKEQPDGRAFFSLRAVI"
FT   CDS_pept        complement(193587..195578)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01731"
FT                   /product="putative serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24900"
FT                   /protein_id="CAW24900.1"
FT                   /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLAY
FT                   AKNFTLLHRQKILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRGDF
FT                   RDHAYFIIASGSQHYYFNDGRQPYSERPRYTLEAGDPEDAWYFNTLRNSAAYNINVNVD
FT                   SKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGAIQAH
FT                   PDRRLIAYSSAAGGASERHRVFDLLDQPEQRDALREAMRLARAKAGSVHCLWAGLDGRQ
FT                   QLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYAVERLLL
FT                   RPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELEDKVQERT
FT                   QALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKPRDVVGGDF
FT                   YVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAILGETDQAMR
FT                   SMLSQEQIPQALATNMDAGLVWVDRRRRQLAFAGAKISLYASDGEEVQELKGARRAIGD
FT                   KRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLRDHARQPLPEQA
FT                   EAFVATLAEYQGEHPQRDDITILSFRFD"
FT   CDS_pept        complement(195841..196890)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01741"
FT                   /product="probable methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24901"
FT                   /protein_id="CAW24901.1"
FT                   /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIK
FT                   QHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVDFI
FT                   AKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIALGAS
FT                   TGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPG
FT                   HALVAPGDHHMEVQRSGANYVVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTG
FT                   MGKDGARGLLAIRQAGGYTLAQDEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQA
FT                   ARRGSGNRL"
FT   CDS_pept        complement(196910..197512)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01751"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24902"
FT                   /protein_id="CAW24902.1"
FT                   /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASGEDLVIVTVLG
FT                   SCVSVCLRDPLNGIAGMNHFMLPERGLGGDPASPSARYGSHAMELLINRMLALGASRER
FT                   LQAKVFGGGSVLRQISAAIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGR
FT                   VLVKSLVELKNDTVLQRERDYRRRIDRNADGGPIDLF"
FT   CDS_pept        complement(197518..198360)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01761"
FT                   /product="probable chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24903"
FT                   /protein_id="CAW24903.1"
FT                   /translation="MPTSTPSPVFGNQEFHYTREDFQQVRERLYRLTGISLAESKAQLV
FT                   YSRLSRRLRLLRLGSFAEYFTHLDREPGEQQLFVNALTTNLTAFFRERHHFPLLADLAR
FT                   RQLQRHRPLRIWSAAASTGEEPYSIAITLVEALGSFDPPVKIVASDIDTGVLDCARQGV
FT                   YPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWSIAGELDA
FT                   IFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRSVGQTVYSPA"
FT   CDS_pept        complement(198430..200469)
FT                   /transl_table=11
FT                   /gene="aer2"
FT                   /locus_tag="PLES_01771"
FT                   /product="aerotaxis transducer Aer2"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24904"
FT                   /protein_id="CAW24904.1"
FT                   /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLY
FT                   DSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGV
FT                   NELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRGAAEATS
FT                   AQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDA
FT                   GRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAV
FT                   QWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEEAGKEGFFLRLAKDLNSLVDTADRGLR
FT                   DVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNDTAQSLSRMLGQIREAADTINTAAS
FT                   EIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANASEVATQGG
FT                   TVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAIRRVTDIMSEI
FT                   AAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGLLNQSVAVFRLD
FT                   TPPSVVQLASARPSAPRPSAPAPLARSGMARASKARKEDGWEEF"
FT   CDS_pept        complement(200505..200990)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01781"
FT                   /product="probable purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24905"
FT                   /protein_id="CAW24905.1"
FT                   /translation="MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAI
FT                   ANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSD
FT                   VIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAAA"
FT   CDS_pept        complement(200977..202896)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01791"
FT                   /product="probable two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24906"
FT                   /protein_id="CAW24906.1"
FT                   /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIFR
FT                   AAHSIKGSSGMFGFDDITAVTHELETLLDRIRCGQMHLRPDMISSFLEARDVLQRLLDA
FT                   HRSGSPDPGVPLLETVERLRGWLRVPEQEAAEEGFGLFDDAPARETADDDAFGFFDEGP
FT                   GAPERAAAPEAFGLFDEAPGAPAASEAFGLFDEAPGSPPAEERAFGLFDGAPGSPAAPS
FT                   APAQAVAAPARGAVAPVRGDGESGSIRVSVEKIDSLINLVGELVITQAMLGQLGEQLDP
FT                   SRHERLQHALAQLEHNTRDLQESVMSIRMLPINFIFSRFPRLVRDTATRLGKQVELHLH
FT                   GEHTELDKSVIEKLSDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKLAASHQGGSVV
FT                   VEVSDDGRGLSRPRILAKARERNLPVHDGMSDAEVWQLVFMPGFSTAETVTELSGRGVG
FT                   MDVVKRNIGAMGGRIDIDSAPGMGTRIGIRLPLTLAILDGLIVAVEAVNYVIPLTYIVE
FT                   SLQARSDDVRGLGGEDNAMIRVRGEYLPLFSLHELLRIGGEAPAPEQGIVVILESEGRS
FT                   FALQVDELVGQQQVVIKSLEQNFRRVEGIAGATIMGDGSVALILDVDALPRLAAREDTA
FT                   DERH"
FT   CDS_pept        complement(202924..203289)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01801"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24907"
FT                   /protein_id="CAW24907.1"
FT                   /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQSK
FT                   SYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGWLV
FT                   KPFDPPKLLEVTRKVLP"
FT   CDS_pept        complement(203487..204659)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01811"
FT                   /product="probable chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24908"
FT                   /protein_id="CAW24908.1"
FT                   /translation="MRESLGVSLPSRPLLLKLGLLSLPWALCAGLHAVGLGVWLVLALG
FT                   WFASLAMLVLLLRAPRQAVANANPQADAASPAWSAAQRALADETAQLDGHARQIDELLH
FT                   SAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGRGQVDEGINFQDFVRTTQQTLSLFVE
FT                   ATLETSRTSQQLVERMDQVRLKITEILQSTQDMDAIAKQTNLLALNAAIEAARAGESGR
FT                   GFAVVADEVRALSTRSTEFSAAIRKHVDVVHHEIQDAESAISQLADKDMSFALDSKHKI
FT                   QGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVDAAVTALQFQDMGSQLLGQMRKHHARL
FT                   GAFALGLGALEARPRQEWPERVAREVEELRRPLPSPVSQNSVNVGEVELF"
FT   CDS_pept        complement(204852..205784)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01821"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24909"
FT                   /protein_id="CAW24909.1"
FT                   /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNLG
FT                   VRLFQRSTRRLTLTEAGERFLQEVGGSLEGIQTALANVSSVGNQPSGTLKVSMGLAFGR
FT                   DYILPLLGEFLERYPDIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPGVVARNLTPGHL
FT                   ILLASPAYLRDKPPIRHPGDLGGFDGIRIRSPQTGRVRSWPLRRRNGEEAPIELRERMT
FT                   MSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAANKLLP
FT                   AKTRVFVDFVVDYFRRQDLARRFSAFPTG"
FT   CDS_pept        205901..206653
FT                   /transl_table=11
FT                   /locus_tag="PLES_01831"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24910"
FT                   /protein_id="CAW24910.1"
FT                   /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSSA
FT                   DKSRALAAELEGAGASILALHADSADAAALVAAVDEAAARFGRIDILVNNAAVLALGSV
FT                   EELPLADFERTLAINVRSVFVATQAAVKHMGDGGRVISIGSTNAERMPFAGGATYAMSK
FT                   SALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAEALKGLMALPRYARSEEI
FT                   ASFVAYLAGPEAAYITGASLTIDGGFSA"
FT   CDS_pept        complement(206753..208363)
FT                   /transl_table=11
FT                   /gene="atsA"
FT                   /locus_tag="PLES_01841"
FT                   /product="arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24911"
FT                   /protein_id="CAW24911.1"
FT                   /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTDF
FT                   HTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELEGKPGYEGHLNERVVALPELLREA
FT                   GYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGTPAL
FT                   YVEDERYLDTLPEGFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPREIVE
FT                   KYRGRYDAGPEALRQERLARLKELGLVEADVEAHPVLALTREWEALEDEERAKSARAME
FT                   VYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPDLLGFLD
FT                   RHYDNSLENIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYPRLSRQGA
FT                   ISHAFATVMDVTPTILDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEAAHDENTVT
FT                   GWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPGKLAELIEHW
FT                   KRYVSETGVVEGASPFLVR"
FT   CDS_pept        complement(208450..209289)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01851"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24912"
FT                   /protein_id="CAW24912.1"
FT                   /translation="MNAFAAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGEF
FT                   IAIVGASGCGKSTLLRLLIGLDRDYDGEIRVDGRPIAGIGGERGIVFQEHRLFPWLTVQ
FT                   QNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLVASP
FT                   RLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVMEPRP
FT                   GRIRRVVEVGLAHPRERGGFDFLRQREALLHELTADGEYVAPPPRRVENLPFEFIAC"
FT   CDS_pept        complement(209286..210902)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01861"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24913"
FT                   /protein_id="CAW24913.1"
FT                   /translation="MKNIDKTLSPAWSRPLPRLAPPPSAAFARRLGDGLLPWLLPLGLA
FT                   LLWWVASHRHWMSAQVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASGAA
FT                   LGAWLGFSPRAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVPVTI
FT                   HTLVGVRDAQPKLREAAAVLRLPPRLLVWRLILPAALPAFLTGLRLALAQGWTSLLAVE
FT                   LLASSEGIGYLMVQGRQLFMLDIVFVCILIIGLVGVGMDRAIQWLDRRLLHWPQAATGE
FT                   FRRRPPGRGWQRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSGALDGSL
FT                   PGALFDSLKRTLGGLLLGGGLGFLGGLLLGLWRPAERFFGPTFAALRQVAIFAWVPLLT
FT                   AWFGLGEPAKLTFVAIAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRRLLRLVLPG
FT                   AAPSVFAGLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIGAGMLLVGLT
FT                   GALLNALGQRIEARATRWRHA"
FT   CDS_pept        211169..212230
FT                   /transl_table=11
FT                   /locus_tag="PLES_01871"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24914"
FT                   /protein_id="CAW24914.1"
FT                   /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVSA
FT                   GSSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLGDL
FT                   AAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLSFDN
FT                   ALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLSTRDLN
FT                   GAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQASYPVV
FT                   ILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRREFSAEQWAAPELLEAAG
FT                   KLAKAKAVAQAAE"
FT   CDS_pept        212648..213463
FT                   /transl_table=11
FT                   /locus_tag="PLES_01881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24915"
FT                   /protein_id="CAW24915.1"
FT                   /translation="MNLDSKLFDATLDLERVKVSVRTLVKLSRQEQSAIIRTLNEFGFL
FT                   LLRSEHGEDRQELLALKELFGRAAPHPRADADGIVPISNARYVSGYLGSTPLEHKLHTD
FT                   GAFLDTPEQLCSLQCVRNAREGGETLLASAGLAFERLRRRMPTKHLGLLRGDALTIVRK
FT                   HQSSTQPVFRLNGEALGIKFRQNDGAAEVVEHPVAVEAFAELVAALEDPACQLRIKLEP
FT                   GEILVLDNTAVLHGRTAFCANELREMRRLNFDGHGRLRAELELGFKVGL"
FT   CDS_pept        213460..214341
FT                   /transl_table=11
FT                   /locus_tag="PLES_01891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24916"
FT                   /protein_id="CAW24916.1"
FT                   /translation="MIAQFVAVVLPILICTGIGFAWSRSAGPVDTRALVFLVANVGFPC
FT                   LLLSSLDRPGLSIGMVAGVFLATALAVLAFALLGLVALRLLRMPVRRYLPSIMLPNSGN
FT                   MGIPIAYLAFGEEALVYAVAFSTLIQVGHATLGVWFASGDITPASILRNPMIYALAVAL
FT                   GLIALGWSLPPPLRDVTRLLGGITVPLMLVMLGLSLAGLRLHETWRPLLLSLVRVWGGF
FT                   AVGYGIAAGLGMEAVAAGTFAIQCGMPTAVLTYLLAKRYDGPVNEVAGMVLITTLLVLL
FT                   STPLFIQLLPRA"
FT   CDS_pept        complement(214379..215737)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01901"
FT                   /product="probable porin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24917"
FT                   /protein_id="CAW24917.1"
FT                   /translation="MQNLRRAVFAGLVAGTLSEGAAATAGDGGFVEDSELQFLARTYYF
FT                   NRDYRDSPNNAGRNRFKPRSERNGYREEATQGLRLQFASGYTPGSLGFGLDAHAMLGLQ
FT                   LDSGGGRTGTGNLPVGADGHPDHRYGKVGGALRLRHGETRLKYGQTTTSAPVFAASSNR
FT                   TLAGMAYGLLLEDRSFDGLLLEGGRFTAASGPGESKVRGDISTVYGRLGAYSVRLDAVG
FT                   FLGGQWQATERLQLSLYASRFDDIWQQAYFGASHRQPLGGERALRVDLDAYRTRDSGQS
FT                   RFGRIDTLASSLALGYEQGPQRITLAYQRVHGEQPFDYMAFGDGRSSASMVLANSVGYS
FT                   DFNGPGERSWQLRYDLDLGALGLPGLSLHALHARGRAGASASSAAESIYAGLYGRDGRH
FT                   RESDLGFAYRVKAGPLAGLALRASQAWHRGNASYLDGDIDETRLVVDYSRSIW"
FT   CDS_pept        215985..216710
FT                   /transl_table=11
FT                   /locus_tag="PLES_01911"
FT                   /product="probable acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24918"
FT                   /protein_id="CAW24918.1"
FT                   /translation="MNNKTLCPSLLLCLSLLAPLSCLGETAAAPYPLAHPPRLADYLPP
FT                   PPAADSAAAVADLGAVLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGASFDKERLP
FT                   LTRSFFNRAQENLVEVLMPAKKHFARPRPYEVTPKVKPVLPPPEGESYPSGHTMDSYFK
FT                   ASLLSMLVPEHHDAFFARAEEHAQSRVLAGVHFPSDLEGGQTAAAALVASLLADPAVAA
FT                   DFAAVREELRGALGLPKLQ"
FT   CDS_pept        complement(216734..217651)
FT                   /transl_table=11
FT                   /locus_tag="PLES_01921"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24919"
FT                   /protein_id="CAW24919.1"
FT                   /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELGC
FT                   QLVDRGSKDLRPTPEGQVVLQHALSLVQGSANLIHEIAQLNKLDAGELRFGSGPAPAQQ
FT                   LVPDAVADFINRHPRVQISLDVDNWEKLSRALLREEIEFFVADIRDFEADPNFQTRPLT
FT                   PRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAANIRCE
FT                   NMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGIISRSGY
FT                   RLSAAAKAMIETLVELDQAQHAAA"
FT   CDS_pept        218001..220373
FT                   /transl_table=11
FT                   /locus_tag="PLES_01931"
FT                   /product="probable TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24920"
FT                   /protein_id="CAW24920.1"
FT                   /translation="MKHHYRLPLRRTPPGGSDYALALLLALGGALPASAADAPAPAEEA
FT                   PPLASSLPDKADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQVL
FT                   PSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIEQLE
FT                   LLRGPQGTLFGKNTTAGVLNISTRAPTFTAERTVEVSGGQDGYFQGRGTVSGPLGETLA
FT                   GRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEEDSSNG
FT                   SMVVYGGAERFWQRAALVGASPLRDPQRRKVNINGRQHVSVHQGGSSLEANWNLAGGYR
FT                   LTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFDYVVGAYA
FT                   FRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQGTWHLTERL
FT                   DFTAGLRGTYEEKNAKVERFAPLGGAAVGGVGAAVRNGQLGAYDSGDLSQYNFAPSALL
FT                   SLSYQFSDDLLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERANDAELGLKSTLF
FT                   DRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLEFEATALPLRGL
FT                   TLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLTGQRVVGASKWIANLNGEYQWR
FT                   LDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSDLGDGQLDTSVWLK
FT                   NAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
FT   CDS_pept        220414..221316
FT                   /transl_table=11
FT                   /locus_tag="PLES_01941"
FT                   /product="putative alkylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24921"
FT                   /protein_id="CAW24921.1"
FT                   /translation="MSNAAQALATPVRLDIRPVAGRIGAEIRGVTLSGELDAATVEAIQ
FT                   AALVRHKVIFFRDQSHLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRRAN
FT                   SWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAVHSN
FT                   EYDYAGVKPSASVEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRLKGLS
FT                   QHDSAHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAIDDYGDQPRVVRRVTL
FT                   GGDVPVGIDGQRSRTIRKA"
FT   CDS_pept        221384..222283
FT                   /transl_table=11
FT                   /locus_tag="PLES_01951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24922"
FT                   /protein_id="CAW24922.1"
FT                   /translation="MSQSATARQPEPEVAEAFRITPLEAPLGAEVRGLDARRPLAPEQV
FT                   LALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPDIVKV
FT                   ANTGDGELGNFALPAHIDHQWTPVPSSGSFLYALEVPSSGGETRFTNLARAYESLDEAT
FT                   RREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRRVLFL
FT                   SAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHARNAFP
FT                   ASERRRLKRISLAGSRPF"
FT   CDS_pept        222930..224048
FT                   /transl_table=11
FT                   /gene="pntAA"
FT                   /locus_tag="PLES_01961"
FT                   /product="putative NAD(P) transhydrogenase, subunit alpha
FT                   part 1"
FT                   /note="orf00295"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24923"
FT                   /protein_id="CAW24923.1"
FT                   /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNASQ
FT                   PDSAYEAAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIARM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATVAEMKP
FT                   GSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNILDFLKL
FT                   TLNAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
FT   CDS_pept        224432..225868
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PLES_01971"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24924"
FT                   /protein_id="CAW24924.1"
FT                   /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIAV
FT                   ATTVGLVFKLGAEIATTGVGYIVVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLRIVAHLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAVARAQHA
FT                   LMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQTDV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   CDS_pept        226211..227023
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="PLES_01981"
FT                   /product="putative TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24925"
FT                   /protein_id="CAW24925.1"
FT                   /translation="MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPAQGRV
FT                   LSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPP
FT                   EPLPPVVEEPPPPVIDENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPPQPA
FT                   APPAPPAPAAAPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSE
FT                   IQVQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVSVPIDFKLN"
FT   CDS_pept        227052..227771
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="PLES_01991"
FT                   /product="transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_01991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24926"
FT                   /protein_id="CAW24926.1"
FT                   /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDR
FT                   QFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLER
FT                   ALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHP
FT                   SAARQAGNPSRNVKEAS"
FT   CDS_pept        227773..228174
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="PLES_02001"
FT                   /product="transport protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24927"
FT                   /protein_id="CAW24927.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPIN
FT                   LPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQAD
FT                   EGVNYGQVAKAMASIERAGITRLAVITAR"
FT   CDS_pept        complement(228355..228567)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24928"
FT                   /protein_id="CAW24928.1"
FT                   /translation="MAKKFPLHPSHPERICWGCDRYCSAESMGCGNGASRTQHPSELFG
FT                   EDWAGEWEVEGTEDAKEQDAPARQA"
FT   CDS_pept        228783..229364
FT                   /transl_table=11
FT                   /locus_tag="PLES_02021"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24929"
FT                   /protein_id="CAW24929.1"
FT                   /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRALPNASRVEQQDWITPL
FT                   RADWIAELDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDQVRGALLVAPADVER
FT                   ESCAEALRNFAPISREPLPFPSVLVGSDNDQACSPQRAMHLARAWGAETVILPEAGHIN
FT                   VKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
FT   CDS_pept        229475..231139
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PLES_02031"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24930"
FT                   /protein_id="CAW24930.1"
FT                   /translation="MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPRERLVAALEA
FT                   LIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARK
FT                   LDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNV
FT                   YTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSN
FT                   RMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTPAW
FT                   LDMRGESEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDD
FT                   VTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDL
FT                   GIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
FT   CDS_pept        231139..232020
FT                   /transl_table=11
FT                   /locus_tag="PLES_02041"
FT                   /product="putative Triphosphoribosyl-dephospho-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24931"
FT                   /db_xref="GOA:B7V2C0"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2C0"
FT                   /protein_id="CAW24931.1"
FT                   /translation="MNAIANLAATPCADLGECLADLAVDALIDEAELSPKPALVDRRGN
FT                   GAHADLHLGLMQASALSLWPCFKEMADAAQRHGRIDARLRGVLGQLGRDGEAAMLRTTE
FT                   GVNTHRGAIWALGLLVAAAALEPRRTQAGEVAARAGRIALLDDPAAAIGDSHGERVRRR
FT                   YGVGGAREEARLGFPRAVRHGLPQLWRSREGGAGEQNARLDALLAIMSVLDDTCVLHRA
FT                   GRVGLAVMQDGARAVLAAGGSASLAGRRRLCELDRRLLALNASPGGAADLLAACLFLDR
FT                   LPAVSGGWAGSL"
FT   CDS_pept        232022..232321
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PLES_02051"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24932"
FT                   /db_xref="GOA:B7V2C1"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2C1"
FT                   /protein_id="CAW24932.1"
FT                   /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVV
FT                   TSVNGSGPRWQQLFARVFAAPTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD"
FT   CDS_pept        232314..233177
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PLES_02061"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24933"
FT                   /protein_id="CAW24933.1"
FT                   /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPW
FT                   LERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDN
FT                   RNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGM
FT                   SIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLAD
FT                   AYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLSDLDTAEQPDAAGVRRLYQGL
FT                   GQGDAT"
FT   CDS_pept        233174..233980
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PLES_02071"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24934"
FT                   /protein_id="CAW24934.1"
FT                   /translation="MSQPFASRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRFL
FT                   AVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGR
FT                   REEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGV
FT                   MVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTA
FT                   DLVRVRTCLGEALADILGGPRDLGGRLGAANREASARVRRLLREQW"
FT   CDS_pept        233996..234688
FT                   /transl_table=11
FT                   /locus_tag="PLES_02081"
FT                   /product="putative malonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24935"
FT                   /protein_id="CAW24935.1"
FT                   /translation="MVIANSSQRGSSRRRLAPDPMRRRAGPEPHDLLLGMAPAHLPENA
FT                   PAWVCAALKAGWPVVVRRAPADPARVAIGVRGLAREQRWAGWMPLAAITRRLRPEALGQ
FT                   REPAMLRDLPAWRALRDLRAPLNALGLAWGVTGGAGFELASGVAVLHPDSDLDLLLRTP
FT                   RPFPRDDALRLLQCFEQCPCRIDLQLQTPAGGVALREWAEGRPRVLAKGSEAPLLLEDP
FT                   WRIAEVEA"
FT   CDS_pept        234685..235617
FT                   /transl_table=11
FT                   /locus_tag="PLES_02091"
FT                   /product="probable acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24936"
FT                   /protein_id="CAW24936.1"
FT                   /translation="MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAEL
FT                   ESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFDDA
FT                   LRLVALRGELMQAAWPEGYGMSAILGLEQAQLEALILAVRREHPPLYLANVNAERQLVV
FT                   AGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGIRLHRPRVPY
FT                   LSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARP
FT                   LFGCATPAFEGSRADTLDALLREEEKRTR"
FT   CDS_pept        235674..236078
FT                   /transl_table=11
FT                   /locus_tag="PLES_02101"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24937"
FT                   /protein_id="CAW24937.1"
FT                   /translation="MIIYGVALLSLCTLAGLFIGEILGVLLGVPANVGGVGIAMLLLIF
FT                   VGSYLGKRGLLSAKTEQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAVAV
FT                   AFALVPLLDRFGRKKAEGAPPLKPRTSVQG"
FT   CDS_pept        236084..236848
FT                   /transl_table=11
FT                   /locus_tag="PLES_02111"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24938"
FT                   /protein_id="CAW24938.1"
FT                   /translation="MFESLNKVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSAI
FT                   AIFLGLVLSYVGGVATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELRRA
FT                   GVSGVVSLFLGVGSSFVAGVAVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGASSE
FT                   VMALSIAAGLVKAILVMVLTPFVAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAATDPKL
FT                   VPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
FT   CDS_pept        complement(236933..237862)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02121"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24939"
FT                   /protein_id="CAW24939.1"
FT                   /translation="MLIDEEITLKKLETFLAFMRTGNLARAAAELGTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLGAL
FT                   YSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSDPDC
FT                   EHLPLFSDDIFLAVPVDSPYARLAEIDLSTLRDTPFVTLTQGFATHQDGTRVFQQAGFE
FT                   PQIAMQVNDIFTLLSMVSSGVGHALLPKRIEAVYENRVRLIPLQPRYRLQQHIGVVFLK
FT                   AKERDPNLLALLAECRMYSLRLEQEAAG"
FT   CDS_pept        complement(238050..238487)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02131"
FT                   /product="conserved hypothetical protein"
FT                   /note="orf00322"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24940"
FT                   /protein_id="CAW24940.1"
FT                   /translation="MKKFLLPALLFAAASLTGCASYNVSQPIAPVAGAVKTDLKADVAV
FT                   GEPISGDSSVNILFGFLKFGGDSQFADGVTYGAESGSGLSLGAFDPVSSAKAAAAFKAV
FT                   KNSNADLIVAPRYEVSVNDYFLFKKVDVKVTGSKGTIRSIR"
FT   CDS_pept        complement(238679..239599)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02141"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24941"
FT                   /protein_id="CAW24941.1"
FT                   /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEES
FT                   FGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCFET
FT                   VAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIETEP
FT                   LMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLTPNIA
FT                   FSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVIMVDLAEPVSTSGLAAAWLKRA
FT                   QLTKPARLFVDYCREQLGKLAERRH"
FT   CDS_pept        complement(239620..239805)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02151"
FT                   /product="hypothetical protein"
FT                   /note="orf00329"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24942"
FT                   /protein_id="CAW24942.1"
FT                   /translation="MSSGHKKKLARRAPAKCVVLGYRAGGQSSSRPAPRRSAAACNLLA
FT                   ARRTQQSRRARPARGG"
FT   CDS_pept        239950..241440
FT                   /transl_table=11
FT                   /locus_tag="PLES_02161"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24943"
FT                   /protein_id="CAW24943.1"
FT                   /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNRL
FT                   LARVAACDAADVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALLDS
FT                   LNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAQQALATITRVPLGVIGAVV
FT                   PWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGMPEGVLNVVPGLG
FT                   EQAGKALGLHPEVDALVFTGSTEVGKYFMRYSAQSNLKQVWLECGGKSPNLVFADCRDL
FT                   DLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLDPASRAG
FT                   AIVDRRQTAGILAAIERAQGEGATLLGGGRQLTINGSDNFIEPTLFGDVRPDMQLAREE
FT                   IFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGTVSVNTVDA
FT                   LDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
FT   CDS_pept        241498..242931
FT                   /transl_table=11
FT                   /locus_tag="PLES_02171"
FT                   /product="probable amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24944"
FT                   /protein_id="CAW24944.1"
FT                   /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGTA
FT                   GLGFIVPLGVAYLLALSYAFSFSELALMIPRAGSLSSYTEVAIGHFPAILATFSGYVVV
FT                   AMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALALLM
FT                   MIVLLVLGLGAVSSDHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLVEETR
FT                   RPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGEYGQLF
FT                   LVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFKQLSRRARTPWVAVLFVAAITG
FT                   LPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTPFYPLPQL
FT                   FGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLFVPEPLETA
FT                   GETAQGKSVALDPLQSPSA"
FT   CDS_pept        242962..244344
FT                   /transl_table=11
FT                   /locus_tag="PLES_02181"
FT                   /product="probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24945"
FT                   /protein_id="CAW24945.1"
FT                   /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGDG
FT                   LQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVELS
FT                   EMLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGSTLG
FT                   STALGGMKFMHEMGGMLPDFAHIDEPYWYANGGELSPAEFGRRAALQLEEKILELGAEN
FT                   VAAFVAEPFQGAGGMIFPPQSYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFG
FT                   FQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAAVAIANL
FT                   KALRDEGVVTRVREETGPYLQRCLREVFGDHPLVGEVQGAGFVAALQFAEDKATRKRFA
FT                   NENDLAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREIG
FT                   VL"
FT   CDS_pept        244508..245566
FT                   /transl_table=11
FT                   /locus_tag="PLES_02191"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24946"
FT                   /protein_id="CAW24946.1"
FT                   /translation="MFKSLHQYAHVFSRLSLFGLAFAAAAQAQSQSLTVISFGGATKAA
FT                   QEQAYFKPFERSGGGQVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLF
FT                   ERLDPARFGDPAQFVPGTFSECGVATYVWSMVMAYDSTKLARAPQSWADFWNVREFPGK
FT                   RGLRKGAKYTLEVALLADGVKAEDLYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPP
FT                   QWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIA
FT                   FASQPQTQKVFSEQIPYGPVHKGTLALLPKTVQEALPTAPANLEGARAVDAEFWVDHGE
FT                   ELEQRFNAWAAR"
FT   CDS_pept        complement(245643..246524)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02201"
FT                   /product="probable dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24947"
FT                   /protein_id="CAW24947.1"
FT                   /translation="MSASIHGIIGYTITPFAADGGLDLPALGRSIERLIDGGVHAIAPL
FT                   GSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEAVM
FT                   VLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDNVTM
FT                   VKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCSAAPNLIPTLNGQLY
FT                   QAVLDGDLEKARALFYRQLPLLDFLLRRGLPTTIKAGLGLSGLEVGAPRLPVQALDTEG
FT                   CRYLQGLLEELR"
FT   CDS_pept        complement(246584..247366)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02211"
FT                   /product="probable aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24948"
FT                   /protein_id="CAW24948.1"
FT                   /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEA
FT                   GHDSGLAGQITSRGPEAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRF
FT                   HSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGN
FT                   EEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPI
FT                   PPALAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
FT   CDS_pept        247521..248060
FT                   /transl_table=11
FT                   /locus_tag="PLES_02221"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24949"
FT                   /protein_id="CAW24949.1"
FT                   /translation="MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAAA
FT                   LKLAKALNVQVEELFSEESDGVDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARALLP
FT                   FIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHRIRS
FT                   LGETQAELLVVIHSDE"
FT   CDS_pept        248211..249062
FT                   /transl_table=11
FT                   /locus_tag="PLES_02231"
FT                   /product="probable CoA transferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24950"
FT                   /protein_id="CAW24950.1"
FT                   /translation="MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRKD
FT                   LTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEHSH
FT                   ADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVI
FT                   HAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWALSAVC
FT                   LVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQAKLAEG
FT                   KR"
FT   CDS_pept        249059..249841
FT                   /transl_table=11
FT                   /locus_tag="PLES_02241"
FT                   /product="probable CoA transferase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24951"
FT                   /protein_id="CAW24951.1"
FT                   /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSPD
FT                   VVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQV
FT                   DRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFVTSVG
FT                   HGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEATGWAI
FT                   RFAERVAETPAPSEVELAALRDLEARTAAAHGQKGSDE"
FT   CDS_pept        249838..251043
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="PLES_02251"
FT                   /product="beta-ketoadipyl CoA thiolase PcaF"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24952"
FT                   /protein_id="CAW24952.1"
FT                   /translation="MSREVFICDAVRTPIGRFGGSLSAVRADDLAAVPLKALVERNPGV
FT                   DWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAFRA
FT                   IACGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYGIDP
FT                   MPQTADNVADDYRVSRADQDAFALRSQQRAGRAQEAGFFAEEIVPVTIRGRKGDTLVEH
FT                   DEHPRPDTTLEALARLKPVNGPEKTVTAGNASGVNDGAAALVLASAEAVEKHGLTPRAR
FT                   VLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACLRELGVA
FT                   DDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQGLALAIE
FT                   RV"
FT   CDS_pept        251193..252491
FT                   /transl_table=11
FT                   /gene="pcaT"
FT                   /locus_tag="PLES_02261"
FT                   /product="dicarboxylic acid transporter PcaT"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24953"
FT                   /protein_id="CAW24953.1"
FT                   /translation="MTAPVHQYSNEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYFA
FT                   PAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAGSL
FT                   AIACMPTYASIGTLAPALLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASFQYV
FT                   TLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETASKST
FT                   LERKESGTFAELFKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKTASAVM
FT                   TFALLAYMLMQPLFGMLSDRIGRKTSMLWFGTLGTLCTLPILLALKTVSSPYMAFFLII
FT                   LALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALGLKSVGMEN
FT                   VFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
FT   CDS_pept        252514..253893
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="PLES_02271"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24954"
FT                   /protein_id="CAW24954.1"
FT                   /translation="MSDVPANQLFDAYFMAAPMRAVFSDRGRLQGMLDFEAALARAEAR
FT                   TGVVPATAVAPIEAACRAELYDPLALAEAVATAGNSAIPLVKALGRQVAAGDAEAERYV
FT                   HLGATSQDAMDSGLVLQLRRALALLEQDLQRLAEVLADQAERHADTPLAGRTWLQHATP
FT                   VTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALAEELG
FT                   LALPEQPWHTQRDRLVEFASVLGLVAGSLGKFGRDVSLLMQTEAGEVFEPAGAGRGGSS
FT                   TMPHKRNPVSSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPELCCLVAG
FT                   ALQQAIGLLEGLEVDAQRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLVEQCCRRA
FT                   VEQRRELRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHHALGLEPHP
FT                   A"
FT   CDS_pept        253908..254699
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="PLES_02281"
FT                   /product="beta-ketoadipate enol-lactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24955"
FT                   /protein_id="CAW24955.1"
FT                   /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPALT
FT                   AHFRVLRYDTRGHGASLVTPGPYAIGQLGADVLALLDALELPRVHFCGLSMGGLIGQWL
FT                   GIHAGERLGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASVARWFTAGFAE
FT                   REPAQVERIVAMLAATSPQGYAANCAAVRDADFREQLGLVQAPTLIVAGSHDAVTTPDN
FT                   ARFMQARIADAQLVEFAAAHLSNVEAGDAFSRRLVDFLLSA"
FT   CDS_pept        254710..255111
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="PLES_02291"
FT                   /product="gamma-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24956"
FT                   /protein_id="CAW24956.1"
FT                   /translation="MDEKQRYEAGMQVRRAVLGDAHVERSLANLTPFNEEFQEMITRHA
FT                   WGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSAIY
FT                   CGIPAANATFHLAESVWDELGVESQQASR"
FT   CDS_pept        255286..256227
FT                   /transl_table=11
FT                   /locus_tag="PLES_02301"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24957"
FT                   /protein_id="CAW24957.1"
FT                   /translation="MSRKLHIHAPAIHYFDMVRRCHSIREAARRLNVASSAVNRQILKL
FT                   EDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLRTGHVEIATI
FT                   EAVTSDLLPCVLKAMRERYPDITVGVTLLGSQAIPEAVSSGAVDLGLAFALPRSADLQQ
FT                   VSVGHFRLGAIVSPQHPLARHQAIAFADCVEHGLIMAKSELSIHHLLAPLQRRLREPRR
FT                   AVLESSSLELSRQLARRGLGVAFQTRLGIEADIAQGELRFLPLKDNGGIHSDLGLYVRT
FT                   GRYLPVAVDALARQIAEEVRLREREEARLNQA"
FT   CDS_pept        256418..257251
FT                   /transl_table=11
FT                   /locus_tag="PLES_02311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24958"
FT                   /protein_id="CAW24958.1"
FT                   /translation="MKKMMQGAAALIALVGAGESMALEWMSNSVGFRYGQQFTNPNNPD
FT                   KFAKRIYSFTHADGYRYGSNFFNLDVFLSGNRDPRKGTDHGGSEVYAVYRHQLYASRVF
FT                   DRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKN
FT                   HFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGEKGEDYNDKDTAAE
FT                   TLVRTALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF"
FT   CDS_pept        complement(257895..259241)
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="PLES_02321"
FT                   /product="4-hydroxybenzoate transporter PcaK"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24959"
FT                   /protein_id="CAW24959.1"
FT                   /translation="MNSPSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLDT
FT                   AAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVFLF
FT                   GLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFCGFN
FT                   LGMACGGFVSAKLIPLFGWHSLLLLGGLLPLVLAVVLLFRLPESARYLVVRNRGSERVR
FT                   QVLAPIAPAQVALARSFHVPEQQTVQARNVFAVIFSGTYSAGTLLLWLTYFMGLVIVYL
FT                   LTSWLPTLMRDSGASLEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLFYLLAGV
FT                   FAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSWMLGIGRF
FT                   GAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
FT   CDS_pept        259547..260326
FT                   /transl_table=11
FT                   /locus_tag="PLES_02331"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24960"
FT                   /protein_id="CAW24960.1"
FT                   /translation="MAGSLIERALGLLELLASDARGLPLQQLADRLDIPKSAAHRMLAE
FT                   LIRLGYVRQDDDTSRYRLSTRLAALGFRFLASSGVVDLVQPVLDGLARETGELVRLGVI
FT                   EGDRQTWIAKSQGATSGLRYDPDMGREAPLFYTASGHAWLASLSDKAALALVERQGVGA
FT                   ARDFGPNAPRSRSELLRYLKRAREHGYAWQIECSAPGMAAMAALVRHPEDGRALGVLSV
FT                   AGPSARFGEARMHELAPLLLAAAQDLSHASQASELFR"
FT   CDS_pept        260570..261613
FT                   /transl_table=11
FT                   /locus_tag="PLES_02341"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24961"
FT                   /protein_id="CAW24961.1"
FT                   /translation="MDAPLRIALIGTGNMGRQHYHRLQRIAGARLCAVADPQGQAFAAD
FT                   AGVPWFGDHRRLLEEARPQAAIVANPNNLHVATALDCLAAGVPLLLEKPVGVQLDEVSE
FT                   LVAVARRSGVPLLVGHHRRHNPLVVRARQLIAEGALGRLLSVTALWQLKKPDSYFEVAW
FT                   RREPGAGMLLTNLIHDLDLLRYLCGEVREVQALAGNAIRGLPNEDNVALLLRFANGALG
FT                   SLTGCDAAAAPWSWELAAGENPVYPRQAEQPCYLLAGTEGALSLPQLRRWRYAEARQGW
FT                   HDPLAASVEAVAAGDPLQRQLEHFVRVARGEEAPLMDATDAARTLALVEAVREAARSGR
FT                   ACAPASF"
FT   CDS_pept        261636..262451
FT                   /transl_table=11
FT                   /locus_tag="PLES_02351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24962"
FT                   /protein_id="CAW24962.1"
FT                   /translation="MESRILSLAALTVLELSPPDMVEAAARAGYSHVGLRLVPATVEEH
FT                   HYPLLADAGLRRRTLARLRDSGVRTLDVEILRLRPDTRVGEFAAVLEVGAEFGARYVLV
FT                   AGNDDDERRSADNFAALCDLARPLGLDPHLEFMPWTGIRDLRQAARVVEAAARDNAGLL
FT                   LDAFHFDRSASSLEDLRAIPPARLGYAQLCDVVGPRPTSMDEILRQAREERRFPGDGGL
FT                   DLLALLRALPENLPLSLEVPALDLLARGVDGTERARLAIERTRALLARL"
FT   CDS_pept        262601..263479
FT                   /transl_table=11
FT                   /locus_tag="PLES_02361"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24963"
FT                   /protein_id="CAW24963.1"
FT                   /translation="MNASTSPLPASDQTLRGILLICAAVFLFASHDGLSKFLSGFYPIV
FT                   MVVWARYLVHTLLMVAVFVPRNGLAVIRSRRPLMQLARALCLIGTSLFFTTGLRYLPLA
FT                   EATAVNFLAPLLVTALSVPLLKEKVSLGQWLAVLTGFIGVLFIVRPGGALFTPAALFPL
FT                   GSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLMMIAL
FT                   GGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHVPDAWALLGILVICA
FT                   SGLVVAWRRGR"
FT   CDS_pept        complement(263505..264770)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02371"
FT                   /product="probable porin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24964"
FT                   /protein_id="CAW24964.1"
FT                   /translation="MSHPSHVRALCASLCLGAGLPVHAGHVHAGQGFLEDAKASLTARN
FT                   FHLHRNFVGDASQGKAEEWTQSFILDARSGFTQGSVGFGLDVLGLYSLKLDGGKGTAGT
FT                   QLLPIHDDGRPADDFGRLAVAGKLRVSNSELKIGEWMPVLPILRSDDGRSLPQTFRGGQ
FT                   LSANEIAGLTLYAGQFRGNSPRNDASMQDMSLFGRPAATSDRFDFAGGEYRFNGERSLL
FT                   GLWNAELKDIYRQQYLQLQHSQPLGDWLLGANLGGFRGRDAGSARAGKLDNRTVSALFS
FT                   ARYGLHTLYLGLQKVSGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFVG
FT                   LGLPGLTFMTRYLHGDHVRLAGVTDDGSEWGRESELGYTLQSGAFKRLNVRWRNSSQRR
FT                   DWGSNTRFDENRLIVSYPLSLL"
FT   CDS_pept        complement(264836..266161)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02381"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24965"
FT                   /protein_id="CAW24965.1"
FT                   /translation="MIHSSSSRLLAADAPRESRGGRIRNAFAVGRTRWGMLALVFFATT
FT                   LNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDKVGVKRAFF
FT                   LAVLLWSLATGAHGLATSAAGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGI
FT                   FNAGTNVGAMVTPALLPLILGVWGWQAAFLCMSALGLVWLVFWWRNYYNPEEHPRVKQS
FT                   ELEYIQQQEEPPATRVPFSQILRRRGTWAFALAYSITAPVFWFYLYWLPPFLNQQYGLG
FT                   ISVTQMGIPLILIWLTADFGSVGGGILSSWLIGRGMPAIRARLLSMLLFACTIVGVVFA
FT                   ANASGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPKHLMSTVFGFGGMCAALGGMFMT
FT                   QIVGGVLTATNNNYAVLFTMIPAMYFIALTWLYFMAPRRIEA"
FT   CDS_pept        266707..268611
FT                   /transl_table=11
FT                   /locus_tag="PLES_02391"
FT                   /product="putative 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24966"
FT                   /protein_id="CAW24966.1"
FT                   /translation="MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLHYDGSPRD
FT                   VRRLCADLGLEILLFQPFRDFEGCRRERLGRNLERAERKFDLMQELGTDLVLVCSNVAA
FT                   DALGEPALLADDLRQLAERAAVRGLRIGYEALAWGRQVNTWEQAWDLVRRADQANLGLI
FT                   LDSFHTLSLDGDPRGIADLPGEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGFDLAG
FT                   FLAPVVASGYRGPLSLEVFNDGFRAAPTRANAVDGLRSLLYLEEKTREHLQRQTPHVAV
FT                   DELFAPPPASLCDGIEFLEFAVDETLGARLGQWLQRLGFARAGEHRSKNVSLLRQGDIN
FT                   LVLNAEPYSFAHGFFEAHGPSLCATALCVRDAGQALERARAYGGQPYRGLLGPNEREIP
FT                   AVRALDGSLLYLVERHTEGRSIYDSDFVTNDADTSGLGLRRVDHVALALPAEGLDSWVL
FT                   FYKSLFDFGADDEVVLPDPYGLVTSRAVRSPCGSVRLPLNISEDRNTAIARSLSSYRGS
FT                   GVHHIAFDCADIFAAVAQAKEAGVALLEIPLNYYDDLAARFDFDDEFLSELAYYNVLYD
FT                   RDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVPVRLAAMAQARRGVRRVKL"
FT   CDS_pept        268704..269372
FT                   /transl_table=11
FT                   /locus_tag="PLES_02401"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24967"
FT                   /protein_id="CAW24967.1"
FT                   /translation="MSKPDPAVVEESAPRGKGRKNNPEKTRQDILRAAIDEFVAQGLSG
FT                   ARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIEGTLRLGALPPAKAMEK
FT                   LVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNSSIVQSIAEILRRGEAEGV
FT                   FRAGLEALDVHMLISSFCFYRVSNRYTVSRIFRTDLHDAEVRQRHRRMIGEAVLRYIRA
FT                   "
FT   CDS_pept        complement(269412..270266)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02411"
FT                   /product="putative shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24968"
FT                   /protein_id="CAW24968.1"
FT                   /translation="MSAPRSVLAGLIGAGIQASRTPALHEREGDAQGIRYLYRLIDLDP
FT                   LGKSADDLEFLLAAASDLGFTGLNVTFPCKQAIIPLLDDLSAEARGIGAVNTVVLRDGR
FT                   RIGHNTDCLGFAEGFRRGLADAPRQRVVQMGAGGAGAAVAHALLAEGVERLVLFDVDPA
FT                   RAQALADNLNQHFGAPRALAGSDLAGALGDAQGLVNTTPVGMAKLPGMPVPAELLRADL
FT                   WVAEVIYFPLETELLRQARALGCRTLDGGTMAVFQAVKAFELFSGVTADAARMQAHFAS
FT                   LGD"
FT   CDS_pept        complement(270263..270709)
FT                   /transl_table=11
FT                   /gene="aroQ2"
FT                   /locus_tag="PLES_02421"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24969"
FT                   /protein_id="CAW24969.1"
FT                   /translation="MTRTVLVLNGPNLNLLGTREPQTYGRRTLGEIADECAAFAETRGF
FT                   AVDFRQTNQEGQLLDWIHQARGRVAGIVINPAAWTHTSVALRDALAAVELPVVEVHLSN
FT                   VHQREAFRHHSYVSPVALGVICGFGSLGYRLALEHFAERFEAAA"
FT   CDS_pept        complement(270826..272331)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02431"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24970"
FT                   /protein_id="CAW24970.1"
FT                   /translation="MSDLAQNPPAVRTVLAGLMLSIFLSALDQTIVAVSLPAISADYAD
FT                   LDLLAWVISAYMVAMTVSMPIYGKLGDLYGRRRLMLFAIVVFTAASLLCGLAQSMGQLV
FT                   LARVLQGIGAGGLMAVSQAIIGDIVPPRERGRYQGYFSSMYAIASVAGPVLGGLLTEYL
FT                   SWHWVFWINLPIGLLALAISRRTLVGLPVPRRQPVIDYLGIVLMVVGLTALLLAITQIG
FT                   QGAAWSDPALLGLFALAALALLLFVAQERRFREPLVPMQLFAVRAATLSWLVAFFASFQ
FT                   AISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAYCCGRLTASLGRYKPLILLGA
FT                   VLLPCGIAGLALVPVGDHWLSGLCMLLTGIAIGTQFPTSLVAAQNAVEQRHIGVATSNA
FT                   TLFRSLGGAVGVALMSAILLALLKHLRIGGGLDQGFSESALLSSLDAASGPARVILQHV
FT                   LADAFKVLFLVNAAVALLGLAVASALPDMTLRGRGATQPTAGE"
FT   CDS_pept        complement(272506..273690)
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="PLES_02441"
FT                   /product="p-hydroxybenzoate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24971"
FT                   /protein_id="CAW24971.1"
FT                   /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRA
FT                   GVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVMVYGQTE
FT                   VTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHG
FT                   ISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYY
FT                   VQVPLSEKVEDWSDERFWTELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRL
FT                   FLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAE
FT                   RFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE"
FT   CDS_pept        273868..274734
FT                   /transl_table=11
FT                   /locus_tag="PLES_02451"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24972"
FT                   /protein_id="CAW24972.1"
FT                   /translation="MTDSIRDVPVFKLYGAPLEWPTPDLLHCESIPARSRLHDWEIKPH
FT                   RHADLAQLLYVRKGWAQLQVEGEPTRVEQPSIQFVPPLCIHGFQFSERIDGYVLTLAAP
FT                   LLARLQAHLGAQRQALEAPGLYPVGADRRYIDTLFDAIDGEYAGAAPARELLLQSLIGV
FT                   LAVWLGRQVMVRRAEARPGRGQEYLSAFSQLVERHFREHLGIDEYARRLGISPAHLNSV
FT                   ARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRLSGVSP
FT                   SAFRKGD"
FT   CDS_pept        complement(274731..275177)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02461"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24973"
FT                   /protein_id="CAW24973.1"
FT                   /translation="MSSPLKIRRYIPADRDATLAIWLEASRVGHGFLGEAELQKQKALV
FT                   RDHYLDASETWLALDGDTPLGFIGLLDAFIGGLFVAPAAHGRGIGRQLVEHAATLKGAL
FT                   EVEVYAANREALGFYARCGFVESGRRPRDDEGRAREIVQLRREH"
FT   CDS_pept        complement(275255..275689)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02471"
FT                   /product="putative CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24974"
FT                   /protein_id="CAW24974.1"
FT                   /translation="MKTVAQLLNAKQNQQVYTIGADEMVLDALRLMAEKNIGALLVVNH
FT                   GEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHLRH
FT                   LPVVEDGQLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
FT   CDS_pept        complement(275854..276495)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24975"
FT                   /protein_id="CAW24975.1"
FT                   /translation="MNDYIARLREKYDDHFGCAPSIVLDCRDFWRHCVTAPEMAVFGYR
FT                   QESSRRPHHVVITAGMSQARMHFAPYMGSARWSSELICYLDVLGGEDLRHLQWLAGLPF
FT                   HERLALGHGHSVAFGFPLYEHSLLRHFLLLPTPLGEDAALFDGFDLSAHPVDLLWVVPL
FT                   TEQEYQVKVNKHLEGIAEVLNDAGHPLSLDRHRHCYVTGQRPEGFERILH"
FT   CDS_pept        complement(276763..277050)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24976"
FT                   /protein_id="CAW24976.1"
FT                   /translation="MGGLRKPIRPAMPRHPHTTLLLCLCLTLPGCESGRSYSLSEGAPV
FT                   TGIRIQRDDRSPLQRLRDCERQGCSERQKIDPFTPDPDYLRAEGHFPLPW"
FT   CDS_pept        complement(277142..277618)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02501"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24977"
FT                   /protein_id="CAW24977.1"
FT                   /translation="MTGPMTETNALGLPQGPLYLMTEIVRQRERQLTALLAPLELGLHE
FT                   WRALRIIHAFDGDVPMSVLIEHSQTDRTALGRTIERLVRRGWVSRLPDPDDGRAVLVRR
FT                   SPAAQAVFEQALAQVAGLDERLLAGLGSGPEEEALTLVLGKLLWAFDGLSRVRQ"
FT   CDS_pept        complement(277659..279149)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02511"
FT                   /product="putative 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24978"
FT                   /protein_id="CAW24978.1"
FT                   /translation="MNRSALDFRHFVDHLRRQGDLVDVHTEVDANLEIGAITRRVYERR
FT                   APAPLFHNIRDSLPGARVLGAPAGLRADRARAHSRLALHFGLPEHSGPRDIVAMLRAAM
FT                   RAEPIAPRRLERGPVQENVWLGEQVDLTRFPVPLLHEQDGGRYFGTYGFHVVQTPDGSW
FT                   DSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRQGKPTPWAMALGAPPAALAAAGMP
FT                   LPEGVSEAGYVGALVGEPVEVVRTQTNGLWVPANAEIVLEGEISLDETALEGPMGEYHG
FT                   YSFPTGKPQPLFHVHALSFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVAQNAGLP
FT                   VDMVWCSYEAATCWAVLSIDVQRLAALGTDAAAFAARVAETVFGSHAGHLVPKLILVGN
FT                   DIDVTEIDQVVWALATRAHPLHDHFAFPKIRDFPMVPYLDAEDKARGSGGRLVINCLYP
FT                   EQFAGQMRAATASFRHAYPTALRRRVEERWSDYGFGDA"
FT   CDS_pept        complement(279283..279969)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02521"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24979"
FT                   /protein_id="CAW24979.1"
FT                   /translation="MVGSSARRLRLRRTRGRVGLGLVAGLSVLAGMTDAIGFLATGDFV
FT                   SFMSGNTTRLAVSLGEGDFGGLVRLSVALASFVVGNALGVILARFSGRRAAPILVCCAM
FT                   LLALSAVWPFDWNVPALVAAILAMGMLNAVVEQVNGLPIGLTYVTGALSRFGRGLGRWL
FT                   LGERRNGWRVQLVPWSGMCVGAVLGALLEQQLGLAAMAASAALAALLALLALVIPRPWQ
FT                   MDYMVR"
FT   CDS_pept        complement(280133..281065)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24980"
FT                   /protein_id="CAW24980.1"
FT                   /translation="MRSWHGVVTKIAKQGKGAVVKNRLGPEELLVPFTVSTLVEVDLDA
FT                   RIYGTDVDDTPWAEGDERKEVLVGTEVELLTDTDTFPTHASQVLSANFRFALDIVKGGL
FT                   SGPVRKGAVLVIYHDFQQEIRRGDSGSAFAEAVVAYARNKLYKPAFAIKADTNYAQLVR
FT                   DLGKVAAESGEQYFIDTILIATHGTAGQLWLGNPHGESTADVMARRVQGKQFVEPQAFG
FT                   ATLLELFGKELAIALYGCDFAGDEDGEAAALELRIAANARAVYAGKGTVYLNASKEGRS
FT                   TVTCSKAMVVYRTDKIEVLGGNQVPVFDI"
FT   CDS_pept        complement(282147..282332)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24981"
FT                   /protein_id="CAW24981.1"
FT                   /translation="MSDPKTLTPEQRIKELEQQLELMSQKDQFFETVVDVLKNDYGVSV
FT                   VKKRSGKSSRKVKSQD"
FT   CDS_pept        complement(282512..283948)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24982"
FT                   /protein_id="CAW24982.1"
FT                   /translation="MSADAYHAPKTSPRLETLDVLSVGMSLDVFRQGQVWKALQEQNAM
FT                   QAEALHVGSILPMDPRKYPVTADDKDIASEKREADALELGLKNFLEKWPIPTVTVVRGW
FT                   NPNTPNLRFTPEETQGSLSAMVNDMRIPAGLHWHRIVNLQDGIICNDTPEGVLEALFRL
FT                   FERNPDLPAVLIYANEGFNMALSLMAKGEKPIGVGTGPRQPGELTDTMVALIVGRPERV
FT                   DWLRQFAPYTKVNENRIDPEFRGWGWRKPPVEFRPTPFIPQPWTERALEQWDALPVLAR
FT                   LHRPVSVPLTRPDTGERLKREALTAQLAAAWKTASAGLRPAPARLFYDGGLNATPLAEL
FT                   TPALGAAQSSLDLLDSRESYDLTQRLGDTGAASPFVGIALATMASYLNGDSSMVMPLRR
FT                   KDQATLIGISSPTPGKKPAHDPFGVDLLPQTASGDGPPPSADPVAPASRLTTRLPPGED
FT                   YALEEFLSSLKPSTDWQDDL"
FT   CDS_pept        complement(284098..286254)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24983"
FT                   /protein_id="CAW24983.1"
FT                   /translation="MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDL
FT                   AGCYERIERGLCQGLNERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDVVYYR
FT                   RKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFV
FT                   NATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIR
FT                   KRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWS
FT                   SQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGQGCQTTID
FT                   GERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQR
FT                   IFTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTA
FT                   PRLPLPTEARFDFDGAVTAPGENSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVA
FT                   QQVDAALAYRYGRDARSVERALNEGKELAQQTHVFSARELGTGMVLVTRAETPYEARLR
FT                   LQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDW
FT                   NATRAKGRAQVESDTELDLPDEDVRALYRAEEAGNRKLIDSTEIYRRSGAIPSIVGNTL
FT                   PSLVATQTINDRYYDRPVCFGGPI"
FT   CDS_pept        complement(286251..286748)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24984"
FT                   /protein_id="CAW24984.1"
FT                   /translation="MKCKTLLIACLFGLGSAQALAVSKLPPQIPVHAGSGRVTLDLRPL
FT                   LAETNDVEITRVSVCRRVGSHCQETLWRIELPPGWRAGEIEVFGDYPGSSVLLRRPERL
FT                   QPDGSYNAFIHFNERSRRHRQTVSSIAVEFCLAGEPGNWMLLDEATCLARRNAEERQGE
FT                   KP"
FT   CDS_pept        complement(286752..289811)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24985"
FT                   /protein_id="CAW24985.1"
FT                   /translation="MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKN
FT                   AIDFRQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELC
FT                   CNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEE
FT                   GLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTA
FT                   RQTQRDYSFKRPTYDQEHHLAGEALEHQGSSYERYDYPGRYKRSGAGRPFTESRLRGHR
FT                   RDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPL
FT                   GVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDR
FT                   EGRHDEFSTCWIRVAQNWAGADWGHMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNR
FT                   PPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRP
FT                   EGGKPRGEGFELRTDEHGAVRAAKGLLLSTEEQLRAGAGHLDRGVVVQVLEAALKLARE
FT                   LGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATP
FT                   ASLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQK
FT                   NDIRLEAEQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKH
FT                   SHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGA
FT                   TQLLQKDAMNIAKVDMKHTKSPASAVAGIAAAVGAAVAVGKLLGGPDAEAGRALSEGEI
FT                   SLAKGVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQ
FT                   GLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIV
FT                   RDYFLEKNEFGEASANSRFAGVLKNFPTGY"
FT   CDS_pept        complement(289993..290511)
FT                   /transl_table=11
FT                   /gene="hcpC"
FT                   /locus_tag="PLES_02591"
FT                   /product="secreted protein Hcp"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24986"
FT                   /protein_id="CAW24986.1"
FT                   /translation="MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFN
FT                   HEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAA
FT                   GTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGS
FT                   DDWRSPVAG"
FT   tRNA            complement(291766..291842)
FT                   /locus_tag="PLES_02592"
FT                   /product="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:291806..291808,aa:Arg)"
FT                   /note="tRNA Arg anticodon CCG, Cove score 77.55"
FT   CDS_pept        complement(292031..292447)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24987"
FT                   /protein_id="CAW24987.1"
FT                   /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIRKGQRPGVPFPAPCASG
FT                   VAVTGRPPCATGGRGRTRPPAGVGEDTKGSCGKGIADETPRRHHGGPAARKAGRATGRS
FT                   ERGHSRGTRPAELMPIPRSPVVVALGAFEISNES"
FT   CDS_pept        292472..293923
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="PLES_02611"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24988"
FT                   /protein_id="CAW24988.1"
FT                   /translation="MQLKDAKLFRQQAYVDGAWVDADNGQTIKVNNPATGEIIGSVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPLAE
FT                   AKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPSAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGGELTS
FT                   NPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEGALISK
FT                   YRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVAKV
FT                   EEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKNALVSKDETFGPLAPVFRFKD
FT                   EAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKAS
FT                   GLGREGSKYGIEDYLEIKYLCLGGI"
FT   CDS_pept        294168..295448
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="PLES_02621"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24989"
FT                   /protein_id="CAW24989.1"
FT                   /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYI
FT                   DFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPK
FT                   KTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSF
FT                   MQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVA
FT                   GKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQ
FT                   AKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIR
FT                   FLMPVTIPDAQLEKGLAILAECFDELA"
FT   CDS_pept        295774..296973
FT                   /transl_table=11
FT                   /locus_tag="PLES_02631"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24990"
FT                   /protein_id="CAW24990.1"
FT                   /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLGVRCDARLVLCGDGGEA
FT                   LAHCRRRRFALILAELNLPQVDGFELLREARLRRSVAEQPFILISDRADQASVRAAVAL
FT                   APTAYLVKPFQAENLMQRLRGLLLKGDEVVACPLPERDAGENLEAFLERTRDSAEGAPL
FT                   LADVRAASDRCLSAEEHPLRVLEDEFGRDPQITAGLIAAANSAARHVGPACQTLGQALR
FT                   RLGLGHSLNLVLGFSLQRAIQLGEPLLAERAMHFWDLSQRCADIAWELADALGADVERC
FT                   YTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDELLGRFGASFGSALRARWRLPLELR
FT                   RLIAAAYQFGGVLSREELILSLATQAASLPEDDAEQLAESKAARMLGLDGERLAKLLQP
FT                   "
FT   CDS_pept        complement(297144..298565)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02641"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24991"
FT                   /protein_id="CAW24991.1"
FT                   /translation="MELQLILDGRHDLVGQLYRQLRDAILHGRLATGDRLPATRYLAER
FT                   LEVSRKTVSEAYERLASEGFLEGRVGSGTFVARGPAGEAPPQRADGPLRPAARWARIEP
FT                   QSGLMDQRAPLRYSFAGGTTDKRRFPFDTWRTCVLQALRLQQRSPAFYKETEGDPELRL
FT                   AISRYLAINRAVQCDWNALMVTQGAQQGLDLLARVMLDPGDLAVVEEPGYPPARASLLA
FT                   TGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQHHRAL
FT                   IIEDDYDSEYRFDGRSLESLRSLDRNGQVAYLGTFSKTLFPELRLGYLLPPASLREAVL
FT                   AARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRGRLLERLHGDLSPWLEA
FT                   LPAVAGIHLAARCREPLDVLRIARHLRQQGLEVGTLPPFYAETPAQAGFLFGFGCIERD
FT                   DIDPALDLLRAELRR"
FT   CDS_pept        298692..299129
FT                   /transl_table=11
FT                   /locus_tag="PLES_02651"
FT                   /product="putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24992"
FT                   /protein_id="CAW24992.1"
FT                   /translation="MTTRLEWAKASPDAYAAMLGLEKALAKAGLERPLIELVYLRTSQI
FT                   NGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERAALAWTEQLARLSQGALP
FT                   HGLLDELREHFDDKEIAELTLAVSAINAWNRFGVGMGMQPE"
FT   CDS_pept        299141..299548
FT                   /transl_table=11
FT                   /locus_tag="PLES_02661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24993"
FT                   /protein_id="CAW24993.1"
FT                   /translation="MKANRSIACLLLAALPTLASAHVAEKVETLHDQVLAEIPGHRGLM
FT                   LTVSFKPGQVSAPHVHPGSVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVPHLLAR
FT                   NPDPMKPAKLLVWELLKEGDPILKPLERGAH"
FT   CDS_pept        299582..299866
FT                   /transl_table=11
FT                   /locus_tag="PLES_02671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24994"
FT                   /protein_id="CAW24994.1"
FT                   /translation="MSASQVIRIRARNGQSERLGLRLQQLVEPGLEAPGCLEYQVRRDA
FT                   LEPDLWLVCSQWREAQQMFDYLAGGIQQVFAEVLWRSLAASLEVQDDAG"
FT   CDS_pept        complement(299863..300795)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02681"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24995"
FT                   /protein_id="CAW24995.1"
FT                   /translation="MLIANGLRKVDMQDLLVFLQVHQRQNLVEVAEHLNLSPSTVSYCL
FT                   KKLRQAFDDELFIATRGGMQPTHKSRAMLPHVEEMLARINACHAAQGSFDPRGEPRTFT
FT                   LCAPEYVELLILPALLRRLAANGPRIGLDIRRLGPELPTEALLDGQVDLVFDFGPEYHR
FT                   PAPELQALALFSDELLCVQDRAQPRHERLELDEFCRRRFVFPTPLDASNANLVDTWLRR
FT                   QGRSREVAARANSYVAALQLLSGSDFVLMLPRRIHALLDDGRHHACLAPPGLPPFALHL
FT                   SWSRAADQDPANLWLREQVLIVCAELGLL"
FT   CDS_pept        complement(300845..302059)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02691"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24996"
FT                   /protein_id="CAW24996.1"
FT                   /translation="MPTANPPGRTLWLMAAIVLVGLNLRPSMAAVGPLLNAMRGEIALS
FT                   FGDVSLLTALPVLTLGLGMFFGLGIARRVGEWRSVALALLLIGAASALRLGSRGLPDLL
FT                   GSAMLAGLGIALIQALMPALIKARFGARTPLCMGLYVTAIMAGAALSASAAPTLAEHAG
FT                   WRLGLGAWAAPAALALLAWWLQPGTRLRLPAAQPGRSLLRYPRTWLLVLFFGLGTACYT
FT                   CVLAWLAPYYLEQGWSAQESGLLLGFLTAMEVLSGLLAPALASRSRDRRPVLVGLTALM
FT                   LAGFLGLAWAPASLPLLWALCLGLGIGGLFPMGLIVCLDHFDAPQRAGQLAALVQGAGY
FT                   LIAGVSPWIAGLLRDSLGSFTGAWLGLATVAALLLGLGLRFDPRRYAALFDERQPQGVG
FT                   AESLR"
FT   CDS_pept        complement(302222..302992)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24997"
FT                   /protein_id="CAW24997.1"
FT                   /translation="MPRPALFAVLCLYCLLLALPARATLDDQQRALQQLQVQACRAVGS
FT                   LLLLRGEGFQEQHAAQLEKDLASLDRALAAAPEGVLLRQGEKTLVARIREGAAYGPREE
FT                   DLPWRYPQQLSRALRDFLNLVERQVPPPPPDQPLPLWQLPVRVEYLSLQYLARAYLGGL
FT                   EIAREQPRDYLGQDESVLVPLIDRRIALLVAQSANPAGLKKLENRWEYLSQALRDLNSK
FT                   SSALVSASGRPWAPIIVDRHARALSESLMRLSAE"
FT   CDS_pept        complement(303101..303787)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02711"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24998"
FT                   /protein_id="CAW24998.1"
FT                   /translation="MNERTDYRSQLQAGRWFQGLPEALQTHLLALAQPRQLPPGQRLFA
FT                   RGDAPCGLYCVVEGAIRISAVSENGKEALLILVEAPHWFGEIALFDGQARTHDAYAEGH
FT                   TQLLQVPQAALLELLRREPHYWRDVALLMSHKLRLAFIALEEMALLPAAQRLARRLLML
FT                   AEGYDNSRSRQVLHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILDLAGL
FT                   RAATHG"
FT   CDS_pept        303863..304378
FT                   /transl_table=11
FT                   /locus_tag="PLES_02721"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW24999"
FT                   /protein_id="CAW24999.1"
FT                   /translation="MKTLVDHLAQYAAYHRDRRNIFSHFIGIPMIVLSIAVLLARPALG
FT                   FGLSPALLLALAAALFYLRLDLRFGVAMTALLALTVWGAAQLAAGTTAAWLGWGVGLFV
FT                   VGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGDVQREVEERAGPTC
FT                   IREHKRAA"
FT   CDS_pept        complement(304418..305176)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02731"
FT                   /product="putative putative Zn-dependent protease with
FT                   chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25000"
FT                   /protein_id="CAW25000.1"
FT                   /translation="MKTRLSLSALALACATLAGCQNLPQGDLMQHGMMAVKAATLSDAE
FT                   VRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEEVNAWA
FT                   MANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQTAYAAAAVRGAAGASKS
FT                   GALAALSGSQLGELTESLVNAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEKLAKL
FT                   GGGDSSMFDSHPGSQARADHIRQRIAADRK"
FT   CDS_pept        complement(305348..306100)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02741"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25001"
FT                   /protein_id="CAW25001.1"
FT                   /translation="MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPPM
FT                   QAAALLIVPSMVTNLWQLACGPRFLGLMKRLAGLLLGVIVGTLLVGAWLGGDAPRQATG
FT                   VLGLALAAYALLGLAAIPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLGALG
FT                   LQRDELVQALGLSFSASTLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQWLRQ
FT                   RISATLFRRCFFVGLLLLGADLAWRGFH"
FT   CDS_pept        306194..306892
FT                   /transl_table=11
FT                   /locus_tag="PLES_02751"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25002"
FT                   /protein_id="CAW25002.1"
FT                   /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVSP
FT                   SSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALVSASLALQPQRRSLPPSH
FT                   GTPSALREARTCYDHLAGELAVGVFARMLDAGWIEQEGRTLRLSATGEAGLARLGIDLA
FT                   EVRRRRRQFACACPDWSERKPHLGGALGAALLEACLRQGWLRPQDGSRALQVSSKGRAG
FT                   LRGLAERTAG"
FT   CDS_pept        complement(306906..307895)
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PLES_02761"
FT                   /product="sulfate transport protein CysA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25003"
FT                   /protein_id="CAW25003.1"
FT                   /translation="MSIEIRNVSKNFNAFKALDNINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   GERPGESAIKAKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLLDEP
FT                   FGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLQLGNDQHLLFRPHEVSLSRSAVAEHRAAEVRDIRPLGA
FT                   ITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
FT   CDS_pept        complement(307899..308768)
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PLES_02771"
FT                   /product="sulfate transport protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25004"
FT                   /protein_id="CAW25004.1"
FT                   /translation="MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVVL
FT                   SEALKQGFGTFFEAILEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGKSI
FT                   LVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVTVPF
FT                   VARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFG
FT                   AVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSR
FT                   LKSNADEE"
FT   CDS_pept        complement(308779..309597)
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PLES_02781"
FT                   /product="sulfate transport protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25005"
FT                   /protein_id="CAW25005.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWEQ
FT                   FWAIISAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
FT   CDS_pept        complement(309759..310757)
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PLES_02791"
FT                   /product="sulfate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25006"
FT                   /protein_id="CAW25006.1"
FT                   /translation="MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAF
FT                   IKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADW
FT                   QARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAW
FT                   AWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKK
FT                   EQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFY
FT                   RPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ"
FT   CDS_pept        complement(310934..311116)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25007"
FT                   /protein_id="CAW25007.1"
FT                   /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQIE
FT                   RKEKFRLQQPAVKQA"
FT   CDS_pept        complement(311280..313562)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02811"
FT                   /product="putative sensory box/GGDEF domain/EAL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25008"
FT                   /protein_id="CAW25008.1"
FT                   /translation="MSPRLSALRLSLAYLAIAIAWAFLSDHLLQNQVQDHDQLVFWMTA
FT                   KRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTDRM
FT                   FVSPGYAALIGLAPEELGDPIETWKKRLHPEEYATVLEAHRNHLQGLTDNLDHIYRLRH
FT                   KDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREGVLVT
FT                   DAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDVWSGEI
FT                   WNRRKSGEIYPQWLHIRVVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHDSLTGLP
FT                   NRVLLRERIEQALENGKDRTVAGALLLIDLDHFKHINDSLGHTTGDMLLKEVSKRLQHQ
FT                   LDERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYISASLGVSL
FT                   YPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESALRHALDHDE
FT                   LRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIAALDNWVLKRA
FT                   CRQMREWQQRGVELEFVAVNVSSRLFNRGGLEERIANALEESGLEPRYLELEVTESAVM
FT                   EDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQGFVAGLPGAVDD
FT                   AAIARAIVALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYGRPQPAEALRFDLP
FT                   PVALPED"
FT   CDS_pept        313734..314912
FT                   /transl_table=11
FT                   /gene="desA"
FT                   /locus_tag="PLES_02821"
FT                   /product="delta-9 fatty acid desaturase, DesA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25009"
FT                   /protein_id="CAW25009.1"
FT                   /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDLH
FT                   PALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAELYK
FT                   AEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQMVW
FT                   IPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVKK
FT                   WEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMAQYRKL
FT                   VIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQALKVIYEK
FT                   RLALQQIWAKTSANGHDMLAAIKDWVHEAEASGIQSLKEFAAQLKTYSLRPA"
FT   CDS_pept        315143..316528
FT                   /transl_table=11
FT                   /gene="gpuP"
FT                   /locus_tag="PLES_02831"
FT                   /product="3-guanidinopropionate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25010"
FT                   /protein_id="CAW25010.1"
FT                   /translation="MLLDYLIMLVYALAMLGLGWYGMRKAKSQSDFLVAGRRLGPGLYL
FT                   GTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTVTQ
FT                   VLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIVIVY
FT                   SVIGGMWSLTLTDIIQFVIKTVGIFLVLLPLSIDGAGGLARMQEVLPAGFFDLGHIGLD
FT                   TILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGAACALIGAAARV
FT                   LLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQEDIYARF
FT                   LRPGTTSDIRLSRCITLLMGVAMLVLACLVNDVIAALSIAYNLLVGGLLVPIVGALLWR
FT                   RASPQGAIASIVAGCLAVIACMARDGLLANSPIVYGLLASLATFVAVSLATRPAASLRA
FT                   QPE"
FT   CDS_pept        316584..317540
FT                   /transl_table=11
FT                   /gene="gpuA"
FT                   /locus_tag="PLES_02841"
FT                   /product="3-guanidinopropionase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25011"
FT                   /protein_id="CAW25011.1"
FT                   /translation="MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWD
FT                   GGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRR
FT                   IEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPY
FT                   THGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEAT
FT                   LAEARRVVGDGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGAD
FT                   VVEVSPPFDVGGATALVGATMMFELLCLLAESAARSA"
FT   CDS_pept        317593..318555
FT                   /transl_table=11
FT                   /gene="gpuR"
FT                   /locus_tag="PLES_02851"
FT                   /product="transcriptional activator GpuR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25012"
FT                   /protein_id="CAW25012.1"
FT                   /translation="MGAGMLGNLNDIDLRMLRTFCAIVEAGGFTAAQARLNTSLSRLSV
FT                   LVRDLEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDREAL
FT                   HLGCVDGVIGQHCLPLPLAIRLFRQRAPEVLLKLHTRRPDELEHAVLEERLQLAVGAFH
FT                   HRLSGLYYQPLFREEQNLYCGSAHPFFARADDEPALDEICAADYVGRGYMAENHRPHDL
FT                   RFNQGTDAYTMEAIATLVFSGTYIGYLPTHYAATWVAEGRMRAIRPRQLAYDSEFHCIT
FT                   RQGHEERPTLTLFLRSLFEAQKQLGVQAPANTNGIARQL"
FT   CDS_pept        318668..319639
FT                   /transl_table=11
FT                   /locus_tag="PLES_02861"
FT                   /product="putative sensory box/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25013"
FT                   /protein_id="CAW25013.1"
FT                   /translation="MDDLTGIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNSV
FT                   LWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLLQVLERG
FT                   AVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKHMESELQRLAT
FT                   TDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQVLQR
FT                   IAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEGEHSFG
FT                   ITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
FT   CDS_pept        320252..321634
FT                   /transl_table=11
FT                   /gene="oprE"
FT                   /locus_tag="PLES_02871"
FT                   /product="Anaerobically-induced outer membrane porin OprE
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25014"
FT                   /protein_id="CAW25014.1"
FT                   /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRNF
FT                   YINTDNRNGTASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAGKS
FT                   GLDRQPGTVFPLESNGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGRLLP
FT                   VTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSASSRDSNKFYYAG
FT                   GDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGKNGSRS
FT                   GRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFPFLNRGD
FT                   GEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFATVGVPGLTFNTIYLSGDKIKTARGD
FT                   QSEWERDISLAYVIPDGTFKGLGFTWKNASFRSGLPAAGSSNNQRDQDENRLIVSYTLP
FT                   LL"
FT   CDS_pept        complement(321769..322875)
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="PLES_02881"
FT                   /product="agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25015"
FT                   /db_xref="GOA:B7V2K4"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2K4"
FT                   /protein_id="CAW25015.1"
FT                   /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQA
FT                   AFAAVAKAIARFEPVTVCASAGQYENARARLDDGNIRVVEISSDDAWVRDTGPTFVIDD
FT                   KGDVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVD
FT                   GEGTLITTEECLLNHNRNPHLSQAEIERTLRDYLAVESIIWLPNGLYNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEE
FT                   CDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIIAPSFDDPKDAEARAILQRVFPEHEV
FT                   VMVPGREILLGGGNIHCITQQQPAPRKA"
FT   CDS_pept        complement(322961..323839)
FT                   /transl_table=11
FT                   /gene="aguB"
FT                   /locus_tag="PLES_02891"
FT                   /product="N-carbamoylputrescine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25016"
FT                   /protein_id="CAW25016.1"
FT                   /translation="MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQEL
FT                   FETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAV
FT                   IDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESA
FT                   RSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQD
FT                   GYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYG
FT                   PLKTLDGSLES"
FT   CDS_pept        complement(324002..324667)
FT                   /transl_table=11
FT                   /gene="aguR"
FT                   /locus_tag="PLES_02901"
FT                   /product="transcriptional regulator AguR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25017"
FT                   /protein_id="CAW25017.1"
FT                   /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLTIYSVAER
FT                   AEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLA
FT                   VYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLA
FT                   MELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLTGFISDLNR"
FT   CDS_pept        complement(324730..325791)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02911"
FT                   /product="probable periplasmic polyamine binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25018"
FT                   /protein_id="CAW25018.1"
FT                   /translation="MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTG
FT                   IRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDR
FT                   QLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKS
FT                   CGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLE
FT                   GGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYL
FT                   MQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPV
FT                   VDEIWKAFRGASH"
FT   CDS_pept        complement(326047..327423)
FT                   /transl_table=11
FT                   /locus_tag="PLES_02921"
FT                   /product="probable glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25019"
FT                   /protein_id="CAW25019.1"
FT                   /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERN
FT                   SLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPT
FT                   AQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQP
FT                   PRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLN
FT                   HVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNI
FT                   FTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTV
FT                   ALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQME
FT                   PSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
FT                   "
FT   CDS_pept        327702..328454
FT                   /transl_table=11
FT                   /gene="spuA"
FT                   /locus_tag="PLES_02931"
FT                   /product="probable glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25020"
FT                   /protein_id="CAW25020.1"
FT                   /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPA
FT                   LGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAID
FT                   AGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPG
FT                   GVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHP
FT                   EWQVLTNPNYLAIFQAFGKACSKRAGQR"
FT   CDS_pept        328495..329853
FT                   /transl_table=11
FT                   /gene="spuB"
FT                   /locus_tag="PLES_02941"
FT                   /product="probable glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25021"
FT                   /protein_id="CAW25021.1"
FT                   /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEK
FT                   GMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHD
FT                   TFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRS
FT                   GRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALD
FT                   LADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADG
FT                   TMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPD
FT                   SSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLT
FT                   IEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV"
FT   CDS_pept        329919..331289
FT                   /transl_table=11
FT                   /gene="spuC"
FT                   /locus_tag="PLES_02951"
FT                   /product="putrescine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25022"
FT                   /protein_id="CAW25022.1"
FT                   /translation="MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGV
FT                   YIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAK
FT                   AIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAG
FT                   VSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEEN
FT                   VAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYG
FT                   NAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIR
FT                   ILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDK
FT                   GVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA"
FT   CDS_pept        331405..332508
FT                   /transl_table=11
FT                   /gene="spuD"
FT                   /locus_tag="PLES_02961"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25023"
FT                   /protein_id="CAW25023.1"
FT                   /translation="MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLE
FT                   KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKL
FT                   PNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFK
FT                   PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFH
FT                   SSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPK
FT                   DAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMK
FT                   KLYTFPDLPAKTQRAMTRSWTKIKSGK"
FT   CDS_pept        332927..334024
FT                   /transl_table=11
FT                   /gene="spuE"
FT                   /locus_tag="PLES_02971"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25024"
FT                   /protein_id="CAW25024.1"
FT                   /translation="MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKD
FT                   FTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLP
FT                   NWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPE
FT                   NMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSS
FT                   KYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADA
FT                   KAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKL
FT                   YVSAVLPAKVLRLQTRTWTRIKTGK"
FT   CDS_pept        334079..335233
FT                   /transl_table=11
FT                   /gene="spuF"
FT                   /locus_tag="PLES_02981"
FT                   /product="polyamine transport protein PotG"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25025"
FT                   /protein_id="CAW25025.1"
FT                   /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYA
FT                   LFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENP
FT                   IYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVY
FT                   YIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
FT   CDS_pept        335260..336141
FT                   /transl_table=11
FT                   /gene="spuG"
FT                   /locus_tag="PLES_02991"
FT                   /product="polyamine transport protein PotH"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_02991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25026"
FT                   /protein_id="CAW25026.1"
FT                   /translation="MPTGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEADVAIPPYTEI
FT                   FAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFISTLICLLVGYPMAYAIARSS
FT                   QSSQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGLISEPLTILNTNIAV
FT                   YIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPLSKNGIIAGCM
FT                   LVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILIIPIILF
FT                   NKNQAKELEGKV"
FT   CDS_pept        336224..337093
FT                   /transl_table=11
FT                   /gene="spuH"
FT                   /locus_tag="PLES_03001"
FT                   /product="polyamine transport protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25027"
FT                   /protein_id="CAW25027.1"
FT                   /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSVK
FT                   WYVGLLDNTQLVSSVGRSLEIAFYTAFSSVLLGTLAAFVLTRIPRFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFFAWYFTRQAEERRRRAIQQAMEETATDW
FT                   QKGSPTPA"
FT   CDS_pept        complement(337271..339658)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03011"
FT                   /product="putative penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25028"
FT                   /protein_id="CAW25028.1"
FT                   /translation="MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLAVAHLQAPVDV
FT                   RYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRL
FT                   FRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTP
FT                   EDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGD
FT                   WKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYE
FT                   AQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQ
FT                   GKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENP
FT                   VLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSF
FT                   ILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWL
FT                   DTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWN
FT                   GDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWW
FT                   DDRRTERRETRADIVRAAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLKR
FT                   LLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGV
FT                   PFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
FT   CDS_pept        339769..340821
FT                   /transl_table=11
FT                   /locus_tag="PLES_03021"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25029"
FT                   /protein_id="CAW25029.1"
FT                   /translation="MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLP
FT                   PPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEAL
FT                   RSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISD
FT                   DEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHDV
FT                   LTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGAS
FT                   FRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAK
FT                   REEGYSTSGT"
FT   CDS_pept        complement(341408..342019)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25030"
FT                   /protein_id="CAW25030.1"
FT                   /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYI
FT                   RPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGV
FT                   EFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAV
FT                   CTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG"
FT   CDS_pept        342018..343037
FT                   /transl_table=11
FT                   /locus_tag="PLES_03041"
FT                   /product="putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25031"
FT                   /protein_id="CAW25031.1"
FT                   /translation="MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAA
FT                   AEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGY
FT                   YDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFEGLLGQAAEL
FT                   DLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPF
FT                   VDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLV
FT                   VQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA"
FT   CDS_pept        complement(343057..343809)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25032"
FT                   /protein_id="CAW25032.1"
FT                   /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQ
FT                   KRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVV
FT                   AAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADS
FT                   LSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFA
FT                   ESPAGRSYYQAALAALKAGLAVDQAVAH"
FT   CDS_pept        343858..344556
FT                   /transl_table=11
FT                   /locus_tag="PLES_03061"
FT                   /product="putative proline hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25033"
FT                   /protein_id="CAW25033.1"
FT                   /translation="MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGW
FT                   SHQSIFMPERLTTRLAEECRTRAVAGDLTPAGIGRGDGQVIREGIRGDLTQWLEPGESE
FT                   ACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVL
FT                   YLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFR
FT                   RRNESLLQLS"
FT   CDS_pept        complement(344578..345132)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25034"
FT                   /protein_id="CAW25034.1"
FT                   /translation="MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISL
FT                   RLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIF
FT                   GVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNS
FT                   IGRIELRDITDLRGTIKVWGH"
FT   CDS_pept        345398..345892
FT                   /transl_table=11
FT                   /locus_tag="PLES_03081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25035"
FT                   /protein_id="CAW25035.1"
FT                   /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVA
FT                   GGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAV
FT                   LKARSPSCGNLENYDGRFNGNRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAG
FT                   G"
FT   CDS_pept        complement(345895..346587)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03091"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25036"
FT                   /protein_id="CAW25036.1"
FT                   /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLI
FT                   LGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILA
FT                   LTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSL
FT                   ISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALEN
FT                   RLTAPLRR"
FT   CDS_pept        complement(346659..347429)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03101"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25037"
FT                   /protein_id="CAW25037.1"
FT                   /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNF
FT                   KQGGKLTGFETELGELLAAELAVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRK
FT                   VFDFSEPYTISSAQLIVRADETRQFKSLEDLKGLRLGVGQGTNYADLAKSVAGVNVRTY
FT                   PGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKNNPKF
FT                   GEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK"
FT   CDS_pept        347722..348159
FT                   /transl_table=11
FT                   /locus_tag="PLES_03111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25038"
FT                   /protein_id="CAW25038.1"
FT                   /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPADG
FT                   ATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFGKG
FT                   QTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
FT   CDS_pept        complement(348217..349446)
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="PLES_03121"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25039"
FT                   /protein_id="CAW25039.1"
FT                   /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSGD
FT                   ELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYGSIG
FT                   TQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQWMIG
FT                   EKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEEFASPL
FT                   RGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPSHPGKHR
FT                   LLHIHANIPGVMSEINKVFADNGINVSGQYLQTNEKVGYVVIDVDAEYSDLALEKLQQV
FT                   NGTIRSRVLF"
FT   CDS_pept        349650..351044
FT                   /transl_table=11
FT                   /locus_tag="PLES_03131"
FT                   /product="putative oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25040"
FT                   /protein_id="CAW25040.1"
FT                   /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAIV
FT                   FPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDLNAFD
FT                   RTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMTRNW
FT                   VAGMKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPKNLTA
FT                   MVLGTPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPFYALLE
FT                   FEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISHWTPYKN
FT                   DISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGKDEFFAKC
FT                   ATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVFDPNGIMNP
FT                   GKIFAE"
FT   CDS_pept        351136..351801
FT                   /transl_table=11
FT                   /locus_tag="PLES_03141"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25041"
FT                   /protein_id="CAW25041.1"
FT                   /translation="MSYQHQYIDGTPIHFPLGKLVCVGRNYAEHAKELNNPVPTEPLLF
FT                   IKPGSCVVPVSGGLSLPQERGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPALDL
FT                   TLREVQAKLKEKGLPWELAKSFDGAGVLSPFVNADQFPDPTDIGIRLTINGEVRQDGNS
FT                   RDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLNSGDELLLELPGASRFETRVL"
FT   CDS_pept        351900..352889
FT                   /transl_table=11
FT                   /locus_tag="PLES_03151"
FT                   /product="putatitve transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25042"
FT                   /protein_id="CAW25042.1"
FT                   /translation="MPFHGDAQENTWPNSRASPMSLASKLPRFRWLLPAFVVLVGVVLT
FT                   IVMHWDDRAGLWWKESQASQQQRDESIWLPGYRVVIDAKPLQGLEEEETSDLAYNPATR
FT                   TLFTVTGKRPLLVELSLTGDVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTIFHV
FT                   DPQTAELSTKSLAEFPLGNIGKKNKGFEGIAWDPRQQRLLLSKERDPMTLFSWKSDGGP
FT                   SLSGAMTALPSDDLYMRNVSALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFISLLGG
FT                   FNGLDSKIPRAEGVAIDDEGTIYMVSEPNLFYVFRKKSGERLATSDAD"
FT   CDS_pept        352973..353323
FT                   /transl_table=11
FT                   /locus_tag="PLES_03161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25043"
FT                   /protein_id="CAW25043.1"
FT                   /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAADD
FT                   TPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTRVKLTGEVDRDLVG
FT                   REIDVEFVEVIK"
FT   CDS_pept        complement(353404..354438)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03171"
FT                   /product="probable acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25044"
FT                   /protein_id="CAW25044.1"
FT                   /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRVKAVGL
FT                   GEVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLATGRSHDMLPIAWPTRRLRQTEPDN
FT                   IDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELANGARSVFSLCRPPGHHAAAD
FT                   YMGGYCFFNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIHGDPR
FT                   FEYPYFLGYADEKGNGVGTGYNFNYPLAAGSDWATWSQALQAAIRQIQAYAADVLIVSL
FT                   GVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFVMEGGYAVEEIGINAVNVLQGFE
FT                   GVHR"
FT   CDS_pept        complement(354454..355848)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03181"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25045"
FT                   /protein_id="CAW25045.1"
FT                   /translation="MASERNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYMV
FT                   PLTMFTTYGVVTEITGGRTASAYLITLAAMLFTAFSYSFMVKKYPIAGSAYSYTSLSFG
FT                   PCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLAAIGLVTVLNVIGIS
FT                   SVAGMSNVIVGAQFVFAVVFVAMAVKHLAGIPSLDLSLPFVGDGSQPGFAPLMAGAAVL
FT                   CLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSVFQDAE
FT                   SAANEVMLAAGGKFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRVFGSL
FT                   SERFKTPVIAILVVSVISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSYLLLDGRR
FT                   APRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLTWFAAGLAYLALHTGGFRRKAPTV
FT                   TFSEQN"
FT   CDS_pept        complement(356269..357312)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03191"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25046"
FT                   /protein_id="CAW25046.1"
FT                   /translation="MTYRTPLTLLFAAGLALGGQARAEGTLHFANWSDYYPPELLKKFE
FT                   KDTGIKATLDAYDSNETLLAKLKAGGGAYDVVVPSDSFIEIFVKEGLLQKLDKSQLPSL
FT                   GNLKENFRTLGFDPGHDYSIPYLWGTTGYSYDTAKVPGGRLEESWKPFFEPPAELKGKV
FT                   VALNSIEELFIPATYYLGIDECTEDAREAQKVLDLLLRQKPALAMYNSDGTIERMAAGE
FT                   VAMHQQWNGAFHRAHAQRASLEYVYPKEGIRLFIDNFAIPRDASNVKEAHVFIDWMMRP
FT                   ENIAAASNFAKYNNAIVGSEKFMEKALFDDPAINTPQDKLDRLKPFKLCSPKALALRSK
FT                   VWTKLKK"
FT   CDS_pept        complement(357360..358148)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03201"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25047"
FT                   /protein_id="CAW25047.1"
FT                   /translation="MNGRNPLWTFSGVRQAAWLFFAFLYIPILVLVVLSFNSGQSATLW
FT                   ESFSLKWYAVVANDPEILRAAKNSLLVATLATLASTVLATLAALGMRGRAFRGQTLMNG
FT                   VLGLPLLVPEIVTAVATLMFFSFIGLKLSLFTILIAHIVFCIPFAYLPIRARLEGLDPR
FT                   LAEAAADLYASPWKAFWKITLPLLMPGVLSGAMLAFIISMDDFVITYFVAGAGATTLPV
FT                   YIFSSIRMGISPKINAISSIILMISIAFVALSYYLGQRRR"
FT   CDS_pept        complement(358145..359074)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03211"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25048"
FT                   /protein_id="CAW25048.1"
FT                   /translation="MSTAGRPTAQQSAERRQLRRRLLLSSPAMLMLVLFLVIPLGIMFA
FT                   VSIQQSGDYGGVKWGQHSLEAYLNFLWERDLDDSLVFNADYLGIFQRSFWLSLLTTLGC
FT                   LALGFPTALYLALQPERRRNLLLFLVTVPFWTNLLVRVYAWILLLRNGGLVDAGLQGIG
FT                   LTDTGLGLLYTDNAVIIGLLYTYLPFMVLPIYSSLEKMDWRLVEAAFDLGANRWKALRR
FT                   VIVPLAMPGIVAGCILVFIPALGSYIIPELLGGGKALMIGNLIQLQFGTAHNWPFGAAL
FT                   SFALLAFVLLAMLIYNLRFRANAVGGQP"
FT   CDS_pept        complement(359071..360120)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03221"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25049"
FT                   /protein_id="CAW25049.1"
FT                   /translation="MTSAIAIERICMEFGTPGQGLKALDDVSLDIHANEFFTLLGPSGC
FT                   GKTTLLRLIAGFEQPSSGSIRLYGEHMEGLPPFRRPVNTVFQSYALFPHMSVADNIGFG
FT                   LEMQGRPRSEIDATVSRMLDLVKLPEVGKRRADQLSGGQQQRIALARALASRPKVLLLD
FT                   ESLSALDLKLRKEMQIELKRLQHETGITFIFVTHDQEEALTMSDRIAVMSKGKVLQVGT
FT                   PSDIYEAPLNRAVADFIGETNFLEGQADADGVRLADGQRLAATTPGSGAVTLAIRPERT
FT                   ELAADGQLEGVLENIVYVGTDTVYHLNVAGQPGFRVRQQNRDGARCPHSPGAKVRVRIP
FT                   AAAIRVLAE"
FT   CDS_pept        360448..361413
FT                   /transl_table=11
FT                   /locus_tag="PLES_03231"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25050"
FT                   /protein_id="CAW25050.1"
FT                   /translation="MTIHAQTPEPFSMSRAFTPRRLLLAVLLVALSALVLLGQSFRVFD
FT                   RAWFAVQEWRHADAWKERSIWLPDYRVRIEAQPIEGLNDDVSALTFDPDRRTLFTVTNQ
FT                   PAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDERQQRLVKVRLEDDTRFID
FT                   AADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAV
FT                   HVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSLLRGMH
FT                   GLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
FT   CDS_pept        complement(361453..363396)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03241"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25051"
FT                   /protein_id="CAW25051.1"
FT                   /translation="MFKPLAVAVGLGCAALSLGANAYQYGEYAGETLERLITDYPGRYR
FT                   GTASFAGASELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKFLVLGAHYDTY
FT                   YGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVESLDA
FT                   SQRANLLGMINLDSLVTGDKMYAHAGSNSVSSPALGAYREQILRIARELDIPLFTNPGL
FT                   NAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTWHDPAE
FT                   DNKEVLTNALGQERIEQRMRDFSRLLTRLVLELTNADLLASTASGGALARQMEDQLQRQ
FT                   HQALTRLHDRRWLTLLGSNRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRAGVHLLGD
FT                   YRYSEALTLGGSLAFQRSRDKLDHGGRIEGDTWQLGLFGLYNDGGPEWLAGELNLGHTR
FT                   YDSKRSVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGPLAGLDYMHY
FT                   RIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYASLRWVRELAD
FT                   GRLDDMDLTSRGDGRVRVADMGGVDKDFGRAQLGAQLAITEQLGVFAEANSRFAHSEGN
FT                   QAGYSLGVNWQF"
FT   CDS_pept        363686..364411
FT                   /transl_table=11
FT                   /locus_tag="PLES_03251"
FT                   /product="conserved hypothetical protein"
FT                   /note="orf00489"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25052"
FT                   /protein_id="CAW25052.1"
FT                   /translation="MNIFREALLNRRLKKALARHGCRMASGVETLRDGTQVTLEPNVKL
FT                   GKAKIHSPALEVGAYTDVVSGCEFLEVASIGRFCSIATGVVIGQPRRSHPMHWLSTHAF
FT                   TANPKLLRKPLQPEREATPARIGHDVWIGRDALILDGVEIGTGAVIGAQSLVNRDVPPY
FT                   AVVAGSPARVLRYRFAPELIERLLASRWWELPLDVLGELPLDDPQACVEALERRPPQAC
FT                   QEARRLRIRHKPFAIEWLS"
FT   CDS_pept        complement(364454..364786)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25053"
FT                   /protein_id="CAW25053.1"
FT                   /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALGGIES
FT                   VRKNSQRDGAFEVKPASNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAPEA
FT                   GLSDES"
FT   CDS_pept        complement(364909..365580)
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="PLES_03271"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25054"
FT                   /db_xref="GOA:B7V2P3"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2P3"
FT                   /protein_id="CAW25054.1"
FT                   /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALAR
FT                   HKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGAAL
FT                   TREKIVAAVAKTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVYREG
FT                   VLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGVKTLK
FT                   A"
FT   CDS_pept        365839..367353
FT                   /transl_table=11
FT                   /gene="ilvA1"
FT                   /locus_tag="PLES_03281"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25055"
FT                   /protein_id="CAW25055.1"
FT                   /translation="MLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQVLLKREDLQ
FT                   PVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRAVIVMPKTTPE
FT                   IKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTIAGQGTVAMEIL
FT                   RQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGERVVL
FT                   GQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITEPAGAL
FT                   AVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGERREAIIAVTIPERPG
FT                   SFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREALVAYLREKGFPVLDL
FT                   TDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLTKLGGRWNISMFHYRNH
FT                   GAADGRVVAGLQVPEDERHLIPQTLEAIGYPYWDETANPAYQLFLG"
FT   CDS_pept        367473..367940
FT                   /transl_table=11
FT                   /locus_tag="PLES_03291"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25056"
FT                   /protein_id="CAW25056.1"
FT                   /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARVARGF
FT                   KRVRLIGWPLLGLSLLALPVSGWWLAHLAGWPLGQSWLLFGACLYLLGCIFWLVLAGRL
FT                   ARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
FT   CDS_pept        367991..369262
FT                   /transl_table=11
FT                   /locus_tag="PLES_03301"
FT                   /product="putative epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25057"
FT                   /protein_id="CAW25057.1"
FT                   /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPVDAPAGVRWL
FT                   ALDLERLAERPDSFAWPAGVDLLINAAGTMSLDEASMARVQDSGARTLFDLAAAHGAKV
FT                   LQISALGAGAHPDVAFLASKAAADRHLLELGIPALVLRPSLLLGPGGASSAWLERLSPL
FT                   PLIPLLDNRARLQPLHVEDLVGAVLALLRRWPERAQVIPLVGPQALTQGELLDELRRAQ
FT                   GWPRGRYVVPPAALLDALGGLGRRAGWRTLSPSMLKLVRHDNLADPALLDAACGYRCAP
FT                   LASRLLGWPQAARSLAALMRPLMLAALVLIWLGTLVACLGPGYGWGLRILGEAGIHGWP
FT                   ASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLAISLILPHYWYDPYMAVG
FT                   KNIVLMVATLWLLGDEPRAREARG"
FT   CDS_pept        complement(369699..370898)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03311"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="orf00497"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25058"
FT                   /protein_id="CAW25058.1"
FT                   /translation="MIVALVTALCLAGDSMLYIALPIYWHEVGLEALWQVGALLSINRL
FT                   IRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFLAWVLLRGLWGIGWSFF
FT                   RIGGLSAVVYCAADHQRGRAMGLYNGLYRLGSLVGMLLGGLLVPVLGLPALALSFAFLA
FT                   LLGLPLLAKGFDLPENPAGHARTSAATAATSVARRPPPRGLVILSGFATALLIQGVLAA
FT                   TLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPWLAGRFGAWSDGPRGRRRFY
FT                   VAALLVGAMGFGLLSSRLPILAWLAIALLVMLVATALTTLTDALAADVARAGDVVGFMT
FT                   RYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAFLVLALLWLRRGDSQTGLLTIR
FT                   "
FT   CDS_pept        complement(370990..371643)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03321"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25059"
FT                   /protein_id="CAW25059.1"
FT                   /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFYA
FT                   DYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMQEVIEPIVLAKGEALLAEHRAAG
FT                   DRLVIITATNRFVTGPIAERLGVETLIATECEMRDGRYTGQTFDVPCFQGGKVVRLQRW
FT                   LDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR"
FT   CDS_pept        371847..372326
FT                   /transl_table=11
FT                   /gene="ygdP"
FT                   /locus_tag="PLES_03331"
FT                   /product="Nudix hydrolase YgdP"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25060"
FT                   /db_xref="GOA:B7V2P9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2P9"
FT                   /protein_id="CAW25060.1"
FT                   /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRET
FT                   PEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRL
FT                   MSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
FT   CDS_pept        372349..374628
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PLES_03341"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase
FT                   PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25061"
FT                   /protein_id="CAW25061.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLDT
FT                   ETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIALFKQA
FT                   LEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQGALRQ
FT                   VVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVSEELSPA
FT                   MLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDLIVDGYHG
FT                   EVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTGLLADVARA
FT                   QERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPMISGTHELEEA
FT                   LHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWLLRQITLDKARDLLGQLLTFDNPQVIHSSLHLALRNLGLGRVINP
FT                   AATVQP"
FT   CDS_pept        374654..375784
FT                   /transl_table=11
FT                   /locus_tag="PLES_03351"
FT                   /product="putative sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25062"
FT                   /protein_id="CAW25062.1"
FT                   /translation="MRRLRFPRKRIDCLPFGRGHWPVERARDCRKMDERASKPPGLLPL
FT                   SREDLEKTLRYALEIVSDGIWDWNIATNQVSRSAGWYLMLGYPPHSLPESVETWKSIIH
FT                   PEDYPRVMASFQAYLDGESPEYCEEYRCRTYSGDYLWISDRGRFVEFDERGEPRRMIGA
FT                   HHEIHQRKLVELELQQRNEELFDWNLRLEELVAERTEALHRVNQALASKMAEAQRLSEI
FT                   DPLTELYNRRKFEQCLHHEWMRRQRHGRATALVMIDVDHFKRINDLFGHSTGDRVLVAF
FT                   GRLVASELREVDVLARWGGEEFILLLPETGLEAAAALAERLRQRVRSQSFEMGERLTAS
FT                   FGVGVLNDGETLDLLLCRVDDALYRAKQRRDCVACC"
FT   CDS_pept        complement(375788..376543)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25063"
FT                   /protein_id="CAW25063.1"
FT                   /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFAG
FT                   RDLEAGGTWLGLGPAGRFAALTNVRDPSQALGKRSRGELVADFLRGGGNPADYLAQVAG
FT                   RAADYSGFNLLIGDRHQLWHYNPRVGPPRLLPAGIYGLSNAALDTPWPKLLKARAALAE
FT                   RLAEPHPQALLELLADAAPAADGQLPDTGVGLATERLLSSVFIASPSYGTRASSVVRVH
FT                   ADGTREMIERSFGPSGARLGEVSLVLPPG"
FT   CDS_pept        376665..377468
FT                   /transl_table=11
FT                   /locus_tag="PLES_03371"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25064"
FT                   /protein_id="CAW25064.1"
FT                   /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGDV
FT                   LTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIKGP
FT                   LLQKIIGVFAILVALQMVLDLKPKGSREVPGKGGLTLAGAVIGWASAIFGIGGGSLTVP
FT                   FLSWRSVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALVGIAA
FT                   TSMLFARFGARLAHRLSPRVLKRLFALLLFSVGISFLTPDLAFLS"
FT   CDS_pept        377478..378278
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="PLES_03381"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25065"
FT                   /db_xref="GOA:B7V2Q4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2Q4"
FT                   /protein_id="CAW25065.1"
FT                   /translation="MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRFD
FT                   PTWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGLLG
FT                   VMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMVFPN
FT                   GGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEFVRVP
FT                   DAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA"
FT   CDS_pept        378484..379278
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="PLES_03391"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25066"
FT                   /db_xref="GOA:B7V2Q5"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2Q5"
FT                   /protein_id="CAW25066.1"
FT                   /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLV
FT                   TTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAP
FT                   DGRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQL
FT                   YQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTR
FT                   EPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV"
FT   CDS_pept        complement(379305..380102)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25067"
FT                   /protein_id="CAW25067.1"
FT                   /translation="MPFVSYAQNLEDVRLWRALKLFPRGFYIDVGANHPRIDSVTLAFY
FT                   ERGWRGINIEPLPHLHRELERERPEDLNLNLAIGEREGRATLYEMAASGLSTLDPELAR
FT                   QRQAEGCTATPREVKVSTLDAICAAHVEGPIHFLKIDVEGLEGAVLRGLDLNRWRPWLI
FT                   LAETPFDHDPEWKAPLLAAGYRFVHFDGLNGYYLAEEQARLEGAFALPPNLLDDFQLCH
FT                   GHAMSHPVAPLEQALEQALQRAEDAERALRDWRALPWYRRLFG"
FT   CDS_pept        complement(380137..381516)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25068"
FT                   /protein_id="CAW25068.1"
FT                   /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGRFE
FT                   QEAKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPQHREEE
FT                   WRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHETQAAARL
FT                   RAGQRLIAELLVDVAACRRLVPGGESAVQEATRDLHQQVRKREQACVEALLRLYAFARD
FT                   DARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVTLGAAAA
FT                   LGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQTRGHAAVE
FT                   AIRLETPEDKQWREGKLPEALRKARAHPEWSSLNGRRVGGSDRQEQIDALAELLESGRG
FT                   E"
FT   CDS_pept        complement(381509..382894)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25069"
FT                   /protein_id="CAW25069.1"
FT                   /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEAVRQALAQGGSLP
FT                   RRILTRAHWLGRREGLLDAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPVNV
FT                   FWALASLLGLHLLTLLGWALGLFAGGEAAGALGRLWLWLSGKLARDARAAHLAPALLVL
FT                   LGRRRLARWGLGALVHGLWLLGLLTALAMLLGLLATRRYGFVWETTILGSDTFIALTQA
FT                   LGALPALLGFPLPDAELIRASGDAALASEAARHAWAGWLVGVLLVYGVLPRALLGLLCL
FT                   WRWKRGLAHLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSGQEAAGAV
FT                   LVAVELDDRRPWPPKLAEGVADAGILDDGQQRRRLLEQLTRYPPARLAIACDPRRSPDR
FT                   GTLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHAALERLQLPHGETSPLAWLET
FT                   GHD"
FT   CDS_pept        383086..383448
FT                   /transl_table=11
FT                   /locus_tag="PLES_03431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25070"
FT                   /protein_id="CAW25070.1"
FT                   /translation="MKVVRRYPLALLLGMAGALADELPDGSLLQRYGVQADQLPTLAAD
FT                   PPSRKEEKETPSRFRVEPEQPLVTFGVKDHKGMEPTGNPSIDAMHERDRRICRNIRRQA
FT                   LEKGKAQPFDGYIECP"
FT   CDS_pept        complement(383485..384636)
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="PLES_03441"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25071"
FT                   /protein_id="CAW25071.1"
FT                   /translation="MQPAFLRRHLGAACLMLAAGLASAAHADTGNVQRAIDWAQGQASV
FT                   RHPASDERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYVEPDLVMTRDGKLVARHDN
FT                   ELGLTTDVAQHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIRPGNAR
FT                   LDGTFEIPTLQEIIDLVKSLQISQQRTIGLYPEIKHGTHFQRLGLAMERPLVKTLHRNG
FT                   YLGPRAPVFIQSFEVNNLKELKRLTGIRLVQLYGSGQPYDQQAAGGSLTYAEMATAKGL
FT                   RQVARYAYGVGPDKSYVIPRDANGNLGQPTRFVGDAHAAGLKVHPYTFRAENSFLPAEF
FT                   RSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
FT   CDS_pept        384846..385940
FT                   /transl_table=11
FT                   /locus_tag="PLES_03451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25072"
FT                   /protein_id="CAW25072.1"
FT                   /translation="MASAQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARVEA
FT                   RVPTAATDDWGRQPDSLMSAVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGFFI
FT                   QRMLIRMEPTRPGAPLSLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVRNLR
FT                   MNTRKDGQEVRGELLRKGRWRPLRMLTEIELSGPLEVTLVPRRIFVDGVEVTSSLAAAS
FT                   IEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGMQLALGDSLADL
FT                   QWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPGQPLLFNLYDYRRQLQNGVIR
FT                   LREDGMVQIAVSPVKAPAPLEARL"
FT   CDS_pept        385937..386977
FT                   /transl_table=11
FT                   /locus_tag="PLES_03461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25073"
FT                   /protein_id="CAW25073.1"
FT                   /translation="MSRRPWGVLLGWCLLAASAVQAESAIDRQQRELALLREGWYRQVP
FT                   PAPVPLPMRTAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVDFD
FT                   RPQDMHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVRPLG
FT                   VGPWLPLRLGGGVEVDAASGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLDRPGAS
FT                   LVGSAMRLDYRKVFPLLGIDGHVQEAWLDDQGLHLRFSQAPGQPSPVFSPPAAAGPSFL
FT                   WLQSGDLKIFEILITYAQVLLKTETPDQVLTFNLQDYRKVLATGTTQVNEDGTFFMQVP
FT                   PYANPL"
FT   CDS_pept        387048..387554
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="PLES_03471"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25074"
FT                   /protein_id="CAW25074.1"
FT                   /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIM
FT                   GRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLI
FT                   GGAQLYAEALPRAARLYLTRVGLAPEGDAFFPEIDGAAWRLASSIEHVAADDAPAYAFE
FT                   VWERR"
FT   CDS_pept        complement(387570..388043)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03481"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25075"
FT                   /protein_id="CAW25075.1"
FT                   /translation="MPQSRRPLRIGLIADTHGLLRPEALERLRGCDQLIHAGDIGKPEI
FT                   LAELERLAPLSVVRGNNDTQDWAADIPERLLLKIGRLTLYVLHDLKRLDLDPAAEGIDV
FT                   VVAGHSHKPLKEERDGVLYLNPGSAGPRRFSLPIGIGVLEVAGKKIEAELITL"
FT   CDS_pept        complement(388182..389567)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03491"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25076"
FT                   /protein_id="CAW25076.1"
FT                   /translation="MSSLQSPSDASARNDLVYGLDDRPSAPIALLAALQHLLAIIVPIV
FT                   TPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGP
FT                   LIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVVLMI
FT                   GLTLIKVGLISMGGGFSAMSNGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCAIVIA
FT                   LAVGYALAGYLGRLDFTGMHQAELFQIPTPLHFGLDFSWPLFIPMLVIYLVTSLEAIGD
FT                   VTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVIQLTGVA
FT                   SRYVGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINILAGIQLDR
FT                   RALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWFLPESPVQK
FT                   AGH"
FT   CDS_pept        complement(389797..391635)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="PLES_03501"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25077"
FT                   /db_xref="GOA:B7V2R6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2R6"
FT                   /protein_id="CAW25077.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLAT
FT                   HADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIANFKAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEAEVPFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGELARG
FT                   GLLHTDVPTVHSPSMADAIAQWDITQTRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLD
FT                   DDRAEGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGSAKIFESQDA
FT                   AVKGILGDEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVQDGDKVLIDIPNRSINLLVSDEELAARRAEQDKKGWK
FT                   PAAPRARRVSTALKAYALLATSADKGAVRNKALLDG"
FT   CDS_pept        complement(391963..393159)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03511"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25078"
FT                   /protein_id="CAW25078.1"
FT                   /translation="MTLPSLRLKANAERRLRAGHLWVYSNEVDVAATPLNAFAAGDQAV
FT                   LEMANGKPLGIVALSPNNLICGRLISRDTKHVLDKSLLVHRINIALSLRERLFDKPFYR
FT                   LVYGDSDLLPGLVVDRFGDVLVVQLASAAMELRKDEVLAALLQVLKPAAVLWKNDSSAR
FT                   DAEGLERYVANAYGEVPEWVALEENGVKFEAPVLAGQKTGWFYDHRMNRARLAPYVRGK
FT                   RVLDLFSYIGGWGIQAAAFGASEVMCVDASAFALDGVERNAALNGVAEKVACVEGDVFE
FT                   ALRELKAADERFDVVIADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLSKDGILVSASCS
FT                   MHLPEDDLQNILIGSARHLDRNIQLLERGGQGPDHPVHLAIAETRYIKSLTCRLLPNG"
FT   CDS_pept        complement(393232..393771)
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="PLES_03521"
FT                   /product="protease PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25079"
FT                   /protein_id="CAW25079.1"
FT                   /translation="MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSDKAG
FT                   EVRGWNHHQPAEAFRVDGTFEDASLDDYDALLLPGGVINSDQIRSLAKAQELAIRAEQA
FT                   SKPVAVICHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSSRKP
FT                   EDIPAFNRRFIEILAG"
FT   CDS_pept        393987..394811
FT                   /transl_table=11
FT                   /locus_tag="PLES_03531"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25080"
FT                   /protein_id="CAW25080.1"
FT                   /translation="MPPQPQIMVDLQMEQVMPNPDLKNIARLISQDPGLSGALLKLVNS
FT                   PFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSDDTIVTLNRFWDTAQDVAMSC
FT                   LSLAKRIGYESVDEAYALGLFHNCGIPLMLKRFPHYMAVLEEAYAAASDERRVVDTENR
FT                   VLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIFGDESARDTQLKNLLAILKMAEH
FT                   ICGSHRVLGNQPEDHEWNSIGALVLDYVGLTDYDFENLKGSILELGVGQGSY"
FT   CDS_pept        394870..395682
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PLES_03541"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25081"
FT                   /db_xref="GOA:B7V2S0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2S0"
FT                   /protein_id="CAW25081.1"
FT                   /translation="MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRL
FT                   SGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMAL
FT                   RYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNA
FT                   VVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFV
FT                   GGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR"
FT   CDS_pept        395759..396337
FT                   /transl_table=11
FT                   /locus_tag="PLES_03551"
FT                   /product="putative phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25082"
FT                   /protein_id="CAW25082.1"
FT                   /translation="MSGNYLPRNTLVESLGHAMLKLSGWKIEGQLPALDKFVVIGAHHT
FT                   SNWDFVAFLAAKFVLRLNARWFGKHTLFNGPLGGLMRRWGGIPIQRHLKLNTVDQAIQA
FT                   FREHREFMLIIAPEGTRKKVDRWRMGFYHIARGAGVPVVPAALDYENRRIVIGEPFWPT
FT                   GNEDADLCSLIGFYRPFIPKKPHYAFLGD"
FT   CDS_pept        396420..396764
FT                   /transl_table=11
FT                   /locus_tag="PLES_03561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25083"
FT                   /protein_id="CAW25083.1"
FT                   /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAY
FT                   AMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGC
FT                   TTSGYNHDES"
FT   CDS_pept        397034..398020
FT                   /transl_table=11
FT                   /locus_tag="PLES_03571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25084"
FT                   /protein_id="CAW25084.1"
FT                   /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAKEQSKAEQGDKRGDEL
FT                   FAEFTRLRQAAETGEPQALFDFGAYFYQQQNYASAREWWGKAAAAGMVRAQIQLAMLYR
FT                   DGDGGPQDKTEAARWFRKAAEQGDAAAQNEMGVLYWRGEGVDQDRVKAGTWFERAAASG
FT                   SEDAETNLGWFYLDDSQGVYSATSDEEAALLDRYAGSREKAFHWFCKAATQGDARAQFK
FT                   VGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESAANAAWYTRLENWIHAALDG
FT                   ELSGVADCTGAADRRHSGRGMEGAPSDPEAVEASAEDAQQAVEAASQ"
FT   CDS_pept        complement(398125..399858)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03581"
FT                   /product="probable gamma-glutamyltranspeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25085"
FT                   /protein_id="CAW25085.1"
FT                   /translation="MSFLNLPVRTLVAACGLSLLSLAAHADSFRGDAHAPQQAAVATPH
FT                   PAATVAGLETLANGGNAFDAAAAIAAALAVAEPYGSGLGGGGFFLLRQAGAQPTYRFLD
FT                   ARERAPKAAYADMYRRNGKVDPRLSVDGPLAAAIPGLPAALVELSSRYGRKPLADNLVP
FT                   AIRLAVDGVSVDRIYRDRAAMRLEAMRKDPETARIFLDKGGIPDEWNLLRQPQLARTLE
FT                   RLGRYGRIGFYEGETADKLLTGVRAGGGIWSAADLRDYRVIERRPLEVKLANGRELISA
FT                   PPPSAGGVALAQSLQMLEQLPWQKAEPVQRAHYVLEVLRRAYRDRGLLGDPDFVANPLP
FT                   SLLAPDYLKRLAAGIDPRRATPSSALPEAPAWREGDHTTHFAVIDAQGNAVAATLSVNL
FT                   PFGAAFTVPGTGVVLNNEMDDFAADTQGANSYGLAGSQANAVAAGKRPLSSMSPSFLES
FT                   PTDFAAFGTPGGSRIPSMVLISMLQYFDGRPVGQWVAAPRYHHQYKPDVVEYEPRAFSD
FT                   AEAAELRRRGYQLKRLERSYGNQQVLYWDKRSGRVDAASDPRGIGYSSLSLEAQAQPRP
FT                   H"
FT   CDS_pept        complement(399986..400237)
FT                   /transl_table=11
FT                   /gene="fdx1"
FT                   /locus_tag="PLES_03591"
FT                   /product="ferredoxin [4Fe-4S]"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25086"
FT                   /protein_id="CAW25086.1"
FT                   /translation="MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHY
FT                   DEPQCQQVCPVDCIPLDDANVESKDQLMEKYRKITGKA"
FT   CDS_pept        complement(400358..400837)
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="PLES_03601"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25087"
FT                   /db_xref="GOA:B7V2S6"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:5TS2"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V2S6"
FT                   /protein_id="CAW25087.1"
FT                   /translation="MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLF
FT                   SLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANM
FT                   NRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR"
FT   CDS_pept        complement(400989..402584)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03611"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25088"
FT                   /protein_id="CAW25088.1"
FT                   /translation="MPVPDLFAEGLARGWKTYNGSRLDDDLELEADVVVVGTGAGGGTT
FT                   AEILSAAGLKVLLVEEGPLKTSSDFKMQEADAYPELYQEGIGRMSKDGAITILQGRAVG
FT                   GTTLINWTSSFRTPEPTLQHWAQVYGVKGHSAEDMAPWFEKMEQRLHVAPWALPPNANN
FT                   DVIRLGCEKLGYHWKVIPRNVLGCWNLGYCGMGCPVNAKQSMLVTTIPATLDKGGELLY
FT                   LARANRLLLDGDKVTGLECLGMDERCVAPNGRRIRVRARHYVLSGGGINTPAILLRSKA
FT                   PDPSQRVGKRTFLHTVNFSAGLFDRVINPFYGAPQSIYSDHFQWDDGVTGRMSYKLEVP
FT                   PLQPSLASVLLGGFGSDNALRMEQLPHTNMMLALLRDGFHPDSAEGSVGLRGDDTPVLD
FT                   YRMTDYTWDGIRRAFHTMAEIQFAAGAREVRPVHSDARSAKNLQEARGIIDGLRLEIYR
FT                   TRLGSAHVMGGCAMGEDPTAAVADSLGRHHHLRNLSIHDGSLFPTSIGANPQLSVYGLT
FT                   AQLASALAERLARA"
FT   CDS_pept        complement(402640..403188)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25089"
FT                   /protein_id="CAW25089.1"
FT                   /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVTASLTGCSAEKPA
FT                   SGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLTQQ
FT                   LFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAMMAW
FT                   YARPEAWAHCGYPGPPKIA"
FT   CDS_pept        complement(403243..404673)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03631"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25090"
FT                   /protein_id="CAW25090.1"
FT                   /translation="MVADIAYLQQSQQEINQLEALFARQRAAYLAQPMPDATQRVQWLK
FT                   ALRDLLFKEQQALIEAIDRDFSARSADETLLAEIMPSLHGIHYAAKRVKKWMKPARRAV
FT                   GLQFQPASAQVVYQPLGVVGVIVPWNYPLFLSIGPLTGALAAGNRVMIKMSESTPATGR
FT                   LLKDLLARIFPEDQVAVVLGEVDVGVAFSKLPFDHLLFTGATSVGKHVMRAAAENLTPV
FT                   TLELGGKSPAIVSDSVPMKDAAERIAFGKSLNAGQTCVAPDYVLVPSRRVEEFVSQYKE
FT                   VVQGFFPRLSDNPDYTAIINERQLGRLRGYLDDAREKGATLVPLFAEGQQRRLPQTLLL
FT                   NVSDDMKVMQEEIFGPLLPVIPYERLEDALAYVNQRPRPLALYYFGYDKAQQQRVLHET
FT                   HSGGVCLNDTLLHVAQDDIPFGGVGPSGMGHYHGHEGFLTFSKAKGVFSKPRFNAARMI
FT                   YPPYGKSIQKLVYKLFVR"
FT   CDS_pept        404962..405609
FT                   /transl_table=11
FT                   /locus_tag="PLES_03641"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25091"
FT                   /protein_id="CAW25091.1"
FT                   /translation="MAPRIKTRDRIAQASLELFNAQGERSVTTNHIATHLGISPGNLYY
FT                   HYPNKQAIIAELFAEYESHVESFLRLPEGRGLTVDDKTFYLEALLAAMWRYRFLHRDLE
FT                   HLLESDPELAARYRAFAQRCLVNAKAIYRGFTEAGILRMNETQLEALTLNAWIILTSWV
FT                   RFLCTTLDLDGDLSEAQLRRGIYQVLALESGHIEAQAQDAVDGISERLYVPL"
FT   CDS_pept        complement(406067..407065)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03651"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25092"
FT                   /protein_id="CAW25092.1"
FT                   /translation="MTASPTFQPAWWLPNPHLQTLWSPFFRRGPTLERQRERLWLADGD
FT                   FIDLDWAGPHDAETPLVLALHGLTGSSSSHYILGLQRALLERGWASVALNWRGCSGEPN
FT                   RLPRGYHSGVSDDLAEVVAHLRARRPQAPLYAVGYSLGGNVLLKYLGETAGDCPLLGGV
FT                   AVSVPFRLDECADRIGLGFSRVYQAHFMKAMLAYVQDKQRLFGEQGQAEGLAALQRLGP
FT                   LEGMRTFWDFDGRVTAPLHGFADARDYYRRASSRYYLPDIRTPSLIIHSSDDPFVFARS
FT                   LPDRSELAPCTELELHARGGHVGFVDGSPRQPTYYLERRIPDWLEARLRQH"
FT   CDS_pept        complement(407102..407392)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25093"
FT                   /protein_id="CAW25093.1"
FT                   /translation="MADQGADPFILETGSGRILFDLHGGRGWDPAPCFDDLWQMAASLV
FT                   CFGEVWSGAGEDILLDDCSVAPRYRQQLVDELQPILGSRQRAEDLADEFGW"
FT   CDS_pept        complement(407671..408267)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03671"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25094"
FT                   /protein_id="CAW25094.1"
FT                   /translation="MSKPTAKAPGRHGGQGQLRIIGGEWRSRRFVFPDGPGLRPTPDRV
FT                   RETLFNWLAPYVEGARVLDPFAGSGALFLEALSRGAREGLALDTNGEAVAALRNHLDAL
FT                   KCGTAQLVLGDAVRYLGNQAPSAFDLVFLDPPFHQNLLQDACRLLETRGWLNPDAWIYT
FT                   ESESVPSSLGLPGNWRLHREKKAGNVHYALWQRGA"
FT   CDS_pept        complement(408267..409754)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03681"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25095"
FT                   /protein_id="CAW25095.1"
FT                   /translation="MSERTGLRYGLLGLIVIALLAALAYFVARPPQTPAAAHAAAVEEN
FT                   QLQSLKDVAKQAPVHRKLDIQEWKTAEGAKVLFVEAHELPMFDLRLTFAAGSSQDAGTP
FT                   GLSMLTNAMLNEGVPGKDTTAIAAGFEDLGASFSNGSYRDMAVAGLRSLSDADKRTQAL
FT                   KLFEQVIGQPTFPEDALARIKNQVLAGFEYQKQNPGKLAGLELFKRLYGEHPYAHSSDG
FT                   DEKSVPTISREQLQAFHKKAYAAGNVVIALVGDLSRQEAEAIAAEVSKALPQGPALVKT
FT                   VQPETPKPGLTHIDFPSEQTHLMLAQLGIDRQDPDYAALYLGNQILGGGGFGTRLMDQV
FT                   REKRGLTYGIYSGFTAMQARGPFMINFQTRAELSEGALKLVQDIVRDYLANGPTQKELD
FT                   DAKRELAGSFPLSTASNADIVGQLGAIGFYGLPLDYLESFLKQVEGLSVEQVRSAMAKH
FT                   LDADAFVIVSAGPSVPQKPLPPPTAKPAQQPSGVPEH"
FT   CDS_pept        complement(409747..411144)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03691"
FT                   /product="probable zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25096"
FT                   /protein_id="CAW25096.1"
FT                   /translation="MAARKVQITMKTPARRRVGLLLASLCLPLFAQAAETQPTHEFSLD
FT                   NGLKVIVREDHRAPVVVSQLWYRIGSSYETPGLTGLSHALEHMMFKGSRKLGPGEASRV
FT                   LRDLGAEENAFTTDDYTAYYQVLARDRLPVALEMEADRMAHLSLPADQFKSEIEVIKEE
FT                   RRLRTDDNPNALAFERFKAAAYPASGYHTPTIGWMADLQRMTIDDLRHWYESWYAPNNA
FT                   TLVVVGDVTADEVKTLAKRYFGEIPWRQLPPARKPLELAEPGERRLKLYVRTQLPNLIM
FT                   GFNVPSLGSSENPREVNALRLIGALLDGGYSARLASRLERGEELVAGASTYYDAFNRGD
FT                   SLFVLSATPNVQKGKTLEQVEAGLWKQLDDLKQNPPSAAEIERVRAQMIAGMVYEKDSI
FT                   AAQASSIGQLESVGLSWKLIDQDLEALKAVTPDDIQKAARTYFTPSRLTLAQVLPVKAE
FT                   EKEARHE"
FT   CDS_pept        411265..412635
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PLES_03701"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25097"
FT                   /protein_id="CAW25097.1"
FT                   /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPADQPVEPV
FT                   SETAAAEQRAPADDVAQSLTEQPGRQQPSAAEPAEPAPVAEAPLASDEPASAEEHSPRP
FT                   EAPVAQPEPILAAEPEPEPEPEPEPEPVAPLAAAPAVSEPATRPGFFARLRQGLSKTSA
FT                   SIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGA
FT                   LYKALQEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKV
FT                   MLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADT
FT                   AGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTG
FT                   LALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
FT   CDS_pept        412632..413303
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PLES_03711"
FT                   /product="cell division protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25098"
FT                   /protein_id="CAW25098.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTLL
FT                   RLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVADNIALPL
FT                   QILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIADREDE
FT                   A"
FT   CDS_pept        413303..414310
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PLES_03721"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25099"
FT                   /protein_id="CAW25099.1"
FT                   /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFSAYLESHRASL
FT                   VDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDLKT
FT                   SENQGQDLREQIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVISVTP
FT                   KQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLTLLLV
FT                   VGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAYSLNWL
FT                   NGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAPR"
FT   CDS_pept        414424..415278
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PLES_03731"
FT                   /product="sigma factor RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25100"
FT                   /protein_id="CAW25100.1"
FT                   /translation="MTTSLQPVHALVPGANLEAYVHSVNSIPLLSPEQERELAERLFYQ
FT                   QDLEAARQMVLAHLRFVVHIAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNEEVHRVAESLG
FT                   VEPREVREMESRLTGQDMAFDPAADADDESAYQSPAHYLEDHRYDPARQLEDADWSDSS
FT                   SANLHEALEGLDERSRDILQQRWLSEEKATLHDLAEKYNVSAERIRQLEKNAMSKLKGR
FT                   ILA"
FT   CDS_pept        415343..415948
FT                   /transl_table=11
FT                   /locus_tag="PLES_03741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25101"
FT                   /protein_id="CAW25101.1"
FT                   /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWQEQVL
FT                   APLADNALTLRQLHDAVGGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEEQL
FT                   SLQRASALQPGSAPQPLSAGLEGQLGDKPIVALSMIPEGRVGAERLLASLGQPRLRLQL
FT                   AQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPPR"
FT   CDS_pept        complement(415953..416684)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03751"
FT                   /product="probable transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25102"
FT                   /protein_id="CAW25102.1"
FT                   /translation="MAAPFFQAKPRMLRSLFRRLFKYLLWFMAASVVLVAVLRWVPPPG
FT                   TMVMVERKVGSWVDGQPIDLQRDWRSWEQLPDSLKVAVIAGEDQHFAEHHGFDLPAIQQ
FT                   ALAHNERGGSIRGASTLSQQVAKNVFLWSGRSWLRKGLEAWFTLLIETLWTKQRILEVY
FT                   LNSAEWGPGVFGAQAAARYHFGLDAERLSRTQASQLAAVLPSPLKWSAARPGPYVRQRA
FT                   AWIRQQMWQLGGDDYLLRLER"
FT   CDS_pept        416721..417098
FT                   /transl_table=11
FT                   /locus_tag="PLES_03761"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25103"
FT                   /protein_id="CAW25103.1"
FT                   /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEYLAVFQTGVHY
FT                   QLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIVTPFG
FT                   GVSFLAGWLCLGLAAWRLGNA"
FT   CDS_pept        417201..417401
FT                   /transl_table=11
FT                   /locus_tag="PLES_03771"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25104"
FT                   /protein_id="CAW25104.1"
FT                   /translation="MQIQLNGEPFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQ
FT                   HASTALKDGDRVEIVHAIGGG"
FT   CDS_pept        417460..418257
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PLES_03781"
FT                   /product="thiamine biosynthesis protein, thiazole moiety"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25105"
FT                   /db_xref="GOA:B7V3W7"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V3W7"
FT                   /protein_id="CAW25105.1"
FT                   /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAE
FT                   IVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHN
FT                   LVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPL
FT                   AGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHA
FT                   KDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
FT   CDS_pept        418411..419082
FT                   /transl_table=11
FT                   /gene="micA"
FT                   /locus_tag="PLES_03791"
FT                   /product="DNA mismatch repair protein MicA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25106"
FT                   /protein_id="CAW25106.1"
FT                   /translation="MRTVKSFVMRAGRMTEGQQRGLDLGWPKFGLELSDEVQDFDAIFG
FT                   RQAPRTFEIGFGMGHSTLEMAAAAPDIDFIGVEVHKPGVGALLNGLLTQGLGNVRVYSC
FT                   DALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVGGVLHMAT
FT                   DWEPYAEHMLDVMSAAPGYRNQAEDGRFVPRPQERPVTKFERRGERLGHGVWDLKFERV
FT                   D"
FT   CDS_pept        419245..420591
FT                   /transl_table=11
FT                   /locus_tag="PLES_03801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25107"
FT                   /protein_id="CAW25107.1"
FT                   /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGNA
FT                   DGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVLDSRNMAAYQALLTPGTQALLQA
FT                   NPDYHLRVFPTRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSGQEA
FT                   IWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTLFYYK
FT                   YKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDTNGMAT
FT                   ADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDLLRYELH
FT                   RVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPINYYDVPL
FT                   VSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
FT   CDS_pept        complement(420604..420861)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25108"
FT                   /protein_id="CAW25108.1"
FT                   /translation="MKPIKHLYLHFTDGQRLSLRFPRQQDDPAEVARSIRQQLDTPYLS
FT                   VEVDGDLLLIPRDSIKYLQISPAPARLDDDGTLRGAELIV"
FT   CDS_pept        complement(420923..421246)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25109"
FT                   /protein_id="CAW25109.1"
FT                   /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQR
FT                   IGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGMIA
FT                   DRS"
FT   CDS_pept        complement(421327..422481)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03831"
FT                   /product="probable oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25110"
FT                   /protein_id="CAW25110.1"
FT                   /translation="MTQATPFQLPPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYV
FT                   DALLADLEQDLRHVHGRRLGSIFFGGGTPSLFSAKALGRLLEGVERRVGFADGIEITLE
FT                   ANPGTFEQVKFADYRRLGINRLSIGVQSFQADKLQALGRIHDGAEAVRAADMARQAGFD
FT                   NFNLDLMHGLPGQSLDDALADLRQALALAPTHLSWYQLTMEPNTVFWSQPPELPEDDIL
FT                   WDIQEAGQALLDEHGYRQYETSAYARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDG
FT                   RIVRTWKTRLPKDYLNPQKAFQAGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQ
FT                   PLAAIADACAAARDAGLLADDPQRLRPSERGQLFLNDLLQHFLP"
FT   CDS_pept        complement(422602..423195)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03841"
FT                   /product="putative Ham1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25111"
FT                   /protein_id="CAW25111.1"
FT                   /translation="MIKLEQLVLASHNAGKLKELQAMLGASVKVRSIGEFSQVEPEETG
FT                   LSFVENAILKARNAARLSGLPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLL
FT                   EAMKDVPDAERGAQFVSVLALVRHADDPLPILCEGIWEGRILREARGAHGFGYDPLFWV
FT                   PERDCSSAELAPEEKNRLSHRARAMALLKQRLGL"
FT   CDS_pept        complement(423192..423611)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03851"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25112"
FT                   /protein_id="CAW25112.1"
FT                   /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNVA
FT                   SAVGLVRSKAQGVINVVPMEKGKPVEAAVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQ
FT                   FPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
FT   CDS_pept        complement(423743..424363)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03861"
FT                   /product="putative methionine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25113"
FT                   /protein_id="CAW25113.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLEI
FT                   DPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRVGK
FT                   TCIITCPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLRMRV
FT                   LDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRNLAV"
FT   CDS_pept        complement(424371..425510)
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="PLES_03871"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25114"
FT                   /db_xref="GOA:B7V3X6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V3X6"
FT                   /protein_id="CAW25114.1"
FT                   /translation="MPTVFPDDSVGLVSPQTLHFNEPLELTSGKSLAEYDLVIETYGEL
FT                   NATQSNAVLICHALSGHHHAAGYHSVDERKPGWWDSCIGPGKPIDTRKFFVVALNNLGG
FT                   CNGSSGPASINPATGKVYGADFPMVTVEDWVHSQARLADRLGIRQWAAVVGGSLGGMQA
FT                   LQWTISYPERVRHCLCIASAPKLSAQNIAFNEVARQATLSDPEFLGGYFQEQGVIPKRG
FT                   LKLARMVGHITYLSDDAMGAKFGRVLKTEKLNYDLHSVEFQVESYLRYQGEEFSTRFDA
FT                   NTYLLMTKALDYFDPAAAHGDDLVRTLEGVEADFCLMSFTTDWRFSPARSREIVDALIA
FT                   AKKNVSYLEIDAPQGHDAFLMPIPRYLQAFSGYMNRISV"
FT   CDS_pept        complement(425599..427566)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25115"
FT                   /protein_id="CAW25115.1"
FT                   /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAKL
FT                   ERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFHDP
FT                   RAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTGDPEGMAQAFAQVAKTKALPV
FT                   EQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALGSEPE
FT                   LTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDVLWDDL
FT                   SGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRLDRLEAL
FT                   LCERIVAQKEALLENAVLGQVLGLLHNSQHLLRLRLEKVEEQRALLDDKQRDSGQLLFE
FT                   LTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRRNLNGSLTT
FT                   VGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDAPQLRVQRYQ
FT                   RELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLHQRLREETERWANDALM
FT                   PLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAGELQEQLREAGDILRQLR
FT                   RPSPLQRQAKVVNLPGSQRA"
FT   CDS_pept        complement(427674..427844)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03891"
FT                   /product="conserved hypothetical protein"
FT                   /note="orf00584"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25116"
FT                   /protein_id="CAW25116.1"
FT                   /translation="MEGKANAHLLAFLGKAFGVAKSLVSLESGELNRQKRVRIRHPTRL
FT                   PEELGIAARPA"
FT   CDS_pept        complement(427967..428560)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03901"
FT                   /product="putative YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25117"
FT                   /protein_id="CAW25117.1"
FT                   /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIV
FT                   RATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSI
FT                   IAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDL
FT                   SPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
FT   CDS_pept        complement(428571..429392)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="PLES_03911"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25118"
FT                   /protein_id="CAW25118.1"
FT                   /translation="MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKI
FT                   AGEFAIDVVESNAEAVADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCAS
FT                   LEAWLGQPRPVVRCMPNTPALLRQGASGLYANAQVSAAQREQAGQLLSAVGIALWLDDE
FT                   AQIDAVTAVSGSGPAYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVE
FT                   PAELRRRVTSPNGTTEAAIKSFQANGFEALVEQALNAASQRSAELAEQLGQ"
FT   CDS_pept        complement(429404..430096)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03921"
FT                   /product="putative PLP dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25119"
FT                   /protein_id="CAW25119.1"
FT                   /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVRE
FT                   AHAAGLRDFGENYLQEALGKQAELADLPLNWHFIGPIQSNKTRPIAEHFQWVHSVDRLK
FT                   IAQRLSEQRPAGLPPLNVCLQVNVSGEASKSGCAPEDLPALAEAVKQLPNLRLRGLMAI
FT                   PEPTAERAAQHAAFARLRELLLDLNLGLDTLSMGMSDDLEAAIGEGATWVRIGTALFGA
FT                   RDYGAPAS"
FT   CDS_pept        430311..431345
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PLES_03931"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25120"
FT                   /protein_id="CAW25120.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHK
FT                   QVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGRVAAHE
FT                   IMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKI
FT                   PENF"
FT   CDS_pept        431523..432671
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="PLES_03941"
FT                   /product="twitching motility protein PilU"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25121"
FT                   /protein_id="CAW25121.1"
FT                   /translation="MEFEKLLRLMVEKGGSDLFITAGVPPSMKVNGRVMPVTKTPLSPE
FT                   QTRETVLGVMNEQQRRDFAENHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETNIP
FT                   TLEELKLPEILKKLALTKRGLVIFVGATGTGKSTSLAAMIGYRNKNSTGHIISIEDPIE
FT                   YIHQHQGCIVTQREVGLDTDSFEVALKNTLRQAPDVIMIGEVRSRETMDHAVAFAETGH
FT                   LCLATLHANNANQALERIIHFFPADRHGQVWMDLSLNLKAIVAQQLVPTPDGKGRRAVI
FT                   EVLLNTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYQLYTQGEITYEDALAHAD
FT                   SANDLRLMIKLGSESDADHLSSLTQGLSLEITDDDPAGRRFR"
FT   CDS_pept        complement(432679..433578)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03951"
FT                   /product="probable cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25122"
FT                   /protein_id="CAW25122.1"
FT                   /translation="MSAGHEHSFAQTNSTRLKWALLLTGSFLVAEVVGGILTGSLALIS
FT                   DAAHMLTDAVALAIALAAINIARRPTNDRLTYGYHRFEILAAAFNAFLLFGVAFYILYA
FT                   AYERLNQPAEIQSVGMLVIAVLGLLVNLASMRLLAPAQGNSLNVKGAYLEVWSDMLGSL
FT                   GVIVAAIVIRFTGWAWVDSLVAVLIGFWVLPRTWILLRESLHVLLEGVPKEIQLAELRE
FT                   ALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHS
FT                   TLQLETSACAQAEEPLAY"
FT   CDS_pept        433732..434136
FT                   /transl_table=11
FT                   /locus_tag="PLES_03961"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25123"
FT                   /protein_id="CAW25123.1"
FT                   /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGLF
FT                   FIGWIIDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGVLGVHRMYMGKWITGIIYL
FT                   FTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
FT   CDS_pept        434379..435752
FT                   /transl_table=11
FT                   /locus_tag="PLES_03971"
FT                   /product="cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25124"
FT                   /protein_id="CAW25124.1"
FT                   /translation="MTSDSRPAVLDLIGNTPLVRVTRFDTGPCTLYLKLESQNPGGSIK
FT                   DRIGVAMIEAAERDGRLRPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSSEKV
FT                   LHLRAMGAEVHITRSDVGKGHPEYYQDVAARLAQDIPGAFFADQFNNPANPLAHECGTG
FT                   PELWAQTGHDLDAIVVGVGSSGTLTGLTRFFQKVQPELEMVLADPEGSIMAEYSRSGTL
FT                   GTPGSWAVEGIGEDFVPAIADLSSVRHAYSISDEESFAMARELLRVEGIPGGSSTGTLL
FT                   AAALRFCREQKEPKRVVSFVCDTGTRYLSKIYNDQWMTDQGLLQRKHYGDLRDIIARRF
FT                   EEGRVISVGPDDTLLTAFQRMRLADVSQLPVLDDGKLVGVIDESDILLGVHADAPRFRD
FT                   AVSSAMNAAPETLAPGASLAQLQAVLDRGLVAIVADASGFHGLITRFDLLNHLRRKLA"
FT   CDS_pept        435749..436933
FT                   /transl_table=11
FT                   /locus_tag="PLES_03981"
FT                   /product="probable cystathionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25125"
FT                   /protein_id="CAW25125.1"
FT                   /translation="MSQHDQHPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYIQ
FT                   ESPGVHKGLDYGRSHNPTRWALERCVADLEGGTQAFAFASGLAAISSVLELLDAGSHIV
FT                   SGNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLQAFEAALTPETRMVWVETPSNPLLRL
FT                   TDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIGGIAI
FT                   VGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQWLERQP
FT                   QVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSLAESLGG
FT                   VESLIEHPAIMTHASIPAETRADLGIGDSLIRLSVGVEALEDLQADLAQALAKI"
FT   CDS_pept        complement(437160..438431)
FT                   /transl_table=11
FT                   /locus_tag="PLES_03991"
FT                   /product="noncatalytic dihydroorotase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_03991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25126"
FT                   /protein_id="CAW25126.1"
FT                   /translation="MTISIRGARVIDPASGLDQVGDLHIEAGKIVAIGAAPAGFSAQKT
FT                   LDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDTPA
FT                   VAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRIL
FT                   RRALEYAATFDLTVIFTSQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLV
FT                   EQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPP
FT                   LRTRADREALREAVKNGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLV
FT                   QDGLLDLPTLLARLSHGPAQALRLPAGRLAVGQAADLVLFDPQGSTLAGESWYSKGQNS
FT                   PFVGHCLPGRVRYTLVDGHLTHEG"
FT   CDS_pept        complement(438428..439432)
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="PLES_04001"
FT                   /product="aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25127"
FT                   /db_xref="GOA:B7V3Y9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V3Y9"
FT                   /protein_id="CAW25127.1"
FT                   /translation="MPTDAKRPLQLNDQGQLRHFISLDGLPRELLTEILDTADSFLEVG
FT                   ARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLTD
FT                   TLRNLEAMAADMFVVRHSDSGAAHFIAEHVSPNVAVINGGDGRHAHPTQGMLDMLTIRR
FT                   HKGNFEQLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPRTLLPIGLEEQYGVRVF
FT                   TNADEGLKDVDVVIMLRLQRERMQGGLLPSEGEFFKLYGLTEKRLKLAKPDAIVMHPGP
FT                   INRGVEIESAVADGAQSVILNQVTYGIAIRMAVLSMAMSGQNTQRQLEQEDAE"
FT   CDS_pept        complement(439456..439968)
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="PLES_04011"
FT                   /product="transcriptional regulator PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25128"
FT                   /db_xref="GOA:B7V3Z0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V3Z0"
FT                   /protein_id="CAW25128.1"
FT                   /translation="MSLPNPAELLPRMASDLRAHLAERGIERPRFVGIHTGGIWVAEAL
FT                   LRELGNQEPLGTLDVSFYRDDFTQNGLHPQVRPSALPFEIDGQHLVLVDDVLMSGRTIR
FT                   AALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVKLVGPAPLALER
FT                   KVLSSAS"
FT   CDS_pept        complement(440080..440514)
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="PLES_04021"
FT                   /product="putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25129"
FT                   /db_xref="GOA:B7V3Z1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V3Z1"
FT                   /protein_id="CAW25129.1"
FT                   /translation="MASDKPLRLLLGFDYGTRQIGVAVGQAVTGQARELCVLKAQNGVP
FT                   DWNRVEALIKEWQPDAIVVGLPLNMDGSPSEMSERAEKFGRRLNGRFNLPVFTHDERLT
FT                   TYAAKGERLAQGQRDGYRERPVDALAAALLLEGWLAEHPD"
FT   CDS_pept        complement(440514..441083)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04031"
FT                   /product="putative transcriptional activator of alginate
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25130"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V3Z2"
FT                   /protein_id="CAW25130.1"
FT                   /translation="MKQSSPTYLKHHFLIAMPHMADPNFAQTVTYLVEHNEQGAMGLVI
FT                   NRPSGLNLAEVLEQLKPDALPPARCQHIDIYNGGPVQTDRGFVLHPSGLSYQSTLELGE
FT                   LAMSTSQDVLFAIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPADPAILFDLP
FT                   PEERLSAAAARLGVNLSLLTAQAGHA"
FT   CDS_pept        complement(441132..442091)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04041"
FT                   /product="putative tonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25131"
FT                   /protein_id="CAW25131.1"
FT                   /translation="MRHRLFRPPSADFAPRQPPRSAMNAAVLKSPSAAAGVRPADRLGF
FT                   TLFIAAILHVAFILGVGFSMPAPSQISKTLEITLATFKSDKAPEKADYLAQMNQQGSGT
FT                   LEHKAAPKTTEVAPFQDNQVKKVAPPATPKQARSEEAPKAAVTTTRQRQQKAPSKTQAQ
FT                   KAEQVAKPAPHFDSTQLSAEIASLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKE
FT                   DWRKKIERIGNLNYPDEARRQKLYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQR
FT                   IVRLAAPYAPFSGDLADIDRLEIIRTWRFERGDRLSSK"
FT   CDS_pept        complement(442172..443125)
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="PLES_04051"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25132"
FT                   /protein_id="CAW25132.1"
FT                   /translation="MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLY
FT                   QKAGVARGRMRPLKVFNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLE
FT                   QAERAGALVVNRPQSLRDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPL
FT                   DGMGGSSIFRHREGDPNLSVILETLTQHGSQQIMAQRYLPEIKDGDKRILMIDGEPVPY
FT                   CLARIPAQGETRGNLAAGGRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLT
FT                   EINVTSPTCIREIDQAFDTRIGDKLMDAIAAQLAAR"
FT   CDS_pept        443380..443787
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="PLES_04061"
FT                   /product="twitching motility protein PilG"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25133"
FT                   /protein_id="CAW25133.1"
FT                   /translation="MEQQSDGLKVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDALA
FT                   KIADTHPNIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKEELLGAIKAHVPSFTPVDAVS"
FT   CDS_pept        443834..444199
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="PLES_04071"
FT                   /product="twitching motility protein PilH"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25134"
FT                   /protein_id="CAW25134.1"
FT                   /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEK
FT                   PDVVLMDIVMPGLNGFQATRQLTKDAETSAIPVIIVTTKDQETDKVWGKRQGARDYLTK
FT                   PVDEETLLKTINAVLAG"
FT   CDS_pept        444250..444786
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PLES_04081"
FT                   /product="twitching motility protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25135"
FT                   /protein_id="CAW25135.1"
FT                   /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGR
FT                   FFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQR
FT                   RVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFS
FT                   PHALAQHQGFLDVAV"
FT   CDS_pept        444871..446919
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="PLES_04091"
FT                   /product="twitching motility protein PilJ"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25136"
FT                   /protein_id="CAW25136.1"
FT                   /translation="MKKINAGNLFAGMRSSSVIAGLFIVLIVSIVLLFANFAYLNTQSN
FT                   HDKQYIGHAGELRVLSQRIAKNATEAAAGKGEAFKLLKDARNDFEKRWNILVNGDESTS
FT                   LPPSPEAVKPQMDVVQQDWDGLRKNADSILASEQTVLSLHQVASTLAETIPQLQVEYEE
FT                   VVDILLENGAPADQVAVAQRQSLLAERILGSVNKVLAGDENSVQAADSFGRDASLFGRV
FT                   LKGMQEGNAAMSISKVTNAEAVDRLNEIAELFEFVSGSVDEILETSPDLFQVREAANNI
FT                   FSVSQTLLDKASQLADGFENLAGGRSINLFAGYALGALALASIILIGLVMVRETNRRLA
FT                   ETAEKNDRNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQLRELVET
FT                   INQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMAVSIDQVSANASESSA
FT                   VAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIAD
FT                   QTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAV
FT                   ISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTM
FT                   NVIQEITSQTSAGTTATARSIGNLAKMASEMRNSVSGFKLPEGVEQA"
FT   CDS_pept        446980..447855
FT                   /transl_table=11
FT                   /gene="pilK"
FT                   /locus_tag="PLES_04101"
FT                   /product="methyltransferase PilK"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25137"
FT                   /protein_id="CAW25137.1"
FT                   /translation="MQANGVWSLQPLADMSAAEFRDWQVLLENRTGVVLNEQRRTFLQA
FT                   SLTARMRELGIGDYHSYYRQVTDGPRGAVEWATLLDRLTVQETRFFRHPPSFELLERYL
FT                   GERLRREGMPRPWALWSVGCSSGEEPYSLAMCAAQVLRGQEREDFFGVTGTDISLHALQ
FT                   RARQANYPARKLEQLEAGLVERYCERQADGSFSVKTILTERVCCARLNVLDLAKAPWSG
FT                   MDVIFCQNLLIYFRRWRRREILNRLAERLAPGGLLVIGVGEVVDWSHPELEPVADERVL
FT                   AFTRKGYSGT"
FT   CDS_pept        447867..455285
FT                   /transl_table=11
FT                   /gene="chpA"
FT                   /locus_tag="PLES_04111"
FT                   /product="still frameshift probable component of
FT                   chemotactic signal transduction system"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25138"
FT                   /protein_id="CAW25138.1"
FT                   /translation="MGDRHDYVALEWVKGEIAETLKQARQALEAFVENPQDPTRMRFCL
FT                   TYVHQVQGTLQMVEFYGAALLAEEMEQLVQALLDGRVPNQGEALEVLMQAILQLPVYLD
FT                   RIQTARRDLPMVVLPLLNDLRAARGEKLLSETSLFAPDLSQRQPQLDGEAIAQLRTDEL
FT                   GGLLRKLRQTQQMALVGLLRNQDVATSLGYLARVYARLEGLCREAPLGPLWSIASGLVE
FT                   GLANGSVVNSASVRTLLRQLDRELKRLVEQGADGLNQAAPDELVKNLLFYVAKAPSQSP
FT                   RIRALKEQYRLDEALPDHETVDAERARLAGPDRDAMRSVVGALCEELVRIKDSLDLFVR
FT                   SDRGHPSELDALLAPLKQIADTLAVLGFGQPRKVILDQLDVIHALAQGRREPSDAILMD
FT                   VAGALLYVEATLAGMAGPGDERNSEESRLPTTDVAQIHQLVIKEARNGLEQAKDAIIEF
FT                   IASQWNHEHLARVPELLTQVRGGLAMIPLERAATLLETCNRYIQEQLLARKAVPDWQSL
FT                   DTLADAITSVEYYLERLSEDHASQSDLILDVAEDSLANLGYTLKPNSSAPAEPGLSGPA
FT                   AIESPAAEPERPEAVVEVAETAEQPPADTAPAEAAREDAPQLASDDNWTLGEVAPDAGE
FT                   PSLDLALDLPLDDSAEVPPALPEVVEESGQPQSTPAPARSLDDFSLDEIDLSGLDLPAD
FT                   AAPASGPAALADWSLPEQWGLGDDLAQPAQAGETLDLSLEEPALSFDAPLESLEPLPAL
FT                   EPFDGSAEQELVLDALDPLPLDVALPEAEGEVSAWEGSRLEELDLSDLDLPEVQLPEAE
FT                   AEAPPAAEALASEAPALSLAEVMAAPVQPINPPAQNVPVSLLPPPADEEPVDEELREVF
FT                   IEEAGEVLETIGRYLPAWKADHDDREALTEVRRAFHTLKGSGRMVRALVIGELAWSIEN
FT                   LFNRVLDRSIAASEPVQRVVDQVVALLPELVEEFAANAQRQRDDVDLLAATAHALAKGE
FT                   PLPEPPAPDDGGVPPEAGAEQPSSLDNGVQAPPLADAPQAAAEAQSDVELLDPQLLEIF
FT                   TNEAETHLEALVGFLADCARELPQPVTDALQRALHTLKGSAHMAGILPIAEIATPLEKL
FT                   VKEYKSNLLAFDLREAELLHDAEQLFRIGLEQVGAQRPLNPIPGSDALLERIEALHQER
FT                   IASLEAERYSDAGERRDPLLIEAFLVEGMDILLDAEDLLERWHEHPQERQELSALREEL
FT                   STLDRGARHAELPQVEELCQALLALYDAVEEGRLAVSPAFFEEARQAHEALIGMMDQVA
FT                   AGLQVTPRPERVAALQELLEAPAAEAVPFIDPESLGADDFPPEDEEPALPEAVYEEAGT
FT                   PAEETVPAAPAPAPGRELDEEMVSIFLEEAVDILESAGQALAQWQAEPGALSSLSALQR
FT                   DLHTLKGGARMAEIAEIGDLAHELEALYEGLVDRRYQHSPQLAGLLQACHDRLAEQLDQ
FT                   LSAGQPLADPHDLIQAIRRFRQGPLAEAATPGEAESPVEELVAPTVEEPAAPAAEAFEE
FT                   RDPELVEIFLEEGFDILDSAAAALQRWMDDVDNTIELEALQRDLHTLKGGARMAEIGEI
FT                   GDLAHELEFLYEGLCGGRLRASPALFGLLQRCHDELAEMLEAVRGHRTLPDGQALIAEI
FT                   RRLRSDPDEQLSVPTSVSLKPLAAKGAAADESEILDIFLEEADDLLENLELALGRWDGG
FT                   NGDAQPLDDLLRILHTLKGGARLAGQTELGNLAHDLEQHLTDAQQQGAPWPDSLLLDAQ
FT                   SGLEGLQRQVDLLRERLAEDDEAGERPEPAQALVQADDTGRAVASALAELTRLAPAAGA
FT                   IMAAEAAPPAAPATTLPFVRKAQEAAQEAASRRAPQELVKVPAELLENLVNLAGETSIF
FT                   RGRVEQQVSDVGFTLGEMESTIERVRDQLRRLDTETQAQILSRHQADAERAGYEEFDPL
FT                   EMDRYSQLQQLSRALFESASDLLDLKETLAAKNRDAETLLLQQARVNTELQEGLMRTRM
FT                   VPFDRLVPRLRRIVRQVAGELGKQVEFVVGNADGEMDRTVLERIVAPLEHMLRNAVDHG
FT                   IESGETRRAAGKPEHGTIRLNIGREGGDILLTLSDDGAGIRLDAVRRKAIERGLMSADS
FT                   DLSDHEVLQFVLESGFSTAEKVTQISGRGVGLDVANSEVKQLGGSVSIQTEPGQGTRFN
FT                   VRLPFTVSVNRALMVLSGEDLYAVPLNTIEGIVRVSPYELEALYDQRGEAGLDTPSFEY
FT                   AGQSYELKYLGELLNNGQEPKLVGQSLPLPVILVRSSEHAVAVQVDSLAGSREIVVKSL
FT                   GPQFAGVAGISGATLLGDGRVVVILDLLATIRSRHALLGQESRRERLALRQEMAASESE
FT                   QQRPPLVMVVDDSVTVRKVTTRLLERNGMNVLTAKDGVDAIAQLQEHRPDILLLDIEMP
FT                   RMDGFEVATLVRHDERLGNLPIIMITSRTGEKHRERALGIGVNQYLGKPYQETELLEAI
FT                   QSLVGQHE"
FT   CDS_pept        455278..456309
FT                   /transl_table=11
FT                   /gene="chpB"
FT                   /locus_tag="PLES_04121"
FT                   /product="probable methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25139"
FT                   /protein_id="CAW25139.1"
FT                   /translation="MSERATPRVAVIADTSLQRHVLQQALLGHGYEVVLNADPARVDDA
FT                   ALECAPDLWLVDLTQQDDSPLLDSLLEQDRAPVLFGEGHAPERHTEHYPRWERRLIGKL
FT                   KRLIGDPSDGVGDSLGALLDEERPPRLEIPGDLAAMPLQAGEAAREVWLLAASLGGPAA
FT                   VKAFLDALPGGLPIGFLYAQHIDASFEQNLPQAVGRHSQWHVKNVRDGEALRCGEVMVV
FT                   PVLHELGFHHDGRLKCSQRPWPEPYTPSIDQMMLNLAQQFGPDCGVIVFSGMGSDGSAA
FT                   AAYVRRQGGEVWTQRADSCVCSSMPDSLREAGYSSFNASPRELAEALVKHLAARCAPTG
FT                   VET"
FT   CDS_pept        456306..456812
FT                   /transl_table=11
FT                   /gene="chpC"
FT                   /locus_tag="PLES_04131"
FT                   /product="probable chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25140"
FT                   /protein_id="CAW25140.1"
FT                   /translation="MNQAVIEQDGMSRNTPANPTPDSLTGLLLPLSDRTLLLPNVAVAE
FT                   LIAYRNPQVAAGLPQWYLGQVAWRDLRLPLLSFEAASSGEQQPVLGSSARVVVINALGG
FT                   RPHVKFLALLVQGIPRSVRLDANLASTAAPLAALELAAVDIGGETAWIPDLAGLEEKLA
FT                   DAGLI"
FT   CDS_pept        456820..457614
FT                   /transl_table=11
FT                   /gene="chpD"
FT                   /locus_tag="PLES_04141"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25141"
FT                   /protein_id="CAW25141.1"
FT                   /translation="MAGLQHARIGASLEVASASLAGHRFEKHSHDEFVISANLCGLEDV
FT                   WLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELASSLDLSSVEFDRP
FT                   LLRSPALGRELAASIEALLASDRFARERGEERLLDFLGRLLAASGTRLPQRADPGRPAV
FT                   ARLQALLAERLAEPPDLDEMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLL
FT                   RRGLAVGEVAHALGFADQSHLTRYFTSAYGISPGRYQRAVRG"
FT   CDS_pept        457690..458301
FT                   /transl_table=11
FT                   /gene="chpE"
FT                   /locus_tag="PLES_04151"
FT                   /product="probable chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25142"
FT                   /protein_id="CAW25142.1"
FT                   /translation="MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGS
FT                   LIGDAVWALLGLTGLALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGE
FT                   QGRNAFGAGAAISLSNPKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCF
FT                   CCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
FT   CDS_pept        complement(458309..459724)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25143"
FT                   /protein_id="CAW25143.1"
FT                   /translation="MNTVAQPTSQRIARMDTPVTFDWKIRLPDVLGVLRRDYAGRFPQL
FT                   ASAALETLLERLRDDLPEDFLPALGQELESLGLALVERLDEDDSLNLYVVGAPHSQRLL
FT                   DALAAQGHNARTLRQENAPEGARAALPAAAPAGLAPASAYICLEHAEHLAPGLAIARLP
FT                   GEDSRDLLDLRQWPRLQRLPDGAEETQGALLCRASSADGLHAWVRMTRSGSPYAWLHRS
FT                   RDLASLTPELPPLPLPPAQSLRQRRTPELAIGLAGDDLLLADRGLFFLYPGFAQGNDEP
FT                   RLLFDVPQARRSIENPPAVFTTPDQRVCLLSRGQFFEWREARIQPLPFPVGKDLPADPA
FT                   QPTSAAPGTIVWLERETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLE
FT                   PHRSRDLAQLWHLESGRALRIRYGELDLEGGLQHWAELPDGRIVVGDHARHVDLGTFES
FT                   LRQRLLRRRLAPA"
FT   CDS_pept        complement(459759..460481)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25144"
FT                   /protein_id="CAW25144.1"
FT                   /translation="MRLSRFFVDQPLSLGQHDLPEAQAHYIGRVLRHATGDAVQLFDGS
FT                   GREYLGELVEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVA
FT                   EITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRD
FT                   DDLRLVLHPVAAPLASHAPPSRLAFLVGPEGGLSDAEVEQAQAAGFHSARLGPRVLRTE
FT                   TAPVVALAVAQQLWGDFA"
FT   CDS_pept        complement(460574..461977)
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="PLES_04181"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoateaminotra
FT                   nsferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25145"
FT                   /protein_id="CAW25145.1"
FT                   /translation="MGLNADWMQRDLNVLWHPCTQMKDHERLPVIPIRRGEGVWLEDFE
FT                   GKRYIDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKITP
FT                   PGLDRVFYADSGSAGIEVALKMSYHFWLNSGRPRKKRFVTLTNSYHGETIAAMSVGDVA
FT                   LFTETYKSLLLDTIKVPSPDCFLRPDGMCWEEHSRNMFAHMERTLAEGHDEIAAVIVEP
FT                   LIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIAPDFLC
FT                   LSKALTGGYLPMSAVLTSETVYRGFYDDYQTLRAFLHSHTYTGNPLACAAALATLDIFE
FT                   EDKVIEANRALSTHMARATAHLADHPHVAEVRQTGMVLAIEMVQDKASRTPYPWQERRG
FT                   LKVFQHGLERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRDAVSVAVSD
FT                   FHPDHRDPG"
FT   CDS_pept        462151..463641
FT                   /transl_table=11
FT                   /locus_tag="PLES_04191"
FT                   /product="putative monoamine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25146"
FT                   /protein_id="CAW25146.1"
FT                   /translation="MSLRWLRAAAFLMLGVFSAVALGKDKQPTAIVVGAGLAGLSAAYE
FT                   LQKDGWQVTVLEARPQVGGRSGLATSEWVGNQKVQPTLNAYLDTFKLKPVPAPDFVRTP
FT                   SYLIDGLYYSSSDLALKQPNVAADLKRFESTLDDLSASISDPLNPASSNTLFALDQMNA
FT                   ARWLDKLNLSPTARLLVNQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAARLPGG
FT                   SQVLAEAFVKQIKTIKTKSKVSSIVQAKDGVAVKAGSETYKADYVVLAVPLKALGQIQM
FT                   TPSLSGTQMSALKGTNYGWRDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWVEPALKG
FT                   GANVLINLSGDNARVLQAFGDRQMVDQVLIRMNKFYPKMRGAFAGYEIRRYSADPGTGG
FT                   SYLAYGPGQVTRFWRIWEQPLSRVAFAGEHTDALYPGTIEGALRSGKRAASQVRDLYAG
FT                   KTPVIEGAPMVAKAEKVAAPTTGGEKKNPFAWFTRLFD"
FT   CDS_pept        463822..464391
FT                   /transl_table=11
FT                   /locus_tag="PLES_04201"
FT                   /product="putative cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25147"
FT                   /protein_id="CAW25147.1"
FT                   /translation="MQWRNTSSRYGVFSLFLHWGSALVVFGLFGLGLWMRELSYYDPWY
FT                   HPAPALHKSIGILLAIALLVRIVWRFVSPPPTAPANHGPLTRVASKLGHLALYGLLLAV
FT                   IVAGYLISTADGEPISVFGWFSVPATLSGLPDQADVAGEIHLYLAWALVVFAVLHALAA
FT                   LKHHFVDRDPTLKRMLGRSSNDQQPR"
FT   CDS_pept        464403..464978
FT                   /transl_table=11
FT                   /gene="pasP"
FT                   /locus_tag="PLES_04211"
FT                   /product="PasP"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25148"
FT                   /db_xref="GOA:B7V411"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V411"
FT                   /protein_id="CAW25148.1"
FT                   /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVSKNP
FT                   TATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLIGQGDDPWGGYRAGFEGSATLK
FT                   LKDFGIKMDLGPASQEVELLLSVEGIRQ"
FT   CDS_pept        complement(465047..465490)
FT                   /transl_table=11
FT                   /gene="mexR"
FT                   /locus_tag="PLES_04221"
FT                   /product="multidrug resistance operon repressor MexR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25149"
FT                   /protein_id="CAW25149.1"
FT                   /translation="MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKL
FT                   IDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRCERNPSDQRSFQLFLTDEGLAI
FT                   HQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI"
FT   CDS_pept        465765..466916
FT                   /transl_table=11
FT                   /gene="mexA"
FT                   /locus_tag="PLES_04231"
FT                   /product="Resistance-Nodulation-Cell Division (RND)
FT                   multidrug efflux membrane fusion protein MexA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25150"
FT                   /protein_id="CAW25150.1"
FT                   /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEA
FT                   QTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQ
FT                   SAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSP
FT                   ISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERA
FT                   GDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQ
FT                   LQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNA
FT                   GDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
FT   CDS_pept        466932..470072
FT                   /transl_table=11
FT                   /gene="mexB"
FT                   /locus_tag="PLES_04241"
FT                   /product="Resistance-Nodulation-Cell Division (RND)
FT                   multidrug efflux transporter MexB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25151"
FT                   /protein_id="CAW25151.1"
FT                   /translation="MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAV
FT                   QVSYPGASAETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQ
FT                   VQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQ
FT                   DPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGL
FT                   PAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
FT                   NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEV
FT                   VKTLGEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAF
FT                   FGGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFN
FT                   RMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQV
FT                   QTPPGSSAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSSGMAFIMLKPWE
FT                   ERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVRELGNATGFDLFLQDQAGVGHEV
FT                   LLQARNKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAW
FT                   GSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGS
FT                   PKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVKQLPKGVGYSWTGLSYEERLSGSQ
FT                   APALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLATSMRGLSNDVFFQVGL
FT                   LTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVVPLAI
FT                   STGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVSTLFKDEASKQQASVEKGQ"
FT   CDS_pept        470074..471531
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="PLES_04251"
FT                   /product="Major intrinsic multiple antibiotic resistance
FT                   efflux outer membrane protein OprM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25152"
FT                   /protein_id="CAW25152.1"
FT                   /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNT
FT                   GAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPR
FT                   IGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLAT
FT                   EQAQRSAQTTLVASVATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALD
FT                   LRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTEVPAGL
FT                   PSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGS
FT                   WLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQ
FT                   LQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVN
FT                   LYKALGGGWNQQTVTQQQTAKKEDPQA"
FT   CDS_pept        complement(471627..473546)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04261"
FT                   /product="probable ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25153"
FT                   /protein_id="CAW25153.1"
FT                   /translation="MSFSSLGLSEALARAVEAAGYSQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPVLERLFPAGHPDREHRHGPRQARVLVLTPTRELAAQVHDSFKVYAR
FT                   DLPLNSTCIFGGVGMNPQIQALAKGVDVLVACPGRLLDLAGQNKVDLSHVEILVLDEAD
FT                   RMLDMGFIHDVKKVLAKLPHKRQNLLFSATFSKDIVDLANKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLPAPQKRALLAHLVTVGAWEQVLVFTRTKHGANRLAEYLTKHGLPAAAIHG
FT                   NKSQNARTKALADFKANDVRILVATDIAARGLDIDQLPHVVNYELPNVEEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKAIEKMTRQRIPDGDAQGFDPEAVLPEVAQPEPREAPQ
FT                   KQPRRDKERRSSRERKPKDAQASNPDSNVAAAQDGTEKPAGKRRRRGGKNKENREAGQA
FT                   QQPRQSREARPAKPNRPPEVDGNRDPEEFLDDDFDNFGNRADYVSPYQGQENKGRGRRG
FT                   GQQKPQGGTGQQGRGQGQGQARGKSQGAAQGGARGQGAGQGKAKKPRAGKPRGQGRENA
FT                   SRMSDAPLREPSEYGTGKQPSRQPVVINKRDLVRMDRFPTAEQLDELEPRRKGERPALL
FT                   TRNR"
FT   CDS_pept        complement(473797..474867)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25154"
FT                   /protein_id="CAW25154.1"
FT                   /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDGAAHGLTVRV
FT                   YTDDPSPYAGLPVQVREVTAEELVAWCQPHGYHFRAKHVALRDALEDADQALLIDTDTF
FT                   FHSSPLRLFDRIQPGSLLCNAIGARYGEHRNFPLYRDLSPYLFERGWADDEMHQLNSGV
FT                   IGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHHYWSR
FT                   KQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLPAPMRQ
FT                   FSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPQEPIAEQIEDWLNHSLLRNLLG
FT                   SRANEIRQHLRQRDLL"
FT   CDS_pept        complement(474937..475809)
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="PLES_04281"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25155"
FT                   /protein_id="CAW25155.1"
FT                   /translation="MVASKEPIMSQSERRFSFEFFPAKTEAGHEKLLATARNLAGYKPD
FT                   FFSCTYGAGGSTRDRTLSTVLQLDGEVKVPTAPHLSCVGDSKAELRELLGRYREAGIRR
FT                   IVALRGDLPSGMGMASGELRYANELVDFIRTETGDHFHIEVAAYPEVHPQARSFEDDLA
FT                   NFVRKVKAGASSAITQYFFNADAYFYFVERVAKLGVDIPVVPGIMPITNYSKLARFSDA
FT                   CGAELPRWIRKQLEAYGDDSRSIQAFGEQVISEMCERLLEGGAPGLHFYTLNQADPSLA
FT                   IWKNLQLPR"
FT   CDS_pept        complement(475852..476406)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25156"
FT                   /protein_id="CAW25156.1"
FT                   /translation="MSAPTMSTHLADRYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVA
FT                   NALLAADRDGAIERLGETLQIAVLHDTLEDTATSPEELRQQFGEFVCAGVQALSKRVGD
FT                   GPKRSLDDYLQALAEGPAQYALVKLCDRITNLQPPPQTWNQDKIANYHQESQLILARLG
FT                   HAHAATARRLREKIEHYRQYY"
FT   CDS_pept        complement(476447..477856)
FT                   /transl_table=11
FT                   /gene="sahH"
FT                   /locus_tag="PLES_04301"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25157"
FT                   /db_xref="GOA:B7V419"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V419"
FT                   /protein_id="CAW25157.1"
FT                   /translation="MSAVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKY
FT                   AGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHKKYPQMLERIHGITE
FT                   ETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSSQSLRQEGMIVKVAEVDPICAMQACMDGFEVVSPYKNGINDGTEA
FT                   SIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGKDGFDAHNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   HLFEQKYADLPAAEKAKRLSVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSV
FT                   EGPFKPDTYRY"
FT   CDS_pept        478145..478579
FT                   /transl_table=11
FT                   /locus_tag="PLES_04311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25158"
FT                   /protein_id="CAW25158.1"
FT                   /translation="MLECAVMRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQALG
FT                   VGSDKGQKASVGLFCVAGASQWLSLDPDDGSAGDPAPVNPQLPMSCPMCSALVLFVALG
FT                   VIWSWRLQRRRQARFRPPATREPVPPRYVWPPANPRASPA"
FT   CDS_pept        478705..480897
FT                   /transl_table=11
FT                   /locus_tag="PLES_04321"
FT                   /product="putative outer membrane ferric siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25159"
FT                   /protein_id="CAW25159.1"
FT                   /translation="MKKHSTARRVLALGLNLTLAGVPALLWADEEPTELPALTVSAGAA
FT                   GETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVNAS
FT                   APPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLNGAG
FT                   AVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRVDVSRS
FT                   GGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPYAGELK
FT                   IDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRNLETYRY
FT                   NADNSGVVRSNAFLQRHDQQLNGNRFELQHSQPLFGLASDWALGFDYSINKQTRFPSTA
FT                   SGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDELSLVTGLR
FT                   YDHLDLDVRNHQTVTASDPAHFERRWDVLTGRAGLVYQFTPHANVYLQYSTAADPPGGV
FT                   LTSASFGQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSVADPNNPNLSV
FT                   PVGQQTSRGIEAAASLRITPKLLAEGNFAWVDAQYDEFTENVGGVAVSRKGKTPPNVPE
FT                   RVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFLSYRLDERTRITG
FT                   RVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
FT   CDS_pept        480908..482386
FT                   /transl_table=11
FT                   /locus_tag="PLES_04331"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25160"
FT                   /protein_id="CAW25160.1"
FT                   /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERLA
FT                   HLPELDGCEACVPLRTALAGGDGKTPRSIRLASVGGLPTYLLDDADGRTRALAARDGRP
FT                   LAVDADRVLASARAFSGEVPMQLQGRIEEDAWTHTRNLDPHRPLWRVQTADEQGRLLYL
FT                   SSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLATVLGI
FT                   LVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPWNLFGR
FT                   GTPLDLAAYQGGSWERALPAGLEADAVLRRLRAAGLRVRELEWRALDGEPYALGRSASG
FT                   NSLLLTADGEILRELPADRLLAAARALLPGVPMQAERLERYDFYYYPREEHSMMGYLER
FT                   RLPVWRLRFDDPRHTWVHLDPYSGAVVGVLDDGRRGSRWLFSLLHSWDWLPLLTRRPLW
FT                   DLWMLGFSLGGLVVCASGCWIGWRRLRGRRPKRR"
FT   CDS_pept        482471..483091
FT                   /transl_table=11
FT                   /locus_tag="PLES_04341"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25161"
FT                   /protein_id="CAW25161.1"
FT                   /translation="MGTHKIEIRRRNVEKILLAAEKVFAEKGYAGTSMGNIAEEAELPR
FT                   SNLHYYFSTKDELYRDVLLGLLEVWKQDALCFEMFDDPRVVLTSYIRAKMNHSRTRPHG
FT                   SKVWANEIMHGAPLLGATLDDSLYEWAKMKEAKIRQWVEEKRILSIEPSSLLYMIWAST
FT                   QHYADFGYQVEVLNGHQPLSDMQFERAVQTVTSVVLRGIGLEP"
FT   CDS_pept        complement(483128..484399)
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="PLES_04351"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25162"
FT                   /protein_id="CAW25162.1"
FT                   /translation="MLIDNLRLRGREGLWQLRVADGRIAALVPMEQAADDAGERLDGAG
FT                   GLAVPPFIEPHIHLDTTQTAGQPEWNRSGTLFEGIERWAQRKALLSHEDVKQRAWQTLK
FT                   WQIANGVQHVRSHVDVSDPTLTALKAMLEVRGEVAPWVDLQIVAFPQEGILSYPNGLEL
FT                   LEESLRLGADVVGAIPHFEFTRELGVESLHKAIDLAKRYDLPVDVHCDEIDDEQSRFLE
FT                   TLAMLAHRDGLGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVANPLVNIHLQGRF
FT                   DDYPKRRGITRVKELLGAGINTCFGHDDVFDPWYPLGTANMLQVLHMGLHVTQMMGYDE
FT                   IDGGLDLITRNSARTLGLREYGIEVGHPANLLVLPARDGFDAVRRQVPVRYSIRGGRLL
FT                   AETVPAQTTVFLEQAEAVDFSRAS"
FT   CDS_pept        complement(484389..485639)
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="PLES_04361"
FT                   /product="cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25163"
FT                   /protein_id="CAW25163.1"
FT                   /translation="MSADSNYSQQPVPLAARKSALALSVVMLGLTFFSASMWTGGTLGT
FT                   GLSYDDFFLAVLLGNLMLGLYTAILGFIGARTGLSTHLLAHYSFGSKGSWLPSALLGGT
FT                   QVGWFGVGVAMFAIPVAKATGLDVNLLILVSGALMTLTVFFGIAGLTLLSAIAVPAIVV
FT                   LGSYSVWLAVRDAGGLAALQQVTPSAPLSLSTAIALVVGSFVSAGTLTADFVRFGRSAR
FT                   TAVVVCLVAFFLGNSLMFIFGAAGAAAVGKSDISDVMIAQGLLIPAILVLGLNIWTTND
FT                   NALYASGLGFANITGLSSRFLAMLNGALGTLAALWLYNHFVGWLTFLSAAIPPIGGVII
FT                   ADYLSRRRRYRQHPCADIQAINWAAILAVACGTAAGHWLPGIVPVNAVLGAAIAYLLLN
FT                   PLLSRSPNKPEEVLHAD"
FT   CDS_pept        complement(485821..487098)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04371"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25164"
FT                   /protein_id="CAW25164.1"
FT                   /translation="MMADLSIEFAGIKSPNPFWLASAPPTDKAYNVVRAYQAGWGGVVW
FT                   KTLGEDPAAVNVSSRYSAHFGPNRQVQGINNIELITDRSLEINLREIAQVKKDWPDRAL
FT                   IVSLMVPCVEESWKYILPLVEATGADGIELNFGCPHGMPERGMGAAVGQVPEYVEMVTR
FT                   WCKTHCSLPVIVKLTPNITDIRQSARAAHRGGADAVSLINTINSITSVDLERMVALPVV
FT                   GTQSTHGGYCGSAVKPIALNMVAEIARDPQTRGLPICGIGGIGSWRDAAEFVALGCGAV
FT                   QVCTAAMLHGFRIVEDMQDGLARWMDSHGYERLSDFSGGAVGNTTDWKYLDINYQVIAR
FT                   IDQDACIGCGRCHIACEDTSHQAIASLPRADGTHRYEVIDAECVGCNLCQITCPVENCI
FT                   EMVPQDTGKPYLNWTQDPRNPYREAS"
FT   CDS_pept        complement(487095..488462)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04381"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25165"
FT                   /protein_id="CAW25165.1"
FT                   /translation="MIDSLNHLPRPDAGADTLAERFADLAPPLNARQAALESARCLYCY
FT                   DAPCVNACPTEIDIPGFIRSIAQENVQGAAQKILSANILGGSCARVCPTEILCQRACVR
FT                   NNAQECAPVLIGQLQRYALDHAGFDEHPFKRSPATGKRIAVVGAGPAGLSCAHRLAMHG
FT                   HDVVLFEARTKAGGLNEYGIARYKLVDDFARREVEFLLQIGGIELRHGQRLGDNLALGA
FT                   LHDEYDAVFLGIGLAASKRLGLEDEDAPGLLAATDYIRELRQSDDLLDLPVADRCIVIG
FT                   AGNTAIDMAVQMSRLGARDVNLVYRRGFEEMGATGHEQEIAKASQVRLLTWARPERVLL
FT                   DEHGRVRGMRFARTRLENGRLGDTGEHFELAADAIFKAIGQAFEGASLGDPLAAQLRRD
FT                   GERIQVDGQMRTSIPGIYAGGDCVALGEDLTVQAVQHGKLAAEAIHAQLMLNVEAA"
FT   CDS_pept        complement(488557..489996)
FT                   /transl_table=11
FT                   /gene="dht"
FT                   /locus_tag="PLES_04391"
FT                   /product="dihydropyrimidinase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25166"
FT                   /protein_id="CAW25166.1"
FT                   /translation="MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLETPSGCDVLD
FT                   GGGQYLMPGGIDPHTHMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPRQSLLE
FT                   AFHTWRGWAQKSAADYGFHVAITWWSDEVAGEMGELVAQHGVNSFKHFMAYKNAIMAAD
FT                   DTLVASFERCLELGAVPTVHAENGELVFHLQQKLLAQGLTGPEAHPLSRPPQVEGEAAS
FT                   RAIRIAETLGTPLYLVHISSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYRHPDWA
FT                   TAAGYVMSPPFRPVEHQEALWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSKIPNGTA
FT                   GIEDRMALLWDAGVNSGRLSMHEFVALTSTNTAKIFNLFPRKGAIRVGADADLVLWDPQ
FT                   GSRTLSAATHHQRVDFNIFEGRTVRGIPSHTISQGKLLWAAGDLRAEPGAGRYVERPAY
FT                   PSVYEVLGRRAERQRPVAVER"
FT   CDS_pept        490612..492102
FT                   /transl_table=11
FT                   /locus_tag="PLES_04401"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25167"
FT                   /protein_id="CAW25167.1"
FT                   /translation="MQQSRSEVTERDGLVELSAGSDVLDSPRYNHDIAPTRVEQRTWNR
FT                   WHITALWIGMSICVPTYTLGGVLTAYFGLSVGEALLAILLANLVVLIPLTLNAFAGTRY
FT                   GIPFPVLLRASFGIIGSNVPCLIRAVVACGWFGIQTLFGGLAIHLFLGSIFPAWKALGG
FT                   TGEVIGFLLFWGLNLWVVLRGAESIKWLETLSAPLLVLVGLGLLVWALPHISVSELLAQ
FT                   PPKRPEGASVTGYFMAGLTAMVGFWATLSLNIPDFSRYARSQKDQILGQIFGLPLTMFL
FT                   FAALGVVMTAASASLVGETVSDPVSLIGHIPSPGWVAVAMALIIVATLSTNTAANIVSP
FT                   TNDFQNIAPKLIGRTRAVWLTGFIGLALMAHELLKKLGWIVSDLSLESVYSNWLLGYSS
FT                   LLGPIAGIMVVDYFLVRRQRLDLAGLYRDDVYPAWNWPGFAAFAVPVALTVMALGNRQF
FT                   HWFYDYGWFTGSLLGGALYYGLCGRRARSPAALAKPLP"
FT   CDS_pept        492161..493444
FT                   /transl_table=11
FT                   /locus_tag="PLES_04411"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25168"
FT                   /protein_id="CAW25168.1"
FT                   /translation="MSTVRNVLQSTQRHIDGQRLWQSLMDLARLGATAKGGVCRLALSD
FT                   LDRQARDLFVQWCEAAGCTVSVDRVGNIFARRPGRNPDLPPVMTGSHIDTQPTGGKFDG
FT                   CFGVMAGLEVIRTLNDLGVETEAPLEVVVWTNEEGSRFAPCMMGSGVFAGKFTLEETLA
FT                   KRDADGVSVGEALDAIGYAGARDCLGHPVGAYFEAHIEQGPILEDEEKTIGVVLGALGQ
FT                   KWFDLSLRGVEAHAGPTPMHLRKDALVGAAAVVEAVNRAALGHQPHACGTVGCLHAYPG
FT                   SRNVIPGEVKMTLDFRHLQPERLDSMIAEVRQVIAATCEKHGLQYELVPTADFPPLYFD
FT                   QGCVGAVREAAQALGMPQMDIVSGAGHDAIFLAELGPAGMIFVPCENGISHNEIENASP
FT                   DDLAAGCAVLLRAMLKASEAIAGGRLAA"
FT   CDS_pept        complement(493644..494867)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04421"
FT                   /product="putative acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25169"
FT                   /protein_id="CAW25169.1"
FT                   /translation="MPGALSHIRVLDLSRVLAGPWAGQILADLGAEVIKIERPGSGDDT
FT                   RAWGPPFLKDAEGNDTSEAAYYLSANRNKKSVTVDFTQPEGQRIVRELAAKADILLENF
FT                   KVGGLKAYGLDYESLKQVNPKLIYCSITGFGQSGPYAKRAGYDFMIQGLGGLMSLTGRA
FT                   DSEEGAGPVKVGVALTDILTGLYSSTAVLAALAHRDVSGIGQHIDMALLDVQVACLANQ
FT                   TLNYLTTGVPPRRLGNAHPNIVPYQDFPTADGDMILTVGNDSQFRKFAELADHPEWADD
FT                   PRFATNKARVANREVLIPLIRQATVLHTTAEWILSLERAGVPCGPINDLAQVFADPQVQ
FT                   ARGLRVELPHPLAGTVPQVASPIRLSETPVEYRNPPPTLGQHTDEVLETLLGLDAAALE
FT                   RLRDGKVI"
FT   CDS_pept        complement(494987..496168)
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="PLES_04431"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25170"
FT                   /protein_id="CAW25170.1"
FT                   /translation="MATKASFNWEDPLLLDQQLTEEERMVRDSAQQFAQDKLAPRVLEA
FT                   FRHEQTDPKIFREMGETGLLGATIPEAYGGSGLNYVCYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIHEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKVDGGYR
FT                   LSGSKMWITNSPIADVFVVWAKDDEGQIRGFVLEKGWEGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENAFPEVRGLRGPFTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIA
FT                   RLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFF"
FT   CDS_pept        496389..497297
FT                   /transl_table=11
FT                   /locus_tag="PLES_04441"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25171"
FT                   /protein_id="CAW25171.1"
FT                   /translation="MRRKIPSTAALVSFESAARHESFTKAAEELSLTQSAICRQIATLE
FT                   EFLGVELFRRSRRGVKLTEAGLSYSRRVAVRLDAVERDTLAVMGHQGGGAIELAVVPTF
FT                   GTQWLLPRLKRFQRLHPEVTVNLTNRTRPFLFADTEFDAALYFGDADWSGTVSHFLMRE
FT                   NPVPVCSPELLGGRRTLSAEQVAGLPLMQQSTRPYAWRQWFHSQGLNVAHDMSGPRYEL
FT                   FSMLAQAAMHGMGVALIPPFLIQDELADGRLIVPMQHAYLSENAYYLIIPERRVESAML
FT                   NAFRDWLVEEARQYREANGLG"
FT   CDS_pept        497449..497853
FT                   /transl_table=11
FT                   /locus_tag="PLES_04451"
FT                   /product="putative long-chain acyl-CoA thioester hydrolase
FT                   family protein"
FT                   /note="orf00670"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25172"
FT                   /protein_id="CAW25172.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQR
FT                   VVTKYISEINFVSSARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMVFV
FT                   NLGPDGLPAPHGKTEITYIKDQFKEDEVLP"
FT   CDS_pept        complement(497896..499518)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04461"
FT                   /product="probable phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25173"
FT                   /protein_id="CAW25173.1"
FT                   /translation="MTSDVLPADAVASAAGNARKPHLEQRPGRLTALVFFAVLATGLLF
FT                   SAYSLMQDVDDVGSTITTWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYSHSLPP
FT                   HFAVVWSGCFNFLGVLLSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAILWNL
FT                   GTWWLGLPASSSHTLIGSIIGVGVANALMHGRDGTSGVDWGQATKVGYSLLLSPLIGFA
FT                   CAALLLLALRLLVKNRALYKAPKGKAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLI
FT                   MLILVGTLPMAYALNRTMPADQAVQFAAVADVTQQALVKSAPQPAPADPRQVLSDYVRS
FT                   KQASPELIPALAALTGSIGQEVKGYGAFSRVPAEAMGNVRNDMYLTSEAIRLMDKDGVG
FT                   RFDADTRGKLQAFKQKIDDATKFIPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTH
FT                   LTYAQGASAETVAMLTIGAADLYGLPVSTTHVLSSGVAGTMAANGSGLQWKTIRNLLMA
FT                   WVLTLPAAILLSASLYWLLTRLF"
FT   CDS_pept        499898..501229
FT                   /transl_table=11
FT                   /locus_tag="PLES_04471"
FT                   /product="putative membrane-bound protease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25174"
FT                   /protein_id="CAW25174.1"
FT                   /translation="MRMPCRLALALLLCFAGPACLAASGPVRVLSVDGAIGPASADYLV
FT                   RGIERAAEDGAQLVVLELDTPGGLDASMRRIVKAILASQVPVAGFVAPSGARAASAGTY
FT                   ILYACHIAAMAPGTNLGAATPVRLGTPDKPAEKPPARDADPMARKQVNDAAAYIRGLAQ
FT                   LRGRNAEWAERAVREAVSLAAHEAAAQKVIDLQARDLPDLLRQLDSRSLRVGERALTLA
FT                   TAGATVERQAPDWRARLLAVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLL
FT                   LGLYALQMLPVNYAGLALIALGLAFMVGEAFVASFGVLGIGGIVSFVVGALILIDTEVP
FT                   GYGIPPGLVVALALLSAALIVGLLGMALRTRRQAVVSGTAGLVGSLATVAAVDSEQPCA
FT                   GWVLLQGERWRVLAARPLAVGQPVWVLARKGLLLEVALADEGGG"
FT   CDS_pept        501226..502020
FT                   /transl_table=11
FT                   /locus_tag="PLES_04481"
FT                   /product="probable stomatin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25175"
FT                   /protein_id="CAW25175.1"
FT                   /translation="MMGISYGLAMLLVFLALLLFSALRILREYERGVVFQLGRFWKVKG
FT                   PGLVLVIPAIQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQVE
FT                   NYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVEIKH
FT                   VDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLRYMQT
FT                   LGAIAGDKSSTIVFPMPIELFGGKYAGAAPRNEKAAGEDEER"
FT   CDS_pept        complement(502092..502766)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25176"
FT                   /protein_id="CAW25176.1"
FT                   /translation="MPGIPQAHQQVQAVLAKRGGQYLQLVAQIGQFALEGDPQRQLVLH
FT                   RQVDPPRLEHPRGVGEAGHVDLLQTAVTVEFGRVGIVAHDRDAVGTQVAQAGKLDTPPL
FT                   ALQQANAVAQVGAGKLPVEAAGGLVPGAQGDVVVAAAHAVQGTRPGYLLETRVEAGALE
FT                   RGGHQFHRQAVARQARIDERRPGVADQAQVGGRQRAREEQCQQQECASQHEGASREWIA
FT                   TA"
FT   CDS_pept        complement(502856..505057)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04501"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25177"
FT                   /protein_id="CAW25177.1"
FT                   /translation="MPPSSLTHTLRRLWALDKFAYSLRVFIALAGALLLCWWQDRIELL
FT                   IPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPYPWLFVSGMALSAF
FT                   GMILLGALGERYAAIASATLILSIYTMIGVDQRGGEVADVWHEPLLLVAGAAWYGLLSV
FT                   LWNALFSNQPVQQSLSRLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKVVVAL
FT                   NQAKETILNRLGHGRPGPKVSRYLKLYFIAQDVHERASSSHYPYNRLAEAFFHSDVLFR
FT                   CQRLLNQQGKACQALARAIRLRQPFDYADRELALEDLQASLEHLRQQSNPAWKGLLRSL
FT                   GALAANLTTLDRKLAGASNPDAIADEQDSALLDRSPRSLKDAFERLRQQLTPTSLLFRH
FT                   GLRMALALTAGYGVLHWIHPTQGYWILLTTVFVCQPNYGATRLRLVQRILGTVVGLVGG
FT                   WALIDLFPSPLVQSLFAVAAGVAFFATRSSRYTLATAAITLLVLFCFNQVGDGYGLILP
FT                   RLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLRQIMQQYATGKRDDLD
FT                   YRTARRNAHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLSHTLLSYLSGLGAHRES
FT                   LPEDASDGLLERAAERLSASLEEIAASLEQKRPVAIYSEEEEALAKELEQMPEDMDDSH
FT                   RLVQTQLAHICRQLAPLRTLAAHLLKKELAGAQPLPGQP"
FT   CDS_pept        complement(505319..506695)
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PLES_04511"
FT                   /product="RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25178"
FT                   /protein_id="CAW25178.1"
FT                   /translation="MTSTAFSSLPLSADLLANLDSLGYREMTPIQAQSLPLILQGHDLI
FT                   AQAKTGSGKTAAFGLALLSPLNPRYFGCQALVLCPTRELADQVAKEIRRLARAADNIKV
FT                   LTLCGGVPYGPQVASLEHGAHVVVGTPGRIQEHLRKGTLVLDGLNTLVLDEADRMLDMG
FT                   FYDSIAEIIGQLPERRQTLLFSATYPDGIEKLAKTFMRDPRQVRVESLHADSQIEQRFF
FT                   EIDPKQRMDAVVRLLQHFRPQSSVAFCQTRQQCQELADALKAQRISALALHGDLEQRER
FT                   DQVLTVFANRSCNVLVATDVAARGLDIAALETVINVELARDPEVHIHRIGRSGRAGEKG
FT                   LALSLVAPAEASRAQAIEDLQKQPLAWYALGQLKASPEPLLPPMSTLCIAGGRKDKVRP
FT                   GDLLGALTGDAGLPGSAVGKIAIFDFQAFVAIERGLAHQALKRLSEGKIKGRSFKVRLL
FT                   "
FT   CDS_pept        507043..507252
FT                   /transl_table=11
FT                   /locus_tag="PLES_04521"
FT                   /product="probable cold-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25179"
FT                   /protein_id="CAW25179.1"
FT                   /translation="MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLAE
FT                   GQKVSFEVVQGQKGMQAERVQVIN"
FT   CDS_pept        507403..507927
FT                   /transl_table=11
FT                   /locus_tag="PLES_04531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25180"
FT                   /protein_id="CAW25180.1"
FT                   /translation="MKPVQSRRLAFAALLSLSFSSASCHAATEHWGWIEQSWLMPERMQ
FT                   AKAKLDTGALTSSLDARNIHRYKKDGERWVRFDVVLPTADSKAPVSVTFERKVLRLIKV
FT                   RGAGGSDSRPVVAMDICLGAKLLREQFSLRDRGNMNYPVLLGRRTLEHLGAVDVSRTFT
FT                   RKPTCSALAAQ"
FT   CDS_pept        complement(508297..509730)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04541"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25181"
FT                   /protein_id="CAW25181.1"
FT                   /translation="MSEPFQLTPRIARQLPWLVAVAFFMQALDGTILNTALPSMASSLN
FT                   ENPLRMQAVVIAYLLTVALLIPASGWIADRFGTRRVFLGAVLLFSLGSLLCALSPSLEL
FT                   LVGARIVQGVGGALMMPVGRLVILRVYPRQDLVRVLSFVTIPGLLGPLAGPTLGGWLVE
FT                   YASWHWIFLINLPVGLLGCLVAMKLMPDLRSPVPSRFDSIGFLLFGGSMVLISIALEGL
FT                   GELHLSHLRVVLLLIGGLVLLTAYWLRALRIDKPLFPPSLFKARTFAVGILGNLFARLG
FT                   SGALPFLTPLLLQVGLGYPPSTAGMTMIPLALFAMVAKPMAKPLLDFFGYRKLLVGNTL
FT                   ILGCLIAGFGLVDQDTPYVWLLLHLSLLGAVNSLQFTAMNTLTLIDLQDSNASSGNSLM
FT                   SVVVQLSISLGVACAAALLGGFQTDLDTGQDTVLGAFHATYVSVGLMSMLAAAIFFQLG
FT                   SEDGRTSPRRVDPEKDPDL"
FT   CDS_pept        510350..512902
FT                   /transl_table=11
FT                   /locus_tag="PLES_04551"
FT                   /product="probable ClpA/B protease ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25182"
FT                   /protein_id="CAW25182.1"
FT                   /translation="MDIAEYFSKQTTEYLQRAAQVAAEFGKREVDTEHLLYALADADVV
FT                   QAVLKQFGLSPADLKQYIEANAVRGASKGEASEDMTISPRVKSALQHAFALSRELGHSY
FT                   VGPEHLLLGLAAVPDSFAGTLLKKYGLTEQALRQKAVKVVGKGAEDGRVDGPSNTPQLD
FT                   KFSRDLTRLAREGKLDPVIGRSKEVETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQ
FT                   RMVQGEVPEVLRDKRLVELNINAMVAGAKYRGEFEERLKQVMDELQAAQSEIILFIDEV
FT                   HTIVGAGQGGGEGGLDVANVLKPAMARGEMNLIGATTLNEYQKYIEKDAALERRFQPVF
FT                   VPEPTVEQTISILRGLRDKLEGHHKVTIRDEAFVAAAELSDRYIGNRFLPDKAIDLIDQ
FT                   AAARVRIASTSRPAEIQELEAELAQLKREQDYAASRKWYDEAKVFEKRIQERKEHLEQI
FT                   TERWQQTQGSKTEEVRVEDIAEIISKLTGIPVTELTAEEREKLLQMEERLHQRVIGQQE
FT                   AITAVSDAVRLARAGLRQGSRPIATFLFLGPTGVGKTELAKALAEVVFGDEDAMIRIDM
FT                   SEYMERHAVSRLIGAPPGYVGYDEGGQLTERVRRRPYSVILLDEIEKAHADVNNILLQV
FT                   FDDGRLTDGKGRVVDFTNTIIIATSNLGSELIMKNAQAGEFAQPPEKLKRELMTTLRGH
FT                   FRPEFLNRLDEVIVFESLSKAQIEDIVRLQLERVKRAAHAQDIYLHIDDSLVGHLAEEA
FT                   YQPEFGARELKRQIRQQLETRLATAMLKGEVKEGETVTFFYDAKDGVGYRKGAAPKPAA
FT                   RKKSGAGETPKGRATAARKPAAKKGAAAKGKADKPKAK"
FT   CDS_pept        513004..513582
FT                   /transl_table=11
FT                   /locus_tag="PLES_04561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25183"
FT                   /protein_id="CAW25183.1"
FT                   /translation="MRVTTHATLAAALLLSAASAFAFNLGDAAKAVAGASQGDSAQVAT
FT                   TPQTSGLLGALTGQLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLAGNN
FT                   ALAGLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTLGMDSGMTEKFAQVLVDY
FT                   FGKQGANSELLGSLSNLWGVSKAGGSSLL"
FT   CDS_pept        complement(513907..514794)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04571"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25184"
FT                   /protein_id="CAW25184.1"
FT                   /translation="MRELLTGLTSSLLLLLNTLILIGPMMLIALLKLVLPGQRLKDLCS
FT                   RGVMWIAETWAEIDKWIFATCTPTVWDVRGAGDLRQDTSYLVVSNHQSWVDIPALIQVF
FT                   NRRTPYFKFFLKKELIWVPFLGLAWWALEYPFMKRYSKAFLEKHPELKGKDLEITKAAC
FT                   EKFKRIPVTVVNYLEGTRFSEQKKARQQSPYRHLLKPKAGGVAFVLAALGEQLDALLDV
FT                   TVVYPSDKVPGFWDLLCGRVPKVIVDIQTRPIDPALWQGDYENDPVFRQYVQEWVSRMW
FT                   EEKDERIARLRQLR"
FT   CDS_pept        514742..515446
FT                   /transl_table=11
FT                   /locus_tag="PLES_04581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25185"
FT                   /protein_id="CAW25185.1"
FT                   /translation="MLRSSRRLLVRPVNSSRMVGFPVLGVGRRGPSYASAPRRPSRRRG
FT                   ERNRAVLVLCGPRITSGDARVKRALALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQ
FT                   AKMDTGAYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNR
FT                   NGEDEDEDRLSERPVIDLQVCLGGAMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDP
FT                   SERFVADKPTCK"
FT   CDS_pept        515531..516220
FT                   /transl_table=11
FT                   /gene="creB"
FT                   /locus_tag="PLES_04591"
FT                   /product="two-component response regulator CreB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25186"
FT                   /protein_id="CAW25186.1"
FT                   /translation="MPHILIVEDEAAIADTLLYALQAEGFATTWVTLAGEALALQERQP
FT                   ADLLILDVGLPDISGFEACKRLRRFSEVPVIFLTARDAEIDRVVGLEIGADDYVVKPFS
FT                   PREVAARVKAILKRMAPRPAALEGAAPSGPFQVDEERVRIHYRDTPLNLTRHEFRLLQT
FT                   LLGQPERVFSREQLLDALGVASEAGYERNIDSHIKSLRAKLRQVNERGEAIQTHRGLGY
FT                   SYSPDHA"
FT   CDS_pept        516220..517644
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /locus_tag="PLES_04601"
FT                   /product="two-component sensor CreC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25187"
FT                   /protein_id="CAW25187.1"
FT                   /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVDT
FT                   ANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASGKV
FT                   LLDSAGVAVGQDYSRWNDVYLTLRGQYGARSSREDPDDPDSSVMYVAAPIKDGGKIIGV
FT                   VSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTQYAQAVSE
FT                   GRRAELPRYRGGEMAQLADAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRGAAELL
FT                   DGEMPAEQRARFVGNIAGESERLQQLIERLLSLAQVEQRQGLEEVGKVDLREIAASLLE
FT                   GQAARIQRQRLRVENRLEGPCEVRGEQFLLRQALANLLDNALDFTPPGGILRLLAEVDG
FT                   EGIALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQLHGGRLQV
FT                   GNRDDGVEALLWLPRG"
FT   CDS_pept        517747..519105
FT                   /transl_table=11
FT                   /gene="creD"
FT                   /locus_tag="PLES_04611"
FT                   /product="inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25188"
FT                   /protein_id="CAW25188.1"
FT                   /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEVRDGVLQDIA
FT                   RSSSYSQRLTGPLLVVPYRRTVREWVTEEKTEKRVLQEREQRGELYFLPDRFALDGQMR
FT                   TELRYRGIYQARLYHVDNKVAGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGIENA
FT                   LRLSLNGASVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLSLLGSERLDIVPV
FT                   GRDSQVILKADWPHPSFGGEFLPSEREITAQGFTARWQTSFFATNMEEALRSCVEEQRC
FT                   DGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHPVQYALV
FT                   GLALAFFYLLLLSLAEHVGFELAYLVSAGACVGLIGFYLCFVLRSVARGLGFSVGLAGL
FT                   YGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDFPAVPARA"
FT   CDS_pept        519155..519457
FT                   /transl_table=11
FT                   /locus_tag="PLES_04621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25189"
FT                   /protein_id="CAW25189.1"
FT                   /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPLA
FT                   HAMLVLMPDGFWEGLSGIEGAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
FT   CDS_pept        complement(519602..520222)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04631"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25190"
FT                   /protein_id="CAW25190.1"
FT                   /translation="MSATHTLFYAAASPFVRKVLVLLHETGQRERVALEEVTPTPVAPI
FT                   RQLNASNPAGKIPALRLPDGQVLHDSRVICDYFDQQHVGEPLIPREGSARWRRLTIASL
FT                   ADAVLDAAVLSRYETFVRPEEKRWDTWLEAQREKIGRSLAWLEGDCIAELQARFDIAAI
FT                   GVACALGYLDLRQPEWDWRGRYPRLAAWFAEVSQRPSMQATRA"
FT   CDS_pept        complement(520241..521191)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04641"
FT                   /product="putative streptogramin lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25191"
FT                   /protein_id="CAW25191.1"
FT                   /translation="MRHLPYPLLGLFLALSSTGAALAGEQYYPLDKGSAPYAVAPSAQG
FT                   AVWYGADGGHSLGRLDPTSGESVQVPLGEGARPRAIVSDESGNAWVLDSGLNAILRIGG
FT                   ERLGSERFPLPAKAAPAGLDSAVFDDDGRLWFTGSRGFHGRLDPARRLVEVWPSPQGKA
FT                   ANGICVTPDGEVWYAQDDALVHVDPLDGSAEQLPAPEGTKALRGIGADSIGRLWASDSG
FT                   GARLYRYDPSDASWQSWPLPDSQARPDSLRVDAMDRVWLHDAASGALLRFDSEQATFRV
FT                   LPSDRPAPGNALLGGRPGETWSAEPAADRLRVVRD"
FT   CDS_pept        521277..522134
FT                   /transl_table=11
FT                   /locus_tag="PLES_04651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25192"
FT                   /protein_id="CAW25192.1"
FT                   /translation="MATVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLGV
FT                   ESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMPAA
FT                   CLSLLRIRGGEIELLNIGDSRILVEGADGQVRSFGDSALHELDRQSLAHFCRMREEHPQ
FT                   WDHAELFKASRPRVRQNRLLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVLMTDG
FT                   FDRLVEPFRRYTDEQLLRRLEDVGVSAMLDELREIEQGDDQALAFPRFKIHDDASALWG
FT                   RIAG"
FT   CDS_pept        complement(522307..524721)
FT                   /transl_table=11
FT                   /gene="fiuA"
FT                   /locus_tag="PLES_04661"
FT                   /product="Ferrichrome receptor FiuA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25193"
FT                   /protein_id="CAW25193.1"
FT                   /translation="MPRPTFRPGLLALAIALAVPAPFLHAAPAEQASVRDYRIAAGPLA
FT                   GTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALKGSGLELVENAGGTYS
FT                   LRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISVATRQQ
FT                   MTDRAVHNLDDAVRYMPGVVASSFGSDSRSDWLKVRGFKPTQFLDGLPMATGSYNNPKL
FT                   ETWNLERLALLRGPASSVYGQTPPGGMLDMVSLRPQGIASHELKAEIGNYNHKQVSFDS
FT                   TGPIDDEGRFLYRLSGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTFLSQFNRDD
FT                   TAATSQFLPLRGTKYDAPFGKISHHKNLGDPDWDFYDRTYYWLGYSFERRINDVWQFRQ
FT                   NLRYLRNDLSFQTLTPTSSIDAASADGTLQRMTTSVDEDISQFVVDNNFQADFETGALR
FT                   HTLLLGIDHNRTRTDYTSIYNFTGVPPTNVNNPIYGQPIPKPSRSSAFYDYRQKTYQTG
FT                   LYVQDQIALDNWRLTLGGREDWVHAGATFYNQNDATNTSRDKKFSGNAALSYIFDNGLA
FT                   PYLSYAESFQPSTGADDIGSNKMFKPTEGKQWELGVKYQPVGSDSLFTAAVYDLRQENV
FT                   RVTDNVNGTPTTSQAGEVKVTGLELEATSNVTDNLKVIGSYSYADTEVKKGQYAGNRLQ
FT                   QAPRNQASLWADYTWHEGALNGFSVGAGARYVGSTYGDQANTYDGYAGSYTLYDAAVRY
FT                   DLGQLNGSLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSVVGSVSYKW"
FT   CDS_pept        complement(524825..525796)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04671"
FT                   /product="probable transmembrane sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25194"
FT                   /protein_id="CAW25194.1"
FT                   /translation="MSADDRHSPVRARVLDEAIAWQLLLDSGEAHPDDHRAFHRWYAAH
FT                   PEHERAWEQLGGLDRHLARAANGPARNALLSGNARFKRRLRRLGGSALGLVLALGVGLG
FT                   VANRYVPVRYLLADAYSATGEQRELTLPDATHVRLNSRSAIDVRFDGERRQVVLLAGEI
FT                   LVETAHGDPRPFVVSSADGDMRALGTRFLVRREEPGTRLTVLQSAVAARAETLSEERVI
FT                   KEGQQVLILPQGLQASEAAPALAGAWAQGMLVVENARLADLVAELGRYSPALLQVDPSI
FT                   ADLRVTGSFPLKDTRLALQALEPSLPVRSVRHNAWWFEVVPR"
FT   CDS_pept        complement(525793..526311)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04681"
FT                   /product="probable sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25195"
FT                   /protein_id="CAW25195.1"
FT                   /translation="MSAGDVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTF
FT                   VRLLGRPELPGLREPRAFLAKVARGLMIDHFRRAALEQAYLAELALVPEAEQPSAEEQY
FT                   LILEDLREIDRLLGTLSLKARSAFLYSRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQC
FT                   YIALYGEPR"
FT   CDS_pept        526480..527229
FT                   /transl_table=11
FT                   /locus_tag="PLES_04691"
FT                   /product="probable glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25196"
FT                   /protein_id="CAW25196.1"
FT                   /translation="MAEPLLIIGSYLSPYVRKVLVLLELKGIAYRIDPIVPFFGDEAFE
FT                   RLSPLRQIPVLVDGDFVLNDSSVICQYLEERYPQPSLYPVDIGQRAQARWLEEYADSRL
FT                   GQVIIWQLFHQLVINRGIWQREPDQAILQRTYDEDLPSICNYLEGRVPPSGWLCGELSI
FT                   ADVAVACLFRNAQLARYQVDGERWPRLARLLADAFALPAFQHLARFEKATAQTPVAEQR
FT                   QALREAGAPLSATSHARERPVRGPMSR"
FT   CDS_pept        527369..527773
FT                   /transl_table=11
FT                   /locus_tag="PLES_04701"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25197"
FT                   /protein_id="CAW25197.1"
FT                   /translation="MMNVPEGFQPLFRSSPLLDLLGPFFCRQDAQRQLVVALRIDEKHC
FT                   NHGGTAHGGLLSTLADVGLGYAMAFSREPPQPMVTVGLRLDFCGVARVGDWLEVHTRVD
FT                   KLGQRMAFASARLHSGERLVASASGVFHLP"
FT   CDS_pept        527823..528392
FT                   /transl_table=11
FT                   /locus_tag="PLES_04711"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25198"
FT                   /protein_id="CAW25198.1"
FT                   /translation="MPKKSNAAERIVHATASLLASRGYFGTGLSDIIARAEAPKGSLYH
FT                   YFPEGKPQIASAAIGFVADEVASFLDRAGTQAPHARNVLRQFTATLRGWLEHSRFEEAC
FT                   PVLSTSLSIDAELAPVHAECRRALRAWHASIERALRADGLAEKLAASRAWLILAALEGA
FT                   VAVARVERSFQALDAIEEELQALLPA"
FT   CDS_pept        complement(528426..530153)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04721"
FT                   /product="probable permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25199"
FT                   /protein_id="CAW25199.1"
FT                   /translation="MSSTPKPPASPREFSPSLLDLGTLESLDSLPRAGQRSAEFSASLL
FT                   DLGTPASLDCLPRAGLRAAEFSAARLDLGTPASLDCLPRASHHAGPELPPLSPRLYSAD
FT                   LAPTKAEGRRWGRYSLFALWTNDVHNIANYSFAIGLFALGMSGAQILAALALGALMVYG
FT                   LMNLSGYMGQKTGLPYPVMCRIAFGIHGAQLPALIRAVIAIAWFGIQTYLASIVLRVLL
FT                   TAIWPGLAAYDQDAILGLSSLGWATFVAIWCVQLLIFAYGMEMVRRYESFAGPVILLTV
FT                   AALAAWMYLRAGASIAWSSGEPMSGSQMWLKIFGGAAFWVTLYGTMILNFCDFARGCPD
FT                   RRTISVGNFWGLPVNILLFGLFAVVLAGAQFRIDGQLIQSPTDIVAAIPDTLFLVLASL
FT                   ALLIVTVAVNIMANFVAPAYVLTNLAPNLLNFRRAGLISATIAVLILPWHLYNSPGVIL
FT                   YFLGGLGALLGPLYGIIMVDYYLVRKGRVNLPELYTESRAGAYHYAGGVNPRAIAAFVP
FT                   AAIISTLLALLPAFAELSPFSWFFGAGLAGLIHYALAKRRTAYREVSGEAIAVDSVQH"
FT   CDS_pept        complement(530501..531427)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04731"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25200"
FT                   /protein_id="CAW25200.1"
FT                   /translation="MHPLLRRLDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGR
FT                   LRQGLDDELFLRQGNRMQPTQRAEHLAAAVAAALRALGEGLEEWRPFVPGQSQRTFVFA
FT                   ATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLP
FT                   EGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSG
FT                   LRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALADAAGLALYPAPFDIPPYVLRLY
FT                   SHVQHVGRDAHAWMIGQLKGLDISRTG"
FT   CDS_pept        531515..531991
FT                   /transl_table=11
FT                   /locus_tag="PLES_04741"
FT                   /product="probable N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25201"
FT                   /protein_id="CAW25201.1"
FT                   /translation="MTLEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSLF
FT                   AEGSPTRALMCLSEGRPIGYAVYFYSYSTWLGRNGIYLEDLYVTPEYRGVGAGRRLLRE
FT                   LAREAVANDCGRLEWSVLDWNQPAIDFYRSIGALPQDEWVRYRLDGEALRKMAE"
FT   CDS_pept        complement(532070..533020)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04751"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25202"
FT                   /protein_id="CAW25202.1"
FT                   /translation="MHDFTLHDLQCFDAVVDAGGFQAAAQRLHRSHPAVFAAVARLERQ
FT                   LGLVLLERGGYRVGLTAAGRSFHQRAQALLYELEGLRGHAAHLAQGEESELRVVLGDLC
FT                   PPRPALALLAGFFGSQPQTRLQLLFETVSGPLERLLDGEADLILHRVDKSDPRLEWLDL
FT                   CRVGLVPVIAPGLLGDPPPRPVRPEQLRPFAQCVMRDSARHSSPTDYFMLAGARQCSVP
FT                   DQRTKKEVILQGLGWGHLPDFLVDEELADGRLLALARPHLPGRSEEVVAARRRDRAQGP
FT                   VAERLWAFLRDNATALRESGMDTGGDDSAGARRPR"
FT   CDS_pept        533124..533921
FT                   /transl_table=11
FT                   /locus_tag="PLES_04761"
FT                   /product="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25203"
FT                   /protein_id="CAW25203.1"
FT                   /translation="MGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQL
FT                   PALTRHFRVLRYDARGHGASSVPPGPYTLARLGEDVLELFDALEVRRAHFLGLSLGGIV
FT                   GQWLALHAPQRIERLVLANTSAWLGPAAQWDERIAAVLQAEDMSETAAGFLGNWFPPAL
FT                   LERAEPVVERFRAMLMATNRHGLAGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTAA
FT                   SHGELIATSIAGARLVTLSAVHLSNVEFPQAFEGAVLSFLGAA"
FT   CDS_pept        533964..534407
FT                   /transl_table=11
FT                   /locus_tag="PLES_04771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25204"
FT                   /protein_id="CAW25204.1"
FT                   /translation="MNEPGSFIWTWYGQDEHRWVLLSAEAFLALDFLALDGAMQRETIG
FT                   SCPGCSTWSEKVVPLHEWLEGCPGHQAGSFRDALRRVWALCNELPEEALGCFDFDIYAH
FT                   PGWQAVRREAREALRQNGWDSIRSHAEELRDDCWERVHGYPKK"
FT   CDS_pept        complement(534455..536632)
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="PLES_04781"
FT                   /product="malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25205"
FT                   /db_xref="GOA:B7V467"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V467"
FT                   /protein_id="CAW25205.1"
FT                   /translation="MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVIND
FT                   LAPKNKALLAKRDELQAKIDGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQN
FT                   VDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKV
FT                   RGDKVIAFARAFLDEAAPLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQ
FT                   GDAAKPQAVLLKHNGLHFEIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVD
FT                   ADDKVVIYRNWLGLMKGDLAEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVR
FT                   NVGHLMTNDAILDKDGNEVPEGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMH
FT                   GPEEAAFTNELFGRVEDVLGLPRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGF
FT                   LDRTGDEIHTSMEAGAVVRKGAMKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMP
FT                   DLMAAMLEQKIGHPLAGANTAWVPSPTAATLHALHYHKVDVFARQAELAKRTPASVDDI
FT                   LTIPLAPNTNWTAEEIKNEVDNNAQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATL
FT                   RISSQLLANWLRHGVISQEQVVESLKRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAAL
FT                   ELVVEGTRQPNGYTEPVLHRRRREFKAKNGL"
FT   CDS_pept        536938..537381
FT                   /transl_table=11
FT                   /locus_tag="PLES_04791"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25206"
FT                   /protein_id="CAW25206.1"
FT                   /translation="MPVHAASLADLADLVPLFSAYLDFYEVPAPEEQVRAFLAERLRQG
FT                   DSTLFLARDAEARALGFVQLYPLFASLALRPSWLLSDLYVRPEARRRGVGEALMNQARG
FT                   FAESMGACGLQLETAKTNHAGQSLYERLGYVRDEQFYTYWLQL"
FT   CDS_pept        537413..537928
FT                   /transl_table=11
FT                   /locus_tag="PLES_04801"
FT                   /product="putative ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25207"
FT                   /protein_id="CAW25207.1"
FT                   /translation="MDHLVLTVIATDHPGLVERIAQCIASHGGNWLESRMSRMAGQFAG
FT                   ILRVAVPAEGYDELVEGLQGLSSHGIRVLLAESGIEPVCNWKPIHLDLVGNDRPGIVRD
FT                   ITRLLAEHGVNLESLSTEVRPAPMSSEPLFHADALLAVPLTLSLDTLRERLEDLADDLM
FT                   VELVLDAS"
FT   CDS_pept        complement(538618..539514)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04811"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25208"
FT                   /protein_id="CAW25208.1"
FT                   /translation="MATANLRRGYVLGLTAYVIWGLFPLYFKLLERIPAVEIIVQRAVW
FT                   SALFGAVLLLFWKHPGWWRELRQNPQRFVVLAASGLLIASNWMTYVWAVNNGHMLEASL
FT                   GYYINPLINVMLGMLLLKERLRPLQWLAVALASLGVAQQVWQLGSLPWVSLVLALTFGF
FT                   YGLIRKKAPVAALPGLVVETWLLLPLALVWLLFFADGPTSETAFWSTPEALWVVAAGPV
FT                   TLVPLVCFNAAARHLPYATLGFLQYLAPTLVLLQAILLFGEHLDSSRLTAFAFIWLALA
FT                   VYSFDAWRSLRRLPQPG"
FT   CDS_pept        complement(539717..540691)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04821"
FT                   /product="putative putative homoserine kinase type II"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25209"
FT                   /protein_id="CAW25209.1"
FT                   /translation="MSHPFDQLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIED
FT                   GEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLSRDGESLFAFSGFRFALFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALAVDNFGHASLATLLEGNFI
FT                   PRSLLPAYESVARDLLKRLDALFAEVPYQPIRLHGDCHPGNLLCRDEVYHMVDLDDCRM
FT                   GPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFEPRQLPLLEGLRSLRLMHYSAWLA
FT                   RRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
FT   CDS_pept        complement(540753..541511)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04831"
FT                   /product="probable molybdenum transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25210"
FT                   /protein_id="CAW25210.1"
FT                   /translation="MSALSTLAQHVTRRPQRIALLAQIAELGSITRAAKAVGISYKGAW
FT                   DAIDELNNLAERPLVERSVGGKGGGGARLTAEGERLLALYRRLEALQAQVLQAAEDAED
FT                   LNLIGRLMLRTSARNQLHGRVLSIHGEGFHDRIAIELPGQQRIEALITRASTEQLELGR
FT                   GRPVLALIKAGWLDVGLEPREDQPNQLHGTLEEILAAKAGPSEVRIALGSGLILCALLS
FT                   GERLASLGLKKGQKVIASFDPAQVLLGTPL"
FT   CDS_pept        complement(541579..541899)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04841"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25211"
FT                   /protein_id="CAW25211.1"
FT                   /translation="MRALLVAACLLLGGCSHFAEDDWLGEDKALHFASSAALAAAGMQM
FT                   AHDRGLRGARQARFGLSFSLAFGVGKEFYDSRSAGSGWSWKDLAWDLAGAAAGYGLYQA
FT                   AE"
FT   CDS_pept        complement(541941..542666)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04851"
FT                   /product="probable phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25212"
FT                   /protein_id="CAW25212.1"
FT                   /translation="MSFPLRPLTRWLLPPPACLLCAARSDQPPRPLCRACAADLPWSRQ
FT                   QCRRCALPLPLDGQVCGECLRRPPAYEQAIAPWRYAFPLDSLINRFKHQAAWPLGRLLG
FT                   ELLAEHLRQRYAEGLPRPARLLPVPLAPRRERRRGFNQAQQLAERLAGELDLHCDPHSL
FT                   RRVLDTPAQQGLDATVRRRNLRHAFALAPASDVRGLHLALVDDVLTTGATTEHLSRLLR
FT                   RAGAARVDVYCLARTPKPG"
FT   CDS_pept        complement(542805..543098)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25213"
FT                   /protein_id="CAW25213.1"
FT                   /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWGAMDDFLHGLAR
FT                   AIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIVGGVIWTVLGLIVMSWLIH"
FT   CDS_pept        complement(543152..544078)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04871"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25214"
FT                   /protein_id="CAW25214.1"
FT                   /translation="MLPMALTLRQVRYFIATAEFGQISQAAIHLNISQSAVTSAIQELE
FT                   SMLGVALFTRTAQGMNLTDSGRHFLNHAYSIQRSVDDALNSPQPDTRVEGTLKVAASYT
FT                   VMGYFLPHHLQRLAQWYPELELQLFEDERASIERGLLDGRYDIAVLLTGNLTEPGIAAE
FT                   TLFNSERRLWLPSRHPLGEKADLGLADVAGEPYIMLTVDEAGQSALRYWQQSGHRPQVI
FT                   LHTSSVEAVRSMVANGSGVAILSDLVYRPWSLEGKRIETLSLVDPVPSMSVGLAWRRDT
FT                   EASAGMRAFREYFRQSFLAPQQSSSRR"
FT   CDS_pept        544196..544954
FT                   /transl_table=11
FT                   /locus_tag="PLES_04881"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25215"
FT                   /protein_id="CAW25215.1"
FT                   /translation="MTEVDLNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDP
FT                   SSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQ
FT                   GLSLQHVKPHGALYMHLARDEVAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPL
FT                   VREFYADRDYDRSGSIVFTRRVAALDPQQVADKVLRACREGKVRTVEGEDLDIAFDSVC
FT                   IHSDTPGALELVASTRARLEGAGIRIKAPR"
FT   CDS_pept        545031..545279
FT                   /transl_table=11
FT                   /locus_tag="PLES_04891"
FT                   /product="probable biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25216"
FT                   /protein_id="CAW25216.1"
FT                   /translation="MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVMK
FT                   QFSEVQAGQAGILQAFHVEDGEAIEPGQVLAVIASAT"
FT   CDS_pept        545290..546666
FT                   /transl_table=11
FT                   /locus_tag="PLES_04901"
FT                   /product="probable acyl-CoA carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25217"
FT                   /protein_id="CAW25217.1"
FT                   /translation="MHKRLNKLLVANRGEIAVRIIRAAQALGIPTVAVCSEADRDSLAA
FT                   RLADEVRLIGPARADRSYLDIEAILMAARETGADSIHPGYGFLSENPAFAEAVQAAGLV
FT                   FVGPDAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELGDLDAALACAEEVGYPLLVKAS
FT                   AGGGGRGIRIAHDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILGDGER
FT                   AVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTLEYLFD
FT                   AHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEDIRLNGAALEM
FT                   RINAEDPARNFFPSPGTVERLEWPQGEGVRVDSHLYPGYRVPPYYDSLLAKLIVHGRDR
FT                   DEAFARARQALERTVLAGMATTLPLHRWLLADARVQAAQFDTATLETWLAERTAAAQEV
FT                   "
FT   CDS_pept        546668..547546
FT                   /transl_table=11
FT                   /locus_tag="PLES_04911"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25218"
FT                   /protein_id="CAW25218.1"
FT                   /translation="MHANIRYSFGGDEHLFAEVAEAMSLEAFFRGMAITRAIETLQLPG
FT                   VLDVCLANASFQVRFDPDRLAPQALLETVRGLEVEAVAARSIETRIVEVPVLYNDPWTH
FT                   ETLMRFRDRHQDPDSTDLEYAARINGYADVRAFIQAHSGTPWFVSMVGFVAGLPFMYQM
FT                   VERERQLQVPKYLRPRIDTPKLTLGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPRQGL
FT                   PYLEESMVFFRAGDIVQFRPIEWTEYERMAAEVEAGTFDLRIRPVSFDLDAFLADPRGC
FT                   TQHLQEVLYVD"
FT   CDS_pept        547536..548513
FT                   /transl_table=11
FT                   /locus_tag="PLES_04921"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25219"
FT                   /protein_id="CAW25219.1"
FT                   /translation="MSIKVLKPGLATSVQDAGREGHYHLGIPPSGALDQYALRAANLLV
FT                   GNAPTAAVLECALLGPQLEFQRDALVAVCGARMTPRLEGAEMPLDTSFRVRAGQVLGFD
FT                   FIRAGARGYLAIDGGIAVPEVLGSRSTYGLGAIGGLQGRRLAEGDLLPLGPASPSAVEG
FT                   LALPRSLQVEVGGEVSLRVVPGLYVHRLTPDAVERFFAETWTVGSEADRTGYRFKGGTA
FT                   LRFEPREQPFGAGSDPSNIVDACYPIGSIQVPGGLEPIVLHRDAVSGGGYATLGTVISP
FT                   DLNRLAQMQPNQKGRFVAVSLEEGLEARRRYNWQVQRLQHFFLR"
FT   CDS_pept        complement(548560..549561)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25220"
FT                   /protein_id="CAW25220.1"
FT                   /translation="MNAFIRYMLVAMLLVLSQKSFALMCWKSDNKQTEDYVYIDTSIAV
FT                   PSVLPKDTVLWRSPNYSISITCFQDRDWGPEQVYFYLSPTGQGALGSDLEVGINLNGED
FT                   LRCSTLDKCRKEIGMHFDGCWTGRGCEGRAKKMTVNFNFFLSKRAGPSTGKEGPITGVN
FT                   AYPIFQFDGESAINNIGGYNFRMTLHGLNNLRYVACASTISLSPKTVDFQSLQAYFASR
FT                   DQILKELPFSVTANKNCSSAYGLNAMFLPSGSTSLWGSDTLLDNNNKSVGIRLLKQEDR
FT                   SIIDIGKEFVLVPNSQNQLVVIRNFLAQVRWMTGTPTPGPFNATAAIEVYYK"
FT   CDS_pept        complement(549639..550646)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25221"
FT                   /protein_id="CAW25221.1"
FT                   /translation="MNAITRTLLVGMLVALAQKGYALTCERADNKATIDYVNIDTSIAV
FT                   PSALPKDTVLWRSPTYDFSVRCYQERENTGPEDVYFYLSPDGQGALGSDLEVGINLNGE
FT                   DLRCSSLPGCRQKIGMHFDGCWTGGRGGCEGMAQTKQVRFQIFLSKLAAPTPGKEGPIT
FT                   GVNSYALFQFDGVGGINNLGGRNLRMYALGMNNLRYVACTSTLSISPKTLNFQILQSQF
FT                   AAQNLVIKELPFSITANKSCNSAYGLNAMFIPASNTTLSSTDTLLAKDNPTVGIRLLNE
FT                   DRSVISIGKEFEFIPYAPTQTTVTKNFLAQLRWMTSRPILGPFNATAAIEVYYK"
FT   CDS_pept        complement(550662..551363)
FT                   /transl_table=11
FT                   /locus_tag="PLES_04951"
FT                   /product="probable pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25222"
FT                   /protein_id="CAW25222.1"
FT                   /translation="MVLASIFAWLCMSAHADLSFDGQNRFVMKGKRLPITLVNEGKEPA
FT                   LAEISLDWGTDGKGQALPFAVSRPLLRLGAGQRAKVEVLYQGQGLPTDRETYLLLSVLD
FT                   VPHAPSTPETLQIALRHRFKLFYRPPLEATVEQANEGVTWTLGTSGNPKAHNPSPYHIT
FT                   FSQLEFLDASERSCGEAIEHLMLAPFSNHQFDIAACHPDKVRYAIVSDGGNLHPYHGAL
FT                   KSGVETNAKHP"
FT   CDS_pept        551929..552987
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="PLES_04961"
FT                   /product="biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25223"
FT                   /db_xref="GOA:B7V485"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V485"
FT                   /protein_id="CAW25223.1"
FT                   /translation="MSATASVATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAHFDPNR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTS
FT                   PEFYGNIITTRTYSERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVKGTPLAEEKDVDPFDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQAL
FT                   AFMAGANSIFYGEKLLTTKNPQAEKDMQLFARLGIKPEEREEHADEVHQAAIEQALVEQ
FT                   RESKLFYNAASA"
FT   CDS_pept        553093..554298
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="PLES_04971"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25224"
FT                   /db_xref="GOA:B7V486"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V486"
FT                   /protein_id="CAW25224.1"
FT                   /translation="MSFDLASRLASRRAEDLYRQRPLLESAQGPDVVVDGQPLLAFCSN
FT                   DYLGLANHPEVIAALRAGAERWGVGGGASHLVVGHSGPHHELELALAEFTGRPRALLFS
FT                   TGYMANLGAVTALVGKGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDPASLAARLDKA
FT                   EGNTLVVTDGVFSMDGNLADLPALAAVAQARGAWLMVDDAHGFGPLGASGGGIVEHFGL
FT                   GQEQVPVLIGTLGKGFGTAGAFVAGSEELIETLIQYARPYIYTTSQPPAVACATLKSLE
FT                   LLRRESWRRQHLAALIARFRHGAEALGLTLMDSFTPIQPILVGGSRQAVALAGMLRARG
FT                   IMVGAIRPPTVPANSARLRVTLSAAHSEAQVDRLLEALGESWRQLSSSLLAEIEAEEGD
FT                   DA"
FT   CDS_pept        554291..555013
FT                   /transl_table=11
FT                   /locus_tag="PLES_04981"
FT                   /product="probable biotin biosynthesis protein bioH"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25225"
FT                   /protein_id="CAW25225.1"
FT                   /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDA
FT                   ADWLDELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVREDWPNA
FT                   MPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVAGLQ
FT                   LLGQLDTRAALENFRGPQLHLFAEADALVPLAAAEALLEWLPDVEVSTLAASHGLPLEC
FT                   PDEVAGAILRFLREGDDA"
FT   CDS_pept        555006..555830
FT                   /transl_table=11
FT                   /locus_tag="PLES_04991"
FT                   /product="probable biotin synthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_04991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25226"
FT                   /protein_id="CAW25226.1"
FT                   /translation="MPDDSSPLLAPHGVAALPDKRQVAASFSRAAASYDAVAELQRGVG
FT                   ESLLSALPEGFSPRRWVDLGCGTGYFSRALERRFGAAEGLAVDIAEGMLRHARARGGAS
FT                   HFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCVGTL
FT                   GELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLTLRHEDRLLHFPDLRSLTHELK
FT                   ALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPEGLPATYRVVFGVLRKDS"
FT   CDS_pept        555834..556520
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="PLES_05001"
FT                   /product="dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25227"
FT                   /db_xref="GOA:B7V489"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V489"
FT                   /protein_id="CAW25227.1"
FT                   /translation="MPAFFVTGTDTEIGKTTIAAGLLHAARSAGLSTAAAKPVASGCEP
FT                   TAQGLRNGDALVLLGQCSLALAYEQVNPLAFAPAIAPHLAAREAGVELSAARLHEAVRE
FT                   VLALQADFTLVEGAGGWRVPLLGRENLSDLARLLALPVVLVVGVRLGCINHALLSAEAI
FT                   LGDGLALVGWVANVVDPATSRLEENLATLAERLPAPCLGRVPRLEEATPAAVAAHLDLR
FT                   PLGIGL"
FT   CDS_pept        556629..556859
FT                   /transl_table=11
FT                   /locus_tag="PLES_05011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25228"
FT                   /protein_id="CAW25228.1"
FT                   /translation="MEISGNAFVSGLNAVQSGSARVAQAGSEIARNTVEARSAQAEQMV
FT                   ELTRGKLEAQSGARVIEVADETLGTLIDTHA"
FT   CDS_pept        complement(556953..557129)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05021"
FT                   /product="hypothetical protein"
FT                   /note="orf00757"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25229"
FT                   /protein_id="CAW25229.1"
FT                   /translation="MRDRSRSPCRTHSCVPALKQAFETYVYANPLSSIRTDRSVMPEIT
FT                   GSHVLPKHFRLSQ"
FT   CDS_pept        557199..559004
FT                   /transl_table=11
FT                   /locus_tag="PLES_05031"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25230"
FT                   /protein_id="CAW25230.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGAEDATPDMVNAILEE
FT                   GAKFCEQVIAPLNRVGDLEGCTWSADGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGGQG
FT                   LPESLGLAISEMVGQANWSWGMYPGLSHGAMNTLHAHGTAEQQATYLTKLVSGEWTGTM
FT                   CLTEPHCGTDLGMLRTKAEPQADGSYKVTGTKIFISAGEHDMADNIVHIVLARLPDAPQ
FT                   GTKGISLFIVPKFLPNAEGNAGERNAVSCGSIEHKMGIHGNATCVMNFDAATGFLIGPP
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVGFQGGIAYARERLQMRSLTGPKAPEKPADPI
FT                   IVHPDVRRMLLTMKAFAEGNRAMLYFAAKQVDIVQRSQDEEQKKAADSMLAFLTPIAKA
FT                   FMTEVGFESANHGVQIFGGHGFIAEHGMEQNVRDSRISMLYEGTTGVQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQANEANEAVKEFVAPLAQLNKEWGDLTMKVGMAAMKDREEVG
FT                   AASVDYLMYSGYACLAYFWADMARLAAEKLAAGTGEEAFYKAKLQTARFYFQRILPRTR
FT                   AYVAAMLSGASNLMEMAEEDFALGY"
FT   CDS_pept        559217..561013
FT                   /transl_table=11
FT                   /locus_tag="PLES_05041"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25231"
FT                   /protein_id="CAW25231.1"
FT                   /translation="MPEYKAPLRDMRFLIDEVFDFHGRYQALGASDATPDMVAAILDEG
FT                   SKFCEQVLAPLNRSGDEEGCHFDNGVVTTPKGFKEAYAQYVEGGWNGVASDPAYGGQGL
FT                   PHSLGLLLSEMIGASNVSWGMYPGLTRGAMSAIHAHGSQAQKDLYLARMTAGTWTGTMC
FT                   LTEPHCGTDLGIIKTRAVPNADGSHAISGTKIFISAGEHDLSENIVHLVLAKLPDAPAG
FT                   TKGISLFIVPKFLPDAEGNVGARNAVSCGSIEHKMGIKASATCVMNFDGATGYLIGEPN
FT                   KGLHCMFTMMNHARLGTGMQGLCLGETSYQGAVRYARERLQMRSLTGPKAPDKPADPII
FT                   VHPDVRRMLLTMKAFNEGNRALAYFTAQLLDTEHLSQDAAERERAADLLAFLTPICKAF
FT                   MTETGQEVTNLGMQVYGGHGYIREWGMEQLVRDCRIAQIYEGTNGIQALDLLGRKVLGS
FT                   QGKLLRGFTKLVHQLCQAQAEHPQLKGQVAQLAALNAQWGELTQQVGLAAMKNADEVGA
FT                   ASVDYLMFSGYVTLAYFWLRIALVAREKLDAGSGEAAFYEAKLATADFYFSRLLPRTAA
FT                   HAAAIQAGAAGLMSLSAEQFSL"
FT   CDS_pept        561286..563064
FT                   /transl_table=11
FT                   /locus_tag="PLES_05051"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25232"
FT                   /protein_id="CAW25232.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFEVSRLWAQLPALAEVVDAETAAAILE
FT                   EAGKVTAGTIAPLNRPGDEEGCQWNAGAVSTPAGFPEAYRTYAEGGWVGVGGDPAYGGM
FT                   GMPKVISAQVEELVNSANLSFGLYPMLTAGACLALNAHASDELKDKYLPNMYAGIWAGS
FT                   MCLTEPHAGTDLGIIRTRAEPQADGSYKISGTKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKVLVNADGSLGEKNSLGCGSIEHKMGIKASATCVMNFDGATGWLVGE
FT                   VNKGLAAMFTMMNYERLGVGIQGLATGERSYQSAIEYARERIQSRAPTGPVAKDKAADP
FT                   IIVHPDVRRMLLTMKALNEGGRAFSSYVAMQLDTAKYSEDAVTRKRAEELVALLTPVAK
FT                   AFLTDMGLETTIHGQQIFGGHGFIREWGQEQLVRDCRITQIYEGTNGIQALDLVGRKVI
FT                   GSGGAFSRHFTDEIKAFVASADEALGEFSKPLAAAVENLEELTAWLLDRAKGNPNEIGA
FT                   ASVEYLHVFGYTAYAYMWALMARTALAKQGEDDFYASKLGTARFYFARLLPRIHSLSAS
FT                   VRAGSESLYLLDAEQF"
FT   CDS_pept        complement(563396..564877)
FT                   /transl_table=11
FT                   /gene="nirN"
FT                   /locus_tag="PLES_05061"
FT                   /product="probable c-type cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25233"
FT                   /protein_id="CAW25233.1"
FT                   /translation="MRLIGLALGLLLGALAQAGEAPGEALYRQHCQACHGAGRLGGSGP
FT                   TLLPESLSRLKPAQAREVILHGRPATQMAGFAGQLDDAAADALVAYLYQAPPREPQWTA
FT                   EDIRASQVQPHPLATLPSRPRFEADPLNLFVVVESGDHHVTILDGDRFEPIARFPSRYA
FT                   LHGGPKFSPDGRLVYFASRDGWVTLYDLYNLKVVAEVRAGLNTRNLAVSDDGRWVLVGN
FT                   YLPGNLVLLDARDLSLVQVIPAADAQGQASRVSAVYTAPPRHSFVVALKDVHELWELPY
FT                   ANGKPVAPKRLAVADYLDDFSFSPDYRYLLGSSRQARGGEVIELDSGARVASIPLSGMP
FT                   HLGSGIYWKRDGRWVFATPNISRGVISVIDLQNWKPLKEIVTDGPGFFMRSHADSPYAW
FT                   TDTFLGKKHDEILLIDKQTLEIAHRLRPSPGKVAGHVEFTRDGRYALLSVWDRDGALVV
FT                   YDAHSLEEVKRLPMNKPSGKYNVGNKIGYAEGTSH"
FT   CDS_pept        complement(564868..565707)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05071"
FT                   /product="probable uroporphyrin-III c-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25234"
FT                   /protein_id="CAW25234.1"
FT                   /translation="MNTTVIPPSLLDVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAE
FT                   VVVYDRLVARELIALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLKGG
FT                   DPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQ
FT                   NDGRLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQV
FT                   TRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHPSYLGAGSPVSREAVACA"
FT   CDS_pept        complement(565718..566881)
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="PLES_05081"
FT                   /product="heme d1 biosynthesis protein NirJ"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25235"
FT                   /protein_id="CAW25235.1"
FT                   /translation="MLRISHYLRSLAEDAPTPRRAGGRRAPVVIWNLLRRCNLTCKHCY
FT                   STSADSDFRGELETAEILRGIDDLRAAGVRVLILSGGEPLMHPDLFEIAAHARQAGMFV
FT                   ALSSNGTLIDEGNIQRVAEARFDYVGISLDGLRETHDRFRQKQGSFDAALAAMRLCREV
FT                   DIRVGMRTTLTEENAAQLPALLDLMRELDVQKFYLSHLNYSGRGRRSRALDAHHRRTRE
FT                   ALALLFERADEDIRQGRDSDFVTGNNDADAILLLDWLKRRRPQQLARLCELLLDWGGNA
FT                   SGEGIANIDNTGEVHPDSYWWHHSVGNIRHQRFADFWFERPDPLLLQLRQRPRPVVGRC
FT                   SQCRWLDICNGNTRTRAWAGGELWGEDPGCYLSDQEIGLERIALHAV"
FT   CDS_pept        complement(566875..567390)
FT                   /transl_table=11
FT                   /gene="nirH"
FT                   /locus_tag="PLES_05091"
FT                   /product="heme d1 biosynthesis protein NirH"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25236"
FT                   /protein_id="CAW25236.1"
FT                   /translation="MSACISPSDALLARRLIELTQAGLPLVADPWAWIAAQLRLSEAET
FT                   LALLKRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSHCY
FT                   RRPRHLPQWRYNLFAMVHGRSEAEIEGYRQQIRLLLGEDCRADEMLVSSRILKKTGLRL
FT                   AQKEERPC"
FT   CDS_pept        complement(567365..567808)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05101"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25237"
FT                   /protein_id="CAW25237.1"
FT                   /translation="MDEFDRRLLNRLQHGLPLESHPYALLAAELDCREEDILRRLDDLL
FT                   DDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEEIAALLAGWPQVAHNYRREHALNMW
FT                   LVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
FT   CDS_pept        complement(567801..568325)
FT                   /transl_table=11
FT                   /gene="nirL"
FT                   /locus_tag="PLES_05111"
FT                   /product="heme d1 biosynthesis protein NirL"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25238"
FT                   /protein_id="CAW25238.1"
FT                   /translation="MNPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEVL
FT                   EQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDAVGRALAHETIVSLCYR
FT                   RPRRLPMWPYNLFCMIHGRERGEVERQIEALLERHALRQTPHRWLFSLRAYKQCGGRYT
FT                   APPADLERRHG"
FT   CDS_pept        complement(568322..568774)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05121"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25239"
FT                   /protein_id="CAW25239.1"
FT                   /translation="MDDLSRRLLARYQKGLPICAEPYRRMAETLGCSEAEVLERLRRLE
FT                   ADGALSRVGPVLRHQRAGASTLAALAVPEERLQRVAERISQYAEVNHNYQREHRYNLWF
FT                   VLTAGDRAQLDRVLAEIAADTGLQPLDLPMQEAYCIDLAFPLEASR"
FT   CDS_pept        complement(568783..569961)
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="PLES_05131"
FT                   /product="heme d1 biosynthesis protein NirF"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25240"
FT                   /protein_id="CAW25240.1"
FT                   /translation="MNLRPLAPLFLALLAGCSQQPPLRGSGDLGVLIERADGSVQILDG
FT                   TAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTKLDLLAQRIDKRLIQGGNSI
FT                   GGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAPGQR
FT                   FVFSLFDSGEIWIADFSQGDTPHLTRFRDIGKQPYDALISPDGRYYMAGLFGEDGMAQL
FT                   DLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVLDARDW
FT                   KQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPGPGVLHM
FT                   EFSGRGDQVWISVRDADQLQVWDPYRLKRIGSLPARSPSGIFFSHRAQHIGL"
FT   CDS_pept        complement(569958..570317)
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="PLES_05141"
FT                   /product="probable c-type cytochrome precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25241"
FT                   /protein_id="CAW25241.1"
FT                   /translation="MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRH
FT                   LLLQDCGSCHGLRLTGGLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSEDD
FT                   AGWLVDRLIEGEIAP"
FT   CDS_pept        complement(570314..570628)
FT                   /transl_table=11
FT                   /gene="nirM"
FT                   /locus_tag="PLES_05151"
FT                   /product="cytochrome c-551 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25242"
FT                   /protein_id="CAW25242.1"
FT                   /translation="MKPYALLSLLATGTLLAQGAWAEDPEVLFKNKGCVACHAIDTKMV
FT                   GPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
FT                   "
FT   CDS_pept        complement(570679..572385)
FT                   /transl_table=11
FT                   /gene="nirS"
FT                   /locus_tag="PLES_05161"
FT                   /product="nitrite reductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25243"
FT                   /protein_id="CAW25243.1"
FT                   /translation="MPFGKPLVGTLLASLTLLGLATAHAKDDMKAAEQYQGAASAVDPA
FT                   HVVRTNGAPDMSESEFNEAKQIYFQRCAGCHGVLRKGATGKPLTPDITQQRGQQYLEAL
FT                   ITYGTPLGMPNWGSSGELSKEQITLMAKYIQHTPPQPPEWGMPEMRESWKVLVKPEDRP
FT                   KKQLNDLDLPNLFSVTLRDAGQIALVDGDSKKIVKVIDTGYAVHISRMSASGRYLLVIG
FT                   RDARIDMIDLWAKEPTKVAEIKIGIEARSVESSKFKGYEDRYTIAGAYWPPQFAIMDGE
FT                   TLEPKQIVSTRGMTVDTQTYHPEPRVAAIIASHEHPEFIVNVKETGKVLLVNYKDIDNL
FT                   TVTSIGAAPFLHDGGWDSSHRYFMTAANNSNKVAVIDSKDRRLSALVDVGKTPHPGRGA
FT                   NFVHPKYGPVWSTSHLGDGSISLIGTDPKNHPQYAWKKVAELQGQGGGSLFIKTHPKSS
FT                   HLYVDTTFNPDARISQSVAVFDLKNLDAKYQVLPIAEWADLGEGAKRVVQPEYNKRGDE
FT                   VWFSVWNGKNDSSALVVVDDKTLKLKAVVKDPRLITPTGKFNVYNTQHDVY"
FT   CDS_pept        572601..573383
FT                   /transl_table=11
FT                   /gene="nirQ"
FT                   /locus_tag="PLES_05171"
FT                   /product="regulatory protein NirQ"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25244"
FT                   /protein_id="CAW25244.1"
FT                   /translation="MRDATPFYEATGHEIEVFERAWRHGLPVLLKGPTGCGKTRFVQYM
FT                   ARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVEAR
FT                   QDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQRFVA
FT                   LRFDYPAAQQEARILVGESGCAETLAQRLVQLGQALRRLEQHDLEEVASTRLLIFAARL
FT                   IGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVA"
FT   CDS_pept        573418..573945
FT                   /transl_table=11
FT                   /locus_tag="PLES_05181"
FT                   /product="probable cytochrome c oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25245"
FT                   /protein_id="CAW25245.1"
FT                   /translation="MWFFILAELSVFSLLLLAFAGAQAWQPELFRAGREQLDSRWGLLL
FT                   TVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVYVGLKLHEYGRLADLGLDIE
FT                   HDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRCYTPQACSGMESGVLYWHMVDLV
FT                   WVLLFPLVYVLQ"
FT   CDS_pept        573953..574210
FT                   /transl_table=11
FT                   /locus_tag="PLES_05191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25246"
FT                   /protein_id="CAW25246.1"
FT                   /translation="MRTLTLCWLALLALAVTGVLLGGAGDSPWLLAAVLACAVAKGWLI
FT                   GERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
FT   CDS_pept        574300..574740
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="PLES_05201"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25247"
FT                   /protein_id="CAW25247.1"
FT                   /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAM
FT                   SAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
FT                   NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
FT   CDS_pept        574740..576137
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PLES_05211"
FT                   /product="nitric-oxide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25248"
FT                   /protein_id="CAW25248.1"
FT                   /translation="MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGD
FT                   FLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAA
FT                   GVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTML
FT                   RGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAIL
FT                   AFVLVKITGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEP
FT                   LPFFAMVLFAFNTINRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHG
FT                   TQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVF
FT                   ITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSF
FT                   RRGKAAA"
FT   CDS_pept        576139..577977
FT                   /transl_table=11
FT                   /locus_tag="PLES_05221"
FT                   /product="probable dinitrification protein NorD"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25249"
FT                   /protein_id="CAW25249.1"
FT                   /translation="MAFAVELEEWVGAHWHRFITRHASGEFEAARVTLESMRRPLGMLF
FT                   RALGGAPGVALEATPARRLLLRRTWLQRVAGTCEQAPVSWFNGDSLRLPESLAVYPQAE
FT                   LNRELYRWLALLAASAGPLRHWAQDNQRWARQLLDAYPALRPRYARLVAAHLRQRPSLD
FT                   DCPAADAELEIALRRALAEPGSVERFPRVERAPWPVPLWLYPGERWTPSASAEDGEEAA
FT                   AGAGKRQVARSGARKRAERVEERDSERNLLLFRLESLLSWSEHLALDRCSDDEDDPDGA
FT                   RVAEDLDYLSLSRQRTQKGGGLRLDLDLPAADYDDLPLGPGLKLPEWDYRQQRLLSDHV
FT                   LLQPMRPRGATSASLPAHLEKTALHLRRQFACLRDGRQRLRQQPQGDEIDLDAWLDFQV
FT                   ERRRGGSTQPGLFLEQRPRRRDLACLLLADLSMSTEAYLDDQRRVIDSIVDSLLLFGEA
FT                   LQALGDPFALYGFSSVRRQQVRWQVLKDFDEGYGGEVRGRVLALSPGYYTRMGAAIRRA
FT                   SQVLGGQPQKRRLLLLLSDGKPNDLDRYEGRYGIEDTRQAVIEARSQGLVPFCITIDKE
FT                   AADYLPYLFGADGFALVERAGQLPERLLQLYRRLRR"
FT   CDS_pept        complement(577984..578178)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25250"
FT                   /protein_id="CAW25250.1"
FT                   /translation="MRQCLYCLHETEGAESACEQCGMPLPSASQRQLQGRRQRRFAWFC
FT                   VGLALFCLGMMLWLPRDAP"
FT   CDS_pept        complement(578262..578945)
FT                   /transl_table=11
FT                   /gene="dnr"
FT                   /locus_tag="PLES_05241"
FT                   /product="transcriptional regulator Dnr"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25251"
FT                   /protein_id="CAW25251.1"
FT                   /translation="MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFR
FT                   QGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVV
FT                   PSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLT
FT                   LAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIRLDGREISILDRER
FT                   LECFE"
FT   misc_RNA        579149..579272
FT                   /gene="rsmY"
FT                   /locus_tag="PLES_05242"
FT                   /product="regulatory RNA RsmY"
FT   CDS_pept        complement(579299..580177)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05251"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25252"
FT                   /protein_id="CAW25252.1"
FT                   /translation="MDFRQLRYFVALYEEGHVGRAAERLALSQPALSQQIRQLEQNLDV
FT                   SLFQRSGKRLLPTVAAHTLYNHAVPLLEGLERAREAMRVFRGQTPRSLAIGVLQTVNAS
FT                   LVPYMVERLHAAQPHLRVQIYELSGIDIERRLLTGNLDIGIGFLPPRQPGLHSVELYED
FT                   ELQLVIPEEHPLKEFRKVSLAQAAELPMLLLGEEFRARQIWQEQLAAIGRRPRVQAELN
FT                   HMSGILDSLPQTRFATVLPGKARQMHSNQRLLWKPLSEPRIPLKVGLVYRDAQRQHASV
FT                   ELLRSLLEGVI"
FT   CDS_pept        580279..580980
FT                   /transl_table=11
FT                   /locus_tag="PLES_05261"
FT                   /product="putative sulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25253"
FT                   /protein_id="CAW25253.1"
FT                   /translation="MEQIVVNGVFIGKVEETWGGLVSAIDKLPVEQEFWLGHDGLPGDE
FT                   QADIRHHGGLERALHHYPAEHYRYWRKRHPLNRWQLPAFGENISTYGITEAEVCIGDQF
FT                   HWGDALLEVSQPRSPCYRQGQRWNLPELPDELQSGGRCGWFYRVLRSGMVTPGDELKLV
FT                   QRHYPELTVARLLQWYFGDPLEPLGLRQMMACDALSQRWRKTAAKRLSSGVVEDWGPRL
FT                   RGPSDYREHAS"
FT   CDS_pept        581206..582387
FT                   /transl_table=11
FT                   /locus_tag="PLES_05271"
FT                   /product="probable class III pyridoxal phosphate-dependent
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25254"
FT                   /protein_id="CAW25254.1"
FT                   /translation="MADALDSLRLMRTQERPEQVFVRGQGSWLWDSDGRAFLDFTQGLA
FT                   VNCLGHSPSVLVQALARQARELVSAGPGLLNRPVLALAQRLCLATGSDQAYFLTSGAEA
FT                   NEAAIALARKWGRLHRGGAQRIVSTVNSIHGRTPGTLTACGKPAQHGLEGFARVPFNDL
FT                   DAMAAAIDEETVAVMLEPVQGDAGVIPATLDYLRGIERLCRQRGVLLILDEVQTGIGRC
FT                   GALLAEELYGVRADIVTLGKGLGAGVPLSALLARGNACCFEPGDQLGTHHGNALMTAAG
FT                   LAVLNTVLEPGFLEQVREQGTHLRDGLARVARRYGHGPLRGQGLFWGLPLIGQRAPAVV
FT                   RAAFGEGLLINAPQPHCLRFSPALTVSRANVDEMLRRLERALARVANRHEEVA"
FT   CDS_pept        582387..583103
FT                   /transl_table=11
FT                   /locus_tag="PLES_05281"
FT                   /product="probable glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25255"
FT                   /protein_id="CAW25255.1"
FT                   /translation="MRALVLQHVPFEGSARIGDWIGRHCEHEHVCYLYADAHLPALDSF
FT                   DLLVVMGGPMSVHDEAQYPWLVAEKRLIRAALDAGKKVLGICLGAQLLAQALGAAVRPG
FT                   RQAEIGWWPLHRYSQALGSPLGERLPERLMAFHWHGETFDLPAGSVPLYGSAACANQGF
FT                   IWNEQAIGLQCHLESTAESIEALLDACPQDLQREGAVQSAGRIRQGVAHCREVAPVLFL
FT                   LLDYLAHRPAEIARRA"
FT   CDS_pept        complement(583178..583684)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25256"
FT                   /protein_id="CAW25256.1"
FT                   /translation="MPARPDRARVTIALAVLVHLHRETIAEAPLPWRYRKQCPGGKPRR
FT                   RAGREATPPLGPEVVDASTRLALHEKKAPSPCMSDAMSKNKHPDLGEIQRSLNQALEGY
FT                   DCQCRMHYDGTVSINVAAREHDETFTFVGIQPGELDNPTRLHLFAESLRRDLALLEPWL
FT                   GKHAA"
FT   CDS_pept        583727..585217
FT                   /transl_table=11
FT                   /locus_tag="PLES_05301"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25257"
FT                   /protein_id="CAW25257.1"
FT                   /translation="MNDQVLRTQTDRRQLQQIIAGLTEGVILIEPDQRILWANEAALAM
FT                   HGVDSLEGLGADTGEYRERFRLRYRNNHPLQEGQYPAERLVAGECFSDVVVEVFPAADE
FT                   DTRWVHRVRGLVLTTPEDKPDCLVLILHDATEWASAEQRFEKTFNANPAPAVICRLSDY
FT                   RYVKVNVGFLEMTGYARDQVIGRSVYELDVLDQAERRELAVERLGAGETIPQMEASLRV
FT                   AEGGRKCVVVAGQPIEVGEEACMLFTFTDLEPRKKAEEALRKSEERFAKAFRMAPVPSL
FT                   VLYGDDLQALDINQAFSETFGYQAEELLGESTVACGLWQDGGAERLGELLAQSGSVRNV
FT                   QLRLQHKDRNGLDCLVSAEAVSLNEQDCVLVALLDISDRRRTEMELVHAIETVMQDASW
FT                   FSRTLIEKLANVRRANAPGTGAELADLTAREREVFDLICQGLADKEIAKELGLAPNTVR
FT                   NHVATIYAKLDVHSRGEAIVWARERGFAPEPRNGNGRK"
FT   CDS_pept        585250..585498
FT                   /transl_table=11
FT                   /locus_tag="PLES_05311"
FT                   /product="hypothetical protein"
FT                   /note="orf00799"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25258"
FT                   /protein_id="CAW25258.1"
FT                   /translation="MHSYLSPAPVGADTGAARPACPRPWSCTFSPRREPRCPHVCSPRQ
FT                   FRSGGGLPASFRIFAPLPLLVRDGILPAVCECSGLVS"
FT   CDS_pept        585555..586844
FT                   /transl_table=11
FT                   /locus_tag="PLES_05321"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25259"
FT                   /protein_id="CAW25259.1"
FT                   /translation="MFLQSNEHVGTYYAAVNPELIQPRQALEGDLDCEVLVVGAGFSGL
FT                   HTALRLVEGGRQVCVIEASRIAWAASGRNGGQALPGWSSDLPPLEADLGYEGARRLWDG
FT                   MLWAAGEMRELPQRHGFDCDYRVGHLWTAILPRRVGLLYDWQAEANRRWGYEGLRFVAK
FT                   DELPEWIASERYLAGLYDPHAAHLNPLKLAFGLAAAIERAGGRIHERTRALNYREEGDG
FT                   YRVRTEHGEIRCAALVLACNAYIDGLDSELSQRMLPVGTYQVATEPLGEERAKSLLPRN
FT                   CCVTDNQFVLDYFRLTPDHRLLFGGGCTYLGGMPSDIRAATRPYLERVFPQLRGVALEY
FT                   AWGGHIDCSMRRTPDIGRQGNRYWLQGYSGHGVLPSLAAARAVSDALLGDDETLALYQR
FT                   LRNPKFPGGQRFAAPLEALGKAYYRLRDLF"
FT   CDS_pept        586862..587416
FT                   /transl_table=11
FT                   /locus_tag="PLES_05331"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25260"
FT                   /protein_id="CAW25260.1"
FT                   /translation="MSEVADDLAEIASLVRELRKRKGITLQALADGIRRSVGFVSQVER
FT                   GLSRPAVDDLVAISQVLGVPATYFFCSPKIQASPWVTRPGERRTLAYARGASDNLVSPR
FT                   LGGAFFMLETCLEAGADSGERDLLDSSEQGGYVLEGELTLWLEDEELRLQAGDGFQIPS
FT                   HMRSRYANRSQAPVRVLWVYA"
FT   CDS_pept        complement(587527..588552)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05341"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25261"
FT                   /protein_id="CAW25261.1"
FT                   /translation="MRRLLLGAGLLLASLVAWADVPPIPALTARVTDLTATLSGDQRQH
FT                   LEQQLAALEAKSGAQLAVLLVPTTGDDSIEEYAVRTFEKWKLGQKKVDDGVLLLVAKND
FT                   RTLRIEVGYGLEGAITDVQAGRIISEQITPQFRQGNFYGGIQAGVDSLVQLIDAEKNPD
FT                   SATASAPVDALPAVPEATPPRALPAPVDEGEVYDSAPPEPKKKSGLSGQLWGNPVYLGV
FT                   YVAVLLAVALLGRLLPLQWMRRRSIGRFLLCSAAVAGLAWLLSMGLWQNVDRAADDSLG
FT                   VLAPTLFIYALFLLPGEVLMAILSAILNSRGGGGGGGSGGGSIFRGGGGSSGGGGASGR
FT                   W"
FT   CDS_pept        complement(588556..589164)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05351"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25262"
FT                   /protein_id="CAW25262.1"
FT                   /translation="MPRFLRNALLPVLALLLSGCGYNAMQAGDEQVKAAWSEVLNQYQR
FT                   RADLVPNLVSTVKGYASHEASVLTQVTEARAKVGSVQLNADQLDDEQAVQRFQKAQGEL
FT                   SSALSRLLVVTENYPQLKADGLFKDLLTQLEGTENRIAVARGRYVKSVQEYNVLLRQFP
FT                   GVITAKLFGYKPKANFSVENEAAISTAPKVDFGNPQPAQ"
FT   CDS_pept        complement(589252..589761)
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="PLES_05361"
FT                   /product="disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25263"
FT                   /protein_id="CAW25263.1"
FT                   /translation="MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIF
FT                   IRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGS
FT                   CKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLA
FT                   FGRRTA"
FT   CDS_pept        589990..590820
FT                   /transl_table=11
FT                   /locus_tag="PLES_05371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25264"
FT                   /protein_id="CAW25264.1"
FT                   /translation="MLATSLVLCAAVLHATWNTLVKFSSDRLLVVACMDVVGVLCAILL
FT                   LPFVSLPPAEVWPWLLGATVLQLLYRVLLIEAYKVGDLGLVYPLMRGLSPLVVLGLTLA
FT                   FGGEQLSGRQILGILLIPFGMLCLLWGGGGSRLPWRTLPVVLLIGLCIGGYTWSDGNAL
FT                   KRWPLALDYLVWLTLLSGLPFPLIAVGARTRAFARFWALEWKLGLAVGVCVLASYGLVL
FT                   WAMQLGSIAEAAALRETSVLLAVLFGMRFLNEPFGLPRLLACGLVLAGMLLMKL"
FT   CDS_pept        590890..591276
FT                   /transl_table=11
FT                   /locus_tag="PLES_05381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25265"
FT                   /protein_id="CAW25265.1"
FT                   /translation="MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGGRANADPRAFLGSLE
FT                   GFRRRANNAQLNAFEVTPAFAAAVIIAHLVGNASQATLDSLAIAWITSRLLYVICYLAD
FT                   WGPLRSLVWFVGMLLIAAFFVVSA"
FT   CDS_pept        591389..591847
FT                   /transl_table=11
FT                   /locus_tag="PLES_05391"
FT                   /product="putative cytochrome c'"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25266"
FT                   /protein_id="CAW25266.1"
FT                   /translation="MKLKSLLVVLLAGVALSGCHRMDPNSPEAKRQAIFKEMLRTSEDM
FT                   GGMLRGRLPFDAEKFRAGSAKLHQLADQPWQYFPSPKAGEEGEDTRAKDEVWQRQQEFK
FT                   AATQVFIDAMNRLQDNTRQATPTPDGVRKDFAAVEDACEACHKKFRAL"
FT   CDS_pept        complement(592039..592458)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05401"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25267"
FT                   /protein_id="CAW25267.1"
FT                   /translation="MSIRPSLPLAGLLLAVSLPLSAAQPGTTKGAPLSGCAAKQAAIEA
FT                   KLETARSFANEGQVAGLEKALSEVKEHCTEAGLLRENKQKVIDSEREVSEREKDLRKAM
FT                   GKGDPEKIEKRKAKLAEARAELEEAKKGLEQAQAQ"
FT   CDS_pept        592708..593676
FT                   /transl_table=11
FT                   /locus_tag="PLES_05411"
FT                   /product="putative depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25268"
FT                   /protein_id="CAW25268.1"
FT                   /translation="MRTLIRLVRTLILLLVLALLAGAWWWLQDEALRPPALVGHSEDSS
FT                   LKVAGLRRHYLLYVPPGVSEGAPLLVVLHGSRGDGAQMRRISGYGFDRLAAQEGFLVAY
FT                   PDGFEGHWNDCRKAASYSARLRDVDDVAFLRALVARLAQEYRVDSQRVYVAGYSNGGQM
FT                   AFRLAAEAPGLPAAIAAVAASLPTTGNDACRPVERPTAALLINGTRDPINPYLGGKVSL
FT                   FGFGDRGAVRSTLDSARWWAGLNGIAAPPDVAPLTRPGPVWTERQRWQEDGHPPVELLS
FT                   VHGGGHVLAQPDYRFPRILGKSDPELDAPVEIWRFFSQLPR"
FT   CDS_pept        complement(593680..594423)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25269"
FT                   /protein_id="CAW25269.1"
FT                   /translation="MKIRLLSDLHHEHFDGRRQLPEVEADVVVLAGDIHSHLEGLHWAR
FT                   ETFADSEIVYVAGNHEFYSSEMTDLTQAMRNIARALEIHFLENDEARIGPARFLGAPLW
FT                   TDFQLYGADGYAPAHELALQSMPDFSCIDWFGGDFTPEQSIALHQASRDWLAGQLARPH
FT                   DGPTLVVSHHAPSALSIPPQFVGNPLSPAFASNLDELVAQADYWLHGHVHDALDYRIGR
FT                   ARVLANPGGYPHERGGFRPEFVFEV"
FT   CDS_pept        594628..595932
FT                   /transl_table=11
FT                   /locus_tag="PLES_05431"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25270"
FT                   /protein_id="CAW25270.1"
FT                   /translation="MKLLWGVLAAALAAWGLTLAVDPPASLDIWVVRKQAILLTGVASF
FT                   ALMSLIMLLAVRPVWLEKPLDGLDRMYRLHKWAGILAIVLGLLHYLLELAGPWLAGIVG
FT                   KPVKGPRVETFLDVFRGSAKELGEWSAWILGGMLLITLWQRFPYHLWRYVHKALALVYL
FT                   VLAFHSVVLAPASYWSQPAGWLVAACALLGSACALLSLSGRIGRTRRHAGVVTAVERHG
FT                   ESLLEVTCRLQGDWSHRAGQFAFLTCDRLEGAHPFTIASADRGCGEVRFSIKALGDYTR
FT                   RLQDNLEVGARVEVEGPYGCFDFRRGLAGRQVWVAAGIGVTPFIAWLESLQAAPESAPS
FT                   VELHYCVRNSQEALFAGRLRELCEHLPSVTLHIRYSDEQGKPQAAQLGVLKSAEGRWPS
FT                   VWFCGPQGLADSLRRDLRRQGMPLRLFHQEAFRMR"
FT   CDS_pept        complement(595988..597178)
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="PLES_05441"
FT                   /product="methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25271"
FT                   /db_xref="GOA:B7V4D3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4D3"
FT                   /protein_id="CAW25271.1"
FT                   /translation="MSEYSVFTSESVSEGHPDKIADQISDAVLDAIIAKDKYARVACET
FT                   LVKTGVAIIAGEVTTSAWVDLEELVRKVIIDIGYDSSDVGFDGATCGVLNIIGKQSVDI
FT                   NQGVDRAKPEDQGAGDQGLMFGYASNETDVLMPAPICFSHRLVERQAEARKSGLLPWLR
FT                   PDAKSQVTCRYEGGKVVGIDAVVLSTQHNPEVSYNDLRDGVMELIIKQVLPAELLHKDT
FT                   QFHINPTGNFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAQPTSISINTFGTGKVSDEKIVQLVREHFDLRPY
FT                   AITKMLDLLHPMYQPTAAYGHFGRHPFELTVDGDTFTAFTWEKTDKAALLRDAAGL"
FT   CDS_pept        complement(597194..598195)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05451"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25272"
FT                   /protein_id="CAW25272.1"
FT                   /translation="MSLRVPSIRPDDYDPLAALCKAAGDSLRLNVLRALANDSFGVLEL
FT                   AQIFAIGQSGMSHHLKVLAQAGLVATRREGNAIFYRRSLPLAERTGGALHAALLEEVDE
FT                   RALPDDVRARIDAVHAQRAAVSQDFFARAADKFQAQQDLIAGLPQYRESVLALLDALAF
FT                   APGATALEVGPGDGGFLPELARRFRQVTALDNSAAMLELARQRCKEEGLGNVRLELADA
FT                   LQDAAEPADCVVLNMVLHHFAAPAEALKQLARLVHPGGSLLVTDLCRHNQGWAREACGD
FT                   LWLGFEQEDLAQWADAAGLTPGESLYIGLRNGFQIQVRHFARDASESRLTHR"
FT   CDS_pept        598442..600439
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="PLES_05461"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25273"
FT                   /protein_id="CAW25273.1"
FT                   /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYM
FT                   QHNPSNPQWANRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKNFRQLNSRTPGHPEYG
FT                   YTAGVETTTGPLGQGIANAVGMALAEKVLAAQFNRDGHAVVDHYTYAFLGDGCMMEGIS
FT                   HEVASLAGTLRLNKLIAFYDDNGISIDGEVHGWFTDDTPKRFEAYGWQVIRNVDGHDAD
FT                   EIKTAIDTARKSDQPTLICCKTVIGFGSPNKQGKEECHGAPLGADEIAATRAALGWEHA
FT                   PFEIPAQIYAEWDAKESGAAQEAEWNKRFAAYQAAHPELAAELLRRLKGELPADFAEKA
FT                   AAYVADVANKGETIASRKASQNALNAFGPLLPELLGGSADLAGSNLTLWKGCKGVSADD
FT                   AAGNYVFYGVREFGMSAIMNGVALHGGFIPYGATFLIFMEYARNAVRMSALMKQRVLYV
FT                   FTHDSIGLGEDGPTHQPIEQLASLRLTPNLDTWRPADAVESAVAWKHAIERADGPSALI
FT                   FSRQNLPHQARDVAQVADIARGGYVLKDCEGEPELILIATGSEVGLAVQAYDKLSEQGR
FT                   KVRVVSMPCTSVYEQQDESYKQSVLPVEVGARIAIEAAHADYWYKYVGLDGRIIGMTSF
FT                   GESAPAPALFEHFGFTLDNVLAVAEELLED"
FT   CDS_pept        600439..601503
FT                   /transl_table=11
FT                   /locus_tag="PLES_05471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25274"
FT                   /protein_id="CAW25274.1"
FT                   /translation="MHTLYWRDLESPANGEWLGLAVQVEGAHRAPSFLHLQSGGQARIR
FT                   LMRGDQPLLWATQLPYHDGIWLVKSLVAASPAQASVPPIDSPTLEALRGLRGEARYKAW
FT                   SRYFVETLRTSPGSCLEAGRWLLRLSLAEQVPAWQPPQSHDPRERVLERWRYRSVGRDA
FT                   LLPDWRFYSLEKVLDDDWVQWLDWWGRDNDALIALRRVEDDEGRVKWWRKKAREGELPP
FT                   VLALRLNCLDACVILDGHCRLRAGLLENVAPEILVLCAYDEQPMPVDTAQRERVLQSLA
FT                   QRVDAPVRRGRRPLDSEQLNQVLLRLFDDRPWPRVLTRARAVLKEEQWCAEVRDWLAAR
FT                   ERLDALEPIIRRVE"
FT   CDS_pept        complement(601484..602281)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05481"
FT                   /product="putative hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25275"
FT                   /protein_id="CAW25275.1"
FT                   /translation="MPRFAANLSMLYPRYDFLERFAAAAADGFEGVEYLFPYAYPAAEL
FT                   KARLDDHGLRQVLFNAAPGDWDKGERGLASLPGREAEFRRAIAQAIDYAQVLGNRHIHV
FT                   MAGLLPAGADRIRHRETYLDNLAHAAREAAGARLTVLIEPINNRDMPGFFLTRQDDAQA
FT                   ICREVGADNLQVQFDCYHCQIVEGDLATTLRRDIGNIGHVQIAGVPDRHEPDDDNEVNY
FT                   PYLFELLDRLGYQGWIGCEYRPRGDTSAGLEWLRRWRATRRDG"
FT   CDS_pept        602496..603557
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="PLES_05491"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25276"
FT                   /protein_id="CAW25276.1"
FT                   /translation="MSTPPFRVALNGYGRIGRCVLRALHERPEQLGFEIVALNDLADQA
FT                   SVEYLTRFDSTHGRFPGEVKVDGDCLHINGDCVKVLRSPTPEAIDWQALRVDLVLECSG
FT                   QYTNRAQAERFLRAGAPRVLFSQPMASEADIDATIVYGVNQQDLSGRETLVSNASCTTN
FT                   CGVPLLKLLNEAIGLEYVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGLA
FT                   RGIERLLPELAGRIQAKAIRVPTVNVSALDITLQTSRDTSAAEINRVLREAAESGPLRG
FT                   LLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLAWFDNEWGFANRMLDVAGHY
FT                   LRAAVPDQQVPKD"
FT   CDS_pept        603563..604726
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PLES_05501"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25277"
FT                   /db_xref="GOA:B7V4D9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4D9"
FT                   /protein_id="CAW25277.1"
FT                   /translation="MTVLKMTDLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLK
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVAEYLSKALGREVPLLADYLDGVEVKAG
FT                   DLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVARFAKVAAA
FT                   GPLLAAELDALGKALDNPARPMAAIVAGSKVSTKLDVLNSLAGICDQLIVGGGIANTFL
FT                   AAAGHKVGKSLYEADLVETAKAIAAKVKVPLPVDVVVAKEFAESAVATVKAIAEVADDD
FT                   MILDIGPQTAAQFAELLKTSKTILWNGPVGVFEFDQFGEGTRTLANAIADSAAFSIAGG
FT                   GDTLAAIDKYGIAERISYISTGGGAFLEFVEGKVLPAVEILEQRAKG"
FT   CDS_pept        604799..604999
FT                   /transl_table=11
FT                   /locus_tag="PLES_05511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25278"
FT                   /protein_id="CAW25278.1"
FT                   /translation="MRSVTLPLLMFCLGLAACSGDGGRRPSTCEVISPPDVMVPTEQNR
FT                   QRVEQQSSGDPTAGQKPVECP"
FT   CDS_pept        605159..605500
FT                   /transl_table=11
FT                   /locus_tag="PLES_05521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25279"
FT                   /protein_id="CAW25279.1"
FT                   /translation="MNYSRIALFGGFAAAALLAGCSASSGKPGGKDWTRWTCDSKAVIE
FT                   WRYIDGSKNIVDLRLKDEDDVVHHLEQEPAAVGAFYSDGRLGFHLENDEGLVYWVETDD
FT                   LIGRGCKAR"
FT   CDS_pept        605620..606684
FT                   /transl_table=11
FT                   /gene="fda"
FT                   /locus_tag="PLES_05531"
FT                   /product="fructose-1,6-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25280"
FT                   /protein_id="CAW25280.1"
FT                   /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMM
FT                   DGSLREDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAE
FT                   GVLDHSQLLTDPEEAADFVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHA
FT                   RIPDTHLVMHGSSSVPQDWLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLR
FT                   LASTGAIRRFLAQNPSEFDPRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGM
FT                   FQRYARGELDPKVN"
FT   CDS_pept        606750..607232
FT                   /transl_table=11
FT                   /locus_tag="PLES_05541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25281"
FT                   /protein_id="CAW25281.1"
FT                   /translation="MRRWLLTLPFLLLAGCAGLHAPSRDVEEAASPSVARDPADPQDCL
FT                   ARSDCTTKTSRTLLFVFDYAEAGGELVVRDGRQLETPPAPQRSTWPALRIQLAEPVNGR
FT                   FEFESPCLRKSGKGCRYSQATLLKVYRSYLVGKPCSLLSPRAVKRCVDPAATAARR"
FT   CDS_pept        complement(607234..607890)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05551"
FT                   /product="putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25282"
FT                   /protein_id="CAW25282.1"
FT                   /translation="MRDLLGGRESPRYSTAVFPRIPDERFKALRGVARSHWSGASWTSR
FT                   GRGYCRSEGPPDDQGKSIPAHAGVPRHNQESAMSSEVSAIRQLIEDWRAAVRASDVPRI
FT                   VSYYAEDIVAFDAILQLQFKGRDAYQKHWQACTEMCKGPMTFDIAELQIHADPQVAFAH
FT                   YLCHCGGTGPDGQPHSSWMRVSAGYRKHGDGWKVIHEHFSAPFDMDGKALFDLQP"
FT   CDS_pept        607889..608656
FT                   /transl_table=11
FT                   /locus_tag="PLES_05561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25283"
FT                   /protein_id="CAW25283.1"
FT                   /translation="MSSVHSAAQQGFSAEAQRYAQGRPEYPEALSDWLRDALGLRPQTV
FT                   AVDLGAGTGKFTRLLARTGARVVAVEPVDAMRAQLAEALPQVQALAGSAQSIPLANGFA
FT                   DALVCAQAFHWFATVEALEEMRRVLTAEGRLGLVWNVRDESLDWVAEITRIITPYEGDA
FT                   PRFYKGDWRRPFERAPFGPLRLSTFAYEHVGPPEQVIVSRFLSVSFIAALPETEKNAVA
FT                   AQLRELVASHPALKGREQVALPYRTEAYLAEAR"
FT   CDS_pept        complement(608653..609831)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05571"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25284"
FT                   /protein_id="CAW25284.1"
FT                   /translation="MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILMS
FT                   GGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLFCD
FT                   NKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYHLRTSAGEMRCESLVIASGGLS
FT                   IPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSCNGQV
FT                   FRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNSELKTL
FT                   LAELFTKKLAGLLADRWFVSKPMKQYTPTELAGIAGQLSAWRVTPSGTEGYRTAEVTLG
FT                   GVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA"
FT   CDS_pept        609944..610432
FT                   /transl_table=11
FT                   /locus_tag="PLES_05581"
FT                   /product="putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25285"
FT                   /protein_id="CAW25285.1"
FT                   /translation="MIPLKYLQAYPASLQDQVRQLIAENRLGEYLERRYPGRHDVQSDK
FT                   ALYAYTMNLKQEHLRNAPGLDKVLYDNKLDVVQRALGLHTAISRVQGGKLKAKKEIRVA
FT                   SLFKDAAPEFLRMIVVHELAHLKESEHNKAFYQLCQYMLPDYHQLEFDLRVYLTWKSL"
FT   CDS_pept        complement(610440..611135)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05591"
FT                   /product="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25286"
FT                   /protein_id="CAW25286.1"
FT                   /translation="MPHPIDALISDCDGVLVDSEVIAERVMYEALSAYAPLEELQRLLE
FT                   GTFGLTSRDILDRVEKHFGLRIPDSFNREVRQRSEEMVAQVQPIPGAREALLALDLPVA
FT                   VASNSRRHSLERSLARAGLSELIGERLASADMVALPKPAPDVYLHAASLLGVAPERCLV
FT                   VEDSSTGTRAALAAGMRVIGFVGAGHIPAGHAEVLRELGAIAIVEHMRELPETVARLRR
FT                   ESRVALGTP"
FT   CDS_pept        complement(611264..611617)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25287"
FT                   /protein_id="CAW25287.1"
FT                   /translation="MEWFLKCVKEHYFDFNGRARRKEYWMFTLVNIIISVALSVVLGLI
FT                   SEKLLPIANLYSLAVLLPALGVTARRLHDINKSGWWMLIALIPIVGLYLIYLLAKDSDA
FT                   GQNQYGQNPKGIA"
FT   CDS_pept        complement(611795..612706)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05611"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25288"
FT                   /protein_id="CAW25288.1"
FT                   /translation="MDPLDRLIQLANLQGRLDQRCQLQGSWALEHPQAVPGEATFHIVM
FT                   AGTCYCEFLDGGRLDLHPGDLILLPRGTPHLLRSDSPAQPCEPTVEHRGSIPLYQLNGP
FT                   GEALDMLCGSYRYHAGASLFGALPERLLVHMDESTQQPLRALIGLMREEAESTRSGARS
FT                   IIDALATALFALALRAYLDRQPLGDGLFGLLGDARLGRALRAMLERPEHAWTLEQLAQQ
FT                   AAMSRASFVRAFSALGGTSPWNLLTRIRMEKARGLLRQTQKSLLDIAAETGYQSEAAFS
FT                   RNFRQAFGESPGRFRRQADPAR"
FT   CDS_pept        612824..613162
FT                   /transl_table=11
FT                   /locus_tag="PLES_05621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25289"
FT                   /protein_id="CAW25289.1"
FT                   /translation="MLNNWTEFVPAVKKAFGALGKQHPKMLAAYGALEEASAEGALDAK
FT                   TRELISIAVAITTRCDGCIGVHTEAALKAGASEAEIAQTLATAISLNAGAAYVYSLRAL
FT                   EAYDQFKK"
FT   CDS_pept        complement(613152..613667)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25290"
FT                   /protein_id="CAW25290.1"
FT                   /translation="MSDLPPRPAFWPYLPGYALLLLSVLLCASGSYRFVTPMALADGVD
FT                   LVYLSQGLALLPLGTGLVGLLAAFLLHVRGRWLGALLALLPAALICAWNLYNYAAHGDE
FT                   ALSPSFAQYTQALLGLLLLGGVLSLVDLLHGRPSTLLRKGLLGLGWLALVAWLGLLFYL
FT                   QRLYGLTF"
FT   CDS_pept        613855..614013
FT                   /transl_table=11
FT                   /locus_tag="PLES_05641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25291"
FT                   /protein_id="CAW25291.1"
FT                   /translation="MDLIRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHA
FT                   VYIIAKR"
FT   CDS_pept        complement(614023..614481)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25292"
FT                   /protein_id="CAW25292.1"
FT                   /translation="MELIRNLDDANMGEVYWRLYRRYISLFIENEADDAYAWRCARALD
FT                   ELDDAVVERLCAASLRYRAARLERLGESAEEVAPARGVLERIEPGELIVPDPEQGDEAV
FT                   IHLSLNCEWDREHGMEWIVRGGEVLYVGPFHGEDPWRDFTVKEPWNYA"
FT   CDS_pept        complement(614497..614967)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25293"
FT                   /protein_id="CAW25293.1"
FT                   /translation="MIPFGLSPEQFRERYRRDLQRAAPGVIQRLRELLRQPLEEGLRDG
FT                   EIQLFLGEDGRDAAEAWLYLNGASNRVDASDPRLFPGKALDLALGLGHAPDFDEAYFAD
FT                   GFGGVDLLADTLQAWFAECWWKAGGWAWPIPLWLHVHDGFGDGRGIALTERC"
FT   CDS_pept        complement(614981..615328)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25294"
FT                   /protein_id="CAW25294.1"
FT                   /translation="MKPELDALEAWLGRPLPAAFVAALEQHGGRLVEPGLLLYAADELL
FT                   ERNRAFETSLYCPGYLAIGDDSGGRAVVMALDDHRQALFLVDHGAMTPDCFEPLAPSLE
FT                   AWLEAGPCLPE"
FT   CDS_pept        complement(615318..615932)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25295"
FT                   /protein_id="CAW25295.1"
FT                   /translation="MTDRLPCRACGHLILPTTAARNDGLCIPCKGGYQQNIEDGKRFHT
FT                   ERRRYLASPQALYWSALVNRVYDGREGFAGLSPAERSYYAVSVLSGEVHNGGFDQYFGN
FT                   SSGDQYQAARAGLRELEAKDALALLERAAALLFGDGPVPVSQAERQLRMPTWADEPDRD
FT                   CEAALDALDTRFYALADALGERLLAHARHHALFALDEPDEA"
FT   CDS_pept        complement(616123..618894)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25296"
FT                   /protein_id="CAW25296.1"
FT                   /translation="MSLSTTAFPSLQGENMSRSPIPRHRALLAGFCLAGALSAQAATQE
FT                   EILDAALVSGDSSQLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMW
FT                   VLPANPDNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLTQLSGTNAAHAPLLKRAVQ
FT                   WLVNGDPGAATAKDFKVSVVGVDKTAALNGLKSAGLQPADAACNALTDASCASTSKLLV
FT                   LGNGASAASLSATVRARLQAGLPILFVHTNGWNQSSTGQQILAGLGLQEGPYGGNYWDK
FT                   DRVPSSRTRTRSVELGGAYGQDPALVQQIVDGSWRTDYDWSKCTSYVGRTTCDDVPGLS
FT                   DFSKRVDVLKGALDAYNQKAQNLFALPGTTSLRLWLLWADAVRQNIRYPMDKAADTARF
FT                   QETFVADAIVGYVREAGAAQKELGSYAGQRQQSMPVSGSEETLTLTLPSAQGFTAIGRM
FT                   AAPGKRLSIRIEDAGQASLAVGLNTQRIGSTRLWNTRQYDRPRFLKSPDIKLQANQSVA
FT                   LVSPYGGLLQLVYSGATPGQTVTVKVTGAASQPFLDIQPGEDSSQAIADFIQALDADKA
FT                   DWLEIRSGSVEVHAKVEKVRGSIDKDYGGDVQRFIRELNEVFIDDAYTLAGFAIPNQAK
FT                   TPAIQQECAARGWDCDSETLHKLPGTQHINVDQYAQCGGGCSGNPYDQTWGLNPRGWGE
FT                   SHELGHNLQVNRLKVYGGRSGEISNQIFPLHKDWRVLREFGQNLDDTRVNYRNAYNLIV
FT                   AGRAEADPLAGVYKRLWEDPGTYALNGERMAFYTQWVHYWADLKNDPLQGWDIWTLLYL
FT                   HQRQVDKSDWDANKAALGYGTYAQRPGNSGDASSTDGNDNLLLGLSWLTQRDQRPTFAL
FT                   WGIRTSAAAQAQVAAYGFAEQPAFFYANNRTNEYSTVKLLDMSQGSPAWPFP"
FT   CDS_pept        complement(619428..619799)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25297"
FT                   /protein_id="CAW25297.1"
FT                   /translation="MDYSPIVAQVWGMLTWFIPAALLIGLLKSPWAKGQIGELLVRLFA
FT                   HWQLDRHTYRRLHNVTLNTPDGTTQIDHVFLSPYGIFVLETAGFQHLPIGLYRCTGEPC
FT                   CRSQASVSIATHCAINRRV"
FT   CDS_pept        complement(619892..621013)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25298"
FT                   /protein_id="CAW25298.1"
FT                   /translation="MNDPLWIWQQPDWPQFNWQAEALAPLLRSCSQAQGRLLGMLGAVE
FT                   SDTEVQSSLDAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLHEEGRTTSRSEGLAELL
FT                   LDATHAQQEPLDEQRLFTWHRWLFPTDEQLLTRPLHIGALRGEEPMQVVSGRIDRPTVH
FT                   FEAPPRAGLEAQLADFLAWFESSRRDASLDPFLRAGIAHFWFVTLHPFDDGNGRLTRAI
FT                   TDLALAQGEQQAIRFYAMSASILDDRAGYYRILEASQKGGLDITKWLQWFLETLLKSLE
FT                   QALARIDRVLVKARFWQAHRSQTLSAEQIKVLNRLLDGGERGFEEGISAAQYQAVAKVS
FT                   KATATRHLSDLLEKGCIERLPGRGRSTRYQIAR"
FT   tRNA            complement(621563..621639)
FT                   /locus_tag="PLES_05712"
FT                   /product="tRNA-Met"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:621603..621605,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 81.87"
FT   CDS_pept        complement(621656..625393)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25299"
FT                   /protein_id="CAW25299.1"
FT                   /translation="MQRLQAVLLLCLACCWPGLAGALTLTPEERAWLAEHPSIRLGVDT
FT                   SWPPFEFRDEQGRYQGLAAGYVGLLQERLGVSLTPVEPKTWTQVLEQAKDGRLDLLPGI
FT                   MATPERQEYLSFTRPYLDFPIIILARKNGPMPKRIDELYGLKVAVVDHYAPHELLIAQH
FT                   PDLTLLPLPSVAAALQALATGQADAFVGDFASSVWNLRQLKLNGLEISGETPYRYQLAM
FT                   AVPRGQPILAGIVDKVLADLSAEEIERLQAPWVGGLLDRRPAWREMATYGLPIVLLILV
FT                   SVAILLAMNRRLRREVNRRRQLERELRDSEQHYRGLVESLNAIAWEMRLEENRFTYVSP
FT                   HAERLLGYPLGEWLQPGFWQRTLHPMDAEYAIHYCMSESQAGRDHSFDYRMLAADGRVV
FT                   WIRDLVTPITQGRDLLLRGLMIDITEAKLTEQAMRLSEQKFASVFHHCPDMVVLANGAD
FT                   GRFLAVNSTFEQQIGIAADDAIGKTATELGIWALPGLGPQVLEKLGHGNLTNLEVPLRR
FT                   RNGSTFSALLSAQHVALDQTPALVVVIRDITHLVETQELLRISEEKFANAFHAYPDGLL
FT                   ISRLEDGTLIDVNEGFTRLTGYRRDEVISRSTLELGLWVDTEDRKRLISLVRHHTLTQG
FT                   FTAPVRDRNGGIRQCEMSAHRISIDGEDCVLTIARDITERQLMQEKLQQAATVFESTAE
FT                   GVMITDTRQRITAVNRAFSEITGYSEQEALGRSPSLLSSGQHDSSFYLAMWNQLERDGH
FT                   WQGEIWNRRKTGELYPEWLTISAVHNPQGEITHFVGVFADISTLKYAQARLDYQAHHDP
FT                   LTGLPNRLLFESRLNHALDEAREESRPGAVLFIDLDRFKHINDSLGHPIGDLLLKAIAE
FT                   RLRDQLRDVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNAFTAPFQADGHEFFVSA
FT                   SVGIALFPKDGDDAPTLVKNADAAMYRAKSRGRSRIEYYTRELTYLATERMALETELRR
FT                   ALERDELQLYYQPKLSLESGLLVGAEALVRWYHPLFGEISPERFIPLAEDCGLILPLGD
FT                   WVLEHACQQMGEWQKLHAPFGPLSVNLAGAQLGQPQLIERLEQLLEQSGLEPSRLQLEI
FT                   TESFIMNQTEEALAVLHGLKRLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGL
FT                   PDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFLTHEGCEQIQGFVLSPPLPAEL
FT                   FASKFLKPRQPIGAPREAPV"
FT   CDS_pept        complement(625500..627353)
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="PLES_05731"
FT                   /product="sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25300"
FT                   /protein_id="CAW25300.1"
FT                   /translation="MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVED
FT                   IIRMINDMGINVFETAPDADALLLAEADTDEAAAEEAAAALAAVESDIGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFPGTVDSILADYNRIVAEGGRLSDV
FT                   LSGYIDPDDGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDSSDSDDEGDGGPDPEEAR
FT                   LRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVARVRSAL
FT                   EGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPKYAEAIERLRDD
FT                   ILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARRAKKEMVEANLRLVISIAKKYT
FT                   NRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV
FT                   HMIETINKLNRISRQMLQEMGREPTPEELGERMDMPEDKIRKVLKIAKEPISMETPIGD
FT                   DEDSHLGDFIEDSTMQSPIEMATSESLKESTREVLAGLTAREAKVLRMRFGIDMNTDHT
FT                   LEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE"
FT   CDS_pept        complement(627433..629427)
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PLES_05741"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25301"
FT                   /protein_id="CAW25301.1"
FT                   /translation="MAGLIPQSFIDDLLNRTDIVEVVSSRIQLKKTGKNYSACCPFHKE
FT                   KTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDQLEFPQAVEELAKRAGMDVPREERGG
FT                   RGHTPRQPTDSPLYPLLSAAAEFYKQALKSHPARKAAVNYLKGRGLTGEIARDFGLGFA
FT                   PPGWDNLLKHLGGDNLQLKAMLDAGLLVENSDTGKRYDRFRDRVMFPIRDSRGRIIAFG
FT                   GRVLGDDKPKYLNSPETPVFHKGQELYGLYEARQKNRDLDEIMVVEGYMDVIALAQQGI
FT                   RNAVATLGTATSEEHIKRLFRLVPSILFCFDGDQAGRKAAWRALESVLPNLQDGKRVRF
FT                   LFLPEGEDPDSLVRAEGEDAFRARITQQAQPLAEYFFQQLMLEADPATLEGKAHLATLA
FT                   APLLEKIPGNNLRLLMRQRLSEITGLSGENIGQLAHHSPPPSSMDHGASGALDGDDYLA
FT                   ASAYYENELSHAPFDAAPGYGEAQPRKSWNKDKKPWDGKKWDGKKKWDKGGRGDFKTPQ
FT                   RTPVSVESTTLNALRTLLHHPQLALKVDDAGTLAREQDTYAQLLVSLLEALQKNPRQSS
FT                   MQLIARWHGTPQGRLLQALGEKEWLIVQENLEKQFFDTITKLSESQRFGEREERLRSVM
FT                   QKSYSELTDEEKALLREHYSVAASSPSQS"
FT   CDS_pept        complement(629510..629959)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25302"
FT                   /protein_id="CAW25302.1"
FT                   /translation="MSEIKSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERIEV
FT                   DDARALLILDRMIKQRRDAQRQFSDAGRQDLAEVEAAEILVLQDFMPKPLDDHEIDALI
FT                   ERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARLSS"
FT   CDS_pept        complement(630029..630244)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PLES_05761"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25303"
FT                   /db_xref="GOA:B7V4G5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4G5"
FT                   /protein_id="CAW25303.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAER
FT                   KRKAAAAVKRHAKKVQREQRRRERLY"
FT   CDS_pept        630445..631470
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="PLES_05771"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25304"
FT                   /db_xref="GOA:B7V4G6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4G6"
FT                   /protein_id="CAW25304.1"
FT                   /translation="MRVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVYGGVVPE
FT                   LASRDHVKRMLPLIRQVLDESGCTPADIDAIAYTAGPGLVGALLVGASCAQAMAFAWGV
FT                   PAVGVHHMEGHLLAPMLEEQPPRFPFVALLVSGGHTQLVRVDGIGRYQLLGESVDDAAG
FT                   EAFDKTAKLIGLGYPGGPEIARLAELGTPGRFVFPRPMTDRPGLDFSFSGLKTFTLNTW
FT                   QRCVEAGDDSEQTRCDIALAFQTAVVETLLIKCRRALKQTGLKNLVIAGGVSANQALRS
FT                   GLEKMLGEMKGQVFYARPRFCTDNGAMIAYAGCQRLLAGQHDGPAISVQPRWPMESLPA
FT                   V"
FT   CDS_pept        complement(631549..632118)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05781"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25305"
FT                   /db_xref="GOA:B7V4G7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4G7"
FT                   /protein_id="CAW25305.1"
FT                   /translation="MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNMLR
FT                   VAGKKLAILTLLGDVGKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGGKG
FT                   VATAAGMLLGLYPPAVLLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGALLPM
FT                   TVLTGLIVWRHRANLRDLFAGRERHF"
FT   CDS_pept        632202..632555
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="PLES_05791"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25306"
FT                   /protein_id="CAW25306.1"
FT                   /translation="MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGD
FT                   DLALALDYAALSERVQEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPA
FT                   ARGVGVEIERGCR"
FT   CDS_pept        632546..633088
FT                   /transl_table=11
FT                   /locus_tag="PLES_05801"
FT                   /product="putative
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25307"
FT                   /protein_id="CAW25307.1"
FT                   /translation="MSLIPVYLGLGSNVERERHLHAGLDALAGFLHDLRCSPVFESEPV
FT                   GIKSGPFFNLVVSARTDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLFYGDLVGD
FT                   FDGLVLPRAEVLKNAFVLWPLSELAPNLEHPVARQPLGDLWREARIQQKLWPAPFEWRG
FT                   QALTPEALLQAFPRSSL"
FT   CDS_pept        complement(633061..634293)
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="PLES_05811"
FT                   /product="tRNA nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25308"
FT                   /db_xref="GOA:B7V4H0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4H0"
FT                   /protein_id="CAW25308.1"
FT                   /translation="MQIYKVGGAVRDRLLGRPVTDIDWVVVGASSDEMLARGYRPVGAD
FT                   FPVFLHPQSGEEYALARTERKSGRGYGGFTFHASPEVTLEEDLTRRDLTINAMAEDEQG
FT                   RVIDPYGGQADLEARLLRHVSPAFAEDPLRVLRVARFAARYAGLGFRVAAETLALMRQL
FT                   AESGELQALTPERSWKEISRALMEPNPEVFIQVLHDCGALAELIPEVEALFGVPQPAAH
FT                   HPEIDTGVHVLSVLQQCARHRQPLSVRWACLLHDLGKGLTSEADWPRHIAHETRGVPLI
FT                   DAVNQRFRVPRDCQELARLVGEYHTHAHRALELRPNTLLELLQSFDVYRRPQRFEEFVA
FT                   ASEMDARGRLGLEQRDYPQAAYLLGAAQAARAVSVKPLVEKGLKGAELGEALKCARLAA
FT                   LKAYKEERGKA"
FT   CDS_pept        complement(634337..634843)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25309"
FT                   /protein_id="CAW25309.1"
FT                   /translation="MRLFAIVLLCLVLATCASHIPSARVTHPASAGLPGLQGFQLMPPE
FT                   QAVDALPYRNRYPLINAELRQGLAAHGYHESATPQFRVYYWLALRDAPLEFRPDLPPTS
FT                   GMGPYLAIHRLRDETGTLRVRLVDLEERVLWEGMVSTGLSPARANPEQLELAVGALLRQ
FT                   LPRAR"
FT   CDS_pept        complement(634938..636491)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05831"
FT                   /product="putative sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25310"
FT                   /protein_id="CAW25310.1"
FT                   /translation="MSKRQPIATGSEWTFELIQQYDREISRIAERYALDTYPNQIEVIT
FT                   AEQMMDAYASVGMPIGYNHWSYGKHFLSTEKNYKRGQMGLAYEIVINSDPCIAYLMEEN
FT                   TQCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERYGIDAVE
FT                   DLLDSCHALMNYGVDRYKRPYPISAEEERQRQKEREELIQRQVNDLWRTIPRVGGKDKE
FT                   QSMARYPSEPQENILYFIEKNAPLLEPWQREVIRIVRKIAQYFYPQRQTQVMNEGWATF
FT                   WHYTLLNDLYDEGLVNDGFMMEFLQYHTSVVYQPSFDSPYYSGINPYALGFAMYRDIRR
FT                   ICEDPTDEDRRWFPDIAGSDWLATLKFAMKSFKDESFILQFLSPKVIRDLKLFSILDDD
FT                   QKDDLLVAAIHDEAGYRTIRETLAAQYNLGNREPNIQIWNVDRRGDRSLTLRHQQFDRQ
FT                   PLSDSTADVLKHLHRLWGFDIHLETLQGDQLVQTHHMPPKGASEGEEGYPRLDLIIPPI
FT                   "
FT   CDS_pept        complement(636488..637759)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25311"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4H3"
FT                   /protein_id="CAW25311.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSITD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGRQTVVHPGNKEFTAGEHIARPSGGGGGRGGGKAS
FT                   NSGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHITGTDTFKTVRAGISNDGNPSRIN
FT                   IVRTLRSAHARRIALSGGSRAKLRAALKELERIKREEPDNLGDIQELELEIAKLRARID
FT                   RVPFLDTFDLKYNLLVKQPNPTSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRN
FT                   YEKIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKMMQEIMAERYPTHEWNIYAA
FT                   QASDGDNWNDDSPVCRDILLKQIMPFVQYYTYVEITPREHQALWFEYERVREAFEDSFA
FT                   QQQIVSASDIYPVFRELFQRRLVA"
FT   CDS_pept        complement(637860..639782)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05851"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25312"
FT                   /protein_id="CAW25312.1"
FT                   /translation="MSIFSHFQERFEATRQEEYSLQEYLDLCKQDKTAYASAAERLLMA
FT                   IGEPELLDTSVDSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVAFFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNPDEDGAILEEDYGI
FT                   PRRYLRSIMSPWATKRLNEFGGDISQFRVVKLYPSILNQIAIAKTEPGDENNQDISALV
FT                   GKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGALPYSGIILAHSNESEWHSFRNNKNNEAFIDRIYIVKVPYCLRVADEIKIYDK
FT                   LLVNSSLAHAHCAPDTLKMLSQFSVLSRLKEPENSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMAGLSTRFAFKILSKVFNFDPHEVAANPVHLLYVLEQQIEQEQFQPE
FT                   TRERYLRFIKEYLAPRYVEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRAALNEELEKIEKPAGISNPKDFRNEIVNFVLRARAGNNGKNPSWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVKRMVERGYTEKQVRLLSEWYLR
FT                   VRKSQ"
FT   CDS_pept        complement(640061..640393)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05861"
FT                   /product="putative thiosulfate/cyanide sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25313"
FT                   /db_xref="GOA:B7V4H5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4H5"
FT                   /protein_id="CAW25313.1"
FT                   /translation="MSDTFQRIAPEQARQLRENGAQVVDIRDPQSFAVGHISGSRHIDN
FT                   HSVADFIAAADLDAPLVVVCYHGNSSQSAAAYFIQQGFSDVYSLDGGFELWRSVYPADT
FT                   SSGEAE"
FT   CDS_pept        complement(640437..641288)
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="PLES_05871"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25314"
FT                   /db_xref="GOA:B7V4H6"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4H6"
FT                   /protein_id="CAW25314.1"
FT                   /translation="MAVYAVGDLQGCLDPLKCLLERVAFDPAKDRLWLVGDLVNRGPQS
FT                   LETLRFLYAMRESVVSVLGNHDLHLLAVAHKSERLKKSDTLREILEAPDREPLLDWLRR
FT                   LPLLHYDEQRKVALVHAGIPPQWSLEKARLRAAEVEQALRDDQRLPLFLDGMYGNEPAK
FT                   WDKKLHGIDRLRVITNYFTRMRFCTEDGKLDLKSKEGLDTAPPGYAPWFSFPSRKTRGE
FT                   KIIFGHWAALEGHCDEPGLFALDTGCVWGARMTLLNVDSGERLSCDCAEQRAPARPAAT
FT                   PA"
FT   CDS_pept        complement(641288..641668)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05881"
FT                   /product="putative apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25315"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4H7"
FT                   /protein_id="CAW25315.1"
FT                   /translation="MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQ
FT                   LLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLG
FT                   SDGIAFDAAIPVFRLAVPGALH"
FT   CDS_pept        complement(641705..642511)
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="PLES_05891"
FT                   /product="rRNA (adenine-N6,N6)-dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25316"
FT                   /protein_id="CAW25316.1"
FT                   /translation="MSELYQHRARKRFGQNFLHDAGVIHRILRAIHAREGQRLLEIGPG
FT                   QGALTEGLLGSGARLDVIELDQDLIPLLKLKFGLESRFSLHQGDALKFDFASLVESGEK
FT                   LRVVGNLPYNISTPLIFHLLEHAPVIEDMHFMLQKEVVERLAATPGGGDWGRLSIMVQY
FT                   HCRVEHLFNVGPGAFNPPPKVDSAIVRLTPFAEPPHPARDPKLLERVVREAFNQRRKTL
FT                   RNTLKPLLSVEDIEAAEVDPTLRPEQLDLAAFVRLANRLAELPGNR"
FT   CDS_pept        complement(642627..643613)
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="PLES_05901"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25317"
FT                   /protein_id="CAW25317.1"
FT                   /translation="MSLRFALTPGEPAGIGPDLCLLLARSAQPHPLIAIASRTLLQERA
FT                   GQLGLAIDLKDVSPAAWPERPAKAGQLYVWDTPLAAPVRPGQLDRANAAYVLETLTRAG
FT                   QGCLDGHFAGMITAPVHKGVINEAGIPFSGHTEFLADLTHTAQVVMMLATRGLRVALAT
FT                   THLPLREVADAISDERLSRVARILHADLRDKFGIAHPRILVCGLNPHAGEGGHLGREEI
FT                   EVIEPCLERLRGEGLDLVGPLPADTLFTPKHLEHCDAVLAMYHDQGLPVLKYKGFGAAV
FT                   NVTLGLPIIRTSVDHGTALDLAGSGRIDSGSLQVALETAYQMAASRC"
FT   CDS_pept        complement(643610..644902)
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="PLES_05911"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25318"
FT                   /protein_id="CAW25318.1"
FT                   /translation="MKIKLCNRLRPLALGAALLCSFAHAEVVPLDRVVAIVDNDVIMQS
FT                   QLDQRLREVHQTLLKRGAPLPPEHVLTQQVLERLIIENIQQQIGDRSGIRISDEELNQA
FT                   MGTIAQRNGMSLEQFQAALTRDGLSYADAREQVRREMVISRVRQRRVAERIQVSEQEVK
FT                   NFLASDMGKIQLSEEYRLANILIPVPEAASSDVIQAAARQAQELYQQLKQGADFGQLAI
FT                   SRSAGDNALEGGEIGWRKAAQLPQPFDSMIGSLAVGDVTEPVRTPGGFIILKLEEKRGG
FT                   SKMVRDEVHVRHILLKPSEIRSEAETEKLAQKLYERIQSGEDFGELAKSFSEDPGSALN
FT                   GGDLNWIDPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQ
FT                   AVSVLRNRKYDEELQAWLRQIRDEAYVEIKQ"
FT   CDS_pept        complement(644883..647672)
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="PLES_05921"
FT                   /product="organic solvent tolerance protein OstA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25319"
FT                   /db_xref="GOA:B7V4I1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V4I1"
FT                   /protein_id="CAW25319.1"
FT                   /translation="MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQAADQFDCKVSATG
FT                   GWDCSPLQNANANLPPRPAHTATSVSTAAAGSSVSGSGGETVEAEPTQRLVTESGGRAL
FT                   KSRSADYSHLDWIPREKLTAAQLAEIGPYCGGSYIEPVRPGMDDGAPSDESPTYVSAKA
FT                   SRYEQEKQIATLAGDVVLRQGSMQVEGDEANLHQLENRGELVGNVKLRDKGMLVVGDHA
FT                   QVQLDNGEAQVDNAEYVIHKAHARGSALYAKRSENAIIMLKDGTYTRCEPSSNAWTLKG
FT                   NNVKLNPATGFGTATNATLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSSTSDTGFTL
FT                   VTPYYFNLAPNYDATLYPRYMAKRGMMLEGEFRYLTHSSEGTVNAAYLNDKDDHRENFP
FT                   DYSKDRWLYGLKNTTGLDSRWLAEVDYTRISDPYYFQDLDTDLGVGSTTYVNQRGTLTY
FT                   RGDTFTGRLNAQAYQLATTTDVTPYERLPQITFDGFLPYEPGGVKFNYSTEFVRFDRDL
FT                   DDNIYLNDDGSEWGRRPDAYLQGLARSTGDRVHLEPGMSLPMTRSWGYLTPTLKYLYTK
FT                   YDLDLDSQGKRTLTTYDETFDSSQDRSLPLVKVDSGLYFDRDTTLAGTQFRQTLEPRAM
FT                   YLYVPYKDQENIPVFDTSEPSFSYDSLWRENRFSGRDRIGDANQLSLGVTTRFIESNGF
FT                   ERASLSAGQIYYFRDRRVQLPGLSEKDLALMRSKNPNLDLKDPDTDSWRSPYALMGQYR
FT                   FNRDWRVSSDFNWNPNTSRTESGSAMFHYQPEDNPNKVVNAGYRYREDSRRFNSSTGRF
FT                   EYGRENDIIKQHDFSVIWPLVPQWSVLARWQYDYNKNRTLEAFGGFEYDSCCWKLRLIN
FT                   RYWLDVDDDAFLNQNEKADRGIFLQIVLKGLGGIVGNKTEMFLDKGIQGYRQREDQAM"
FT   CDS_pept        647799..648815
FT                   /transl_table=11
FT                   /locus_tag="PLES_05931"
FT                   /product="putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25320"
FT                   /protein_id="CAW25320.1"
FT                   /translation="MSDDARFQQLNRWLDSCLPELFVAEGWGEVPPAELIPASSDASFR
FT                   RYFRWQGGDRSLVVMDAPPPQEDCRPFVKVAGLLAGAGVHVPRILAQDLENGFLLLSDL
FT                   GRQTYLDVLHPGNADELFEPALDALIAFQKVDVAGVLPAYDEAVLRRELQLFPDWYLAR
FT                   HLGVELEGETLARWQRICDLLVRSALEQPRVFVHRDYMPRNLMLSEPNPGVLDFQDALH
FT                   GPVTYDVTCLYKDAFVSWPEPRVHAALNRYWKKATWAGIPLPPSFEDFLRASDLMGVQR
FT                   HLKVIGIFARICHRDGKPRYLGDVPRFFRYLETAVARRPELAELGELLASLPQGAEA"
FT   CDS_pept        648812..649486
FT                   /transl_table=11
FT                   /locus_tag="PLES_05941"
FT                   /product="probable nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25321"
FT                   /protein_id="CAW25321.1"
FT                   /translation="MKAMILAAGRGERMRPTTLHTPKPLIEAAGVPLIERQLLALRQAG
FT                   VDDWVINHAWLGEQIEAYLGDGTRLGGRIAYSPEGEPLETGGGIFRALPLLGEQPFLLL
FT                   NGDVWSDFDYSRLHLADGDLAHLVLVDNPAHHPAGDFHLDAGGRVGETREAGGNLTYSG
FT                   IAVLHPALFEGCQPGAFKLAPLLRKAIAAGRVSGEHYRGQWVDVGTHERLAEVERLLAE
FT                   HA"
FT   CDS_pept        649488..650246
FT                   /transl_table=11
FT                   /locus_tag="PLES_05951"
FT                   /product="putative DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25322"
FT                   /protein_id="CAW25322.1"
FT                   /translation="MLWPATLIGAGAGWALASIPGALLGGLLGQLLDRRLRLESWRGLL
FT                   ARLRGRAVNDEDDLLFQLLGYLAKSGGRVEEMHIRQAREEMALRKLDRRAQRRAIASFG
FT                   KGKAGIAHLQAEVARLKGERAEAVLLACWRMAWAGGVLSQSARQLVLQWGRWLGWSAER
FT                   TERLPARVMPKRTRAVARDSYREALLLLGVEAGSEPALIKRAYRKLISQHHPDKLAGAG
FT                   ASVERVRAATEKTRELQAAYALVREREGFR"
FT   CDS_pept        complement(650247..651308)
FT                   /transl_table=11
FT                   /locus_tag="PLES_05961"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25323"
FT                   /protein_id="CAW25323.1"
FT                   /translation="MPAFSLLPKPSALLPLLLAAAFLPPAFVHAEEEAAKDQPPAPVER
FT                   PAVSERSQDEAKGLERQLPEDGQQILKAGDESFLTLWLPANTAEAEGVVILVPGDGESP
FT                   DWPQAIGPLRRKLPDAGWQTLSLALPDPQSTAPVTRPAESAASASADKDASAADSASKP
FT                   DVKGESGNAPAPESTAQAGSGEPAQSEDQAPPPAIDPVEQRKAHAERVMARLQASIDLA
FT                   LQHEPKSVVLLGHGTGAYWAARYLAEKEPAEIHNLLLVAAEVPRDFRPALEDMVPKLKL
FT                   ATGDFYYRDARADREAARLRMQAGKRQKHPAYVQIAMQALPADPKAEQEQLYRRIRGWL
FT                   SLHLQADAQKPAE"
FT   CDS_pept        651460..653853
FT                   /transl_table=11
FT                   /locus_tag="PLES_05971"
FT                   /product="probable two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25324"
FT                   /protein_id="CAW25324.1"
FT                   /translation="MLRRCCLLFFCLLLSLPVRAEESVALPLTAELRTWLAEHRELRVG
FT                   VVTEAPYAQYDRRLQQYSGANVELMGWLATAMQVTLRWQGYPDQAALDDALRAGRVDIA
FT                   PGLSQTPAGLRLWLFSDPYLRVSRLVVGKRDGSGSVELEQLERDTRVAVRAGSSVADYL
FT                   SSTYSGLQWGAADSEREVLRAVLAGQARYAVIDEAQLSRLTREPEFAELAVVGDIGYPQ
FT                   LLRVATRRDWPELAMVVDQALRSLPRKSLDQLHERWLQPKYPRLGESPGFWQNLSILLG
FT                   LLLAGALAAVFLQRRQQHALEARLYGARRDLELRQAAEEALRLTQFSIDNSTLGILWVN
FT                   WDSRVRYANRAAEQMLGHADGQLVDRPLADFEPGLDMDRWLNLWRRARNSEEGPLSFET
FT                   RCLRADGSWLPADVSLSFLRFGTSEYLVVFLSDVTERRRAREALQESEARMKGIASNVP
FT                   GMVFRLERPRAGAFSDFAYISEGSEALVGYSARELIESGRGIRGLVHPDDRERYWSSQM
FT                   AALDENRDWHWQGRILTRQGELRWADIKASARCFEDGRAVWDGVVWDITANKQIELELG
FT                   ESRAQLRELSAHLESVREEEKARIAREVHDELGQVLTVLKLETSMCELAYADAQEGLRE
FT                   RLGNMKKLIAQLFQLVRDVATALRPPILDAGIGSAVEWQARRFEARTQIPCLVEVPENS
FT                   PQLVDAKAIGLFRILQEALTNVMRHAEAHTVQLRLLREGDELCLSVSDDGRGFDVATVG
FT                   RGSSFGLVGMRERVLMMGGTLDIDSAPGEGTTLSVRIPLGVAGP"
FT   CDS_pept        653899..654531
FT                   /transl_table=11
FT                   /locus_tag="PLES_05981"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25325"
FT                   /protein_id="CAW25325.1"
FT                   /translation="MVIRVLVAEDHTIVREGIKQLIGMAKDLQVVGEATNGEQLLETLR
FT                   GTPCEVVLLDISMPGVNGLEAIPRIRALNEPPAILVLSMHDEAQMAARALKIGAAGYAT
FT                   KDSDPALLLTAIRRVAGGGRYIDPDLADRMVFEVGLTDSRPPHALLSEREFSVFERLVQ
FT                   GANVNEIAQQLAVSNKTISTHKARLMQKLNAHSVADLVRYAMEHRLL"
FT   CDS_pept        654660..655694
FT                   /transl_table=11
FT                   /locus_tag="PLES_05991"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_05991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25326"
FT                   /protein_id="CAW25326.1"
FT                   /translation="MLPAMRTGLLCALLGVTAPAWAEYVTVISFGGANKEAQETAFYKP
FT                   FKSATGNRVVHGSYNGDLAKLKRMVEISHVSWDVVEVEAPELARGCEEGLFEKLDMAKV
FT                   GDPADFVPGAVQPCGVGIFVWTTLLAYNPGKVAGSPQGWADFWDVKKFPGKRGLRWGAK
FT                   YSLEFALMADGVAPKDVYQTLATPAGVERAFRKLDELKPYIHWWKSGQDPVRDLADGTV
FT                   VMSSAYNGRIAAAQAEKQRLAMVWSGGVYDFDFWALPVGVWKKQLAEEFIRFASQPEQQ
FT                   KAFAENIAYGPANRKAVGLLDPQVAANLPTAPQNMQNAVGMNVAFWAEHGEALEQRFQN
FT                   WAKR"
FT   CDS_pept        655927..657036
FT                   /transl_table=11
FT                   /locus_tag="PLES_06001"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25327"
FT                   /protein_id="CAW25327.1"
FT                   /translation="MAETQGGDVLVSFRGVQKSYDGETLIVKDLNLDIRKGEFLTLLGP
FT                   SGSGKTTSLMMLAGFETPTAGEILLAGRSINNVPPHKRDIGMVFQNYALFPHMTVAENL
FT                   AFPLSVRGMSKTDVKERVKRALSMVQLDAFAGRYPAQLSGGQQQRVALARALVFEPQLV
FT                   LMDEPLGALDKQLREHMQMEIKHLHQRLGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQ
FT                   IEPPRNLYEQPRNTFVANFIGENNRLSGQLLSCDGERCVVGLPRGEKVEALAVNVGQPG
FT                   EPVTLSIRPERVRLNGASESCVNRFSGRVAEFVYLGDHVRVRLEVCGRDDFFVKQPIAE
FT                   LDPTLSVGDVVPLGWQVEHVRALDPLPAA"
FT   CDS_pept        657092..658138
FT                   /transl_table=11
FT                   /locus_tag="PLES_06011"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25328"
FT                   /protein_id="CAW25328.1"
FT                   /translation="MSKSLKAASLKFATLAAGLACAAQAMAVDLTVVSFGGANKSAQIK
FT                   AFYEPYQKATGNRIVAGEYNGEMAKVKAMVDTNSVSWDLVEVESPELSRGCDEGLFEEL
FT                   DPAQFGKTEDFVPGAIQPCGVGFFVWSTVLAYNADKLKSAPTSWADFWDIKKFPGKRGL
FT                   RKGAKYTLEFALMADGVAPKDVYGVLATKEGQDRAFKKLDEIKSSIQWWEAGAQPPQYL
FT                   ASGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKKREETLKFIAFSVQ
FT                   PQQQKTYSENIAYGPANKQAVPLLDKALLKDMPTTPENIQNQVAMDVTFWADYGEQLEQ
FT                   RFNAWAAR"
FT   CDS_pept        658253..659500
FT                   /transl_table=11
FT                   /locus_tag="PLES_06021"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25329"
FT                   /protein_id="CAW25329.1"
FT                   /translation="MATAVPMSQAAGSTLKQRLARAERMNRLKSQALILPLLAFLVLTF
FT                   LVPIAALLYKSVSNPEVVRSLPLTVEAISAWDGKSLPADAVYKALSQDLAEARRNQTIG
FT                   DLSKRLNMELAGYRSLMAKTARKLPFKEEPASYKDAMEQLDERWGDPAYWQVIRRNASS
FT                   YTPYYLLAALDHRIDDLGEVARATPDQAIYLDIFARTFWMGAVITVICLLLAYPLAYLL
FT                   ANLPTRKSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINGALLKLGLIDQPLQLVFN
FT                   RTGVYIAMVHIMLPFMILPIYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQTVAGVG
FT                   AGCLLVFILSIGYYITPALLGSPNDQMVSYFVAFYTNSTINWGMATALGGLLLLATLVL
FT                   YVVYSWLVGASRLRLG"
FT   CDS_pept        659606..660436
FT                   /transl_table=11
FT                   /locus_tag="PLES_06031"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25330"
FT                   /protein_id="CAW25330.1"
FT                   /translation="MLSPYMSPVERLWFYSLRILCGLVLLFLVLPVLVIVPLSFNSGTF
FT                   LVYPLQGFSLRWYADFFQSAEWMRSLTNSMIVAPAATLLAMVFGTLAAIGLTRGEFRGK
FT                   ALVMSLMISPMVVPVVIIGVASYLFFAPLGLGNSYLSLIVVHAVLGVPFVIITVSATLQ
FT                   GFNYNLVRAAASLGAPPLTTFFRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQ
FT                   ATLPRQMFSGIRENLSPTIAAAATLLIGFSVLLLLTLEWLRGRSEKMRTAQPGA"
FT   CDS_pept        660560..661234
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="PLES_06041"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25331"
FT                   /protein_id="CAW25331.1"
FT                   /translation="MQPFAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCSALRKYGVSAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEASQHIDRSLQ
FT                   LIRDGGCKAGLVFNPATPLEVLKYVMDKVDMVLLMSVNPGFGGQKFIPGTLDKLREARA
FT                   LIDASGREIRLEIDGGVNVKNIREIAAAGADTFVAGSAIFNAPDYAEVIRAMHAELAQA
FT                   HQ"
FT   CDS_pept        661234..662052
FT                   /transl_table=11
FT                   /locus_tag="PLES_06051"
FT                   /product="probable phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25332"
FT                   /protein_id="CAW25332.1"
FT                   /translation="MSAAEPFFATRLPRLVMFDLDGTLVDSVPDLTAAVDSMLASLGRP
FT                   PAGIEKVRQWIGNGARVLVRRALAGSIEHDGIGEEETEAALALFMEAYADSHALTEVYP
FT                   GVVDTLKWLKRNGVEMALITNKPERFVAPLLDEMKLGRYFRWIIGGDTLPQQKPDPAAL
FT                   LFVMKMAGIEPEDALFVGDSRNDVLAAKAAGVRCAALTYGYNHGRPIAEEAPTLVIDNL
FT                   RDLLPCADQAAEIVLPDDSLSPSDQRDQAVAVSKLWMKVIKALARWRWRA"
FT   CDS_pept        662125..663603
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="PLES_06061"
FT                   /product="anthranilate synthetase component I"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25333"
FT                   /protein_id="CAW25333.1"
FT                   /translation="MNREEFLRLAADGYNRIPLSFETLADFDTPLSIYLKLADAPNSYL
FT                   LESVQGGEKWGRYSIIGLPCRTVLRVYDHQVRISIDGVETERFDCADPLAFVEEFKARY
FT                   QVPTVPGLPRFDGGLVGYFGYDCVRYVEKRLATCPNPDPLGNPDILLMVSDAVVVFDNL
FT                   AGKIHAIVLADPSEENAYERGQARLEELLERLRQPITPRRGLDLEAAQGREPAFRASFT
FT                   REDYENAVGRIKDYILAGDCMQVVPSQRMSIEFKAAPIDLYRALRCFNPTPYMYFFNFG
FT                   DFHVVGSSPEVLVRVEDGLVTVRPIAGTRPRGINEEADLALEQDLLSDAKEIAEHLMLI
FT                   DLGRNDVGRVSDIGAVKVTEKMVIERYSNVMHIVSNVTGQLREGLSAMDALRAILPAGT
FT                   LSGAPKIRAMEIIDELEPVKRGVYGGAVGYLAWNGNMDTAIAIRTAVIKNGELHVQAGG
FT                   GIVADSVPALEWEETINKRRAMFRAVALAEQSVE"
FT   CDS_pept        complement(663919..664233)
FT                   /transl_table=11
FT                   /gene="prtN"
FT                   /locus_tag="PLES_06071"
FT                   /product="transcriptional regulator PrtN"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25334"
FT                   /protein_id="CAW25334.1"
FT                   /translation="MQPSIAPSTPIPRQETVELVYRIFGDVLVPLEQVRERWFRNLNKE
FT                   NFSKALACGRIALPVTTLDDSHKAMQFVALDHLAAYVDQRANQAGSARRAQPGADSIAS
FT                   "
FT   CDS_pept        complement(664333..665103)
FT                   /transl_table=11
FT                   /gene="prtR"
FT                   /locus_tag="PLES_06081"
FT                   /product="transcriptional regulator PrtR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25335"
FT                   /protein_id="CAW25335.1"
FT                   /translation="MDKSTQIPPDSFAARLKQAMAMRNLKQETLAEAAGVSQNTIHKLT
FT                   SGKAQSTRKLIEIAAALGVSPVWLQTGEGAPAARSAVSVADGSPLVLEPLHPWDSDTPL
FT                   DEDEVELPLYKEVEMSAGAGRTAVREIEGRKLRFSYATLRASGVDPSAAICAQLTGNSM
FT                   EPLIMDGSTIGVDTATTHITDGEIYALEHDGMLRVKFVYRLPGGGIRLRSFNREEYPDE
FT                   EYSPEDMRSRQISMIGWVFWWSTVRHRRGPSLVR"
FT   misc_feature    665272..680608
FT                   /note="LES prophage 1"
FT   CDS_pept        665561..665761
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="PLES_06091"
FT                   /product="repressor, PtrB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25336"
FT                   /protein_id="CAW25336.1"
FT                   /translation="MADLADHANELVLARLDGLLAARPALAIRESAEDCEDCGEPIPQA
FT                   RRRAAPGCSRCIDCQDRHERR"
FT   CDS_pept        665809..666168
FT                   /transl_table=11
FT                   /locus_tag="PLES_06101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25337"
FT                   /protein_id="CAW25337.1"
FT                   /translation="MIKAIDEMLKLWAEEMHAPGSNGGGYAGGNLIAMLIASKGEVVRG
FT                   HRGSRVILDRVAEVDRLVNRLPEELKNVVVEHYLNRDSFPEQKYRHCGCSRNTFYLRLH
FT                   VAHQGIQDGLLRRVA"
FT   CDS_pept        666531..666980
FT                   /transl_table=11
FT                   /locus_tag="PLES_06111"
FT                   /product="putative holin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25338"
FT                   /protein_id="CAW25338.1"
FT                   /translation="MKHRNPALAPGFLLPGKTFVRTCPALPAKEGPMGNEPQTLTEMPL
FT                   WVLILLAALGGVSGEMWRADKAGLGGWALLRRLALRSGASIVCGVAVMLLALACGAALL
FT                   FAAALGSLTAAAGAEIAVGLYERWAARRLGVCELPEEQSDDRGPH"
FT   CDS_pept        667002..667517
FT                   /transl_table=11
FT                   /locus_tag="PLES_06121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25339"
FT                   /protein_id="CAW25339.1"
FT                   /translation="MPEQAVTLEALYAAIEQVLRERLPEAQLIGFWPGVPENTPAVSLE
FT                   IAELLPERDPGTGESALLCRLQARIMVPPGADRQAVSIACGIVRTLREQTWNLSLQPAR
FT                   FVRSAVDGSREELKSLRVWLVEWTQSLRLGDPEWAWEDQPPGSLMLGFDPQTGPGHEPD
FT                   YFAPEALA"
FT   CDS_pept        667514..668071
FT                   /transl_table=11
FT                   /locus_tag="PLES_06131"
FT                   /product="putative baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25340"
FT                   /protein_id="CAW25340.1"
FT                   /translation="MSYVSAEHDRMLAAMILPCVVVAVDLAAARVRVRSGDWTSGWLRW
FT                   HSLAAGKVRHWRAPSIGEQGILLSPSGGVSMGTFIPGLYGDAGTAPDNSASSETWRFDD
FT                   GASLSYDWAAHRYRVELPSGTVEVRVGASEVRVSDGAVSLKAPKISLEGPVEIAGTLTV
FT                   SGDILGGGSIIDTAGNSNHHTH"
FT   CDS_pept        668224..668550
FT                   /transl_table=11
FT                   /locus_tag="PLES_06141"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25341"
FT                   /protein_id="CAW25341.1"
FT                   /translation="MIGMDRRSGLPLSGLAHLKQSVEDILTTPLGSRRMRPEYGSKLRR
FT                   MVDMPVSEGWKSAVQAEVARSLGRWEPRIALSAVRVVAVVDGRVDLLLSGVFEGENINM
FT                   EVSA"
FT   CDS_pept        668547..669434
FT                   /transl_table=11
FT                   /locus_tag="PLES_06151"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25342"
FT                   /protein_id="CAW25342.1"
FT                   /translation="MIIDLSQLPEPEVIENLDFETIYQQLLGDFREAMAGEWTAEVESD
FT                   PVLKLLQLAAYRELLLRARINDAARAVMLAYASGADLDQIGAGFNVQRLLIRPAQPEAV
FT                   PPVEAQYESDKSLRNRIQLAFEQLSVAGPRNAYIAHALGADGRVADASATSPAPCEVLI
FT                   SVLGVEGNGQAPETVLQAVRLALNAEDVRPVADRVTVRSAGIVPYQVKAQLYLFPGPEA
FT                   ELIRAAAEASLRDYISAQRRLGRDIRRSALFATLHVEGVQRVELQEPAADVVLDETQAA
FT                   YCTGYAITLGGVDE"
FT   CDS_pept        669427..669960
FT                   /transl_table=11
FT                   /locus_tag="PLES_06161"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25343"
FT                   /protein_id="CAW25343.1"
FT                   /translation="MSSRLLPPNRSSLERSLGDVLPAELPVPLRELNDPARCEAALLPY
FT                   LAWTRSVDRWDPDWSDEAKRNAVATSFVLHQRKGTLTALRQVVEPIGALSEVTEWWQRS
FT                   PLGVPGTFEITVDVSDRGIDEGTVLELERLLDDVRPVSRHLTRLDLRITPVIRSRHGLA
FT                   VTDGDTLEIFPWKQ"
FT   CDS_pept        669962..672067
FT                   /transl_table=11
FT                   /locus_tag="PLES_06171"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25344"
FT                   /protein_id="CAW25344.1"
FT                   /translation="MTTNTPKYGGLLTDIGAAALAAASAAGKKWQPTHMLIGDAGGAPG
FT                   DTPDPLPSAAQKSLINQRHRAQLNRLFVSDKNANTLVAEVVLPVEVGGFWIREIGLQDA
FT                   DGKFVAVSNCPPSYKAAMESGSARTQTIRVNIALSGLENVQLLIDNGIIYATQDWVKEK
FT                   VAADFKGRKILAGNGLLGGGDLSADRSIGLAPSGVTAGSYRSVTVNANGVVTQGSNPTT
FT                   LAGYAIGDAYTKADTDGKLAQKANKATTLAGYGITDALRVDGNAVSSSRLAAPRSLAAS
FT                   GDASWSVTFDGSANVSAPLSLSATGVAAGSYPKVTVDTKGRVTAGMALAATDIPGLDAS
FT                   KLVSGVLAEQRLPVFARGLATAVSNSSDPNTATVPLMLTNHANGPVAGRYFYIQSMFYP
FT                   DQNGNASQIATSYNATSEMYVRVSYAANPSIREWLPWQRCDIGGSFTKTTDGSIGNGVN
FT                   INSFVNSGWWLQSTSEWAAGGANYPVGLAGLLIVYRAHADHIYQTYVTLNGSTYSRCCY
FT                   AGSWRPWRQNWDDGNFDPASYLPKAGFTWAALPGKPATFPPSGHNHDTSQITSGILPLA
FT                   RGGLGANTAAGARNNIGAGVPATASRALNGWWKDNDTGLIVQWMQVNVGDHPGGIIDRT
FT                   LTFPIAFPSACLHVVPTVKEVGRPATSASTVTVADVSVSNTGCVIVSSEYYGLAQNYGI
FT                   RVMAIGY"
FT   CDS_pept        672558..673718
FT                   /transl_table=11
FT                   /locus_tag="PLES_06181"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25345"
FT                   /protein_id="CAW25345.1"
FT                   /translation="MSFFHGVTVTNVDIGARTIALPASSVIGLCDVFTPGAQASAKPNV
FT                   PVLLTSKKDAAAAFGIGSSIYLACEAIYNRAQAVIVAVGVEAAETPEAQASAVIGGISA
FT                   AGERTGLQALLDGKSRFNAQPRLLVAPGHSAQQAVATAMDGLAEKLRAIAILDGPNSTD
FT                   EAAVAYAKNFGSKRLFMVDPGVQVWDSATNAARNAPASAYAAGLFAWTDAEYGFWSSPS
FT                   NKEIKGVTGTSRPVEFLDGDETCRANLLNNANIATIIRDDGYRLWGNRTLSSDSKWAFV
FT                   TRVRTMDLVMDAILAGHKWAVDRGITKTYVKDVTEGLRAFMRDLKNQGAVINFEVYADP
FT                   DLNSASQLAQGKVYWNIRFTDVPPAENPNFRVEVTDQWLTEVLDVA"
FT   CDS_pept        673731..674234
FT                   /transl_table=11
FT                   /locus_tag="PLES_06191"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25346"
FT                   /protein_id="CAW25346.1"
FT                   /translation="MIPQTLTNTNLFIDGVSFAGDVPSLTLPKLAVKTEQYRAGGMDAP
FT                   VSIDMGLEAMEAKFSTNGARREALNFFGLADQSAFNGVFRGSFKGQKGASVPVVATLRG
FT                   LLKEVDPGDWKAGEKAEFKYAVAVSYYKLEVDGREVYEIDPVNGVRAINGVDQLAGMRN
FT                   DLGL"
FT   CDS_pept        674249..674593
FT                   /transl_table=11
FT                   /locus_tag="PLES_06201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25347"
FT                   /protein_id="CAW25347.1"
FT                   /translation="MTQENRLPGWLTLDADAALVRLSRPAQCNGVSVDTLTLRAPTVRD
FT                   IRLAGKVAGDDAEERELQLFASLAQVSRQDLEGLKLSDYQRLQGAYFRLVQDDTDDTFA
FT                   YASTGEAPGH"
FT   CDS_pept        674763..677000
FT                   /transl_table=11
FT                   /locus_tag="PLES_06211"
FT                   /product="putative tail length determinator protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25348"
FT                   /protein_id="CAW25348.1"
FT                   /translation="MSKDMDLVVSIGGIADPSLGKAFETVKARLDSLQERARQASSLRD
FT                   VLGDAIRLERELADMRKVGDRGVAEHARQLGERQEQLKRLGIEARAAGDAYARLGEMQR
FT                   GLDMQVRGLQRLEQASQAMPLASAFSGLVVEASKTAAGYQARLRDLAIRNGLDVGREPA
FT                   LASLIQDSASQSGLGRTATLDMLEHLNATGMGFAAAQMNLGLAGRFGFGQGIASAEVAG
FT                   LVRALQLAQGSDSPEQLSASLDRLVVLGKGRVGSEALARRLPALLSALGNAGEATAGDV
FT                   GALGALLEIQAKNTTPDKADVRMKAWLEFVGSGSLKRAYGQDYDRDLEALRKDGASLLE
FT                   ANLELAARYRDKGGKLSAGVASPALEAYRASRGEFQGLLESQQSSVGSSERDAQRRKGM
FT                   SQELWKASSDSWERAQTALGSALNPYLDNLAKGSAVLGESTAELLEAYPRTTAGLTAAA
FT                   GAVLSGYLAYKGGRGAIDVLRGGRLGRRGTAAVGDLIERGAGRVSGGSEIQRVFVTNWP
FT                   VPGGDSTLESARRPAQRKRGQTPRRKRGKGGGLKARSLPSLGFSAGGGLGAMAGKLPRL
FT                   SRLPIRNAPLQVASSLIDVAEVYSSDLSESEKTVAYGEAGGSLAGSLAGAALGASIGSV
FT                   VPVVGTLIGGLVGGAIGAWGGSELGGRLGRSLAGDPPAASDNKPAVAVPQAGPVAAAPN
FT                   WTFAPQINLTVQGNVHEPQRLADELLPYLQRMLVDFADERQRRSLYDPAMV"
FT   CDS_pept        677010..677882
FT                   /transl_table=11
FT                   /locus_tag="PLES_06221"
FT                   /product="putative tail formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25349"
FT                   /protein_id="CAW25349.1"
FT                   /translation="MAYLEQLQAGLRYLGRAGESGRKSLDKVVAPVNGAISEIRGAAAE
FT                   LENLPGVSPEMAARLQRAMRGIGQAQGKVNRVVSTYDRASRALLGIDERLDALKVQVNS
FT                   AAQAVGKVAGDISPTLAGVLPSWLLAPSATPPSEAAAPLPHLLVLQPLTANAQPFYFNL
FT                   NTAAFDALQRNSAYNWSGQVRLGRRPALQSVGMGEESILLKGAVFPLRRQVGNQEKVVG
FT                   LEQLEALRRLAERREPLILSSGYGEVQMGLWCLVRISENQSALLGNGAPRKQTFDLEFK
FT                   RYGDDLPNR"
FT   CDS_pept        677857..678063
FT                   /transl_table=11
FT                   /locus_tag="PLES_06231"
FT                   /product="putative phage protein X"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25350"
FT                   /protein_id="CAW25350.1"
FT                   /translation="MATTCRTADGDMLDSLCYHVYGHLLGCVEATLDANPGLADEQQPF
FT                   RAGLLISFPDMPVVNVEQVRLWD"
FT   CDS_pept        678121..679110
FT                   /transl_table=11
FT                   /locus_tag="PLES_06241"
FT                   /product="putative phage late control gene D protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25351"
FT                   /protein_id="CAW25351.1"
FT                   /translation="MQPSFRIVADGTDVTQRLNDRLLKLTLLDKPGMESDSLTLRIDDR
FT                   DGQVALPRRGAVLEVHLGYAGEPLMRMGRFTVDTLQWAGPPDCLTVTAKAGDMRGSGKT
FT                   IRSGGWEGTTLAQVCRDVGARNGWRVECPLQVAIARVDQVNESDYHFVTRLARQYDCTA
FT                   KLAEGMLMVLPRQSGQSATGRRIEPLVLGRADVGSFDVTFDDRSLMRTVKTRYQLPGSG
FT                   EVKSVELKNPKAPATAMGEHVDRHLYTSRGEAEQAAKARLASFSRSSASVRLELPGRGD
FT                   LFAERSLLLQGFKAGIDGEFLIDSVEHTYSSSGWTTVVQCNGGRGGKG"
FT   CDS_pept        679143..679772
FT                   /transl_table=11
FT                   /locus_tag="PLES_06251"
FT                   /product="putative lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25352"
FT                   /protein_id="CAW25352.1"
FT                   /translation="MKLTEQQLLRIFPNARLVAGVFVVALQRAMDEREIDTPARRAAFL
FT                   AQVGHESSQLTRLVENLNYSAQGLAATWPGRYLGPDGQPNALALRLARNPQAIADNTYA
FT                   TRNGNGDEASGDGWRFRGRGLLQITGRANYRLVGEALGEPLEAEPWRLEQPVPAARSAA
FT                   WWWAGHGLNELADRGEFAAITRRINGGLNGQAERLALWQRARAVLS"
FT   CDS_pept        679769..680131
FT                   /transl_table=11
FT                   /locus_tag="PLES_06261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25353"
FT                   /protein_id="CAW25353.1"
FT                   /translation="MSRLALLLPAVLLVLLAGALLGGGLVARHYRPQLEEALGQLTASR
FT                   VASGQLEALLDEQQRALAAVRASAERRAKDVEQALGEARAQAAEQYAAAVRLLQEPDIG
FT                   VDCQAAGAAIDRELGL"
FT   CDS_pept        680128..680385
FT                   /transl_table=11
FT                   /locus_tag="PLES_06271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25354"
FT                   /protein_id="CAW25354.1"
FT                   /translation="MTRLLLGLCLLFAGCAASPTTPRPVRVEVPLAVPCRVPDVRPPSW
FT                   AGATLKAGDSLQAKVRALLAERRQRQGYELELQAALRACR"
FT   CDS_pept        680733..681338
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="PLES_06281"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25355"
FT                   /protein_id="CAW25355.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPE
FT                   RIVLSPGPCTPNEAGVSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKT
FT                   SPIHHKNLGVFAGLANPLTVTRYHSLVVKRESLPECLEITAWTQHADGSLDEIMGVRHK
FT                   TLNVEGVQFHPESILTEQGHELLANFLRQQGGVRGEGN"
FT   CDS_pept        681340..682389
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="PLES_06291"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25356"
FT                   /db_xref="GOA:B7V608"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V608"
FT                   /protein_id="CAW25356.1"
FT                   /translation="MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDAQIGAFLMGM
FT                   RMKSETIDEIVGAVAVMRELADGVQLPTLKHVVDVVGTGGDGANIFNVSSAASFVVAAA
FT                   GGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFMFAQVHHKAMKY
FT                   AAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRLGSEHVLVVHS
FT                   RDGLDEFSLAAATHIAELKDGEVREYEVRPEDFGIKSQTLMGLEVDSPQASLELIRDAL
FT                   GRRKTEAGQKAAELIVMNAGPALYAADLATSLHEGIQLAHDALHTGLAREKMDELVAFT
FT                   AVYREENAQ"
FT   CDS_pept        682386..683222
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="PLES_06301"
FT                   /product="indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25357"
FT                   /db_xref="GOA:B7V609"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V609"
FT                   /protein_id="CAW25357.1"
FT                   /translation="MSVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFAN
FT                   ALLERAKRKEPAVIAEIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQG
FT                   ADAYLKEARAACALPVIRKDFMIDPYQIVEARAIGADCILLIVSALDDVLMAELAATAK
FT                   SVGLDVLVEVHDGTELERALKTLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVV
FT                   TESGILNRADVELMEVSEVYAFLVGEAFMRADDPGLELKRLFFQERGGVVLGADPD"
FT   CDS_pept        complement(683284..683928)
FT                   /transl_table=11
FT                   /gene="vfr"
FT                   /locus_tag="PLES_06311"
FT                   /product="transcriptional regulator Vfr"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25358"
FT                   /protein_id="CAW25358.1"
FT                   /translation="MVAITHTPKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFII
FT                   KGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEKEGSEQERSAWVRAKVECEVAEISY
FT                   AKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMT
FT                   HPDGMQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGTR"
FT   CDS_pept        684200..684622
FT                   /transl_table=11
FT                   /locus_tag="PLES_06321"
FT                   /product="putative redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25359"
FT                   /protein_id="CAW25359.1"
FT                   /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPDHGGRNLGVRPMEMVL
FT                   IGLGGCTNFDVVSILKKARQPVESCEAFLEAERADEEPKVFTKIHVHFVVKGRGLKEAQ
FT                   VKRAVELSAEKYCSASIMLGRGGVEITHDYEIVELG"
FT   CDS_pept        684942..685736
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="PLES_06331"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25360"
FT                   /db_xref="GOA:B7V612"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V612"
FT                   /protein_id="CAW25360.1"
FT                   /translation="MKSKLKLHGFNNLTKTLSFNIYDICYAETPEDLQAYVQYIDEEYD
FT                   AERLTQILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTPTDSQIEESPGPLPD
FT                   TILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPLKALNYLIHQFDSDIVT
FT                   VDYRVRGFTRDIEGRKHFIDHEINSIQNYLSDDTREAYQMTDVNVYQENLFHTKMLLKD
FT                   FELENYLFGDATRTLSAEQREQVTERLKHEMLEIFYARNMPR"
FT   CDS_pept        complement(685791..686438)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06341"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25361"
FT                   /db_xref="GOA:B7V613"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V613"
FT                   /protein_id="CAW25361.1"
FT                   /translation="MSADRHYSPIDRFLLQADSALRTLLPFSGQPARPSPAIVEPDGEL
FT                   SEEDTRHIAGLMRINHTGEVCAQALYQGQSLTAKLPEVREAMEEAAEEEIDHLAWCEQR
FT                   IRQLGSRPSVLNPIFYGLSFGVGAAAGLVSDRVSLGFVAATEDQVCKHLDEHLAQIPQE
FT                   DRKSRAILEQMRIDEEQHSSNALAAGGLRFPAPVKLGMSLLAKVMTKSTYRI"
FT   CDS_pept        complement(686538..686876)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06351"
FT                   /product="probable HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25362"
FT                   /protein_id="CAW25362.1"
FT                   /translation="MDCLFCKIVAGEVPARKFYEDEEVVAFHDIGPQAPVHFLVIPKRH
FT                   IPTLEHLTEADRPLAGHILFTAQRLAREQGCEEGFRVVMNCNDLGGQTVHHIHMHVLGQ
FT                   RQMHWPPG"
FT   CDS_pept        686955..688436
FT                   /transl_table=11
FT                   /locus_tag="PLES_06361"
FT                   /product="probable ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25363"
FT                   /protein_id="CAW25363.1"
FT                   /translation="MKNDIHDLGLVLDSRVKLILIESWDEPKVMETLTGLAVRRGLGLY
FT                   AWSVTEGVQRLGFGGEPLGGEESRDPVAALRLIKHDQQANLYVLCDLHPFLGDSPTLVR
FT                   LLKEIAMAEGNHRPTVVLVSHALKLPAEVQRFAARFSLSLPSEDELLGIVREEATRWSE
FT                   RNRGARVRTDNRTLQQVVKNLRGLSHAEARLLARNVICNDGAITQEDLPELNRTKFQLL
FT                   DLEGVLSFEYDTARFAEVGGLAALKRWLGERQSAFLAGKPGDQPKGMMLVGVQGAGKSL
FT                   AAKAVAGLWGLPLLRLDFACLYNKYFGETERNLREALRLAEQMAPCVLWMDEVEKGISG
FT                   GDQDNGVSQRVLGTLLTWMAEREAPVFMVATANAIDRLPPELIRKGRFDELFFVDLPTP
FT                   EVRAEIFRIHLQRRELEPAQFDLLLLAAASEGFSGAEIEQAVVAALYAGQARQQAVDQE
FT                   LLLRELSRTSPLSVLMAEKLAALRTWAKGRAVPAD"
FT   CDS_pept        complement(688476..689276)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06371"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25364"
FT                   /protein_id="CAW25364.1"
FT                   /translation="MPRYALITGASSGIGLALAEALARRGRALILVARQRDALESIAYE
FT                   LAQRFGVEVLFRTCDLSEPLQLSGLLHELEQGERQIDLLVNNAGIGTSGPFIDQEWARE
FT                   QELIELNILALARLCHSLGARMVAQGGGQILNIASVAAFQPGAWMSNYYASKAYVLHFS
FT                   EGLREELKERGVKVSVLCPGPTRTAFFREAGMRLGRLDRSKLMMTPEEVALLALRGLDK
FT                   NRALIVPGWRNRLLALSPRLAPRWLVRRLAARINASAVPSVPRG"
FT   CDS_pept        complement(689337..690413)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25365"
FT                   /protein_id="CAW25365.1"
FT                   /translation="MTDQRFKIVFSGELMPDASLETVKDNLARLFKSEPGKIDALFGGR
FT                   PVVLKRELPEAEAERYLTALRQAGANAYKEVDLAASLSLVETPDHNPQVAEETPAQDLP
FT                   PMTCPKCGHEQPSGAECSACGVIIEKYLARQAQLGENAAPAATAAAGASPYTPPSAQVG
FT                   DALPEFGELNVFTTNGRIGRLRYLGWSMAMTLCFLVIMGLGFLLGETVGVAVTALASIA
FT                   FIVIAVMIGVQRLHDLGWSGWLWLLNFVPFVGSVFGILMLVLPGSTGANRYGPPPPANS
FT                   TGVKVLASLIILLPIVGIIAAIALPSYQGYLERANYDGGASAPADPYTTDEQAAAAAAE
FT                   ADEAATAAAEAMEDDDQQ"
FT   CDS_pept        complement(690535..691503)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06391"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25366"
FT                   /protein_id="CAW25366.1"
FT                   /translation="MSLPALLDQRLRLPMVAAPMFLVSNPQLVLACCRSGIVGSFPALN
FT                   QRESSGFEGWLEEIGAGLQALDNPAPYAVNLIVHNTNPRLQADLRICVEHRVPIVITSL
FT                   GAVREVVDAVHSYGGLVFHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFALVA
FT                   EIRQFFDKTLLLAGCINHGHEILAAQMLGADLAYLGTRFIATRESNASDAYKQMILEAR
FT                   AADIVHTPAVSGVPASFMRQSLEAAGYDLKRLTDKADMNYGEKLKPVNDEAKAWKTVWS
FT                   AGQGAGNIDDLPGVDELVARLDREYRAALRNMDRLANRWPR"
FT   CDS_pept        complement(691520..691942)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06401"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25367"
FT                   /protein_id="CAW25367.1"
FT                   /translation="MYLWLKAFHIIAVVCWFAGLFYLPRLFVYHAMSEDQTSRERFCVM
FT                   ERKLYRGIMMPSMLATLVLGLWMLYLTPGWLSQGWLHAKLTLVVLLIGYHHACGAMLKR
FT                   FARGEPGRSHVFYRWFNEVPVLFLLLIVLLVVLKPF"
FT   CDS_pept        692233..693267
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="PLES_06411"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25368"
FT                   /db_xref="GOA:B7V620"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V620"
FT                   /protein_id="CAW25368.1"
FT                   /translation="MIKVGIVGGTGYTGVELLRLLAQHPQARVEVITSRSEAGVKVADM
FT                   YPNLRGHYDDLQFSVPDVQRLGACDVVFFATPHGVAHALAGELLDAGTRVIDLSADFRL
FT                   ADAEEWARWYGQPHGAPALLDEAVYGLPEVNREKIRQARLIAVPGCYPTATQLGLIPLL
FT                   EAGLADASRLIADCKSGVSGAGRGAKVGSLFCEAGESMMAYAVKGHRHLPEISQGLRRA
FT                   SGGDVGLTFVPHLTPMIRGIHATLYAHVADRSVDLQALFEKRYADEPFVDVMPAGSHPE
FT                   TRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQALQNMNILFGLDERLGLSHA
FT                   ALLP"
FT   CDS_pept        693267..693986
FT                   /transl_table=11
FT                   /locus_tag="PLES_06421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25369"
FT                   /protein_id="CAW25369.1"
FT                   /translation="MSGWELQFRDPRRAWLVRLGVGALLLAVPLAFLGGRWSTGADAAR
FT                   SEADAQRQETLIGEQKAELERLRTEIEVLRSGERLSQQATEQSRQTIKLLEDQVFKQQQ
FT                   DIAFYKGVVAPASKADALEIRAFEVQGTDDPQRFRYKVMLSRLGRDDRKLDGRLKVRIS
FT                   GKLARKDATYDLEQLSPELGKTGLSISLRHFQSIPEGGRFAELELPKNFIPKLIDVRAE
FT                   LNGQSKPLQRRFDWPKQ"
FT   CDS_pept        693987..694409
FT                   /transl_table=11
FT                   /locus_tag="PLES_06431"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25370"
FT                   /protein_id="CAW25370.1"
FT                   /translation="MSIMWSKNKGRADVQRFTGQTSLIASGAELVGDMNLKGAVQIDGT
FT                   VRGALQAHEGLVRVSAGGRVDGEIRAPHVIIDGQVDGDIHAIERLELGAQARVKGNLHY
FT                   GLIETAMGAQIEGRLCPMTEASPRPLELPASVETVD"
FT   CDS_pept        694487..694837
FT                   /transl_table=11
FT                   /locus_tag="PLES_06441"
FT                   /product="HesB-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25371"
FT                   /db_xref="GOA:B7V623"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V623"
FT                   /protein_id="CAW25371.1"
FT                   /translation="MSIETFTPTPLLFTPGAANKVKTLIDEEGNPRLKLRVFVTGGGCS
FT                   GFQYGFTFDEDIADDDTVIERDGVGLVVDPMSFQYLAGSEVDYQEGLEGSRFVIKNPNA
FT                   ATTCGCGQSFSI"
FT   CDS_pept        complement(694891..695982)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06451"
FT                   /product="putative chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25372"
FT                   /protein_id="CAW25372.1"
FT                   /translation="MPRYLGLMSGTSLDGMDIVLIEQGDRTTLLASHYLPMPAGLREDI
FT                   LALCVPGPDEIARAAEVEQRWVALAAQGVRELLLQQQMSPDEVRAIGSHGQTIRHEPAR
FT                   HFTVQIGNPALLAELTGIDVVADFRRRDVAAGGQGAPLVPAFHQALFGDDDASRAVLNI
FT                   GGFSNVSLLSPGKPVRGFDCGPGNVLMDAWIHHQRGEHFDRDGAWAASGQMNHALLASL
FT                   LADEFFAARGPKSTGRERFNLSWLQEHLARHPALPAADIQATLLELSARSISESLLDAQ
FT                   PDCKEVLVCGGGAFNTALMKRLALLMPEARVASTDEYGIPPAWMEGMAFAWLAHRFLER
FT                   LPGNCPDVTGALGPRTLGALYPA"
FT   CDS_pept        complement(695985..697328)
FT                   /transl_table=11
FT                   /locus_tag="PLES_06461"
FT                   /product="putative metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25373"
FT                   /protein_id="CAW25373.1"
FT                   /translation="MFPSSEVEAKRTTLNLELESNTDRLLQEKDDLLPQSVTNSSDEGT
FT                   PFAQVEGASDDNTAEQDSDKPGTSVADADTKPVDPEWKTITVASGDTLSTVFTKAGLST
FT                   SAMHDMLTSSKDAKRFTHLKVGQEVKLKLDPKGELQALRVKQSELETIGLDKTDKGYSF
FT                   KREKAQIDLHTAYAHGRITSSLFVAGRNAGLPYNLVTSLSNIFGYDIDFALDLREGDEF
FT                   DVIYEQHKVNGKQVATGNILAARFVNRGKTYTAVRYTNKQGNTSYYRADGSSMRKAFIR
FT                   TPVDFARISSRFSLGRRHPILNKIRAHKGVDYAAPIGTPIKATGDGKILEAGRKGGYGN
FT                   AVVIQHGQRYRTIYGHMSRFAKGIRAGTSVKQGQIIGYVGMTGLATGPHLHYEFQINGR
FT                   HVDPLSAKLPMADPLGGADRKRFMAQTQPMIARMDQEKKTLLALNKQR"
FT   CDS_pept        697613..698812
FT                   /transl_table=11
FT                   /gene="tyrZ"
FT                   /locus_tag="PLES_06471"
FT                   /product="tyrosyl-tRNA synthetase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25374"
FT                   /protein_id="CAW25374.1"
FT                   /translation="MKSVEEQLALIQRGADEILVEAELVAKLKRGQPLRIKAGFDPTAP
FT                   DLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSVTRPPLTREQVLENAETY
FT                   KSQVFKILDPAKTEVAFNSTWMDQLTPADFIRLASQYTVARMLERDDFSKRYASNQPIA
FT                   IHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRAYGQEAQVILTMPLLEGLD
FT                   GVKKMSKSLGNYIGIQEAPGVMYSKLVSIPDTLMWRYFELLSFRSLDEIDSFRKDVEAG
FT                   ANPRDIKIKLAEEIVARFHGEEAAASAHKSAGNRLKDGELPEDLPEIELSSPEDMPVAS
FT                   VLNKAGLVKNAAAARDLLGAGSVKVDGQVVDRTFMLALGETRMFQAGKKAFARITLKAE
FT                   "
FT   rRNA            699352..700887
FT                   /locus_tag="PLES_06472"
FT                   /product="16S ribosomal RNA"
FT   tRNA            700952..701028
FT                   /locus_tag="PLES_06473"
FT                   /product="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:700986..700988,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 83.35"
FT   tRNA            701057..701132
FT                   /locus_tag="PLES_06474"
FT                   /product="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:701090..701092,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 72.95"
FT   rRNA            701359..704249
FT                   /locus_tag="PLES_06475"
FT                   /product="23S ribosomal RNA"
FT   rRNA            704391..704510
FT                   /locus_tag="PLES_06476"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        704670..705608
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="PLES_06481"
FT                   /product="BirA bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25375"
FT                   /protein_id="CAW25375.1"
FT                   /translation="MQTLLKLLQDGRFHSGEELGAVLGISRSAVWKRLQHLEAEHGLQF
FT                   HKVRGRGYRLASPLSLLDPRKIDSLWPVEIMPTVDSTNSEAMRRLAAGASTPFVIVAEQ
FT                   QTAGRGRRGRAWVSPYGENLYYSLAITVRGGARELEGLSLVVGLAVLRALESLGVRDAG
FT                   LKWPNDLLQGGKKIAGILLELSGDPADLCHVVIGIGINVNMKTATDIGQPWTSLREALG
FT                   ELVDRSRLLSALNRQLADYLDRHSREGFAASREEWESCNLWQGAQVILSTALSSIEGRV
FT                   LGVDSRGALRLEVDGVEQGFSGGELSLRLRQ"
FT   CDS_pept        705605..706351
FT                   /transl_table=11
FT                   /locus_tag="PLES_06491"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25376"
FT                   /db_xref="GOA:B7V628"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V628"
FT                   /protein_id="CAW25376.1"
FT                   /translation="MILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQAL
FT                   PVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWL
FT                   ALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYD
FT                   DAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAEL
FT                   VRDELAGARIMPDLVFVGLALACPIE"
FT   CDS_pept        706360..707064
FT                   /transl_table=11
FT                   /locus_tag="PLES_06501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25377"
FT                   /protein_id="CAW25377.1"
FT                   /translation="MRWFFLFLLALNVFYYVWHQQQSPLRAKEIAPLELYKDGQKNILL
FT                   LAESNLASRARSGSQVPAPSVPPAAEESIASESACLYLGGGGEEADARRLQQRLLGLDI
FT                   EAEVEARGEMSVDYWVYLPPLASREAALRQLKELQARNIDSYLIGEGVLANGISLGMFS
FT                   ARDSAESAQARLKTAGYEAELKELPRGQRDFWVRVAPGSRRLVDEQLLQELARDFKGLQ
FT                   HQIMSCKGVASP"
FT   tRNA            707212..707296
FT                   /locus_tag="PLES_06502"
FT                   /product="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:707246..707248,aa:Tyr)"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 51.85"
FT   tRNA            707323..707396
FT                   /locus_tag="PLES_06503"
FT                   /product="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:707355..707357,aa:Gly)"
FT                   /note="tRNA Gly anticodon TCC, Cove score 74.75"
FT   tRNA            707416..707491
FT                   /locus_tag="PLES_06504"
FT                   /product="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:707449..707451,aa:Thr)"
FT                   /note="tRNA Thr anticodon GGT, Cove score 75.20"
FT   CDS_pept        707576..708769
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="PLES_06511"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25378"
FT                   /protein_id="CAW25378.1"
FT                   /translation="MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDF
FT                   PGDDTPIIIGSALMALEGKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRVERGIIKVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGIL
FT                   LRGTKREDVERGQVLAKPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGNCELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   tRNA            708825..708900
FT                   /locus_tag="PLES_06512"
FT                   /product="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:708858..708860,aa:Trp)"
FT                   /note="tRNA Trp anticodon CCA, Cove score 69.19"
FT   CDS_pept        708946..709314
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="PLES_06521"
FT                   /product="secretion protein SecE"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25379"
FT                   /protein_id="CAW25379.1"
FT                   /translation="MNAKAEAKESRFDLLKWLLVAVLVVVAVVGNQYFSAQPILYRVLG
FT                   ILVLAVIAAFLALQTAKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMAL
FT                   LLWGLDSLLGWLVSMIVG"
FT   CDS_pept        709324..709857
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="PLES_06531"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25380"
FT                   /protein_id="CAW25380.1"
FT                   /translation="MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEEEFGEILVPTEEV
FT                   VEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDREA
FT                   DAILRRVADSGDKPKPKTLFEPGETVRVIDGPFADFNGVVEEVNYEKSRIQVAVLIFGR
FT                   STPVELEFSQVEKV"
FT   CDS_pept        709974..710405
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="PLES_06541"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25381"
FT                   /db_xref="GOA:B7V633"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V633"
FT                   /protein_id="CAW25381.1"
FT                   /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAK
FT                   TQGQEPGLPTPVIITVYSDRSFTFETKSTPAAVLLKKAAGITSGSARPNSQKVGTVTRA
FT                   QLEEIAKTKQADLTAADLDAAVRTIAGSARSMGLNVEGV"
FT   CDS_pept        710405..711100
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="PLES_06551"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25382"
FT                   /db_xref="GOA:B7V634"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V634"
FT                   /protein_id="CAW25382.1"
FT                   /translation="MAKLTKRQKAIAEKVVAGKQYSFEEAAKLLAELSTIKFKESVDVA
FT                   VNLGVDPRKSDQVVRGATVLPNGTGKSVRVAVFTQGPAAEAALAAGADKVGMDELAAEM
FT                   KGGDLNYDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVRF
FT                   RTDKNGIIHSSVGKVDFEPAKLQQNVEALLADLKRLKPSSSKGVYVKRVTLSTTMGPGL
FT                   QIDLASLEA"
FT   misc_RNA        complement(711107..711299)
FT                   /locus_tag="PLES_06552"
FT   CDS_pept        711299..711799
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="PLES_06561"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25383"
FT                   /db_xref="GOA:B7V635"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V635"
FT                   /protein_id="CAW25383.1"
FT                   /translation="MAIKLEDKKAIVAEVNEAAKAALSAVVADARGVTVGAMTGLRKEA
FT                   REAGVYVKVVRNTLLKRAVEGTQFDVLNDVFKGPTLIAFSNEHPGAAARIFREFAKGQD
FT                   KFEIKAAAFEGQFLAANQIDVLASLPTYDEAVSQLMSVIQGATSKLARTLAAIRDQKEA
FT                   AAA"
FT   CDS_pept        711878..712246
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="PLES_06571"
FT                   /product="50S ribosomal protein L7 / L12"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25384"
FT                   /db_xref="GOA:B7V636"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V636"
FT                   /protein_id="CAW25384.1"
FT                   /translation="MALTNEDIINAVSEMSVMQVVELIKAMEEKFGVTAAAATVAAAGP
FT                   AAAAAEEQTEFTIVLAEAGDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASKEE
FT                   AEAAKKALEEAGAKVELK"
FT   misc_RNA        712252..712317
FT                   /locus_tag="PLES_06572"
FT   CDS_pept        712468..716541
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="PLES_06581"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25385"
FT                   /db_xref="GOA:B7V637"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V637"
FT                   /protein_id="CAW25385.1"
FT                   /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGATK
FT                   EQFRDIGLHAAFKSVFPIISYSGNAALEYVGYRLGEPAFDVKECVLRGVTFAVPLRVKV
FT                   RLIIFDRESSNKAIKDIKEQEVYMGEIPLMTENGTFIINGTERVIVSQLHRSPGVFFDH
FT                   DRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALGYSTE
FT                   EILNAFYATNVFHIKGETLNLELVPQRLRGEVASIDIKDGSGKVIVEQGRRITARHINQ
FT                   LEKAGVSQLEVPFDYLIGRTIAKAIVHPATGEIIAECNTELTLDLLAKVAKAQVVRIET
FT                   LYTNDIDCGPFISDTLKIDNTSNQLEALVEIYRMMRPGEPPTKEAAETLFGNLFFSAER
FT                   YDLSAVGRMKFNRRIGRTEIEGPGVLSKEDIIDVLKTLVDIRNGKGIVDDIDHLGNRRV
FT                   RCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAIKEFFGSSQLS
FT                   QFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGL
FT                   INSLATYARTNKYGFLESPYRVVKDSLVTDEIVFLSAIEEADHVIAQASATLNEKGQLV
FT                   DELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDANRALMGSNMQRQA
FT                   VPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRVVVRVADDEVETGEAGV
FT                   DIYNLTKYTRSNQNTCINQRPLVSKGDVVARGDILADGPSTDMGELALGQNMRVAFMPW
FT                   NGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEITADIPNVGEAALNKLD
FT                   EAGIVYVGAEVQAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPTGTK
FT                   GTVIDVQVFTRDGVERDSRALSIEKMQLDQIRKDLNEEFRIVEGATFERLRAALVGAKA
FT                   EGGPALKKGTEITDDYLDGLERGQWFKLRMADDALNEQLEKAQAYISDRRQLLDDKFED
FT                   KKRKLQQGDDLAPGVLKIVKVYLAIKRRIQPGDKMAGRHGNKGVVSVIMPVEDMPHDAN
FT                   GTPVDIVLNPLGVPSRMNVGQILETHLGLAAKGLGEKINRMLEEQRKVAELRKFLHEIY
FT                   NEIGGREENLDELGDNEILALAKNLRGGVPMATPVFDGAKEREIKAMLKLADLPESGQM
FT                   RLFDGRTGNQFERPTTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQR
FT                   FGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEAGMPESFNVLIK
FT                   EIRSLGIDIELETE"
FT   CDS_pept        716607..720806
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="PLES_06591"
FT                   /product="DNA-directed RNA polymerase beta* chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25386"
FT                   /protein_id="CAW25386.1"
FT                   /translation="MKDLLNLLKNQGQIEEFDAIRIGLASPEMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDE
FT                   QYFEALEEFGDDFDARMGAEAVHELLNAIDLEHEIGRLREEIPQTNSETKIKKLSKRLK
FT                   LMEAFQGSGNKPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEGRGMATTIKAAKK
FT                   MVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVMGLYYMTREA
FT                   INAKGEGMAFADLQEVDRAYRSGQASLHARVKVRINEKIKGEDGQLTANTRIVDTTVGR
FT                   ALLFQVVPAGLPFDVVNQSMKKKAISKLINHCYRVVGLKDTVIFADQLMYTGFAYSTIS
FT                   GVSIGVNDFVIPDEKARIINAATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVS
FT                   KAMMANLSKEKVVDREGKEVDQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEI
FT                   DCGTEHGLLMSPHIEGGDVVEPLGERVLGRVIARDVFKPGSDEVIVPAGTLIDEKWVDF
FT                   LEVMSVDEVVVRSPITCETRHGICAMCYGRDLARGHRVNIGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRTSAADNVQVKNGGTIRLHNLKHVVRADGALVAVSRSGELAVADDFG
FT                   RERERYKLPYGAVISVKEGDKVDPGAIVAKWDPHTHPIVTEVDGTVAFVGMEEGITVKR
FT                   QTDELTGLTNIEVMDPKDCPAAGKDIRPAVKLIDAAGKDLLLPGTDVPAQYFLPANALV
FT                   NLTDGAKVSIGDVVARIPQETSKTRDITGGLPRVADLFEARRPKEPSILAEISGTISFG
FT                   KETKGKRRLVITPNDGSDPYEELIPKWRHLNVFEGEQVNRGEVISDGPSNPHDILRLLG
FT                   VSSLAKYIVNEIQDVYRLQGVKINDKHIETILRQMLRKVEVSESGDSSFIKGDQVELTQ
FT                   VLEENEQLGTEDKFPAKYERVLLGITKASLSTESFISAASFQETTRVLTEAAVTGKRDF
FT                   LRGLKENVVVGRLIPAGTGLAYHSERKRQRDLGKPQRVSASEAEAALTEALNSSGN"
FT   CDS_pept        720958..721329
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="PLES_06601"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25387"
FT                   /db_xref="GOA:B7V639"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V639"
FT                   /protein_id="CAW25387.1"
FT                   /translation="MATINQLVRKPRKRMVDKSDVPALQNCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   SGVKDRKQGRSKYGAKRPK"
FT   CDS_pept        721429..721899
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="PLES_06611"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25388"
FT                   /db_xref="GOA:B7V640"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V640"
FT                   /protein_id="CAW25388.1"
FT                   /translation="MPRRRVAAKREVLADPKYGSQILAKFMNHVMESGKKAVAERIVYG
FT                   ALDKVKERGKADPLETFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWL
FT                   VDFARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF"
FT   CDS_pept        721930..724050
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="PLES_06621"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25389"
FT                   /protein_id="CAW25389.1"
FT                   /translation="MARTTPINRYRNIGICAHVDAGKTTTTERVLFYTGVNHKLGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWKGSRGQYDNYRVNVIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRIVYVNKMDRQGANFLRVVEQIKKRLG
FT                   HTPVPVQLAIGAEENFVGQVDLIKMKAIYWNDDDKGMTYREEEIPAELKDLAEEWRSSM
FT                   VEAAAEANEELMNKYLEEGELSEAEIKEGLRLRTLACEIVPAVCGSSFKNKGVPLVLDA
FT                   VIDYLPAPTEIPAIKGVSPDDETVEDERHADDNEPFSSLAFKIATDPFVGTLTFARVYS
FT                   GVLSSGDSVLNSVKGKKERVGRMVQMHANQREEIKEVRAGDIAALIGMKDVTTGDTLCS
FT                   IEKPIILERMDFPEPVISVAVEPKTKADQEKMGIALGKLAQEDPSFRVKTDEESGQTII
FT                   SGMGELHLDIIVDRMKREFGVEANIGKPQVAYRETITKDNVEIEGKFVRQSGGRGQFGH
FT                   CWIRFSAADVDEKGNITEGLVFENEVVGGVVPKEYIPAIQKGIEEQMKNGVVAGYPLIG
FT                   LKATVFDGSYHGVDSNEMAFKIAASMATKQLAQKGGGKVLEPIMKVEVVTPEDYMGDVM
FT                   GDLNRRRGLIQGMEDTVSGKVIRAEVPLGEMFGYATDVRSMSQGRASYSMEFSKYAEAP
FT                   SNIVEALVKKQG"
FT   CDS_pept        724081..725274
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="PLES_06631"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25390"
FT                   /protein_id="CAW25390.1"
FT                   /translation="MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDF
FT                   PGDDTPIIIGSALMALEGKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRVERGIIKVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGIL
FT                   LRGTKREDVERGQVLAKPGTIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGNCELPEGVEMVMPGDNIKMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   CDS_pept        725431..725742
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="PLES_06641"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25391"
FT                   /db_xref="GOA:B7V643"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V643"
FT                   /protein_id="CAW25391.1"
FT                   /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISLG"
FT   CDS_pept        725825..726460
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="PLES_06651"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25392"
FT                   /db_xref="GOA:B7V644"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V644"
FT                   /protein_id="CAW25392.1"
FT                   /translation="MTIGVVGRKCGMTRIFTEEGVSIPVTVIEVEPNRVTQFKTEETDG
FT                   YRAVQVTAGERRASRVTKAQAGHFAKANVAAGRGVWEFRLGEEQYAAGDQITVDLFQAG
FT                   QMVDVTGESKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKKMSG
FT                   HLGAERVTVQSLEIVRVDAERNLLLVKGAVPGATGGDVIVRPAAKARG"
FT   CDS_pept        726474..727076
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="PLES_06661"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25393"
FT                   /db_xref="GOA:B7V645"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V645"
FT                   /protein_id="CAW25393.1"
FT                   /translation="MQLNVSGAQAIEVSERTFGGEFNETLVHQAVVAYMAGGRQGSKAQ
FT                   KTRSEVSGGGKKPWRQKGTGRARAGTIRSPIWRGGGTTFAAKPRSHEQKLNKKMYRAAL
FT                   RSILAELVRLDRLVVVADFAVDAPKTKGLVAKLDTLGLKDVLIVTDGVDENLYLAARNL
FT                   AHVDVRDVQGSDPVSLIAYDKVLVTVSAVKKFEELLG"
FT   CDS_pept        727073..727372
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="PLES_06671"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25394"
FT                   /db_xref="GOA:B7V646"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V646"
FT                   /protein_id="CAW25394.1"
FT                   /translation="MNQERVFKVLLGPHISEKATGLADGKSQFVFKVATDATKLEIKKA
FT                   VESLFSVKVQRVTTLNVKGKTKRTARGLGKRNDWKKAYIALQPGQDLDFATSAE"
FT   CDS_pept        727384..728205
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="PLES_06681"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25395"
FT                   /db_xref="GOA:B7V647"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V647"
FT                   /protein_id="CAW25395.1"
FT                   /translation="MAIVKCKPTSAGRRFVVKVVNQELHKGAPYAPLLEKKSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFRRNKDGIPAIVERVEYDPNRTAHIALLKYADGERRYI
FT                   IAPKGVAAGDQLISGIGAPIKAGNSMPLRNIPVGSTVHGIELKPGKGAQIARSAGASAQ
FT                   LVAREGAYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGATRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSAGRHPVSPWGLQTKGKKTRSNKRTDNMIVRRRK"
FT   CDS_pept        728222..728497
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="PLES_06691"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25396"
FT                   /db_xref="GOA:B7V648"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V648"
FT                   /protein_id="CAW25396.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPIKTWSRRSMILPHMV
FT                   GLTIAVHNGRQHVPVLVNEDMVGHKLGEFAATRTYRGHAADKKAKR"
FT   CDS_pept        728510..728842
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="PLES_06701"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25397"
FT                   /db_xref="GOA:B7V649"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V649"
FT                   /protein_id="CAW25397.1"
FT                   /translation="MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAE
FT                   IMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHIT
FT                   VKVADK"
FT   CDS_pept        728855..729541
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="PLES_06711"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25398"
FT                   /protein_id="CAW25398.1"
FT                   /translation="MGQKVHPNGIRLGIVKEHTSVWYADRKNYADYLFADLKVREYLQD
FT                   KLKSASVSRIDIHRPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIE
FT                   EIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPVAPAP
FT                   RKKAAR"
FT   CDS_pept        729553..729966
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="PLES_06721"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25399"
FT                   /db_xref="GOA:B7V651"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V651"
FT                   /protein_id="CAW25399.1"
FT                   /translation="MLQPKRTKFRKQMTGHNRGLAHRGSKVSFGEYALKATSRGRLTAR
FT                   QIESARRALTRHVKRGGKIWIRVFPDKPVTKKPLEVRMGKGKGGVEYWVAQIQPGKVLY
FT                   EIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
FT   CDS_pept        729966..730157
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="PLES_06731"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25400"
FT                   /db_xref="GOA:B7V652"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V652"
FT                   /protein_id="CAW25400.1"
FT                   /translation="MKANELREKSVEQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLSQ
FT                   VKRDIARVKTVLNQQAGK"
FT   CDS_pept        730160..730426
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="PLES_06741"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25401"
FT                   /db_xref="GOA:B7V653"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V653"
FT                   /protein_id="CAW25401.1"
FT                   /translation="MAEAQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRST
FT                   KLHAHDESNQCRIGDLVTIRETRPLAKTKAWTLVDIVERAVEV"
FT   CDS_pept        730450..730818
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="PLES_06751"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25402"
FT                   /db_xref="GOA:B7V654"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V654"
FT                   /protein_id="CAW25402.1"
FT                   /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKE
FT                   AIPRGKVKKGQVMTAVVVRTKHGVRRTDGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   CDS_pept        730831..731145
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="PLES_06761"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25403"
FT                   /db_xref="GOA:B7V655"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V655"
FT                   /protein_id="CAW25403.1"
FT                   /translation="MQKIRRDDEVIVIAGKDKGKRGKVLKVLADDRLVVGGVNLIKRHT
FT                   KPNPMLGQQGGIVEKEAPLHVSNVAIFNTETSKADRVGFKVEDGKKIRVFKSTQKPVQA
FT                   "
FT   CDS_pept        731165..731704
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="PLES_06771"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25404"
FT                   /db_xref="GOA:B7V656"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V656"
FT                   /protein_id="CAW25404.1"
FT                   /translation="MARLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVG
FT                   DKKIIENAVADLEKITGQKPVVTYARKSIAGFKIREGWPIGVKVTLRSDRMYEFLDRLL
FT                   SISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTARTD
FT                   DEGRALLRAFKFPFRN"
FT   CDS_pept        731718..732023
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="PLES_06781"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25405"
FT                   /db_xref="GOA:B7V657"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V657"
FT                   /protein_id="CAW25405.1"
FT                   /translation="MAKESMKNRELKRQLTVAKYAKKRAELKAIIANPNSSAEERWNAQ
FT                   VALQKQPRDASASRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKASW"
FT   CDS_pept        732213..732605
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="PLES_06791"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25406"
FT                   /db_xref="GOA:B7V658"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V658"
FT                   /protein_id="CAW25406.1"
FT                   /translation="MSMQDPLADMLTRIRNAQMAEKTVVSMPSSKLKAAVAKVLKDEGY
FT                   IADFQISSEVKPQLSIELKYFEGKPVIEEVKRISRPGLRQYKSVEQLPKVRGGLGVSIV
FT                   STNKGVMTDRAARAAGVGGEVLCTVF"
FT   CDS_pept        732617..733150
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="PLES_06801"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25407"
FT                   /db_xref="GOA:B7V659"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V659"
FT                   /protein_id="CAW25407.1"
FT                   /translation="MSRVAKNPVKLPAGVEIKLAGQQLSIKGAKGALELKVHPSVEVIQ
FT                   DSGELRFAARNGDQQTRAMAGTTRALVNNMVVGVSQGFERKLQLVGVGYKAQAKGQVLS
FT                   LSLGFSHPVDYELPAGIVAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGKGVR
FT                   YADEVVRRKEAKKK"
FT   CDS_pept        733161..733511
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="PLES_06811"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25408"
FT                   /db_xref="GOA:B7V660"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V660"
FT                   /protein_id="CAW25408.1"
FT                   /translation="MSVKKETRLRRARKARLKMRELETVRLCVYRSSQHIYAQVIAADG
FT                   GKVLASASTLDKDLREGATGNIDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGRVKA
FT                   LADAAREGGLEF"
FT   CDS_pept        733515..734015
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="PLES_06821"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25409"
FT                   /db_xref="GOA:B7V661"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V661"
FT                   /protein_id="CAW25409.1"
FT                   /translation="MANNEQKRDEGYIEKLVQVNRVAKTVKGGRIFAFTALTVVGDGKG
FT                   RVGFGRGKAREVPAAIQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGT
FT                   GIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKNMQAPEAVAAKRGKSVE
FT                   EIL"
FT   CDS_pept        734018..734194
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="PLES_06831"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25410"
FT                   /db_xref="GOA:B7V662"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V662"
FT                   /protein_id="CAW25410.1"
FT                   /translation="MATVKVTLVKSLNGRLANHKACVKGLGLRRINHTVEVQDTPENRG
FT                   MINKAYYLLRVEG"
FT   CDS_pept        734198..734632
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="PLES_06841"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25411"
FT                   /db_xref="GOA:B7V663"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V663"
FT                   /protein_id="CAW25411.1"
FT                   /translation="MQLNDLRSAPGARREKHRPGRGIGSGLGKTGGRGHKGLTSRSGGK
FT                   VAPGFEGGQQPLHRRLPKFGFVSLKAMDRAEVRTSELAKVEGDVVSLQTLKDANLINQH
FT                   VQRVKVMLSGEVGRAVTLKGIAATKGARAAIEAAGGKFED"
FT   CDS_pept        734633..735961
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="PLES_06851"
FT                   /product="secretion protein SecY"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25412"
FT                   /protein_id="CAW25412.1"
FT                   /translation="MAKQGALSALSNGGLSELWARLRFLFLAIIVYRIGAHIPVPGINP
FT                   DRLAALFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAISPQLEQL
FT                   KKEGESGRRKISQYTRYGTVVLALVQAIGMSVGLGSQGVAFSNDFGFYFVAVTTFVAGA
FT                   MFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARQGDINIFALIGVGLLA
FT                   VAIIAFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLF
FT                   PASLGSWFGQSEGLGWLQDVAQAIAPGQPLNILLFTAGIVFFCFFYTALMFNPKDVAEN
FT                   LKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMTAVCLLPQFLVVAAHVPFYLGGT
FT                   SLLIVVVVVMDFMAQVQSHLVSHQYESLMKKANLKGYGSGMLR"
FT   CDS_pept        736237..736593
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="PLES_06861"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25413"
FT                   /db_xref="GOA:B7V665"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V665"
FT                   /protein_id="CAW25413.1"
FT                   /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQSICAATGVNPAAKI
FT                   KDLSDEQIDQLRNEVAKITTEGDLRREINMNIKRLMDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   CDS_pept        736612..737001
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="PLES_06871"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25414"
FT                   /db_xref="GOA:B7V666"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V666"
FT                   /protein_id="CAW25414.1"
FT                   /translation="MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNACG
FT                   YKIASITDVTPIPHNGCRPPKKRRV"
FT   CDS_pept        737018..737638
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="PLES_06881"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25415"
FT                   /db_xref="GOA:B7V667"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V667"
FT                   /protein_id="CAW25415.1"
FT                   /translation="MARYIGPKCKLSRREGTDLFLKSGARALDSKCKAENVPGQHGQRR
FT                   GRLSDYGLQLREKQKVRRIYGVLERQFRGYYQEASRRKGSTGENLLQLLECRLDNVVYR
FT                   MGFGSTRSESRQLVSHKAITVNGQTVNIPSYQVKAGDVVAVREKSKNQLRIAQALELCG
FT                   QRGRVEWVEVDLDKKAGTFKSAPARSDLSADINENLIVELYSK"
FT   CDS_pept        737661..738662
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="PLES_06891"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25416"
FT                   /protein_id="CAW25416.1"
FT                   /translation="MQSSVNEFLTPRHIDVQVVSQTRAKITLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLTLAK
FT                   KGSGVVTAADIQLDHDVEIINGDHVIANLADNGALNMKLKVARGRGYEPADARQSDEDE
FT                   SRSIGRLQLDASFSPVRRVSYVVENARVEQRTNLDKLVLDLETNGTLDPEEAIRRAATI
FT                   LQQQLAAFVDLKGDSEPVVEEQEDEIDPILLRPVDDLELTVRSANCLKAENIYYIGDLI
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
FT   CDS_pept        738706..739095
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="PLES_06901"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25417"
FT                   /db_xref="GOA:B7V669"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V669"
FT                   /protein_id="CAW25417.1"
FT                   /translation="MRHRKSGRHLSRTSAHRKAMFQNMAVSLFEHELIKTTLPKAKELR
FT                   RVAEPLITLAKEDSVANRRLAFDRTRSKAAVGKLFNDLGKRYANRPGGYLRILKCGFRA
FT                   GDNAPMAYVELVDRPVGGEVVEAAE"
FT   CDS_pept        739377..740825
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="PLES_06911"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25418"
FT                   /protein_id="CAW25418.1"
FT                   /translation="MEEKTRLTTAAGAPVVDNQNVQTAGPRGPMLLQDVWFLEKLAHFD
FT                   REVIPERRMHAKGSAAYGTFTVTHDITPYTRAKIFSQVGKKTDMFLRFSTVAGERGAAD
FT                   AERDIRGFSMRFYTEQGNWDLVGNNTPVFYLRDPLKFPDLNHVVKRDPRTNLRNATFKW
FT                   DFFSHLPESLHQLTIDFSDRGLPKSYRHIHGFGSHTFSFINANNERFWVKFHFKTQQGI
FT                   ENLTNAEAAEVIAQDRESSQRDLYESIEKGDFPRWKMYVQIMPEKEAATYRYNPFDLTK
FT                   VWPHGDYPLIEVGFFELNRNPDNYFAEVEQAAFTPANVVPGIGFSPDKMLQGRLFSYGD
FT                   AHRYRLGVNHHQIPVNAARCPHQVYHRDGGMRVDGNNAHQRVTYEPNSFNQWQEQPDFS
FT                   EPPLSLEGAADHWNHRVDDDYYSQPAALFHLFTDEQKQRLFANIAEDIRDVPEQIQRRQ
FT                   IGLFLKVDPAYGKGVADALGLKLD"
FT   CDS_pept        740956..741420
FT                   /transl_table=11
FT                   /gene="bfrA"
FT                   /locus_tag="PLES_06921"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25419"
FT                   /protein_id="CAW25419.1"
FT                   /translation="MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLN
FT                   HEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGI
FT                   ALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI"
FT   CDS_pept        complement(741492..744335)
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="PLES_06931"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25420"
FT                   /protein_id="CAW25420.1"
FT                   /translation="MDKILIRGARTHNLKNVDLTLPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARVGTPRCPDHDIPLEAQTVSQMVDQVLALPEGSKLMLLAPVIRERKGEHL
FT                   AVFDEMRAQGFVRARVDGKLYELDEVPKLDKQKKHSIDVVVDRFKVRADLQQRLAESFE
FT                   TALSLADGIALVAPMDEDEDEDVEEIIFSARFACPVCGHSISELEPKLFSFNNPAGACP
FT                   TCDGLGVKQFFDARRVVNGELTLAEGAIRGWDRRNVYYFQMLGSLAQHYGFSLEEPFDE
FT                   LGAEHQKVVLYGSGRENVDFRYLNDRGDIVKRSHPFEGILPNLERRYRETESATVREEL
FT                   AKFLSTQPCPDCHGTRLRREARHVWVGDRTLPAITAMPVGEACEYAAGLSLTGRRGEIA
FT                   AKILKEIRDRLQFLVNVGLDYLTLDRSADTLSGGEAQRIRLASQIGAGLVGVMYILDEP
FT                   SIGLHQRDNERLLGTLTHLRNLGNTVIVVEHDEDAIRLADYVVDIGPGAGVHGGQVVAE
FT                   GTPDQVMNHPDSLTGKYLSGRKKIAVPAKRTPRDKKKLLKLKGARGNNLQNVNLEIPVG
FT                   LFTCITGVSGSGKSTLINNTLFPITATALNGATTLEVAPYDSFDGLQHLDKVVDIDQSP
FT                   IGRTPRSNPATYTGLFTPIRELFSGVPEARSRGYGPGRFSFNVKGGRCEACQGDGVIKV
FT                   EMHFLPDIYVPCDVCKGKRYNRETLEIRYKGKSIHEVLEMTIEEAREFFDAVPALARKL
FT                   QTLMDVGLSYIKLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILDEPTTGLHFADIQ
FT                   QLLDVLHRLRDHGNTVVVIEHNLDVIKTADWLVDLGPEGGSKGGQIIANGTPEQVAEMP
FT                   QSHTGHFLKPLLERDRA"
FT   CDS_pept        744549..745937
FT                   /transl_table=11
FT                   /locus_tag="PLES_06941"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25421"
FT                   /protein_id="CAW25421.1"
FT                   /translation="MHDSHTERMSGTETRAAVGLSLVFAFRMLGMFMVLPVLATYGQDL
FT                   AGATPALIGLAIGAYGLTQAILQIPFGTISDRIGRRPVIVVGLLIFAAGAALAANADSI
FT                   WGVIAGRVLQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGVSFAVAMVLGPVLTH
FT                   LFGLHGLFWFTAGMALVGLLLILFFVPQPDHMTQHRESSVARQALLPTLKHGDLLRLDA
FT                   GILILHAILMASFVALPLALVHEGGLPKEQHWWVYLTALLVGFFGMVPFIIYAEKKRRM
FT                   KRVLTGAVATLLACELFFLVFGHSLAMLVVGTVVFFTAFNLLEASLPSLVSKVSPAGGK
FT                   GTAMGVYSTSQFLGAALGGILGGWMFQHGGLSMVFIGCAVLAALWLAIAVTMREPPYVT
FT                   SIRLPLAPAALQDAVLVQRFRALPGVADAVVVAEEAAAYVKVDTQQVDRTALERLAQAA
FT                   PGGC"
FT   CDS_pept        745954..746451
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="PLES_06951"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25422"
FT                   /protein_id="CAW25422.1"
FT                   /translation="MARGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESWKDKQT
FT                   GQQQERTEWHRVVFFGRLAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQDRYTTEIVVD
FT                   INGNMQLLGGRPSGDDSQRAPREPMQRPQQAPQQQSRPAPQQQPAPQPAQDYDSFDDDI
FT                   PF"
FT   CDS_pept        complement(746540..747970)
FT                   /transl_table=11
FT                   /gene="pchA"
FT                   /locus_tag="PLES_06961"
FT                   /product="salicylate biosynthesis isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25423"
FT                   /protein_id="CAW25423.1"
FT                   /translation="MSRLAPLSQCLHALRGTFERAIGQAQALDRPVLVAASFEIDPLDP
FT                   LQVFGAWDDRQTPCLYWEQPELAFFAWGSALELQGHGEQRFARIEENWQLLCADAVVEG
FT                   PLAPRLCGGFRFDPRGPREEHWQAFADASLMLAGITVLREGERYRVLCQHLAKPGEDAL
FT                   ALAAYHCSALLRLRQPARRRPSEPTAGAQGDASAQERRQWEAKVSDAVSSVRQGRFGKV
FT                   VLARTQARPLGDIELWQVIEHLRLQHADAQLFACRRGNACFLGASPERLVRIRAGEALT
FT                   HALAGTIARGGDAQEDARLGQALLDSAKDRHEHQLVVEAIRTALEPFSEVLEIPDAPGL
FT                   KRLARVQHLNTPIRARLADAGGILRLLQALHPTPAVGGYPRSAALDYIRQHEGMDRGWY
FT                   AAPLGWLDGEGNGDFLVALRSALLTPGRGYLFAGCGLVGDSEPAHEYRETCLKLSAMRE
FT                   ALSAIGGLDEVPLQRGVA"
FT   CDS_pept        complement(747967..748272)
FT                   /transl_table=11
FT                   /gene="pchB"
FT                   /locus_tag="PLES_06971"
FT                   /product="salicylate biosynthesis protein PchB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25424"
FT                   /protein_id="CAW25424.1"
FT                   /translation="MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASE
FT                   AAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYWRQTRGAA"
FT   CDS_pept        complement(748272..749027)
FT                   /transl_table=11
FT                   /gene="pchC"
FT                   /locus_tag="PLES_06981"
FT                   /product="pyochelin biosynthetic protein PchC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25425"
FT                   /protein_id="CAW25425.1"
FT                   /translation="MSAAWVRPFRLTPMPRLRLACFPHAGGSASFFRSWSERLPPDIDL
FT                   LALQYPGREDRFNEAPATRLEDLSDGAALALRDFADAPLALFGHSLGAALAYETALRLE
FT                   SVGAPLRHLFVSAHPAPHRQRGGALHRGDEAALLEDVRRQGGASELLEDADLRALFLPI
FT                   LRADYQAIETYRRAQPIALVCALDVLLGEHDEEVSAAEAQAWSDASRTPARLRRFPGGH
FT                   FYLSEGRDAVIEHLLRRLAHPDALSREVA"
FT   CDS_pept        complement(749024..750667)
FT                   /transl_table=11
FT                   /gene="pchD"
FT                   /locus_tag="PLES_06991"
FT                   /product="pyochelin biosynthesis protein PchD"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_06991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25426"
FT                   /protein_id="CAW25426.1"
FT                   /translation="MTSSPVTPSAVDDAPDWPAAFVRRYLDAGHWQDQNFAEALAASAA
FT                   RHPRRIALCDDDQRLSYADLLQRCRRLAAGLRQAGLAHGDTVVLHLPNGIAFVETCFAL
FT                   FQLGVRPVLALPAHRQHEISGFCRFAEAKAYIGAERIDGFDPRPMARELLASGACRMAL
FT                   IHGEAEAPLQALAPLYQADALEDCAARAEDIACFQLSGGTTGTPKLIPRRHREYLYNVR
FT                   ASAEVCGFDEHTVYLTGLPMAHNFTLCCPGVIGTLLAGGRVVVSQRADPEHCFALIARE
FT                   RVTHTALVPPLAMLWLDAQESRRADLSSLRLLQVGGSRLGSSAAQRVEPVLGCQLQQVL
FT                   GMAEGLICYTRLDDPPERVLHTQGRPLSPDDEVRVVDAEGREVGPGEVGELTVRGPYTI
FT                   RGYYRLPEHNAKAFSADGFYRTGDRVSRDKDGYLVVEGRDKDQINRGGEKIAAEEVENL
FT                   LIAHPQVHDATVVAMPDSLLGERTCAFVIPRQPAPSALKLKQYLHACGLAAFKVPDRIE
FT                   LVPAFPQTGIGKISKKDLRERLRRELEARA"
FT   CDS_pept        750897..751787
FT                   /transl_table=11
FT                   /gene="pchR"
FT                   /locus_tag="PLES_07001"
FT                   /product="transcriptional regulator PchR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25427"
FT                   /protein_id="CAW25427.1"
FT                   /translation="MTITIIAPPQADAAAPAPGNRPGVAHIDPNMKLVTGTFCSASEDW
FT                   FEEPLERGLRLILVQSGQLRCRIPGQPEHLIEGPSLCTIANDGDFTSAQIYGTDKPLRY
FT                   TIVQLGVEALDSRLGWLPEQLIRRPGGDPRIMSCPAPRAMQALASQIATCQMLGPTRDL
FT                   YLGGKALELAALSAQFLSGEGRPVEEPRITCSEVERIHAARDLLVGALQEPPSLDTLAS
FT                   RVGMNPRKLTAGFRKVFGASVFGYLQEYRLREAHRMLCDEEANVSTVAYRVGYSPAHFS
FT                   IAFRKRYGISPSEIR"
FT   CDS_pept        751981..756297
FT                   /transl_table=11
FT                   /gene="pchE"
FT                   /locus_tag="PLES_07011"
FT                   /product="dihydroaeruginoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25428"
FT                   /protein_id="CAW25428.1"
FT                   /translation="MDLPPDSRTALRDWLTEQLADLLGEPLADVRALADDDDLLGCGLD
FT                   SIRLMYLQERLRARGSTLDFAQLAQRPCLGAWLDLLACADRLSAPATVALPAAQDRDQP
FT                   FELSSVQQAYWLGRGAGEVLGNVSCHAFLEFRTRDIDPQRLAAATECVRQRHPMLRARF
FT                   LDGRQQILPTPPLSCFDLQDWRTLQVDEAERDWQALRDWRAHECLAVERGQVFLLGLVR
FT                   MPGGEDRLWLSLDLLAADVESLRLLLAELGVAYLAPERLAEPPALHFADYLARRAAQRA
FT                   EAAARARDYWLERLPRLPDAPALPLACAPESIRQPRTRRLAFQLSAGESRRLERLAAQH
FT                   GVTLSSVFGCAFALVLARWSESAEFLLNVPLFDRHADDPRIGEVIADFTTLLLLECRMQ
FT                   AGVSFAEAVKSFQRNLHGAIDHAAFPALEVLREARRQGQPRSAPVVFASNLGEEGFVPA
FT                   AFRDAFGDLHDMLSQTPQVWLDHQLYRVGDGILLAWDSVVGLFPEGLPETMFEAYVGLL
FT                   QRLCDSAWGQPADLPLPWAQQARRALLNGQPACATARTLHRDFFLRAAEAPDADALLYR
FT                   DQRVTRGELAERALRIAGGLREAGVRPGDAVEVSLPRGPQQVAAVFGVLAAGACYVPLD
FT                   IDQPPTRRRLIEEAAGVCLAITEEDDPQALPPRLDVQRLLRGPALAAPVPLAPQASAYV
FT                   IYTSGSTGVPKGVEVSHAAAINTIDALLDLLRVNASDRLLAVSALDFDLSVFDLFGGLG
FT                   AGASLVLPAQEQARDAAAWAEAIQRHAVSLWNSAPALLEMALSLPASQADYRSLRAVLL
FT                   SGDWVALDLPGRLRPRCAEGCRLHVLGGATEAGIWSNLQSVDTVPPHWRSIPYGRPLPG
FT                   QAYRVVDTHGRDVPDLVVGELWIGGASLARSYRNDPELSARRFVHDAQGRWYRTGDRGR
FT                   YWGDGTLEFLGRVDQQVKVRGQRIELGEVEAALCAQAGVESACAAVLGGGVASLGAVLV
FT                   PRLAPRAEGSMELPAAQPFAGLAEAEAVLTREILGALLEAPLELDDGLRRRWLDWLADS
FT                   AASALPSLDEALRRLGWQAAGLTAMGNALRGLLAGEQAPAALLLDPWLAPQAVAARLPD
FT                   GREALARLLEALPTPAAGERLRVAVLDTRAGLWLDQGMASLLRPGLELTLFERSRVLLD
FT                   AAATRLPERIVVQALDDGLLPAEHLGRYDRVISFAALHAYEASREGLALAAALLRPQGR
FT                   LLLADLLCESPLALLGAALLDDRPLRLAELPSLLADLAAAGLAPRCLWRSERIALVEAL
FT                   APGLGLDAAALQAGLEQRLPQAMRPERLWCLPSLPLNGNGKVDRRRLAESMTRALGECR
FT                   HEPSAEEPLEAHEQALAECWEAVLKRPVRRREASFFSLGGDSLLATRLLAGIRERFGVR
FT                   LGMADFYRQPTLAGLARHLQAQTVEIEETQLEEGVL"
FT   CDS_pept        756294..761723
FT                   /transl_table=11
FT                   /gene="pchF"
FT                   /locus_tag="PLES_07021"
FT                   /product="pyochelin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25429"
FT                   /protein_id="CAW25429.1"
FT                   /translation="MSLGELLETCRSRRIELWSEAGRLRYRAPQGALDAGLAERLRAER
FT                   EALLEHLEGGPGWRAEPDLAHQRFPLTPVQAAYVLGRQAAFDYGGNACQLYAEYDWPAD
FT                   TDPARLEAAWNAMVERHPMLRAVIEDNAWQRVLPEVPWQRLTVHACAGLDEAAFQAHLE
FT                   RVRERLDHACAALDQWPVLRPELSIGRDACVLHCSVDFTLVDYASLQLLLGEWRRRYLD
FT                   PQWTAEPLEATFRDYVGVEQRRRQSPAWQRDRDWWLARLDALPGRPDLPLRVQPDTRST
FT                   RFRHFHARLDEAAWQALGARAGEHGLSAAGVALAAFAETIGRWSQAPAFCLNLTVLNRP
FT                   PLHPQLAQVLGDFTALSLLAVDSRHGDSFVERARRIGEQMFDDLDHPTFSGVDLLRELA
FT                   RRRGRGADLMPVVFTSGIGSVQRLLGDGEAPRAPRYMISQTPQVWLDCQVTDQFGGLEI
FT                   GWDVRLGLFPEGQAEAMFDDFVGLLRRLAKSPRAWTDGEATEPVEAPPQALPGSARSIA
FT                   AGFAERALLTPDATVIHDAAGSYSYRQVAQHASALRRVLEAHGAGRGRRVAVMLPKSAA
FT                   QLVAVIGILQAGAAYVPVDIRQPPLRRQAILASAEVVALVCLESDVPDVGCACVAIDRL
FT                   AADSAWPPPPAAEVAADDLAYVIYTSGSTGTPKGVMLSHAAVSNTLLDINQRYGVDAND
FT                   RVLGLAELSFDLSVYDFFGATAAGAQVVLPDPARGSDPSHWAELLERHAITLWNSVPAQ
FT                   GQMLIDYLESEPQRHLPGPRCVLWSGDWIPVSLPTRWWRRWPDSALFSLGGATEAAIWS
FT                   IEQPIRPQHTELASIPYGRALRGQSVEVLDARGRRCPPGVRGEIHIGGVGLALGYAGDP
FT                   QRTAERFVRHPDGRRLYRTGDLGRYLADGSIEFLGREDDQVKIRGHRIELAELDAALCA
FT                   HPQVNLAATVVLGETHERSLASFVTLHAPVEAGEDPRTALDAVRQRAAQALRRDWGSEE
FT                   GIAAAVAALDRACLASLAAWLAGSGLFASATPLDFATLCQRLGIAEARQRLLRHWLRQL
FT                   EEGGYLRAEGEGWLGCAERPAQSPEDAWTAFAGCAPAALWPAELVAYLRDSAQSLGEQL
FT                   AGRISPAALMFPQGSARIAEAMYSQGLHAQALHEAMAEAIAAIVERQPQRRWRLLELGA
FT                   GTAAASRTVIARLAPLVQRGVEVDYLFTDVSSYFLAAARERFADQPWVRFGRFDMNGDL
FT                   LDQGVAPHSVDILLSSGALNNALDTPALLAGLRELLSADAWLVIQELTREHNEISVSQS
FT                   LMMENPCDLRDERRQLFVHTGQWLEWLAAQGGDLACGVVPPGSALDLLGYDVLLARCKT
FT                   DRARLEPAELLAFVEARVPRYMLPAQLRVLERLPVTGNGKIDRKALTGFARQPQADLRH
FT                   GVAQAPADELENALLALWREVLDNPSLGVEQDFFGAGGDSLLIAQLIARLRERLESARR
FT                   HPFDRLLRWALSQPTPRGLAERLRSAPDEGRGPALAAARGVAPAPAGMSRAPLAEGAVA
FT                   LDPLVRLVPGEGVPRVLVHEGLGTLLPYRPLLRALGEGRPLLGLAVHDSDAYLAIPAEH
FT                   LNACLGRRYAEALHRAGLREVDLLGYCSGGLVALETAKSLVQRGVRVRQLDIVSSYRIP
FT                   YRVDDERLLLFSFAATLGLDTAALGFPAPERLGQAVQAALAQTPERLVAEALAGLPGLA
FT                   DLVALRGRVLQAASGSADAVSVERDTLYRLFCHSVRASQAEAPEPYVGALRLFVPDAGN
FT                   PLVPRYAEALETQWRAAALGACGIHEVPGGHFDCLGEALAQSLSKPMPEEASR"
FT   CDS_pept        761720..762769
FT                   /transl_table=11
FT                   /gene="pchG"
FT                   /locus_tag="PLES_07031"
FT                   /product="pyochelin biosynthetic protein PchG"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25430"
FT                   /protein_id="CAW25430.1"
FT                   /translation="MSDVRSVVVAGSRFGQFYAAGVAADPRFVLRGILGQGSRRSRALA
FT                   ERLGVETWCEVEALPDDVRLACVAVGGAARGEQGPALAEALMARGIDVLIEHPLLPREW
FT                   QDLLRSAERLGRRCLLNTFYPQLPAVARFIELGRQLHRRRGIRHLDAACGVQVGFATLD
FT                   ILAALLEGVGPWSLESPSNDLSAMRGLSLVLAEVPLSLLVLNELAAADDGRMTLLQRVS
FT                   LTTDRGTLSLLSPHGPLLWTPAVAVPAEDDDGLFALFDEIAGEPLPSAQLWYAEPCSWA
FT                   QVHQRLWPAAAAEALALLADGDEVRRRNQRSLEVAALWQRIGERLGFPEAPPASLAPAS
FT                   LEQVLEQAS"
FT   CDS_pept        762766..764478
FT                   /transl_table=11
FT                   /locus_tag="PLES_07041"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25431"
FT                   /protein_id="CAW25431.1"
FT                   /translation="MTPVLWRLLRTYRWRLAAAMGLQALAGLCSLLPWMLLAWLAEPLA
FT                   RGQAQPALLALVLLAVLAWLGCQALAAHLAHRVDADLCNDLRLRLLAHLQRLPLDWFGR
FT                   QGPDGVARLVEQDVRALHQLIAHAPNDLSNLLVVPLVALLWLAWLHPWLLLFCLLPLVL
FT                   AAAGFLLLRSARYRDLVLRRNAALERLSADYGEFAHNLLLARQYPGAGIQQGAEASAAA
FT                   FGEAFGAWVKRVGHLAALVYVQLSTPWLLAWVLLGALALDALGVPLVLGQACAFLLLLR
FT                   ALAAPVQALGHGGDALLGARAAAERLQQVFDQAPLAEGRSTREPVDGAVALHGLGHAYE
FT                   GVEVLADIDLELEDGSLVALVGPSGSGKSTLLHLLARYMDAQRGELEIGGLALKDMPDA
FT                   VRHRHIALVGQQAAALEISLADNIALFRPDADLQEIRQAARDACLDERIMALPRGYDSV
FT                   PGRDLQLSGGELQRLALARALLSPARLLLLDEPTSALDPQTARQVLRNLRERGGGRTRV
FT                   IVAHRLAEVSDADLILVLVAGRLVERGEHAALLAADGAYARLWREQNGAEVAA"
FT   CDS_pept        764475..766199
FT                   /transl_table=11
FT                   /locus_tag="PLES_07051"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25432"
FT                   /protein_id="CAW25432.1"
FT                   /translation="MTLFERMRALPEDCRAALRRASAWAVLAALLDAACGVLLVPLVEA
FT                   WFAEGALPWRWVAALLGLSLAQALLQYLALRRGFAAGGSLAAGLVRSLVARLPRLAPPA
FT                   LRRVAPAEGLLRGPVMQAMGIPAHLLGPLIAALVTPLGVILGLFLIDPSIALGLLLAGA
FT                   FLAALLRWSGRRNLAAEDARLAAERDAARQLQAFAERQPLLRAAQRESVARQGLEEALR
FT                   SLHRSTLELLRRSLPSGLGFALAVQAAFAFALLGGAWAVERQWLDGARLVAVLVLLVRF
FT                   IEPLAQLTHLDQALRGAWQALDTLLRVFALAPLRSPEPGERPHDASLAAEAVELRLEDG
FT                   RALLEDISLRLEPGSLNVLVGPSGAGKSSLLALLGRLYDVDAGRVLLGGVDIRRLSETT
FT                   LAASRNLVFQDNGLFRGSVAWNLRMARADADLEALREAARAVGLLEEIEAWPQGWDSDV
FT                   GPGGALLSGGQRQRLCLARGLLSTAPLLLLDEPTASLDAASEAQVLRSLLGLRGRRTLL
FT                   VVTHRPALARQADQVLLLEEGRLRLSGLHADLLVRDDWYAGFVGLAGEESSATVVDR"
FT   CDS_pept        766291..768453
FT                   /transl_table=11
FT                   /gene="fptA"
FT                   /locus_tag="PLES_07061"
FT                   /product="Fe(III)-pyochelin outer membrane receptor
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25433"
FT                   /protein_id="CAW25433.1"
FT                   /translation="MKTETKVIKGRQGIARNRHTPLCLGLLLALSPLAAAVADARKDGE
FT                   TELPDMVISGESTSATQPPGVTTLGKVPLKPRELPQSASVIDHERLEQQNLFSLDEAMQ
FT                   QATGVTVQPFQLLTTAYYVRGFKVDSFELDGVPALLGNTASSPQDMAIYERVEILRGSN
FT                   GLLHGTGNPAATVNLVRKRPQREFAASTTLSAGRWDRYRAEVDVGGPLSASGNVRGRAV
FT                   AAYEDRDYFYDVADQGTRLLYGVTEFDLSPDTLLTVGAQYQHIDSITNMAGVPMAKDGS
FT                   NLGLSRDTYLDVDWDRFKWDTYRAFGSLEQQLGGGWKGKVSAEYQEADSRLRYAGSFGA
FT                   IDPQTGDGGQLTGAAYKFKSIQRSLDANLNGPVRLFGLTHELLGGVTYAQGETRQDTAR
FT                   FLNLPNTPVNVYRWDPHGVPRPQIGQYTSPGTTTTTQKGLYALGRIKLAEPLTLVVGGR
FT                   ESWWDQDTPATRFKPGRQFTPYGGLIWDFARDWSWYVSYAEVYQPQADRQTWNSEPLSP
FT                   VEGKTYETGIKGELADGRLNLSLAAFRIDLENNPQEDPDHPGPPNNPFYISGGKVRSQG
FT                   FELEGTGYLTPYWSLSAGYTYTSTEYLKDSQNDSGTRYSTFTPRHLLRLWSNYDLPWQD
FT                   RRWSVGGGLQAQSDYSVDYRGVSMRQGGYALVNMRLGYKIDEHWTAAVNVNNLFDRTYY
FT                   QSLSNPNWNNRYGEPRSFNVSLRGAF"
FT   CDS_pept        768453..768734
FT                   /transl_table=11
FT                   /locus_tag="PLES_07071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25434"
FT                   /protein_id="CAW25434.1"
FT                   /translation="MPRQSGFGWAWRVPLALAGSLAAATASGYLLTRGLPLDDPLERLY
FT                   AGFFGALGVGLLLLVGGLLARGPGNFAWRLGGSLLLLGLALWLLAGRG"
FT   CDS_pept        769057..770241
FT                   /transl_table=11
FT                   /locus_tag="PLES_07081"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25435"
FT                   /protein_id="CAW25435.1"
FT                   /translation="MPALDLLLNLHKSLFVGFPGRVLVSLFGVSLLLLCLAGVLLHSRR
FT                   WRDLRRWRRDRGLRLALFDLHGLIGIWGLPWLLLFGFTGALSGLGALGTLLLAPVAYPQ
FT                   EPNRVFVELMGPPPPAAEGRPLASRIDLDRLLAGDAVRAPGFVAQRLSLSHAGDVAGSV
FT                   EIAGIRRGLPSTANFERHRYRLADGALLGERSSAQRGFWLRAFIAVQPLHFAQYQWLGP
FT                   GWSAALRGLHLAMGLGACLLCASGLYLWLQRRASAPDARVRLLQRLSQGFCAGLVAAAA
FT                   LLLLGLQLAPSELLAGPWPGRLFLVLWAAAGLAALLLPGDWPLARGLLGVAGLACLAAA
FT                   VAHLAPWLMRGRLPALGPDLTLILCGALLIRHAWMQARAAAPPAHPRVTGDHHA"
FT   CDS_pept        770234..771478
FT                   /transl_table=11
FT                   /locus_tag="PLES_07091"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25436"
FT                   /protein_id="CAW25436.1"
FT                   /translation="MLELYRHRRLVITLALLYLSQGIPIGLAMDALPTLLRQDGAPLQA
FT                   LAFLPLVGLPWVVKFLWAPWVDNHWSRRLGRRRSWILPMQCMVLACLLGLATLGLGVAS
FT                   AGWAVGLLALASLASATQDIATDGMAAEHFSGELLAKVNAVQIAGVMIGFFGGGAGSLI
FT                   LAGHFGQRTAFLVMACVPLASLCCVLALGRGDPHELPPAPAAKASLLRFLRRPLAPSLL
FT                   ALALLSAMTAVSGFGLSKLYLSDAGWALQDIGRLGMSGGLVTVFLGCGGGAWLVRRIGL
FT                   WRGFALGVVLAGCSALLWYLQAGRWLALSEGLAWTCVLIGSLATGITSVAILTAAMRFA
FT                   GQGGQAGTDVTAVQSTRDLGEMLASSFLVSLTAQIGYAGGFLTGSALAVLALLLALRLQ
FT                   AGEGRGEWKGRAEEA"
FT   CDS_pept        complement(771574..772782)
FT                   /transl_table=11
FT                   /gene="phzS"
FT                   /locus_tag="PLES_07101"
FT                   /product="flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25437"
FT                   /protein_id="CAW25437.1"
FT                   /translation="MSEPIDILIAGAGIGGLSCALALHQAGIGKVTLLESSSEIRPLGV
FT                   GINIQPAAVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYSI
FT                   HRGELQMILLAAVRERLGQQAVRTGLGVERIEERDGRVLIGARDGHGKPLALGADVLVG
FT                   ADGIHSAVRAHLHPDQGPLSHGGITMWRGVTEFDRFLDGKTMIVANDEHWSRLVAYPIS
FT                   ARHAAEGKSLVNWVCMVPSAAVGQLDNEADWNRNGRLEDVLPFFADWDLGWFDIRDLLT
FT                   RNQLILQYPMVDRDPLPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELAAALARN
FT                   ADVAAALREYEEARRPTANKIILANREREKEEWAAASRPKTEKSAALEAITGSYRNQVE
FT                   RPR"
FT   CDS_pept        complement(773020..773664)
FT                   /transl_table=11
FT                   /gene="phzG1"
FT                   /locus_tag="PLES_07111"
FT                   /product="probable pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25438"
FT                   /protein_id="CAW25438.1"
FT                   /translation="MGVNANISESLTGTIEAPFPEFEAPPANPMEVLRNWLERARRYGV
FT                   REPRALALATVDGQGRPSTRIVVIAELGERGVVFATHADSQKGRELAQNPWASGVLYWR
FT                   ESSQQIILNGRAERLPDERADAQWLSRPYQTHPMSIASRQSETLADIHALRAEARRLAE
FT                   TDGPLPRPPGYCLFELCLESVEFWGNGTERLHERLRYDRDEGGWKHRYLQP"
FT   CDS_pept        complement(773690..774526)
FT                   /transl_table=11
FT                   /gene="phzF1"
FT                   /locus_tag="PLES_07121"
FT                   /product="probable phenazine biosynthesis protein"
FT                   /note="orf01047"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25439"
FT                   /protein_id="CAW25439.1"
FT                   /translation="MHRYVVIDAFASEPLQGNPVAVFFDCDDLSGERMQRMAREMNLSE
FT                   STFVLRPQQDGDARIRIFTPVNELPFAGHPLLGTAIALGAETDKDRLFLETRMGTVPFA
FT                   LERQDGKVVACSMQQPIPTWEHFSRPAELLAALGLKGSTFPIEVYRNGPRHVFVGLESV
FT                   AALSALHPDHRALCDFPDLAVNCFAGAGRHWRSRMFSPAYGVVEDAATGSAAGPLAIHL
FT                   ARHRQIPYGQQIEILQGVEIGRPSRMYARAEGAGERVSTVEVSGNGAAFAEGRAYL"
FT   CDS_pept        complement(774540..776423)
FT                   /transl_table=11
FT                   /gene="phzE1"
FT                   /locus_tag="PLES_07131"
FT                   /product="phenazine biosynthesis protein PhzE"
FT                   /note="orf01049"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25440"
FT                   /protein_id="CAW25440.1"
FT                   /translation="MNALPTSLLQRLLERPAPFALLYRPESNGPGLLDVIRGEALELHG
FT                   LADLPLDEPGPGLPRHDLLALIPYRQIAERGFEALDDGTPLLALKVLEQELLPLEQALA
FT                   MLPNQALELSEEGFDLDDEAYAEVVGRVIADEIGRGEGANFVIKRRFQARIDGYATASA
FT                   LSFFRQLLLREKGAYWTFIVHTGERTLVGASPERHISVRDGLAVMNPISGTYRYPPAGP
FT                   NLAEVMEFLDNRKEADELYMVVDEELKMMARICEDGGRVLGPYLKEMAHLAHTEYFIEG
FT                   QTSRDVREVLRETLFAPTVTGSPLESACRVIRRYEPQGRGYYSGVAALIGGDGQGGRTL
FT                   DSAILIRTAEIEGDGRLRIGVGSTIVRHSDPLGEAAESRAKASGLIAALKSQAPQRLGS
FT                   HPHVVAALASRNAPIADFWLRGASERQQLQADLSGREVLIVDAEDTFTSMIAKQLKSLG
FT                   LTVTVRGFQEPYSFDGYDLVIMGPGPGNPTEIGQPKIGHLHLAIRSLLSERRPFLAVCL
FT                   SHQVLSLCLGLDLQRRQEPNQGVQKQIDLFGAAERVGFYNTFAARALQDRIEIPEVGPI
FT                   EISRDRETGEVHALRGPRFASMQFHPESVLTREGPRIIADLLRHALVERRP"
FT   CDS_pept        complement(776420..777043)
FT                   /transl_table=11
FT                   /gene="phzD1"
FT                   /locus_tag="PLES_07141"
FT                   /product="phenazine biosynthesis protein PhzD"
FT                   /note="orf01050"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25441"
FT                   /protein_id="CAW25441.1"
FT                   /translation="MSGIPEITAYPLPTAQQLPANLARWSLESRRAVLLVHDMQRYFLR
FT                   PLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPAD
FT                   REVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDA
FT                   YSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE"
FT   CDS_pept        complement(777040..778257)
FT                   /transl_table=11
FT                   /gene="phzC1"
FT                   /locus_tag="PLES_07151"
FT                   /product="phenazine biosynthesis protein PhzC"
FT                   /note="orf01051"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25442"
FT                   /protein_id="CAW25442.1"
FT                   /translation="MDDLLQRVRRCEALQQPEWGDPSRLRDVQAYLRGSPALIRAGDIL
FT                   ALRATLARVARGEALVVQCGDCAEDMDDHHAENVARKAAVLELLAGALRLAGRRPVIRV
FT                   GRIAGQYAKPRSKPHEQVGEQTLPVYRGDMVNGREAHAEQRRADPQRILKGYAAARNIM
FT                   RHLGWDAASGQEANASPVWTSHEMLLLDYELSMLREDEQRRVYLGSTHWPWIGERTRQV
FT                   DGAHVALLAEVLNPVACKVGPEIGRDQLLALCERLDPRREPGRLTLIARMGAQKVGERL
FT                   PPLVEAVRAAGHPVIWLSDPMHGNTIVAPCGNKTRLVRSIAEEVAAFRLAVSGSGGVAA
FT                   GLHLETTPDDVTECVADSSGLHQVSRHYTSLCDPRLNPWQALSAVMAWSGAEAIPSATF
FT                   PLETVA"
FT   CDS_pept        complement(778293..778781)
FT                   /transl_table=11
FT                   /gene="phzB1"
FT                   /locus_tag="PLES_07161"
FT                   /product="probable phenazine biosynthesis protein"
FT                   /note="orf01052"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25443"
FT                   /protein_id="CAW25443.1"
FT                   /translation="MPDTTNPIGFTDANELREKNRATVEKYMNTKGQDRLRRHELFVED
FT                   GCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNINIFGTDDPNHFWVECDGH
FT                   GKILFPGYPEGYYENHFLHSFELEDGKIKRNREFMNVFQQLRALSIPVPEIKREGIPT"
FT   CDS_pept        complement(778811..779299)
FT                   /transl_table=11
FT                   /gene="phzA1"
FT                   /locus_tag="PLES_07171"
FT                   /product="probable phenazine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25444"
FT                   /protein_id="CAW25444.1"
FT                   /translation="MNGQRYRETPLDIERLRRLNRATVERYMAMKGAERLQRHSLFVED
FT                   GCAGNWTTESGEPLVFRGHESLRRLAEWLERCFPDWEWHNVRIFETEDPNHFWVECDGR
FT                   GKALVPGYPEGYCENHYIHSFELENGRIKRNREFMNPIQKLRALGIAVPQIKRDGIPT"
FT   CDS_pept        779995..780999
FT                   /transl_table=11
FT                   /gene="phzM"
FT                   /locus_tag="PLES_07181"
FT                   /product="probable phenazine-specific methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25445"
FT                   /protein_id="CAW25445.1"
FT                   /translation="MNNSNLAAARNLIQVVTGEWKSRCVYVATRLGLADLIESGIDSDE
FT                   TLAAAVGSDAERIHRLMRLLVAFEIFQGDTRDGYANTPTSHLLRDVEGSFRDMVLFYGE
FT                   EFHAAWTPACEALLSGTPGFELAFGEDFYSYLKRCPDAGRRFLLAMKASNLAFHEIPRL
FT                   LDFRGRSFVDVGGGSGELTKAILQAEPSARGVMLDREGSLGVARDNLSSLLAGERVSLV
FT                   GGDMLQEVPSNGDIYLLSRIIGDLDEAASLRLLGNCREAMAGDGRVVVIERTISASEPS
FT                   PMSVLWDVHLFMACAGRHRTTEEVVDLLGRGGFAVERIVDLPMETRMIVAARA"
FT   CDS_pept        complement(781010..782473)
FT                   /transl_table=11
FT                   /gene="opmD"
FT                   /locus_tag="PLES_07191"
FT                   /product="probable outer membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25446"
FT                   /protein_id="CAW25446.1"
FT                   /translation="MKRSYPNLSRLALALAVGTGLAACSVGPDYQRPQSPPPRVASEHL
FT                   GEFSGERREAPWWSFFDDPQLVRLVDQALARNHDIREARANLRSARALFDDRWLDQLPQ
FT                   VTSQAGYSRSIEQQLDYDGEPRRRLAESYRAGFDAQWEIDLFGRLGRLSDAALARAEAA
FT                   DADLRLVRLSIAADTARAYFEIQGYQRRLDVARAQVRSWRDTLELTRSSLQLGSGLPED
FT                   VENAQANLLRSEAAIPPLTTALESARYRLDVLRGEAPGSGAPILDGGAAAPLAKNLPLG
FT                   DVDRLILQRPDVVSAERQLAASTEDVGAATAELYPRLDLGGFIGFFALRSGDLGSASRA
FT                   FELAPSVSWPAFRLGNVRARLRAVEAQSDAALARYQRSLLLAQEDVGNALNQLAEHQRR
FT                   LVALFQSATHGANALEIANERYRAGAGSYLAVLENQRALYQIREELAQAETASFVNVIA
FT                   LYKALGWGSGDLAPGAGQLAAGETAGANR"
FT   CDS_pept        complement(782470..785559)
FT                   /transl_table=11
FT                   /gene="mexI"
FT                   /locus_tag="PLES_07201"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25447"
FT                   /protein_id="CAW25447.1"
FT                   /translation="MTFTDLFVRRPVLALVVSTLILLLGLFSLGKLPIRQYPLLESSTI
FT                   TVTTEYPGASADLMQGFVTQPIAQAVSSVEGIDYLSSTSVQGRSVVTIRMLLNRDSTQA
FT                   MTETMAKVNSVRYKLPERAYDSVIERSSGETTAVAYVGFSSKTLPIPALTDYLSRVVEP
FT                   MFSSIDGVAKVQTFGGQRLAMRLWLDADRLAGRGLTASDVAEAIRRNNYQAAPGMVKGQ
FT                   YVLSNVRVNTDLTNVDDFREMVIRNDGNGLVRLRDVGTVELGAAATETSALMDGDPAVH
FT                   LGLFPTPTGNPLVIVDGIRKLLPEIQKTLPPDVRVDLAYETSRFIQASIDEVVRTLVEA
FT                   LLIVVLVIYLCLGSLRSVLIPVATIPLSMLGAAALMLAFGFSVNLLTLLAMVLAIGLVV
FT                   DDAIVVVENVHRHIEEGKSPVAAALIGAREVAGPVIAMTITLAAVYTPIGLMGGLTGAL
FT                   FREFALTLAGAVIVSGVVALTLSPVMSSLLLQAHQNEGRMGRAAEWFFGGLTRRYGQVL
FT                   EFSLGHRWLTGGLALLVCISLPLLYSMPKRELAPTEDQAAVLTAIKAPQHANLDYVELF
FT                   ARKLDQVYTSIPETVSTWIINGTDGPAASFGGINLAAWEKRERDASAIQSELQGKVGDV
FT                   EGSSIFAFQLAALPGSTGGLPVQMVLRSPQDYPVLYRTMEEIKQKARQSGLFVVVDSDL
FT                   DYNNPVVQVRIDRAKANSLGIRMQDIGESLAVLVGENYVNRFGMEGRSYDVIPQSLRDQ
FT                   RFTPQALARQFVRTQDGNLVPLSTVVRVALQVEPNKLIQFDQQNAATLQAIPAPGVSMG
FT                   QAVAFLDDVARGLPAGFSHDWQSDSRQYTQEGNTLVFAFLAALVVIYLVLAAQYESLAD
FT                   PLIILITVPLSICGALLPLALGYATMNIYTQIGLVTLIGLISKHGILMVEFANELQLHE
FT                   RLDRRAAILRAAQIRLRPVLMTTAAMVFGLVPLLFASGAGAASRFGLGVVIVSGMLVGT
FT                   LFTLFVLPTVYTLLARNHAEVDKSPRSRQLAEADLLVNKA"
FT   CDS_pept        complement(785572..786684)
FT                   /transl_table=11
FT                   /gene="mexH"
FT                   /locus_tag="PLES_07211"
FT                   /product="probable Resistance-Nodulation-Cell Division
FT                   (RND) efflux membrane fusion protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25448"
FT                   /protein_id="CAW25448.1"
FT                   /translation="MQKPVLIASAALICAAVIGIAVYATGSAKKDAGGFAGYPPVKVAL
FT                   ASVERRVVPRVFDGVGELEAGRQVQVAAEAAGRITRIAFESGQQVQQGQLLVQLNDAVE
FT                   QAELIRLKAQLRNAEILHARARKLVERNVASQEQLDNAVAARDMALGAVRQTQALIDQK
FT                   AIRAPFSGQLGIRRVHLGQYLGVAEPVASLVDARTLKSNFSLDESTSPELKLGQPLEVL
FT                   VDAYPGRSFPARISAIDPLIGKSRTVQVQALLDNPEGLLAAGMFASIRVSRKADAPSLS
FT                   VPETAVTYTAYGDTVFVAHQDGDRPLSAKRVSVRIGERWDGRVEILQGLAEGDRVVTSG
FT                   QINLSDGMAVEPVKEDTLSSAAPPVPVAGR"
FT   CDS_pept        complement(786692..787138)
FT                   /transl_table=11
FT                   /gene="mexG"
FT                   /locus_tag="PLES_07221"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25449"
FT                   /protein_id="CAW25449.1"
FT                   /translation="MQRFIDNSLESNWLWLTARICLALMFVASGLAKLFDYQASLEEMR
FT                   AAGLEPAWLFNIATAVTLLAGSALVLLDRKLWLGAGALAVFLLLTILIVHTFWSKTGVE
FT                   AKLAMFFALEHIAVIGGLIATAIASAQRQRLRQDVSVAATYQKA"
FT   CDS_pept        complement(787788..788954)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07231"
FT                   /product="putative 3-carboxymuconate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25450"
FT                   /protein_id="CAW25450.1"
FT                   /translation="MRRLPTLCLLALAPLTGVAPQAQAASLYNLLVGTYTEGSSEGIQV
FT                   YRFDGADGSVKGPLRVAHTSNPSYLTFAPDQRTLFVVNENGRGGKGDTVGRATSYRFDP
FT                   ISGRLQQISQVQTLGDHPTYSSLSHDGRYLFVANYSVQPEGSVAVLPVRADGSLAPVVQ
FT                   VESHQASKVHPRQVSGHVHSVVSSPDGQYLFAPDLGADKVFVYRYAPEQAERPLQAADP
FT                   AFVPTPPGSGPRHLIFSADGRFAYLTLELSGQVMVFAHEGNGRLRQLQTHDLAPAGFQG
FT                   KVGAGALHLSADGRFLGVLNRGDDNQLVTFAVDPASGQLRFVERRSVEGTEPREFAFSP
FT                   GGRFVLVANQNSDQLRVFARDPQSGQVGKTLQSVEVGSPSDLRFVAVP"
FT   CDS_pept        complement(789034..789888)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07241"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25451"
FT                   /protein_id="CAW25451.1"
FT                   /translation="MDLSSLEIFRAVAHEASVTRAAQQLQRAQSNVTTRILQLEEDLGV
FT                   ELFLRDGKRMSLTERGSEFLAYAEQLLALADEARQSMHPAEPGGRLRLGSMESTAASRL
FT                   PALLASYHKACPRVALEVSTGTSRALFDGVRARRLDCALVAAGPGWAGELDGSGLRGEP
FT                   LFREELLMILPAEHPPVHDVAEVRLRTLAGFARGCTYRQLAEDSLGTPLTVQEVGSYHA
FT                   ILACVAAGACVGVLPRSVLQLLGTPPLRSLPLAEVDTWLVWREGYATAAFERWRGLLGQ
FT                   SGD"
FT   CDS_pept        789996..791051
FT                   /transl_table=11
FT                   /locus_tag="PLES_07251"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25452"
FT                   /protein_id="CAW25452.1"
FT                   /translation="MTDRFTRLLGIQQPIIQAPMLGVSTPALAAAVSNAGGLGSIAITG
FT                   SAAEKGRALIREVRGLTDKPFNVNLFCHRPGQADPARERAWLDYLKPLFAEFGAEPPVR
FT                   LKNIYLSFLEDPTLLPMLLEERPAAVSFHFGAPPRDQVRALQAAGIRVLVCATTPEEAA
FT                   LVEAAGADAVVAQGIEAGGHRGVFEPERGDAAIGTLALVRLLAARGSLPVVAAGGIMDG
FT                   RGIRAALELGASAVQMGTAFVLCPESSANAAYREALKGPRAARTALTVTMSGRSARGLP
FT                   NRMFFDAAAPGVPPLPDYPFVYDATKALQTAALARGNHDFAAQWAGQGAALARELPAAE
FT                   LLRTLVEELRG"
FT   CDS_pept        791147..792187
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="PLES_07261"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25453"
FT                   /protein_id="CAW25453.1"
FT                   /translation="MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDT
FT                   ASGLLGAEEERRLLASKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTG
FT                   EDGTLQALLDAGGFAYTGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVRE
FT                   QLGFPLVVKPNSQGSTVGLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLD
FT                   DQALPVGEILLGGQEVFDYEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSG
FT                   YSRTDFRLDEQGRLWCLEVNTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKG
FT                   ARKARS"
FT   CDS_pept        complement(792211..793077)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07271"
FT                   /product="hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25454"
FT                   /protein_id="CAW25454.1"
FT                   /translation="MRTLTTLLGNSQKLDGGAMFGNAPRALWSRWMQPDAENRIDLGCR
FT                   ALLVRDGERNVLVETGIGAFFPPALRQRYGVQEERHVLLDSLAAVGLDDADIDVVLLTH
FT                   LHFDHAGGLLAAWEEGQPARLLFPNAHFVSGRRHWQRARQPHPRDRASFVPELLDLLQA
FT                   SGRLELLDDGERSAHLGEGWRFHFSEGHTPGQMLPEIAMPDGPVVFSGDLIPGAPWVHL
FT                   PLTMGYDRFPEGLIEEKERLLDSLIARNGRLVFTHDPCVAMGRVRRDEQERYSLYDTLE
FT                   RVENLEA"
FT   CDS_pept        complement(793285..795066)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07281"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25455"
FT                   /protein_id="CAW25455.1"
FT                   /translation="MPEYNAPLRDMRFLLNDVFDAPALWQRLPRLAERIDADTADAILE
FT                   EAAKVTGGLLAPLNRSGDEEGAQWQDGAVRTPAGFREAYATYAEGGWVGLTGNPAHGGM
FT                   GMPKMLAVQFEEMMYAANASFSLYSTLSAGACLALDAHGSEELKNRYLPNMYAGTWAGS
FT                   MCLTEPHAGTDLGIIRTKAEPQADGSYRISGTKIFITGGEQDLTENIIHLVLAKLPDAP
FT                   AGSRGISLFLVPKFLVGDDGALGARNAVHCGSIEHKMGIKASATCVMNFDGASGWLVGE
FT                   VNKGLAAMFTMMNYERLSIGIQGIGCAEMSYQSAVAYARERLQSRAPTGPVARDKAADP
FT                   IIVHPDVRRMLLTMKALTEGGRAFSTYVGQQLDLAKYAEDQEERSQAEALVALLTPVAK
FT                   AFFTDTGLESCVLGQQVFGGHGYIREWGQEQLVRDVRIAQIYEGTNGIQALDLMGRKVV
FT                   ANGGLFLSIFSREVRAFAAGANAELAEFVTPLLTALDLLDNLTQGIVARAGNDPREIGA
FT                   ASVEYLHLFGYTAYAYLWARMAAAALRQREADPAFHDGKLATARFYFARILPRVHSLAA
FT                   AVEAGSESLYGLEAEQF"
FT   CDS_pept        complement(795184..796806)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07291"
FT                   /product="probable AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25456"
FT                   /protein_id="CAW25456.1"
FT                   /translation="MSIFEQGLAPAAVNHIALTPLSFIERTASVYPHYPAVIHGNIRRD
FT                   WAQTYQRCRRLASALAGRGIGQGDTVAVMLPNIPEMLEAHYGVPMIGAVLNTLNVRLDA
FT                   EAIAFMLQHGEAKVLITDYEFHEVIHAAIGMLDHPPLVVDVNDPEYGEGRPVGELDYEA
FT                   LLAEGDPQFAWEWPRDEWQAISLNYTSGTTGNPKGVVYHHRGAYLNALGNQMTWSMGQH
FT                   PVYLWTLPMFHCNGWCYPWTVTALAGVHVCLRRVDPQKVLTLIREHQVSHLCGAPIVLN
FT                   ALINMPDSAKAAIDHPVHAMVAGAAPPAKVIGAVEEMGIRVTHVYGLTEVYGPVTVCAW
FT                   HGEWDDLPLERRAAIKSRQGVRYPTLEGVMVADPKTLEPVPRDGQSIGEIFMRGNTVMK
FT                   GYLKNPSATEEAFAGGWFHTGDLAVCHPDGYIEIRDRLKDIIISGGENISTIELEGVLY
FT                   RHPAVLEAAVVARPDEKWGETPCAFITLKSDHQGLAESEIVAFCREHLAAFKIPRTVVF
FT                   SELPKTSTGKIQKYVLREWAAAL"
FT   CDS_pept        797052..799328
FT                   /transl_table=11
FT                   /locus_tag="PLES_07301"
FT                   /product="probable two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25457"
FT                   /protein_id="CAW25457.1"
FT                   /translation="MSPLPASPALNSLLRLLREGAPLVERVGALRRLLLEHPGTRQAWY
FT                   LAWQPQAQTYTPVPPSPALPPGAGEPNRASDLALRERLVRDGRLALDELRRSASWLGAR
FT                   LRRAGVEHGMAFALDLQAGDEGLLLVASDTPQSAALDWLGLLLAPLLAAARGVTRAAPF
FT                   LAADPQPALLLDGEAQAVEFNQAFLALLGERPREAWRAYLPANHGQLVRASLGQARALG
FT                   EVEAECDGRILLWQFIPDSAEARVLARCRDATASLRGEREAARASRLYRLITENTTDLI
FT                   SRHTLDGIFLDASPASWTLLGYWPEELRGRPAQALFHPQDRGQVALRAREALEQDGYLT
FT                   ITYRIRHRDGRYRWFETASRAIRETYTGAVVEVVSVSRDVTRRVEAEENRRRLAEVVEA
FT                   NTDLVLFVEHGGRVTYLNPSARAALGIADGQEAPALERLLAGDTPARLAEEGWRQARDG
FT                   GVWSREGRLQPQDGRPSLPVSLVLLAHRGRGEERYYSLVARDMTERELREAQQRRHQDE
FT                   LAHTARLVTLGELASGIAHEINQPLAAVMNYASASQRYLAVLGSQPEAAGRVAEGLARI
FT                   GEHAGHAAEVIKRLRAFLRKGQRRLQALDLNQVAREAIGLCAWEAGHWQVAVEEAMTDN
FT                   PPPLYADRVLLEQVFLNLLRNAIEANREAHPGSPSRVVIGSRVEPGGLLCLWVRDQGPG
FT                   VPADQLEHIFTPFYTSKPEGLGLGLSMSRSIVEGFGGTLEAELPADGGLLMNCRLPLAA
FT                   GATGG"
FT   CDS_pept        799331..799975
FT                   /transl_table=11
FT                   /locus_tag="PLES_07311"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25458"
FT                   /protein_id="CAW25458.1"
FT                   /translation="MAMPDEALVYVVDDDQGMLESTVWLLESVGLKARPFTQGRDFLDA
FT                   CEGGRHACVLLDVRMPGMGGLNVQDELLVRGIDLPVIFVSGHADVPIVVRAFKAGAVDF
FT                   IEKPYNEQLLLDSVQQALDRHARRRRHRDLDAGLRERLDSLTPRERDVLLPLVRGHTSR
FT                   EVAEQLEVSVKTVDLYRARVMKRMQAQTLPELVGMAIAAGLVDPLRLREGT"
FT   CDS_pept        800131..800961
FT                   /transl_table=11
FT                   /locus_tag="PLES_07321"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25459"
FT                   /protein_id="CAW25459.1"
FT                   /translation="MKIRLLGAAVAAVFTLIGSAAHADDLADIRKKGEIVIGTLGTDEP
FT                   NSFIDPKTRQIIGYEVDLGTEIAKAIGVKPVFKQISVAARIPELQQGHVDLLAASLTHN
FT                   KEREALVDFSYSIIVTGQKALVKKNAGFASLHDLDGKKVLTVKGGTQEPNIRKALPNAQ
FT                   VVTFETSQQALLALQQGKGQAFVDDESALVNDFGKLGAAAGGYAILPENLSTEALAIAF
FT                   RKGNPQLKQLVDSTLAGLERSGAAEQLYLKWYGPGTKSNLSERHFKIDSDRIPE"
FT   CDS_pept        801046..801744
FT                   /transl_table=11
FT                   /locus_tag="PLES_07331"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25460"
FT                   /protein_id="CAW25460.1"
FT                   /translation="MFEFDFSLLLRGQYHEMLVAGLLLSLKLAAVTLVFAVPLAMLVAL
FT                   LRLAPFRALQWLGFAYVESIRNVPLLAHMLFWYFAAPEWLPEDLKAWLYAGNIEAASAI
FT                   VALTLYTAAFMSEDMRSGIRAVPTVQLEAARALGFGYLASMRLVILPQALRITVPPLIS
FT                   QTLNLWKNTSIATVIGVAELMYQAGQVESSTFRSFESFAFATAAYLSVSLLITGAAAWY
FT                   QQRYPGVERR"
FT   CDS_pept        801741..802445
FT                   /transl_table=11
FT                   /locus_tag="PLES_07341"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25461"
FT                   /protein_id="CAW25461.1"
FT                   /translation="MTTLELIDSYWLYFLVGQYPNGPLGGLALTLVLASLALLLALPLG
FT                   ILLGLARVSPWRWLRWPITALVFVVRGVPLLMVIFWAYFFLPTLTGQRTDQFTTMLLAL
FT                   VLFDAVYLAEIVRAGIQGLDRGQFEAARSLGLGYLASMRLVILPQALRNMLPSLVNQFV
FT                   STIKETSLGYIIGLAEVSFIASQINTQVFTLPTQVYLILGLTYFILCFGLSRFAFWLER
FT                   RQAQRGNPKEAR"
FT   CDS_pept        802442..803185
FT                   /transl_table=11
FT                   /locus_tag="PLES_07351"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25462"
FT                   /protein_id="CAW25462.1"
FT                   /translation="MIRLEKVNKWYGAYHALADVDEQVGRGEVVVVCGPSGSGKSTLIR
FT                   TLNRLEPIQGGRILIDGQDIHAPGLDLNRFRSHIGFVFQQFNLFPHLNVLDNCTLAPLR
FT                   LRGLKPAEARRQALALLERVGLADKAAAFPARLSGGQQQRVAIARALAMEPPLMLFDEP
FT                   TSALDPEMVGEVLLVMRDLARDGMTMVVVTHEMGFAHDVADRVLFMDAGRVLERASPDD
FT                   FFNRPQHPRARKFLADIRTPFAQPL"
FT   CDS_pept        803194..804198
FT                   /transl_table=11
FT                   /locus_tag="PLES_07361"
FT                   /product="probable iron/ascorbate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25463"
FT                   /protein_id="CAW25463.1"
FT                   /translation="MSTPSLPIIDIAALAGSDPAARRSVAVRIDRACREQGFFYVVGHG
FT                   VEAQLVERLERLARQFFALDETSKLRWRMELGGRAWRGYFPLGGELTSNRPDWKEGLYL
FT                   GSELDAEHPEVRAGTPLHGANLFPEVPGLRETLLEYLDATTRVGHRLMEGIALGLGLEA
FT                   DYFAARYTGDPLILFRLFNYPSQPVPEGLDVQWGVGEHTDYGLLTLLHQDAIGGLQVRT
FT                   PQGWLEAPPIPGSFVCNLGDMLERMTGGLYRSTPHRVARNTSGRDRLSFPLFFDPNFHA
FT                   RVQPIEGLPEVPEQDDSARRWDQANVHAFHGEYGDYLLNKVAKVFPQLRRDLL"
FT   CDS_pept        complement(804239..805435)
FT                   /transl_table=11
FT                   /gene="pqsL"
FT                   /locus_tag="PLES_07371"
FT                   /product="probable FAD-dependent monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25464"
FT                   /protein_id="CAW25464.1"
FT                   /translation="MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAING
FT                   ADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVYHDGELLRYFNYSSVDARGYFILMP
FT                   CESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGADGI
FT                   ASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRAR
FT                   LVVSFPREEARELMADTRGESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDR
FT                   YWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALDLALRDACALEDALAGYQAER
FT                   FPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSYQPVRSPAPLG"
FT   CDS_pept        complement(805603..807093)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07381"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25465"
FT                   /protein_id="CAW25465.1"
FT                   /translation="MTELLSREEYAAIAATLDLPQRAFIDGGFRDACGGRTFASTNPAT
FT                   GELLAQVAACDAEDVGHAVASARRAFEDGRWRSRTPAERKAALLRLAELLEEHLLELAV
FT                   MESLDSGKPIRECQHTDLPETINTLRWHAELIDKIYDSTAPVGSAALAMVVREPIGVVG
FT                   LVLPWNFPLLMLAWKIGPALAAGCSVVVKPAPETSLTALRVAELASQAGIPAGVFNVVP
FT                   GGGREAGEPLGRHPDVAMVSFTGSTATGRLFLKYAAESNLKRVVLECGGKNPAVVMNDV
FT                   EDLDLVAQHVVNGAFWNMGENCSASSRLIVHAEVREALLERIGAQLREWRMGDPLDPRN
FT                   RLGALVSPAHFEKVRAYLDQARTERLAVRFGGATEAGIFVEPTVVDGVSPHSRLFREEI
FT                   FGPLLSVTSFDDIDEAIALANDTVYGLAASAYTGSLRHALRLSREIRAGIVTVNCFGEG
FT                   DASTPFGGYKESGFGGRDKSVWAHDQYTELKTIWIDAS"
FT   CDS_pept        complement(807086..807997)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07391"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25466"
FT                   /protein_id="CAW25466.1"
FT                   /translation="MKFEGIYTPAITPLSADGSIDTQAFAEVLEFLVESKVHGIVIGGS
FT                   TGEYYAHTAEERLALAAHASEVIAGRLPLVVGTGAIRTEDSLAYAEAARAIGADAILVG
FT                   SPPYALPTSREIAEHVLAVDRAAGLPIMLYNYPARMGVEMDEAFFAAVAGCRNIVAIKE
FT                   SSGSTAQLHRLACRHPRIALSCGWDDQALEFFAWGARSWVCAGSNFIPGEHLALYQACV
FT                   VENDFAKGRRIMAAMMPLMDFLESGHFVQSIKHGCELAGLRAGGVRAPLKALDEAGKAA
FT                   LAEIVARLKGEVARIVEGGRHD"
FT   CDS_pept        complement(808062..809390)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07401"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25467"
FT                   /protein_id="CAW25467.1"
FT                   /translation="MTNPTTSIEDVPLNAFHRLLTLRSGGGSFVDGYVLSIIGVAMLQM
FT                   TAALQLSSFWQGMIAASALVGIFFGGFLGGWLTDRLGRRRLFFVGPSLFVLASLAQYGV
FT                   DSAAALFVLRFLIGVAVGIEYPVATALLVEFLPKKYRGPRLATLTILWFAGAAFAYLVG
FT                   DLILRSGGEDAWRLVLASTAAIGAVLFLLRIGTPESPRWLLSKGRDADAERVIRQVYGE
FT                   AFSLANLPEQALERKVTIWHLLYAGYGKRMLFVTLFWTCSVIPVFAVYAFAPKVLLALN
FT                   LKGDWASYGSVAITLLFVIGCIIATRLINRIGRRCMLLHSFLWSGLALLGLGVFHAGSE
FT                   ATILGLFGAYALFIGGAQVLQLVYPNELFPTEIRAFAVGVGTSLSRVGAAVGTYLVPLS
FT                   LETLGTAQTMYAAALVTLLGLLVTWALAPETRSLNLQQAASLT"
FT   CDS_pept        complement(809526..810845)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07411"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25468"
FT                   /protein_id="CAW25468.1"
FT                   /translation="MTKVTHLPADDRSCGWYHLSPPRRPKPAHYGRSAARWVVVGAGFT
FT                   GLAAARQLALHFPDEEIVLVEAQEVGFGTAGRNAGFAIDLPHDIGADDYIGDIATARIG
FT                   LKLNLAGQSLLREQVQRHAIDCQMKACGKYQAAVEARGVAVLDAYRRGLDRLGQAYEVI
FT                   EADDLPGHIGTAFYRKALFTPGTLLVQPSALVKGLADSLPGNVSLYEHTPITAVEYGDR
FT                   TLLSHPHGSILADRLVLANNAFGMSFGFLQGRMLPIFTYASLTRPLDAEEQASLGGRPY
FT                   WGLIPADPYGTTVRRTPDNRLLIRNSFSFNPDGRSAGKYLERFAVRHRASFRQRFPMLP
FT                   EVGFDYTWGGSLALSRNHMGHFGELAPNVYGALCCNGLGVTRGTVTGKLLADWLAGERN
FT                   ELIDFLLRAPGPSGNPPEPLLSLGVNLNLRWGQYRAGRES"
FT   CDS_pept        complement(810938..811666)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07421"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25469"
FT                   /protein_id="CAW25469.1"
FT                   /translation="MKAQPDVDSNSADAPFDRKAVLGDALRRRILSMELAPGAVVDELA
FT                   LCDEFGLSRPPVRELLRQIAAEGYIELEANRAPRVAAMSHDSLHAFFLAAPLIYIATTQ
FT                   LAATHASEAEIETLKAIQEDFRKAIEEKHVENRVIHNDAFHLEIGRMAHNDYLMPSLRR
FT                   LLIDHARLGKIFYRHPTTDDMQRDLELACDQHDQIVDAIQRRDPDAAAEIVRAHFELSR
FT                   RRMAEYAAPAGVEVALVYEG"
FT   CDS_pept        811973..812995
FT                   /transl_table=11
FT                   /locus_tag="PLES_07431"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25470"
FT                   /protein_id="CAW25470.1"
FT                   /translation="MERRRFSAALQGQNLRFTGAGEGGSARARVGFLLLEHFSLPAFTQ
FT                   ALDTLVTANLIRSESFAVSNFSLSGEPVTSDLGLLICPDLALASAALQGLDLLVVCGGL
FT                   RTPLRSSAALREALQDVASRGVALAGLWNGAWFLGDAGLLDGYRCCIHPEHRAALAEIA
FT                   RNSQVTSDSYMVDRDRLTAASPTGAFNLALEWIARRHGRDLVEAVVDILAFEESRYRRV
FT                   RPALHEKMSEPLREVINLMAANIEEPLSQEQLAHYVGRSRRQIERLFQQQLGTTPVRYY
FT                   LELRITECRRLLQHSDLTMLEVLVACGFVSPSHFSKCYTAFYGYPPSKEVRYGNVRSTK
FT                   "
FT   CDS_pept        813021..813488
FT                   /transl_table=11
FT                   /locus_tag="PLES_07441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25471"
FT                   /protein_id="CAW25471.1"
FT                   /translation="MLERTFRPGLRRSCAMSQPFLWRRVNDSSGFAEPRVFIRVYLEPG
FT                   SIDAAIAFYEDLQGVAHDMRFDFPEKRLTLAAVGAFLLLEGSDEALAPFRSTTGTLLVD
FT                   DIEPYHRRLLAAGAQVIFGPARAPTGACFNALLPDGTVVEFVHHRPQPGEA"
FT   CDS_pept        complement(813492..814130)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07451"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25472"
FT                   /protein_id="CAW25472.1"
FT                   /translation="MYLPSHFEESDPQALHALIRDYPLGLLVSHGEAGLDANHLPFELS
FT                   PEKGAQGTLEAHVARNNPVWSELRDGDEVLVVFRAGDAYISPQWYPSKQEHHRQVPTWN
FT                   YRVVHAHGRVRIRDDERYVRGLVARLTRTHEATQETPWKMTDGPADYIDEMLRLIVGIE
FT                   IEITRLVGKFKLSQNKEARDIRGASAALLARGEQAIGAAMDDCAARRDG"
FT   CDS_pept        complement(814158..814877)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25473"
FT                   /protein_id="CAW25473.1"
FT                   /translation="MPEHAPILPVIAAEVAALAPGFRALSLTVEAAPIVRPEIADRAVE
FT                   RACQALARGEPDWAEAHLAAWAEAFRRFGAKPQRTPCSAEALRKRALRDGGLPSIDPVV
FT                   DLYNAISVQFAIPVGGENLAAYAGTPRLVVADGSETFDTLKNGEAVDESPDPGEVVWRD
FT                   DLGVTCRRWNWRQGVRTRLDASARRMWFILESLPEMPLAALHEAGGLLLDELRLMMPGM
FT                   RADSRLLCVATEPTDSV"
FT   CDS_pept        815178..816821
FT                   /transl_table=11
FT                   /locus_tag="PLES_07471"
FT                   /product="probable acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25474"
FT                   /protein_id="CAW25474.1"
FT                   /translation="MAKAADVVVQCLENEGVQYVFGIPGEENLDLLESLRKSQIRLVLT
FT                   RHEQSAGFMAATYGRLTGKTGVSLSTLGPGATNLVTAGAYAYLGGMPMLMITGQKPIKK
FT                   SKQGRFQILDVVGMMQPLTKYTHQLASADNIPSRVREAFRLAEEEKPGAVHLELPEDIA
FT                   AEQTDSLPIPPSLSRRPLAEYKAICAAVEKLRAARSPILVIGAGANRKMTAKVLKQLID
FT                   KTGIPFVTTQMGKGVVDERHPRFLGNAALSAGDFVHRAVEAADLIVNVGHDVIEKPPFF
FT                   MVRGGTEVIHVNFRSAEVDPVYFPQIEVVGDIANAIWQIGEALDDTAHWDFTRLLAIRE
FT                   ANEAQVAEGADDPRFPLYPQRLVADVRRALPSQGIVALDNGMYKIWFARNYKAHMPNTV
FT                   LLDNALATMGAGLPSAMAAHLVYPDRPIVAVCGDGGFMMNSQELETAVRLKMNLTVIIL
FT                   RDNGYGMIRWKQSNMGFADFGLDYGNPDFVHYAEAYGAHGHRVDSAEGFLPLLERCLGT
FT                   PGVHVIDCPVDYSENDRILNVELRERALAV"
FT   CDS_pept        complement(816864..818159)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07481"
FT                   /product="probable porin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25475"
FT                   /protein_id="CAW25475.1"
FT                   /translation="MSSPFSPRSPRTLRGLGALALCGGFVAPAPAAFLEDGSARLEART
FT                   VYFNRDFRDGSSANPQGASKREEAAQGFILDLRSGYTEGALGFGVDTLAMLGIKLDSSP
FT                   ADSNSGLLPSSGHDPRRSVDQYAKAGVAGKMRFSQTQFRYGAMLPDMPLLKYNDGRLLP
FT                   TLFHGAQLTSEEIAGLRLSATRLERYTARDSSDAQDIRLHCKNKRYACDTTGNRFDAYQ
FT                   LDYQVNDGLLLQYAQGGLRNVYRQRYLGAVGKRQLGAGKLSADLRWFDSEDAGAARAGK
FT                   IDNRALSLLLAYAEGGHTLSAGWQRMNGASSMPYLDGSNPYLANYLQVNDFANPEERSW
FT                   QLRYDFDLRSVGVPGLSFMTRYVNGDHIRLANGDEGKEWERDIELKYIVQSGRFKDLSL
FT                   RLRNATYRTDFERSARDVDEVRLIASYNLSLF"
FT   CDS_pept        complement(818396..819139)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25476"
FT                   /protein_id="CAW25476.1"
FT                   /translation="MSATALYTDLSHYYDLMCADIDYQAQSHCVRRLHQLFGNQGRRHL
FT                   DLACGTGPHVRHFLDFGYRSAGLDINQPMLDLARQRCPEAHFSRQDMAGFQVDEPLDLI
FT                   TCFLYSIHYNAGLERLRACLASVHGALADGGVFCFNTVDKGQIDNRAFVRHSVEHRGSR
FT                   FTFGSGWYYSGEGERQALRLGIEKTTDGTTQTWEDEHPMVALGFAELQHLLQSHFEVQV
FT                   FEHDYERITPWAGSSGNALFVCVKR"
FT   CDS_pept        complement(819239..819640)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25477"
FT                   /protein_id="CAW25477.1"
FT                   /translation="MSQTFHGSCLCGALHYRLSSPPRALSHCHCGQCRKAHGAAFASYG
FT                   SVPVADLHIDRGADLLAAFRSSPAVLRRFCSRCGSPLFWSRSEGEFADWVSVALGSLDT
FT                   PFPAAKQKHVQVASMACWCRIADDWPRFD"
FT   CDS_pept        819783..820064
FT                   /transl_table=11
FT                   /gene="ppiC2"
FT                   /locus_tag="PLES_07511"
FT                   /product="peptidyl-prolyl cis-trans isomerase C2"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25478"
FT                   /protein_id="CAW25478.1"
FT                   /translation="MARATARHILVSSEAKCNELKTAIEGGADFAEVAREHSSCPSGRD
FT                   GGNLGSFGPGQMVREFDQVVFSAPLNVVQGPVKTQFGYHLLEVTSRQD"
FT   CDS_pept        complement(820385..821773)
FT                   /transl_table=11
FT                   /gene="piv"
FT                   /locus_tag="PLES_07521"
FT                   /product="protease IV"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25479"
FT                   /protein_id="CAW25479.1"
FT                   /translation="MHKRTYLNACLVLALAAGASQALAAPGASEMAGDVAVLQASPAST
FT                   GHARFANPNAAISAAGIHFAAPPARRVARAAPLAPKPGTPLQVGVGLKTATPEIDLTTL
FT                   EWIDTPDGRHTARFPISAAGAASLRAAIRLETRSGSLPDDVLLHFAGAGKEIFEASGKD
FT                   LSVNRPYWSPVIEGDTLTVELVLPANLQPGDLRLSVPQVSYFADSLYKAGYRDGFGASG
FT                   SCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSA
FT                   AHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELK
FT                   RTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDW
FT                   PSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISR
FT                   YFAP"
FT   CDS_pept        complement(822308..823231)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07531"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25480"
FT                   /protein_id="CAW25480.1"
FT                   /translation="MDRFDAMQAFARVVDTGSFTKAAETLHMSRTSVTQLVQQLEARLR
FT                   VRLLNRTTRKLNLTADGAAYYERVVRLLAELDDAETSLSSAALAPRGRLRIDVPSPLAR
FT                   LLLIPALPEFHARYPEIQIDLGVSDRLVDLIDENVDCVIRGGELRDQSLMARRVGDLQL
FT                   GVYAAPAYLQRAGVPSHPRELEDSHQRIVGFLWARTGKALPYAMRRGEECLRVAGRHVL
FT                   AVDDGNAYLAAGLAGLGILWLPHYMAREPLARGELLPLFEDWSLEPMPLYLAFPPNRHV
FT                   SGKLRVFIEWVAELIARHAPPLHPPL"
FT   CDS_pept        823371..823769
FT                   /transl_table=11
FT                   /locus_tag="PLES_07541"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25481"
FT                   /protein_id="CAW25481.1"
FT                   /translation="MTVRDVVFPAGRQALYERNRYSPAVRSDGLLFVSGQVGSRDDGSP
FT                   EPELETQVRRAFDNLNAVLAAAGCGFDDVLDVTVFMVDAEANFERIWKIVPEYWGEAPY
FT                   PTLTAVGVNWLYGFSFEIKVVARLPEGR"
FT   CDS_pept        complement(823801..824601)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07551"
FT                   /product="probable nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25482"
FT                   /protein_id="CAW25482.1"
FT                   /translation="MDTLKIATFNVNGIQTRLAALLAWLEREAPDIVCLQELKTPDARF
FT                   PAAALEKAGYGAIWQGQSAWNGVAILARDSQPLEVRRGLPGNASDPHSRYLEAAVDGLL
FT                   VASLYLPNGNPQPGPKFDYKLAWFEHLIRHAAELMESGHPVVLAGDFNVVPSDFDIYDT
FT                   RSWKKDALLQPESRECFERLLRQGWVDALRQRFPDRRLYTFWDYFRQHWQRDAGLRIDH
FT                   LLLSASLADHLEDAGVDRWVRGEEHASDHAPAWVSLRRPSEPRR"
FT   CDS_pept        complement(824624..825187)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07561"
FT                   /product="probable protease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25483"
FT                   /protein_id="CAW25483.1"
FT                   /translation="MSAKLQGKNVLVITANTGIERDELLEPLKTLKQQGATVTHATIEG
FT                   GEAQTWVHDSEKDLIVNSDARLQGLRAEDYDLLLVPGGTVNADTLRQDSEARRLVREFS
FT                   DAGKTVAAICHGPWLLIDAGVARGKTLTSYSSVRIDLTNAGADWVDTRVKVCPANGWTL
FT                   ITSRNPGDLQAFNEAIGEALQAAA"
FT   CDS_pept        complement(825323..826255)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07571"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25484"
FT                   /protein_id="CAW25484.1"
FT                   /translation="MKLTLLRDYPNGRYAMTFDVIIVGGSYAGISAGMQLARARRRVLV
FT                   MDTGLRRNRFARASHGFLGQDGRDPAAIAYDARAQLLAYPSVEWLSEAAVAAKKEADGF
FT                   VVKAANGERFTARRLILASGVADELPEIPGLAERWGRHVFHCPYCHGYELDGGPIGVLA
FT                   ASPLAIHHALMLPDWGATTFFLNGVFEPDAEQMSRLDRRGVTIEREAVVALGGARADVT
FT                   LASGRTITLAGLFTQPRTRMASPLAALLGCEFEDGPSGPFIRTDGMRETSVPGVFACGD
FT                   AALAAGNVAIAVGDGARTGGAAHHSLLFR"
FT   CDS_pept        826339..826767
FT                   /transl_table=11
FT                   /locus_tag="PLES_07581"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25485"
FT                   /protein_id="CAW25485.1"
FT                   /translation="MRNDTRLSRMLHVLIHMARHEGPATSEAIGQMLGTNPVVVRRTMA
FT                   LLKNEGYVSSEKGHRGGWRLAKPLADITLLDIHQALGASSIFAIGLSTDHPECLVEQAV
FT                   NEALGEAFEAAQALLLERLGSVTLEQLASEFERRYRPC"
FT   CDS_pept        complement(826832..829240)
FT                   /transl_table=11
FT                   /gene="fpvB"
FT                   /locus_tag="PLES_07591"
FT                   /product="second ferric pyoverdine receptor FpvB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25486"
FT                   /protein_id="CAW25486.1"
FT                   /translation="MKHVVSSALLLGLSSLSLAAQAAPIALDLPAQPLAASLEQLQGAS
FT                   GLRIRFDRAAVADRRAPALRGTLEPSEALQRLLAGSGLSGEVRGGDAWVEAAATGAGIA
FT                   PGDSVDLGALSVVATQDPATAAITEDSGSYTTRAMRTSTKLAMSIRETPQSVSVVTRQR
FT                   MDDQGMRDLNDAVKGVTGLTVQQYGPARVKYAARGFDVDNIMYDGLPTSISTYTQDVIS
FT                   AADLAMFDRVEVVRGATGLMQGAGNPAAAINMVRKRPTQDFRASLQGSVGTWDRYRSEA
FT                   DVSGPLNSEGTLRGRAVVAYQKGNSFQDHVSSERGVFYGIAEADLSPDTTFAIGASNQN
FT                   DNRNDNWVGLPSPLGGRHLDLKRSSYYGADWSYWDTDTTHLFSDLTHRFANGWQMKLAA
FT                   DKLWARINMLGLYNDCYYSTTGCASMTQNPGDYSYTDDHDSYDAYANGPFQLLGREHEL
FT                   VVGASYRQERFDGHGGWGSLFNKDGTLTGPMDPTQWDPSSTLKPRLNTSLWGMKLDQEQ
FT                   KGAYLTTRLNLADPLKVILGGRLDWYKADADTDSYKVTRNVTRYAGVIYDLNQTYSVYA
FT                   SYTDIFKPQSNFDAGGGLLDPITGKNYEIGLKGEHFGGALNSQIALFQIDQENRATEDV
FT                   GGPSPCPFSPTSRYCSRASGKVRSQGVDLELSGALSDDWQMMAGYTYVDAKYKHDSNKA
FT                   NEGKPFDAAKPRHLFKLATSYTLPGELHKWRVGGDLATQSKTEDSSTGFQQGGYTVVNA
FT                   MLGYKVNERIDTRLNFNNLFDKYYYSGIDFGNLNYGEPRNLMFTVKYSL"
FT   CDS_pept        829583..830401
FT                   /transl_table=11
FT                   /locus_tag="PLES_07601"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25487"
FT                   /protein_id="CAW25487.1"
FT                   /translation="MSSTIHPLPSFGLGTFRLTGQVVVDSVRSALELGYRAIDTAQIYG
FT                   NEADIGRAIAESGVPRSELFLTTKVWVDNYAREKLLASLRESLEKLRTDRLDLVLIHWP
FT                   APGNGVELAEYMAALAEAKSLGLTRRIGVSNFNIELTRQAIAAVGAGEISTNQIELSPY
FT                   LQNRELTAYLEEQGIAVTSYMTLAYGKVLKDPTLAGIAARHRATVAQVALAWAMQLGYA
FT                   VIPSSTRRENLASNLLARDLRLDAEDMARIAGLERNGREVSPQGLAPAWD"
FT   CDS_pept        complement(830468..830926)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07611"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25488"
FT                   /protein_id="CAW25488.1"
FT                   /translation="MQSLHTLVSVRPVAHEDFEQWLEYWKAYQAFYEVELSAQATEATW
FT                   RRFFDEGEPMHCAVASDGSRLHGIVNFLYHRSTWAAQDVCYLEDLYVSPDVRGQQIGKQ
FT                   LIEYVRRQAEERRCARLYWHTQESNHRAQRLYDWVADKPGVIEYRIEL"
FT   CDS_pept        831058..832548
FT                   /transl_table=11
FT                   /locus_tag="PLES_07621"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25489"
FT                   /protein_id="CAW25489.1"
FT                   /translation="MFRQSLLESVKARLLHPQLQALPLHARIQRAIRQLILDGALAPGN
FT                   PLPASRALAQSLGVSRDTVEAAYSHLHAEGFIERRVGSGSVVAAATRLSPGRRGAGAPR
FT                   RGGGAPRLSRRGEAMQAGGGVREQLVPRPFAPGVPETRTFPLATWERLQRQVLKEYGAR
FT                   ALTHGDPQGAEPLRQAIADYVNLERGARATADRVLVLTSSQQALGLCASVLLDAGERIF
FT                   VEDPAYYGARKAFEAAGLECLPVPVDEQGLRPEPILAQPQAARALCLTPSHHYPTGVTL
FT                   SLERRLALIEWAQRQQAWIIEDDYDSEFHYAGRPTACVQGLDAHERTLYIGTFTKSLFP
FT                   GLRIGYMVLPPALVAPMTVARSLQDGHNASLAQLTLARFIAGGHFGAYVRGMRNLYGER
FT                   LGFLAERVGKRLGGLVEPRVPAGGLQMPGLLCAGIDETRAIAAAYRAGVELVGLSTLHL
FT                   AAPPRAGFLMGFAAYTTDELEAAVGVLAKTLRGLRANP"
FT   CDS_pept        complement(832564..832890)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25490"
FT                   /protein_id="CAW25490.1"
FT                   /translation="MQRLFVYGSLGPGRPNEHLMQKIGGQWQAASLRGRLLEKGWGAGM
FT                   GFPGLAIDADGEEIHGHVFVSDRLAEHWPALDEFEGTEYRRVATRVTLADGAQVDAYVY
FT                   ALRD"
FT   CDS_pept        complement(832952..834661)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07641"
FT                   /product="amidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25491"
FT                   /protein_id="CAW25491.1"
FT                   /translation="MIEVTEVSIAELRDALESGRTTAVELVQAYLARIDAYDAPGTPTA
FT                   LNAVVVRNPDALAEAQASDARRARGEPLGPLDGIPYTAKDSYLVKGLTAASGSPAFKDL
FT                   VAQRDAFTVERLRAAGAICLGKTNMPPMANGGMQRGVYGRTESPYNAAYLTAPFASGSS
FT                   NGAGTATAASFAAFGLAEETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVV
FT                   PYARSMADLLEILDVVVADDPDTRGDLWRMQPWVPIPKASEVRPASYPALAAGAEALAG
FT                   KRFGVPRMFINADPDAGTSESPGIGGPTGQRIHTRPSVIALWEQARKALEAAGAEVIEV
FT                   DFPLVSNCEGDRPGAPTVFNRGLVSKEFLHDELWELSAWGFDDFLRANGDPKLNRLADV
FT                   DGPQIFPHDPGTLPNREGDLAAGMDEYVRMAERGIKPWDRIATLPDGLRGLEETRRIDL
FT                   EEWMRRLRLDAVLFPTVADVGPADADFNPASADIAWSNGVWVANGNLAIRHLGVPTVTV
FT                   PMGVMADIGMPVGLTFAGRAYDDSALLRFAAAFESTGSRRIVPPRTPPLASK"
FT   CDS_pept        834966..835682
FT                   /transl_table=11
FT                   /locus_tag="PLES_07651"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25492"
FT                   /protein_id="CAW25492.1"
FT                   /translation="MTNHRTALVTGATRGIGLALARRLAASGWSVVGIARHASDDFPGR
FT                   LLCCDLADPAQTAETLRGLLSESAVDALVNNAGIALPQSLENLDLAALQQVFDLNVRVA
FT                   VQLAQACLPGLKRSPAGRIVNLCSRAIHGARERTAYAAAKSALVGVTRTWALELAPLGI
FT                   TVNAVAPGPIETELFRQTRPVGGEEERRILSTIPMQRLGRPDEVAALIEFLLSEGASFV
FT                   TGQVIGVDGGGSLGGR"
FT   CDS_pept        complement(835692..836723)
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="PLES_07661"
FT                   /product="ferric enterobactin transport protein FepG"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25493"
FT                   /protein_id="CAW25493.1"
FT                   /translation="MNGLHALRLGSLSLRWRPRAALACLVLAGVGLALAAALLGTGSLA
FT                   LGPAEVFASLLGQGQDPTAQRIVQRVRLPRVLTACLVGAALGMAGAIFQSISRNPLGSP
FT                   DVIGFTTGAASGAIVQIILFDAGPLATSLAALAAGLCTALAVVLLARRGATAGGYRLVL
FT                   VGIGVGASLSGLNSLLLVTGNLDQAMYAQLWLAGSLNTRTWSHVVPASLGLLASVPLAL
FT                   YHGRRLEVLELGDASAAQLGVAVERVRLQMVLVAVGMTAIATAAAGPIAFIALAGPQLA
FT                   RRLTRSAGVPLLSGALMGAVLLLAADLLGQRLAYVANLPIGLMTGLLGGFYLLWLLLRS
FT                   RRI"
FT   CDS_pept        complement(836720..837742)
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="PLES_07671"
FT                   /product="ferric enterobactin transport protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25494"
FT                   /protein_id="CAW25494.1"
FT                   /translation="MQASPMRRRRLRAWGLLAGALLLALAALASLALGSRPVPLAVTLD
FT                   ALQAVDPHDDRHLVVRELRLPRTLVALLAGAALGVAGALMQALTRNPLAEPGLLGINAG
FT                   AALAVVVGVALFDLASMGQYLGCAFLGAGLAGIAVFLLGQARETGTNPVRLVLAGAGLS
FT                   VMLASLTGIIVLNAPPEVFDRFRHWAAGSLSGSGFALLGWPGLAIGAGLAAAFALAARL
FT                   NALALGQEIGRALGVDLRLTWLLACLAVMLLAGAATALAGPIAFVGLVAPHLARLLAGP
FT                   DQRWILPFSALIAAGLLLGADILGRLLAAPAEIAAGIVALLLGGPAFIVLVRRFRLSRL
FT                   "
FT   CDS_pept        complement(837773..838678)
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="PLES_07681"
FT                   /product="ferrienterobactin-binding periplasmic protein
FT                   precursor FepB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25495"
FT                   /protein_id="CAW25495.1"
FT                   /translation="MPTRRRSALPLLALALSLFATLAAAGEPKPARIVSTTPSVTGILL
FT                   AMDAPLVASAATTPSRLTDAKGFFSQWAKVADQRGVEVLYRNLRFDIEAVIAQDPDLLV
FT                   ASATGADSAAPYRAELEAQGVPTLVVDYSKHSWQELATELGRHTGLERQAQAAIQRFDA
FT                   YTAEVATAIAPPQGPVSVVGYNIAGSYSIGRQASPQARLLEALGFRVAELPEALAGKVT
FT                   RASDFQFISRENLPAAIAGDSVFLLGASDDDVQAFLADPVLANLSAVREKRVYALGPSS
FT                   FRIDYYSGRQMIDNVARHFR"
FT   CDS_pept        838805..839602
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="PLES_07691"
FT                   /product="ferric enterobactin transport protein FepC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25496"
FT                   /protein_id="CAW25496.1"
FT                   /translation="MTYRLHADAVTLRRDARTVSRNLSLAIPEGSFSVIVGPNACGKST
FT                   LLAALSRLLAPAEGRVVLDGRDIHSLPGREVARRLGLLPQSALAPDGITVAELVARGRY
FT                   PHQSFLRQWSPADERAVAAALRATRVDGLAERPLDALSGGQRQRVWIAMVLAQETPLLL
FT                   LDEPTTYLDIVHQIELLELLAELNRQGRTIVAVLHDLNQACRYASHLIAMRDGAILAEG
FT                   APAHIFTERLVEEVFGLRSLIIADPVSGTPLLVPRGIAADAPG"
FT   CDS_pept        complement(839609..840397)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07701"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25497"
FT                   /protein_id="CAW25497.1"
FT                   /translation="MPDAPGEKRSGTIQSVSIAARFLKTLANAEGELALGEVARRTGTG
FT                   GSTAHRYLQSLVKEGLARQDPLSGLYDLGPAALSIGIGALKRIDAVDIAARHMKALAQR
FT                   HAASGGVAIWTERGPTLVRWYRSAYFSINPLALGDILPIDNTACGLVFQAFLPKAVVDA
FT                   ARKQQPAHFRGSPPSRALLDEVRERCWAELTSHLLSNVTGQAAPVFDAQQEIVCAMTTV
FT                   TDLGQLQSAEDRDALFHEALQVNQSTGGLVLHPGMRPPPR"
FT   CDS_pept        840653..842737
FT                   /transl_table=11
FT                   /locus_tag="PLES_07711"
FT                   /product="probable TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25498"
FT                   /protein_id="CAW25498.1"
FT                   /translation="MNARTHRTLNRGIGVVTLSTLLASPSALARENPLAEDEPAALEAL
FT                   VVTGEKRERSLKDTASSVSLTSARDIDRKQTGNASVAEVINGSPNVVYTDSVGAPIIRG
FT                   QDTQGPNNGQNVFWGGTVPRATINLDGHYLNYNEMFFGATSVWDVDSIEVFRGPQTTSQ
FT                   GANAIAGAIIVNTKDPTFSPEAAYQAEIGSYHSRRSSIAVSGPLAQDFAGRLAVDYAGR
FT                   DTFIDYDNPKFQDSGTDQDFRALNARAKLLWLPSGIPGLESKFTFSHNDNNRPTQEAAT
FT                   RPFDKLDHRSTTMPSWEQDTNTSILDVAYDLDNGIRLFNQAQYSLSSVHRTTGAGGEGD
FT                   ADIRQKNASNESRISFGEQEDRISGMGGVYYARTRTDETLHLRGLSAFDDTKKNLGVFG
FT                   ELNYRLSDRWTLTTGLRYQEDRIERSGNSVLAPRPLDYQKTFSAFLPKVSLAFAATPDW
FT                   TVGGLVSRGYNPGGVSLNLTTRNWAYFKEETIWNYELFTRASLLDGRLLLNGNLFFMDF
FT                   KDAQYNIPVVVSPGVEQSYTINAEKAHAYGMELDLDYRLRDDLRLKASAGVLRTRIDEM
FT                   SGNTGYEHNEFARSPGYTLSFGPSWDVTERLNLNAQVRYLDGYYSDTANTKAYSIKAYT
FT                   LTDARASYRFNDQVQLYGYVKNVFDDRSPTYMQENRGIGGIEASMTQPRTLGIGIKGTF
FT                   "
FT   CDS_pept        842805..844112
FT                   /transl_table=11
FT                   /locus_tag="PLES_07721"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25499"
FT                   /protein_id="CAW25499.1"
FT                   /translation="MSTPKRLHIGMSLAPTWLSGDAWRRPDSNIEGIFGSDFAVDIARR
FT                   SEAAHLDFVFRPDVSSLPLDVLETGSGFASLDPTVLLAAVARETSRIGLVSTVSTTFYP
FT                   PYVVARQLQSLHWISNGRAGWNIVTALQGHENFGLDAMPDAEQRYARAAEFTRLVHDLW
FT                   DSFPREALLVDRESGRYADVSRVHPVDHDGEFLKVKGPLNLPAFGEARIPLVQAGASES
FT                   GRDFAASVADLVFAPTPDKEAALELRRDLSRRAERHGRSPRDVRLLPGFSLYLAESREE
FT                   AREIFMQTHARLDRTRKFATIRQMLGLDLSDWPLDRPISAADLPPPVANPGSRTHTDLL
FT                   RRLIERETLRLDQLLLRPEVVSAAHWQVIGTVDDAVEQIVDWAAAGAMDGFIAAPGGSV
FT                   GSLRLFLEQVVPRLVEKGLFRERYSATTFAGHLAEE"
FT   CDS_pept        844549..845217
FT                   /transl_table=11
FT                   /locus_tag="PLES_07731"
FT                   /product="putative SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25500"
FT                   /protein_id="CAW25500.1"
FT                   /translation="MSLSRRIPAALSPFQNRVIGACLLGGLLAAGAPAQAEEATGNARW
FT                   VSDSLTTFVRSGPTDGYRIVGTLTSGQKVELLGTQGNYSQVRGENGSTVWIPSRDLQEV
FT                   PGQAERLPQLEQKVAALTAELDGINDTWKTRVQGMQETLDTRKKLIDELQAARSNLDAE
FT                   LGKARSDLRAVQAQLGDENKQVLMRYMVYGGSIAGAGLFAGLILPSLLRVRRKRNDKWF
FT                   "
FT   CDS_pept        complement(845301..846392)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07741"
FT                   /product="2,3-butanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25501"
FT                   /protein_id="CAW25501.1"
FT                   /translation="MNSSPQANAAMRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWC
FT                   GICGSDLHEYLAGPVFIPVEAPHPLTGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVA
FT                   ADACQHCGTCYYCRHGLYNICENLAFTGLMNNGAFAEYVNVPANLLYALPAGFPSEAGA
FT                   LIEPLAVGMHAVKKAGSLLGQNVVVVGAGTIGLSTIMCARAAGAAQVIALEMSSARKAK
FT                   ALEVGASQVLDPSRCDALGEIRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLV
FT                   GIFEEPSEFNFFELVSTEKQLLGALAYNGEFADVIAFIADGRLDIAPLVTGRIGLEEIV
FT                   ERGFEELVNNKEHNVKIIVSPGG"
FT   CDS_pept        complement(846406..847518)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07751"
FT                   /product="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25502"
FT                   /protein_id="CAW25502.1"
FT                   /translation="MSRIHTLTMPKWGLSMTEGRVDAWLKEEGAHIEKGDEVLDVETDK
FT                   ISSSVEAPFSGVLRRKVAREDETLAVGALLGVVVEGEASDEEIDALVQRFQAEFVPADE
FT                   DAGDSGPAPRKVELDGRLLRYFDRGEGDPALLLIHGFGGDLNNWLFNHEALAAERRVIA
FT                   LDLPGHGESGKALVRGDLDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQR
FT                   VLSLSLIGSAGLGEEINGDYLRGFVEAANRNALKPQLVQLFSDPALVTRQMLEDMLRYK
FT                   RLEGVDAALRQLLDNLFADGRQRNDLRAVASEGRQPVLAIWGSDDAIIPARHAEGLPAQ
FT                   VEIIPGQAHMVQMEAAEQVNRLLLDFLRQH"
FT   CDS_pept        complement(847515..848534)
FT                   /transl_table=11
FT                   /gene="acoB"
FT                   /locus_tag="PLES_07761"
FT                   /product="acetoin catabolism protein AcoB"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25503"
FT                   /protein_id="CAW25503.1"
FT                   /translation="MARKISYQQAINEALAQEMRRDPSVFIMGEDNAGGAGAPGEDDAW
FT                   GGVLGVTKGLYHQFPGRVLDTPLSEIGYVGAAVGAATRGMRPVCELMFVDFAGCCLDQI
FT                   LNQAAKFRYMFGGKAVTPLVIRTMVGAGLRAAAQHSQMLTSLWTHIPGLKVVCPSSPYD
FT                   AKGLLVQAIRDNDPVIFCEHKLLYSMQGEVPEELYSVPFGEANFLRDGDDVTLVTYGRM
FT                   VHLALDAAASLARQGISCEVLDLRSTSPLDEDSILESVEKTGRLVVVDEANPRCSMATD
FT                   IAALVAERAFSALRAPIRRVTAPHTPVPFSDALEDLYIPDAAKIEAAVRQALEGRDAA"
FT   CDS_pept        complement(848567..849541)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07771"
FT                   /product="probable dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25504"
FT                   /protein_id="CAW25504.1"
FT                   /translation="MSTLSTDQLLHAYRVMRTIRAFEERLHVEFATGEIPGFVHLYAGE
FT                   EASAAGVMAHLRDDDCIASTHRGHGHCIAKGVDVHGMMAEIYGKKTGVCQGKGGSMHIA
FT                   DLEKGMLGANGIVGAGAPLAAGAALAAKLKGSDAVAVAFFGDGGSNEGAVFEAMNLASV
FT                   WNLPCLFVAENNGYAEATAANWSVACDHIADRAAGFGMPGVTVDGFDFFAVHEAAGAAI
FT                   ERARAGEGPSLIEVKLTRYYGHFEGDAQTYRDPDEVKHYRETRDCLKQFRERTCHAGLL
FT                   SASDLDAIDAEIEARIEDAVQRAKNDPKPEPDDLLRDVYVSYP"
FT   CDS_pept        complement(849564..850604)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07781"
FT                   /product="putative acetoin catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25505"
FT                   /protein_id="CAW25505.1"
FT                   /translation="MTPPSPIVGIIANPASGRDLRRLTAHAGLHSSTDKASVVQRLLAA
FT                   FGATGIRHALLPPDMTGIAAAVLRASQTRQARDGHWPFLEFLDMPLRQSVEDTRLAARR
FT                   MVERGVALIAVLGGDGTHKAVAAEVGDVPLLALSTGTNNAFPELREATGAGLAGGLCAS
FT                   NRVPPEIGLRRNKRLLVREPRRGLCEWALVDVAVSPQPFIGARAISRAEDLAEVFVSFA
FT                   EPHAIGLSALCGLWSPVSREEPHGAWMRLHPDARESLLVPLAPGLLVGCGVSAAGYLQP
FT                   GVAHAPSLSSGTLALDGEREIEFSATDRPSITLDPSGPFSVDVPATLAYAARHRLLAGQ
FT                   RTPMTP"
FT   CDS_pept        complement(850601..851401)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07791"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25506"
FT                   /protein_id="CAW25506.1"
FT                   /translation="MHATSSDDFSLSSRVALVTGAGRGIGRGIALALARAGADVAVADL
FT                   DPQVAEETAAAIRSLGRRSLALGVDVSDGDSVRAMVERVATEFGRLDVAVNNAGVISIR
FT                   KVAELSLADWDRVMNVNARGVFLCCQAELPLMQAQRWGRIVNLSSIAGKVGLPDLAHYC
FT                   ASKFAVIGFSNALAKEVARDGVTVNALCPGIVGTGMWRGEDGLSGRWRQAGESEAQSWE
FT                   RHQASLLPQGEAQTVEDMGQLVVYLACAPHVTGQAIAVDGGFSL"
FT   CDS_pept        851733..853610
FT                   /transl_table=11
FT                   /gene="acoR"
FT                   /locus_tag="PLES_07801"
FT                   /product="transcriptional regulator AcoR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25507"
FT                   /protein_id="CAW25507.1"
FT                   /translation="MLSAHSKDHVDCVSRVLRNAARLPQAPVPTPILDSWRRSMEQHRL
FT                   DPGSLQGPRILSQTLLDECRERSELFLRIASEEVARLHGRVRDADYCVLLTDAQGRTID
FT                   YRVESTIRNDCRKAGLYLGTCWSEGEEGTCGVAAVLTDRTAVTVHKRDHFRAAFIDLTC
FT                   SAAPVFDPQGELLGVLDVSAVQSPDDRRSQHLIRQMVAQSAREIENAFFMHSAQGHWVL
FT                   RAHRAPGYVDSQPDYLFAWDADGRLLALNPAARHYLRQRLGQVPSHIGELFDLDALHAA
FT                   ADQAPCLLRGQAGELHVRLSAPRAKARRLEREVPDDAALDPRIAESLRLAVRVKDRNLP
FT                   VLIQGETGAGKEVFARQLHQASARRDKPFVALNCAAIPESLIESELFGYVGGAFTGAAA
FT                   KGMRGLLQQADGGTLFLDEIGDMPLGLQTRLLRVLAEGEVAPLGAARRQAVDIQVICAT
FT                   HRDLAALVAAGGFREDLYFRLGGARFELPPLRERSDRLALIRRILDEETAHCGVRIELG
FT                   EAALECLLGYRWPGNVRQLRHVLRYACALCGGATLQLADLPAELRGEGRTPASACESGG
FT                   GPERDALLDALVRHRWKPMAAARELGISRATLYRRVRRHGIRMPGQADD"
FT   CDS_pept        complement(853821..854225)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25508"
FT                   /protein_id="CAW25508.1"
FT                   /translation="MRARAGEQGHAGSAGDPGLGIEPLQEHALEEPGDPVFLQGQAWIR
FT                   GGDAVAHMSDERRAGHPQVVEEARVGLDRADEPEADEGQQQDEAEGGAGDERQGPAETM
FT                   VGAGSDDGQVHRTGGNRQAQGERAHGEQQG"
FT   CDS_pept        complement(854413..855303)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07821"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25509"
FT                   /protein_id="CAW25509.1"
FT                   /translation="MIDDIRYLIVFAKIAETGSVSGGAEALGLSAATASLHLSRLERNL
FT                   GRALLYRNSRKLSLTQDGTQLLDTARSMLELYEKGFIEFRQRAVSTRNSLRISMPAVFV
FT                   NGDFTRHLAAFIEEHPDLDLGIACDDSRHDIIGDGIDIAFRIGDLPDSSLKARHLFLLP
FT                   RQVVAAPAFLARHAPLEHPRDLQRLEWIGLGMRPDSRLFRHARDDEEVRVDYTPRVRVD
FT                   SVEASCRLARLGVGLAAPPTYLSDEPIRRGELRAVLPEWRLEPLKVYAVWPPNVPASSI
FT                   AYTLINRLYEAFNPG"
FT   CDS_pept        complement(855399..856814)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07831"
FT                   /product="probable outer membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25510"
FT                   /protein_id="CAW25510.1"
FT                   /translation="MRALAGLLCGLLGLVPGAAAYEPDVFGTAGQVAGQAVYDLGGSGL
FT                   PCRGGPPPTELSLEEAIERILCHDPQTRLAWANAKAQAAQVGIGKSAYLPRLDGRLDAS
FT                   RGYSDMDYRDAPYLSGDGHRHRRGASLQLSWVLFDFGRRSAALRNAQQLLLAANASQDA
FT                   TLQNTFALAAQAYYDALAAQRSLAASRQVAELAAQNLEAADAKYRAGAAALSDRLQAQT
FT                   ALSQASLAQVRDEGALSNALGVIALRMGLAPDTPLRLSGELEAQPDTVFVKAIDEMLAE
FT                   ARREHPALLAAQARLKAAAASVEESRAAGRPSLALSANLARSHSDQAMAFNGDTRERDR
FT                   SIGLQLNIPLFEGFERTYQVRNALARREASEAELADTEQQVSLEVWNNYQSLSVETRSL
FT                   ARTRELVEQSRQSLEVVQGRYRSGVGSMIELLNALTAYASAEDQHIRALGNWQTSRLRL
FT                   AASLGRLGFWSLR"
FT   CDS_pept        complement(856814..858973)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07841"
FT                   /product="probable toxin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25511"
FT                   /protein_id="CAW25511.1"
FT                   /translation="MAFLDALALRLGRRLPLVLQTEATECGLACLAMIAGYHGHHTGLM
FT                   ELRRRFSVSLKGISLKQLIQTAHRLGLGTRAVKLDLGDLGKLKLPCVLHWNFNHFVVLK
FT                   AVDGRGAVLHDPAHGQRRLGLEEVSRSFTGVALELWPESGFEKQEAPPRIKLLGMLGKV
FT                   TGLYRSLAQVLLLAGALEVFSLISPFFLQWTIDNVIVSEDRDLLSTLAIGFGLLLLMQQ
FT                   AVSGVRAWVMMHMSTLLGVQWQANVFSHLLRLPAQYFEKRHLGDVVSRFGAVNSIQQTL
FT                   TAAFLSAVLDGLMTVATLGMMLLYSPPLAAIAIAAMSLYALGRWIWYRPLRNATEEQIV
FT                   HAARQQSHFLETVRGIRPLKLFQRQDERRSVWLGLLVEQINAGLRTQKLQLFYQQLNGL
FT                   LFGVENLLVIWLGATMVMDGQFSVGILMAFNAYKSQFDSRVGSLIDKFFELRMLQLQGE
FT                   RLADIVLQAPEVSHGDILPENLREREASIEIQGLRYRYAEQEPWVLDGLDLRIAGGESV
FT                   AIVGPSGCGKSTLFNVLLGILPPVEGQIRMAGLDLAQLGLDGLRELVGTVLQDDVLFAG
FT                   SLSDNISFFDPQPDMPWLLQCAQMAAIHDDIQAMPMGYNTLVGDMGTVLSGGQKQRVML
FT                   ARALYKKPRILFLDEATSHLDVHCEQRVNAAIRALRITRIMVAHRPETIASADRVIVLG
FT                   QGKVSLDESTARLAERQAAAAREQA"
FT   CDS_pept        complement(858983..860239)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07851"
FT                   /product="probable secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25512"
FT                   /protein_id="CAW25512.1"
FT                   /translation="MFRQEALDAQHAGGLGEIVLIRPVSFTFLTLLAAVMALLVVGFFL
FT                   FGSYTKRSTVSGQLVPASGQVKVHAPQAGIVLRKFVQEGQAVRRGERLMVLSSERYGSD
FT                   AGPVQAGISRRLEQRRDSLRDELEKLRRLQDDERDSLTSKVASLQRELTTLAAQTDSQR
FT                   RLLALASDAAARYQGLMDKGYISMDQLQQRQAELLGQRQTLQGLERERTSLRQQLTERR
FT                   NELAGLSARQANQLAETRRQLSAVEQDLAESEAKRTLLVTAPESGIATAVLAEAGQTVD
FT                   SSRPLLSIVPADTPLQAELYAPSKSIGFIRPGDAVLIRYQAYPYQKFGQYHGKVQSISR
FT                   ASVSYAELSSMVGGVPGLGQDGEQLYRLRVTLDDQAVTAYGQPRPLQSGMLLDADILQD
FT                   TRRLYEWVLEPLYSLTGKL"
FT   CDS_pept        complement(860336..860635)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25513"
FT                   /protein_id="CAW25513.1"
FT                   /translation="MKELNDIEVTCVSGGTLSGMIVGAVDGAATGMAIGGKWGGAGGFG
FT                   FGALSQLVGLIVPTAMGAIAGGTVGLFTNAETAVGYLGKYRENFGPGDVGRTTI"
FT   CDS_pept        complement(860944..862737)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07871"
FT                   /product="putative cholesterol oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25514"
FT                   /protein_id="CAW25514.1"
FT                   /translation="MHDLIQHADAFVGDPDQESGGLSRRSFLGKSATLGAVGLVAGWTP
FT                   AFVIQPAEAAASSCPAPAGFPAGLELYRRAFRNWSGEIAADDLWSCAPRTNEEVLAVVN
FT                   WAWQNGFKVRPRGMGHNWSPLLLKGGENCESRIVLVETSRYLTRVRIDAQGEFGLFSAQ
FT                   TGVTMEALLKQLERVKLGFVATPAPGDLTLGGVLAIDGHGTGIPAQGESRLPGQSYGSL
FT                   SNSIVALTAVVWDGAAGQYVLKTFRRDDPACAPFLVHLGRAFIVEATLQAGVNKRMRCQ
FT                   SYVNIPASEMFAAAGSGGRTFDSFLQKSGRAEAIWFPFTDKPWLKVWTPTPRCPFGARA
FT                   VNGPFNYPFSDNIPKALSDLLAAINTGHPELTPLLGKLQYDLVVGGMALTLGYDLWGWS
FT                   KDLLLYIKPSTLRVTANGYAVLTRRRDVQRVINEFYLQYQTMVAAYRANGHYPMNGPVE
FT                   IRVSGLDQPGESIVPGAQVPSLSAIRPRPDQPEWDTAIWLDILSLPGTPQANAFYHEFE
FT                   AWLFDHFSGDYASLRVEWSKGWGYSPAAAWDEPTVVDQLVAQSLRQGLVADNDWDSAVR
FT                   QLNEADPHRLFSSPLLDRLMP"
FT   CDS_pept        complement(862869..863168)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25515"
FT                   /protein_id="CAW25515.1"
FT                   /translation="MQLATLQELSFDEIDQVSGAGLFSFVGDAIVDVVKVSNDLLNTSV
FT                   ISSVGKVFNAVGLTPIHQLADTLGYGVFKGVAAVGGLLGGDTSRIDYHYDTEWT"
FT   misc_feature    863875..906018
FT                   /note="LES prophage 2"
FT   CDS_pept        complement(863965..865014)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07891"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25516"
FT                   /protein_id="CAW25516.1"
FT                   /translation="MRPRSNKNRGLPPRMIKRTRTMKSGKVWVGYYYDGRDAEGRRKEI
FT                   PLGTDLDEAREKWAKLERKAVPPTTRTVGDLLRRFERDVVPTKAPKTQKEYSKMIRQLL
FT                   GAFDEAPVEDITPSTIAQYRDARTAKVRANREITLLSFAYNMAREWGITSMENPCRGVK
FT                   KNKEQPRDVYVTDEVWKALYEKAPDDLRVTMDLAYLTGQRPADVRKLRKNDVSGDYLLV
FT                   GQNKTSRKLRIRLRRADGQMTQLGHLVESIASDSPALVTNEKGQPMTEKMLRTRFDTAR
FT                   KAAADEAIKAGDQDLAREIMQFQFRDIRPKAASDIESLADASDLLGHTTQEITKRVYRR
FT                   IGKAVNPVR"
FT   CDS_pept        complement(865240..865596)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07901"
FT                   /product="hypothetical protein"
FT                   /note="orf01165"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25517"
FT                   /protein_id="CAW25517.1"
FT                   /translation="MTARRLTRAEMNHLRRLIGWVRCEVGAEPEEIVTATKKALDHFQG
FT                   VSEDGKRRLLEHYQKSAAIPKYIRSAIKALEKVCLEDPTEVVDGELVARGRHEVPLRLV
FT                   VARNEEEIGNGKLD"
FT   CDS_pept        complement(865601..866290)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25518"
FT                   /protein_id="CAW25518.1"
FT                   /translation="MLMTYENLKRLLNIWDKPDLSALTRLLVARRMARQYQFGWEADRT
FT                   CADRKIKEARKGLPFTRAQLEQAKEFRRTSSSYHEKAQAALGAWLLQAERWIEGEIGVD
FT                   RICDALGVNPVHRAAIQGAKPGQMLNHIAFVEGLEDSSNAFSGRREADLKDGPLFNCII
FT                   AEMLRFAEENPEALPDPFAPGGPLYGVPQTVIRNDGTIETRRAALTLHCRDGSMRVIER
FT                   KPEVGRE"
FT   CDS_pept        complement(866463..866654)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07921"
FT                   /product="hypothetical protein"
FT                   /note="orf01168"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25519"
FT                   /protein_id="CAW25519.1"
FT                   /translation="MRGSDIPPPPGYRPTPLATLGQQLVRLGQAMQNPNTKLGELTELV
FT                   QACGVDLRICDTNKGRQP"
FT   CDS_pept        complement(866767..868254)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07931"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25520"
FT                   /protein_id="CAW25520.1"
FT                   /translation="MKSGMGMQLDAIRPYLKPGMPIAIGRAGAVIAEVAEGNAIEDKRQ
FT                   AAEAAAGYIDSVERYVESANTLEGAVSGLESTLQSIEQYAEDGQNGSALQAMNALRVIR
FT                   ETVAKHLADAEGAGEIPLERALLALRTIAELPCPEQDDLPAANMRQIALAALGGAGASS
FT                   EPGNPGGEPLSGPGSAGERPYPAPGSGDSELAESLQTLVRWLDRVDIEDGYVGVPVIEA
FT                   VEVAVNELRRLRQFERICEGLPQDAIDGGWTVQGIRGYAKRLEDQLKAAQAEVEALRAE
FT                   LQSQRERNTELIFKLGSATNGWGRCEKERDAALARAAELEGKLAELEKPVPTHGEHSEL
FT                   RRIAVALKNPLLSGEEASDLMVRYEALTMPDHIIALIDRQAQHSVPEEFIGRLSEFLAQ
FT                   RGATGKALLRELRAMLAAEPTSSASPSCKWTESSGIWETGCGQTWGFVEDGPAENGALF
FT                   CHHCGGRLVLIKSDDQEDDGEPCPDCMENAPAPGCEA"
FT   CDS_pept        complement(868765..869349)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07941"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25521"
FT                   /protein_id="CAW25521.1"
FT                   /translation="MQTIKLKLVGQSPLLMHSDRFANPLDEATKQHKVLTSKRKKLDED
FT                   HADIAKSEWMGSLYHDQEVGVFVPGQNIKSALVGAAKIQRLGSAFKRAVLVLDDKCKLE
FT                   YSGPRDPEAIFANPRFVDARSVVVGTSRLIRYRPKFSDWSTTVEIMYSPEMIERDDVIR
FT                   AAENAGLFVGLCDYRPEKGGAFGRFSVEVLP"
FT   CDS_pept        complement(869820..870203)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07951"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="orf01172"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25522"
FT                   /protein_id="CAW25522.1"
FT                   /translation="MTITISTDTWQGRLGMGLAPRELEATLHAASDLTAKEIAKLMGIA
FT                   PGTVSKRLDDARFKLGAKTIRGLVLEAYKRQIISPLCVGILAILAAAQPFLDEDPAMRT
FT                   RRGGERRVEVRIAARRMESRYAA"
FT   CDS_pept        complement(870555..871343)
FT                   /transl_table=11
FT                   /locus_tag="PLES_07961"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25523"
FT                   /protein_id="CAW25523.1"
FT                   /translation="MKKRKLSQIELNECQALRHIYSAKRRELGLTQSSIAEAFRMSQTA
FT                   ISMYMNGSNALNAAVAAKFSTILEVPVSSFSPRLAAEIEGMAKAMHPKPVPDITDTLEP
FT                   IHPWDDGTPIDDDEVEIPFYKEVEMAAGAGRNIEQEIKGRKLRFSYATLRAAGVDPSAA
FT                   ICTRVGGNSMEPLISDGATIGVDTATKHITDGEIYAIKHDDLLRVKFVYRLPGGGVRLR
FT                   SYNRDEYPDEEYTPEEMRSQQISIIGWVFWWSVVRIRRKL"
FT   CDS_pept        871763..872272
FT                   /transl_table=11
FT                   /gene="endY"
FT                   /locus_tag="PLES_07971"
FT                   /product="EndY"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25524"
FT                   /protein_id="CAW25524.1"
FT                   /translation="MSKPRPRLTLDRVQELFEYRDGSLINRVRRGPFSFAGRPAGSING
FT                   NGYLQTWVDGHSFRIHTLVWFLHRQEWPVEVDHINGIRTDNRIENLREVTRRENMRNKR
FT                   VSVANSSGITGVGWSSAKQKWRACIKVDGKFIHLGYFEEKRAAIAAREEANRKYGFHEN
FT                   HGKAFA"
FT   CDS_pept        873107..873601
FT                   /transl_table=11
FT                   /locus_tag="PLES_07981"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25525"
FT                   /protein_id="CAW25525.1"
FT                   /translation="MALGVAAVGNLLANVGAEGEVGQETSERLGWFLEEIGGGHLPVGG
FT                   ARTGPLGSHQPAEGAEAMSASITMLRQGIRAERDLTSHLWTILNEMRLQRQLPEWAERA
FT                   IDGTSQQADEISAHRKQVDTVLFELVPGLREDVERTDRESYLEWRAREREVKDALGGGH
FT                   V"
FT   CDS_pept        873714..873890
FT                   /transl_table=11
FT                   /locus_tag="PLES_07991"
FT                   /product="hypothetical protein"
FT                   /note="orf01175"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_07991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25526"
FT                   /protein_id="CAW25526.1"
FT                   /translation="MTQLRALLMDSVVPALGGGGHPVVTEIHDLIERIILCTGNFLYRY
FT                   NQQIGAAYRERDL"
FT   CDS_pept        874209..874973
FT                   /transl_table=11
FT                   /locus_tag="PLES_08001"
FT                   /product="putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25527"
FT                   /protein_id="CAW25527.1"
FT                   /translation="MTDLTGFGGQAATMTSREIADLVGSRHDNVRVAIDRLAERGVIAL
FT                   PAMQEKPTSGRPTQEYVFTGDQGKRDSIIVVAQLCPEFTARLVDRWQELEQQASRSLTA
FT                   AEQLLASVQLTVELERRQRQAEQQVAALTETVGDMDRSHPLLDSIPNGMESITAIRQRI
FT                   GKQYGLPPRVIDAVVRDMPHSPRPFAMVRSKHEELNARPYAVWAKAEISRVFERFARGC
FT                   TFVTQHRATHPDFGAGRERFQMRGTPSQEIGE"
FT   CDS_pept        875391..876269
FT                   /transl_table=11
FT                   /locus_tag="PLES_08011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08011"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25528"
FT                   /protein_id="CAW25528.1"
FT                   /translation="MARARNIKPGIMANEELAELSHSHRLLFIYLWMLADREGRLEDRP
FT                   KRIKAEAFPYDDGLDVESMLDDLVSAGFIQRYERCGVRAVQVLNFAKHQTPHSREKASV
FT                   IPAPVLVDGEEDAGADLGSAEGMPGTDQGGADESPSPLAVRPDSLILRSSDSLISEEEL
FT                   APQEQRSAPESEQPLPTDRPKRGSRLPEDWTLPDDWLAWALAERPEFGEAGLRKVGESF
FT                   GDHWRSATGKNATKLDWFATWRNWVRNQRPPFGAQRAGPPPASPHLGLDQTNHEEGLER
FT                   QADGTYRIARP"
FT   CDS_pept        876266..877054
FT                   /transl_table=11
FT                   /locus_tag="PLES_08021"
FT                   /product="DNA replication protein DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25529"
FT                   /protein_id="CAW25529.1"
FT                   /translation="MTMTKNQVKTRDETCPVHGGFESKQQEQFDGGFVWTGCGRCEFEA
FT                   RQSSDPEVRSKAQAARDARMVNAALLESQIPPRFRPATLDNYRTDFAPDQQSPVLARCK
FT                   AYADDFASNWKVGRSLMLLGTMGTGKTHLACAIIQQVLRTEGLAGATARYITAPDLILG
FT                   VKDTFGRKGKSESEVYESLHAPDLLVIDEVGAQHGTDFERQVLFQVVNGRYERLLPTIL
FT                   ISNLSLVDIRRFIGDRVIDRLCDANGEVVLLRWKSVRGSV"
FT   CDS_pept        877087..878481
FT                   /transl_table=11
FT                   /locus_tag="PLES_08031"
FT                   /product="Putative DnaB-like replicative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25530"
FT                   /protein_id="CAW25530.1"
FT                   /translation="MGYEVPESKLYSHEAEYAVIGAMIQKGDLIEGMGAKLEVSDFHHP
FT                   ACAELFELLLACQAKGIAVDIVTLYEARAQLADGQSTLQVAAHLVKNTPSTANADEYAR
FT                   IIKQRSVARRVIAAAEVMSQRLQDGEPLDEVLSQGQQAWVALEAEGLDSRRRYRFIGEV
FT                   LPEAIDGIDRRFNREVKLGYDTGLPSLDAFIPGICPGHMVVVAGEPGSGKTTLGLGFAE
FT                   RVALACNEPALVFSLEMTDVELANRVLSSVGSVPLKHIAEGHSMADSDWPGLTGAVNKL
FT                   NDAPLILCDDASLTLRDIRQICRTVKREHGLGMVAVDYIGLIKGEQRNASRYDVVTEIS
FT                   KGLKRLAKELGVPVVVLAQLNRGPKARGNKRPTKSDLRDSGQIEADADVVVLVHRDQES
FT                   DAGKAGITELIVDKNRHGQVGVAHVQHQGQFHRFVEIIGGYQPSDEEVEMSRPYRGRQY
FT                   GKGKAA"
FT   CDS_pept        878846..879535
FT                   /transl_table=11
FT                   /locus_tag="PLES_08041"
FT                   /product="Putative metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25531"
FT                   /protein_id="CAW25531.1"
FT                   /translation="MTLVQRFERNTVGRDFCVGDVHGCFDLLDALLAQAGFDKAVDRLF
FT                   SVGDLVDRGPGSDLVQEWLSQPWFHAVRGNHEQMVVDTYKHGGDDWLHVANGGAWLLGL
FT                   PETEQRGYAELFDDLPLAIEVETAAGAVGIVHAECQAKSWQAFCAGVGAGEKAHVTAAL
FT                   WARSRAANEDSTPVEGVAAVLVGHTPHNRLTRLGNVFYLDTGACFGGSLTMFCLNDWSV
FT                   SSARGTR"
FT   CDS_pept        879550..879810
FT                   /transl_table=11
FT                   /locus_tag="PLES_08051"
FT                   /product="hypothetical protein"
FT                   /note="orf01184"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25532"
FT                   /protein_id="CAW25532.1"
FT                   /translation="MAPRKVMTRLEREFLKVAGQELAQVKVGGAAALAALLVMIANWHG
FT                   DRGTLGFHDYGRLWLQDGNAKGAAVETLLRDLFGLNGPGAA"
FT   CDS_pept        879951..880196
FT                   /transl_table=11
FT                   /locus_tag="PLES_08061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25533"
FT                   /protein_id="CAW25533.1"
FT                   /translation="MSSPKAYHVTDDMALAVDRVIARLIDRAPQAGDFVWLYYGAKWPA
FT                   LRIAREHQIGEAKVRETLKLAVGWVDSALERFRESA"
FT   CDS_pept        complement(880514..880840)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08071"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25534"
FT                   /protein_id="CAW25534.1"
FT                   /translation="MNTPTNVQIINGPDGSPAFVVIPYAEYIKDHPKDDLVPNEVVGYM
FT                   VKEGLSPAAAWRKHLGLSQAEVASRIGITQPAYAQQETAAKPRKATREKIAAALGIAPD
FT                   LLDI"
FT   tRNA            881215..881287
FT                   /locus_tag="PLES_08072"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:881248..881250,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 48.14"
FT   CDS_pept        881354..881686
FT                   /transl_table=11
FT                   /locus_tag="PLES_08081"
FT                   /product="Holin, phage lambda"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25535"
FT                   /protein_id="CAW25535.1"
FT                   /translation="MKMPDKPDTWAALLAWLSQHAPIIYASLLSWAMAMARIIYGGGTR
FT                   RQALLEGALCGGLALTIISGFEFFGVPQSMATFIGGWIGFLGVEKIRDLADRYAGIKLP
FT                   RRGSGE"
FT   CDS_pept        881683..882300
FT                   /transl_table=11
FT                   /locus_tag="PLES_08091"
FT                   /product="Predicted chitinase; lytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25536"
FT                   /protein_id="CAW25536.1"
FT                   /translation="MKITADQLDRATGCGAATADIWIDHINGAMARFEINTPERVAMFL
FT                   AQVGHESQSLKRLVENLNYSAEGLLKTWPKRFTPAEAKQYARQPERIANRVYANRMGNG
FT                   SPATGDGYRYRGRGLIMITGYDNYAEAARALALPLVAQPELLEQRTWAAIAAGWWWKSR
FT                   GLNDLADQGRFERITLKINGGYNGAEDRVARLEWARAALKGE"
FT   CDS_pept        882536..883006
FT                   /transl_table=11
FT                   /locus_tag="PLES_08101"
FT                   /product="Putative lysis protein Rz"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25537"
FT                   /protein_id="CAW25537.1"
FT                   /translation="MTWRPWLVVALVAALVFWRLDHVTAQRDDLQAAVEQSAETITAMA
FT                   QQAQRDSQAQAQTDAMARTYQAALQASHEENQLRRDAIGTGARVVYVKARCPTGGVHQA
FT                   PGATGSADAGRAVLAAADGQVVSDLRAGVERRELMIKALRKHIAGLPRYCRR"
FT   CDS_pept        883003..883746
FT                   /transl_table=11
FT                   /locus_tag="PLES_08111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25538"
FT                   /protein_id="CAW25538.1"
FT                   /translation="MISIKPEGFQQQLADLTELEQRQIPYATATALTRTAQGLMDRLRD
FT                   EMRVVFDRPTPYTLNSLRMVPARKDRLEARVWFKDEADGAQPASVWIAPEVYGGPRRNK
FT                   PAELQLRAKGILPEGKYVVPGAGADLDRYGNIRRGQVTKALSGIRGFSQAGYNANATDS
FT                   RRSRAKGNARRYFVMTRKGQPIGIAERTGRGRDAVSVIMAFVSRPSYRRRLSFFEIAQQ
FT                   YADENLPRDFEVAMRGVAARFAARR"
FT   CDS_pept        884141..884443
FT                   /transl_table=11
FT                   /locus_tag="PLES_08121"
FT                   /product="Putative small subunit (Nu1 homolog) of DNA
FT                   packaging dimer"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25539"
FT                   /protein_id="CAW25539.1"
FT                   /translation="MQARLELTRAQTYAQEQKNQVNDKLLVPVPFATYALAKIAAKIGS
FT                   KLETVGKTVSQRHPEMDPLILEAFEREIALARNLSADFGDDLPGYLDEYLATLDE"
FT   CDS_pept        884436..886391
FT                   /transl_table=11
FT                   /locus_tag="PLES_08131"
FT                   /product="Putative large subunit (GpA homolog) of DNA
FT                   packaging dimer"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25540"
FT                   /protein_id="CAW25540.1"
FT                   /translation="MNDLRNAVKLGLQAMFKDLPMTAVQWADDNFYMSAESSYNEGDWK
FT                   TAPFQVAILNAMGNDLIRVVNFVKSARIGYTKLLMANIGYKIQHKRRNIMMWSPTDPDA
FT                   ESISKKHVMGMVRDVDVMLALAPWYGKKHSDNTLDNKVFSNRRNLWILGGKAARNYREK
FT                   SPDEVIYDELSKFDADVEGEGSPTFLGDKRLDGAIYPKSIRGSTPKTAGSCQITKAAEE
FT                   SPYRLHFHVACPHCHQEQSLKWGGKDCAFGLKWRKNALGEAEEAWYSCEHCNACFIHRD
FT                   MVAAQENGRWICSETGIWTRDSMDWFGPDNEPIRTPRSVSFYCWAIYSTWKDWVSLADE
FT                   WLKVKGDREKLIAFINTTRGEVWEEDQGERVEWQTLYARRENYPKVPPQALVLMGGIDT
FT                   QDDRYEGRVWAFGLGEEAWLVHRFILTGDPASEELRRKVGLEIHRQFTRVDGVPMRVER
FT                   WCWDAGGHYADEVEAESIKHGVHWVIPTFGASAYGKPIANFPKRRKRKVYKTELGTDNA
FT                   KELIYSRLRIDVPIPWQPTPGCVHFPIDSDICDEDELKQITAEKKKPVMAKGVRVLRWD
FT                   SGGRRNEALDCFVYALAALRISQQRFGLDLDQMEAARQVVARPAVAEVVEKHTSNQSAQ
FT                   DVTNAFLGTTGGSPWL"
FT   CDS_pept        886603..888249
FT                   /transl_table=11
FT                   /locus_tag="PLES_08141"
FT                   /product="Putative portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25541"
FT                   /protein_id="CAW25541.1"
FT                   /translation="MNWIDRLLAPLAPGFVAQRMRHQAVIRAYEAARPSRTHKAKGETR
FT                   SADAALQSAGRSLREQCRWLDENHDIVTGLFDRLEERVVGGSGIGVEPLVLDQAGEVHL
FT                   EFCAQIKSAWAEWSLRPETAGELTRPQMERLVCRTWLRDGESLAQKVMGPVANYKHLTA
FT                   VPFALELLEPDYLPFELNDTGKGIIQGIERDAWRRIRAFHLLKAHPGDIGSGIFQQTKR
FT                   VEAERVIHVANRKRIGQNRGVPLLHAALVRLADLKDYEESERIAARISAAMAFYIKKGE
FT                   AADYGVNQAPADKRGSFPIAPGMIFDDLQPGEDLEMFESNRPNPMLEGYRNGMLRAVAA
FT                   AGRSAYSTIARSYDGNYSSQRQELVEAQEGYDLLQHDFIDDWCRPVYRTWVPLAIASGV
FT                   LRVPPDVDVRTLLSAVYQGPVMPWINPVHEANAWETLVKGGFADEAEVARARGRNPQEL
FT                   KKSRASEIAQNRELGLVFSSDAAHSLTKDRQLTAVEAIQKAYLGVGKVLTSDEARRLVN
FT                   QYGADLEIPGPDFTEEEKPTGGADGQPTEDE"
FT   CDS_pept        888578..890314
FT                   /transl_table=11
FT                   /locus_tag="PLES_08151"
FT                   /product="chaperone with DnaK; heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08151"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25542"
FT                   /protein_id="CAW25542.1"
FT                   /translation="MSCDVIHIPENAMMMVHRPWGIQGGEADDMRRYADLLEKIEGTMV
FT                   AAYMAKTGKSEEDIKALLKAETWMDGREAVEAGFADQLTEPLAAAAQLTSKRMKEFAHM
FT                   PEALKALMQPRASTPAAAAPTPSPAAPTSQPAPAAPDEAAVRAQINAAENTRREGIRAV
FT                   FQPFAASHGEMLNEVLLDSSVTIEQAQAKLLASLASGATPSAGPSGSQGANSHVYAGNG
FT                   NLVGDSVRASVMARAGLEEQQSDNRYNFMSLRELARASLVDRGIGVASYSPMQMVGLAF
FT                   THTTSDFGTILIDVANRSMLAGWDEAEETFQLWTKKGMLSDFKTVHRVGLGEFPSLRQV
FT                   REGAEYKYVTVGSRSQPIALATYGEIFSITRQAIINDDMNLLTDIPRKMGMAAKATIGD
FT                   LVYAILTSNPVLSDGKALFHADHKNLQTGASSALSIESLSKAKTQMATQKTEVEGGKPR
FT                   TLNIRPAFVLTPVALEDKAKQIIRSASVPGAESNSGIENPIRNFAEVIGEPRLDDNSAT
FT                   AYYLAARQGSDTIEVAYLDGNELPYMEQQQGFTVDGVATKVRIDAGVAPLDFRGLQKSN
FT                   GA"
FT   misc_feature    890381..903977
FT                   /note="Duplication 1a"
FT   CDS_pept        890381..890698
FT                   /transl_table=11
FT                   /locus_tag="PLES_08161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08161"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25543"
FT                   /protein_id="CAW25543.1"
FT                   /translation="MAKNYVEDGNVLTLIAPPGGVQSGVPAVVGDLVVVSLVNAAEGEP
FT                   FAGKPGGVWRLPAAAGLTQGAKCSVLDGELVAAATADSVAFGKITEPTVDGFASAMLIQ
FT                   Q"
FT   CDS_pept        890889..891491
FT                   /transl_table=11
FT                   /locus_tag="PLES_08171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08171"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25544"
FT                   /protein_id="CAW25544.1"
FT                   /translation="MAGEGRSHGIAWRPLRHRVVALSRGKAHCERRLVADGSNDRGGSM
FT                   KPNVLTIGRLALLARLQTITPNQGYRTDAGTRVLSGWFNELVKERHEGFPLIVVQPGKE
FT                   QPPEHLDAAVRFHRGFDVVGAVQGGYDHYEEALEDLQLDLLACLMPAPKGQFLRWLPRD
FT                   RGITGLTLGAPEPYPPGDGVAAAVIRIPVYLKTIIEA"
FT   CDS_pept        891495..891689
FT                   /transl_table=11
FT                   /locus_tag="PLES_08181"
FT                   /product="hypothetical protein"
FT                   /note="orf01202"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08181"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25545"
FT                   /protein_id="CAW25545.1"
FT                   /translation="MKSDPQVPASVDAAPSAALNKAVEVTLVKVHWHQGKEKAAGEKIN
FT                   VSPDQVEFLRREGVIKKEA"
FT   CDS_pept        891691..892443
FT                   /transl_table=11
FT                   /locus_tag="PLES_08191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08191"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25546"
FT                   /protein_id="CAW25546.1"
FT                   /translation="MAIEKETYVIGGWLKAREAGTTGPFKKVGLVSTIQQTIESSEITL
FT                   PDTTTPQGGEYDSVSRISSVGLGINFRELHTSMLAALMWGDATNVPSATHTDEAHIAVP
FT                   GGTIALDFMPLEITSVKSEDGTTTYEEFDDWNMTGAGLETVEGGAISAATPIKVTYKSA
FT                   TVDVIEALTNSGKTFEFLFEGENAAGTQRRIQARYFLCRLNPSSQQDWINTEDFLAAEA
FT                   TAKVLMDPTKVGSGKSKYFNIKKELATV"
FT   CDS_pept        892525..893166
FT                   /transl_table=11
FT                   /locus_tag="PLES_08201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08201"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25547"
FT                   /protein_id="CAW25547.1"
FT                   /translation="MYSRSRGFTLVELMVIVVLLGVMVAFAIPSFVNLIKGNSTASARN
FT                   DLQKSLDYARAMAMTNKTGAQVCVADGTITISNARKAEKIITGGSGGSVQYGFKYDWEV
FT                   ASKLSSKEYKAIGSNGLDSGCVVFAYNGSIPEIAKKAPKSPKPPLSSDGKCDTSSSPPP
FT                   YVNKDGFFGRSDGSADPEWELIFNGAGFYVVRKPGGADFTSELSWDTSGC"
FT   CDS_pept        893631..896114
FT                   /transl_table=11
FT                   /locus_tag="PLES_08211"
FT                   /product="Putative tail length tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08211"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25548"
FT                   /protein_id="CAW25548.1"
FT                   /translation="MADVKIRLTADLDDALREVSGFRKEYAELVRQVAQPLKRLNDFTA
FT                   LESTLEDTQRQARSAREQIRTLGNELASTIRPSRELQQAYRDSISDLRSLERAETVQIA
FT                   RLSAMRRELKQAGLDTRSLTSERQRLQRELDRNLQAGRNDAATTSLRQQAAAIKQSAIE
FT                   QRRFNLEQARSSLGVARVRELQAAIGQLNQQYRLLRSSGTLSTRELAVAQRALKKQIAE
FT                   TKSELNSLGAGSRLSSIGSLRGSGPALAVAGLAAAVGAATAKLANGADTVGRLDSRLGL
FT                   ATRSQEEFNTAQIELDRIADDVQGDVGDLIGLYSRLQRPLRDAGMDQRAALETVEAVSL
FT                   GLKIGGASAEESASVITQFSQAIASGVLRGEEFNTVLESSDRIAGALADSFGVTVGRLR
FT                   EMAAAGELTSEQIVIALRKELPKLREEMASFAPEIGAGLNRIFSETQKYWGRRAKNTGI
FT                   VDWVANQLNDVAKSINTATTLVKKGEGSLTATLAAEKARQEQIVKRQNDALKRAREQNV
FT                   ADLQSEVVRTKALLEQSTKNLNDALSRQADVRKEFADLVKGIQATPTSGTQTFGDATAA
FT                   QASARNALTAGNNQKAIEEARRALQILQQLKDAGANSYGFEGVAKEVERIANKAAEVEA
FT                   GNAKAADDVNRLNLADLEERIKAVQNVEVSFGMDFESAETLKQQVADIAAGLAEQLVIP
FT                   ITLVPPPEMGLPGVPSITPKIPGFATGTQSAPPGMAWVGERGPELMMMRGGERIFNAVQ
FT                   SLQMSQRYQRTLPEIPEIPTAALQQANPPAAMQNLGSLTLNLGGDDAGFTVFGTHDTLR
FT                   DIRKAASKFGRTRPK"
FT   CDS_pept        897077..898372
FT                   /transl_table=11
FT                   /locus_tag="PLES_08221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08221"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25549"
FT                   /protein_id="CAW25549.1"
FT                   /translation="MEIAAVDALVGGAWSADVFEPVDGRSRWDYAQERLTSVTGSLDCS
FT                   PYGALRVTSWLSVAPAYEFGQGSTVYGSLAVELADLSSQTNRVEIECDYRFSRLWQLNA
FT                   SYGWQHPGTGNAVGEAGFCNWRGDDTELPDVEMITSATESSGQTLFYATWYPLPPTGVY
FT                   CNPPAAWRNDFTELLLGGNWIAGRRWVQSVTERYRLVMEVQPSVAATGPIVGRQRASFE
FT                   IESDKAERWESDPITGGSTGHDDEKDGNRRLSALNCLLAQGATTLIAAHRGTTVTWDVP
FT                   TSMVLPIDLVHTLRLDDQGARAVGKCRRIVDRLDLGSGSALTTISIAVMRGGGGAADPL
FT                   VPPAGSSDPVSPPSGGGQLSTQLGGRNGSPAYDDEADGFAGNWSNRDPGAELFPRRFSL
FT                   TASDIPETYRDEHAPEIAATYRVSVPDDVLEM"
FT   CDS_pept        898375..898785
FT                   /transl_table=11
FT                   /locus_tag="PLES_08231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08231"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25550"
FT                   /protein_id="CAW25550.1"
FT                   /translation="MVRAWINNWKTTLSAGLSPGELSLTVPDAAAALLPLSGGNWVLLT
FT                   LADDAGAQHEIVKATARAGGVVTIERAQEATAAGNWPAGTAIYAAVTAGDLMTLQARIQ
FT                   ALESGASGGTLVDETGATLVDDAGNNLIMENN"
FT   CDS_pept        898785..899330
FT                   /transl_table=11
FT                   /locus_tag="PLES_08241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08241"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25551"
FT                   /protein_id="CAW25551.1"
FT                   /translation="MATVTHVLSGAGEPLDPPPSIGAHYVNTNNGALYLAKGTASGADW
FT                   VKLGSGGGSAPSEVLHVNTDGQFLLEPQHSFVEARLFAIPELGTAAIGIDPSTSRQFDL
FT                   NIRTAGPSGQQLQIRVTSGELSGGMSIVGTTRQWAVQESYGFLINANDLNGEVWARVYF
FT                   DADELTLSMLVFSDVPNA"
FT   CDS_pept        899341..899763
FT                   /transl_table=11
FT                   /locus_tag="PLES_08251"
FT                   /product="hypothetical protein"
FT                   /note="orf01208"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08251"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25552"
FT                   /protein_id="CAW25552.1"
FT                   /translation="MALSDERRGIGARNEAIRRAGGQRVEAERRGDQGLTAALNRLIEP
FT                   ERQARSLRKIDPRGALDAKRGRADYNPAGKQLGGGGGIASPLIEEDAAQREYYELQTIP
FT                   TSDGLAWLRYRSVKKIVMTDASGAEVVMEYANDVSQ"
FT   CDS_pept        899750..901243
FT                   /transl_table=11
FT                   /locus_tag="PLES_08261"
FT                   /product="hypothetical protein"
FT                   /note="orf01209"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08261"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25553"
FT                   /protein_id="CAW25553.1"
FT                   /translation="MFPNSPLDEAPQVWGWPWHGLIRQPINAVDSTLTLPSGRTMKMPP
FT                   VRLANNTALWDVGMHIPEVETDDPDEQWLNRAILRGTDLSEAYGGVSLQPAFIRGYTIR
FT                   YGVSVQYNFFLETIAASCLFRDGFTGFSGTVSSNAISLSDLGLPVKPDGISFEVLDVNN
FT                   DGTRRLYLARYQETAGSGFIGVGGMLELRVSASGANSFQAELSVVAPWERIQFETIDSS
FT                   RTDVDPNTHTRFWRGTPEDPDGPFNESSGEPPPPPYPGHPWAPHVYRVLIGEFSASLRA
FT                   RSTAGAWYGLSGSLELITLEVSIVSTMSRSAGISGDHISFSMTEDISFSYTLSSSSGGS
FT                   SESLYNSLSTSGVLNGPGSIQWTDSITGQSVASGSESISLGDIYLLTPDVGDSYAEGLD
FT                   WSSPIELFPGRPSTISDQSAWPVLRYSNKLLGLFFYRGRDRRFAGVALTPHGPHGSRQV
FT                   DVDVSGFSPLEMEAWGKGSYNPLTGDAIRNDPSAFYSYV"
FT   CDS_pept        901322..901852
FT                   /transl_table=11
FT                   /locus_tag="PLES_08271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08271"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25554"
FT                   /protein_id="CAW25554.1"
FT                   /translation="MRIMQPSLVYRPITQIAPTAPVRLTIPGHGLPGTWLAWIDGIQGM
FT                   PELNRARLRQLPHRVASIDDNTVEINLLSAVGLAPVGGQLIYQPPVDLTGASVRMQIRD
FT                   APGGTVLMTLALGSGLEIAGAGTISREISASATAALEWSTAVYDVDVTYPDGTVHRYYS
FT                   GPITVSRGGGCDG"
FT   CDS_pept        902041..902601
FT                   /transl_table=11
FT                   /locus_tag="PLES_08281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08281"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25555"
FT                   /protein_id="CAW25555.1"
FT                   /translation="MAQIRFFKVATLPGTLEPDSFYFVENGSYSESYLTNSAGVARSIG
FT                   NSAMINALINEALASLPGTGAPILFVADIAARDALEPESAIFVLVQDASADPTVESGAA
FT                   LYAWNPATSAWLKVAEYESMDVELNWDAINGRPTSTPAQIDTAVSQAHTHANKSTLDKF
FT                   SEDGGLVRFGGQPIPAEWNGAAW"
FT   CDS_pept        902602..902883
FT                   /transl_table=11
FT                   /locus_tag="PLES_08291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08291"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25556"
FT                   /protein_id="CAW25556.1"
FT                   /translation="MAVLQTHKVVAQLPAALEPNAIYFVRRSTGYDQFVTNGAGVVVAY
FT                   PMNVRIPAAVPGYLADGSMLRLAMNPDGQLPAYTAGGATLNLQVLFNG"
FT   CDS_pept        903430..903741
FT                   /transl_table=11
FT                   /locus_tag="PLES_08301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08301"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25557"
FT                   /protein_id="CAW25557.1"
FT                   /translation="MVLMIIKLSPYAPLPGSDEHLSLSRAGDVLTVNGQAFDFTPLPEG
FT                   GELPAEAIGSEWFAGPAVRRADRLELSLRFPLADDASAAARFPEPLLIDTDGPVELPR"
FT   CDS_pept        903738..903977
FT                   /transl_table=11
FT                   /locus_tag="PLES_08311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08311"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25558"
FT                   /protein_id="CAW25558.1"
FT                   /translation="MIDWSQVKTAEQQAQGRWQAEYDAAAVARANAYRLESDPLKTEAE
FT                   FDAIKAGVEPDYSAWVAKVEEIKARFPLPGPLPE"
FT   CDS_pept        904050..904274
FT                   /transl_table=11
FT                   /locus_tag="PLES_08321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08321"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25559"
FT                   /protein_id="CAW25559.1"
FT                   /translation="MDEMLRRRLRAELLEVGFLNQCCLDLMESMEAEFSLTDDQRECIE
FT                   QLSRFLQEGIGKLTSLSERVAAGDIVVLC"
FT   CDS_pept        906071..907309
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="PLES_08331"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08331"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25560"
FT                   /db_xref="GOA:B7V6L2"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V6L2"
FT                   /protein_id="CAW25560.1"
FT                   /translation="MSVPTHQQDLIALLEERGFVHQCTDRDGLAAHLAAGPATAYLGFD
FT                   ATADSLHVGHLQGLMLMRWLQKAGHRPLLLIGGATTRIGDPSFRDSSRPILTEAQIQAN
FT                   IDGIARVFSRYVELHDDSLVNNAEWLDGVGYLEFLDRVGRHFSINRLLTFDAIRQRLDR
FT                   EHSLSFLEFGYTLLQAYDFVELSRRRGCTLQLGGADQWANIINGVELSRRQGGAQLFGL
FT                   TMPLLATSDGRKMGKSAQGAVWLNAERLAPFDFWQFWRNCDDRDVGRFLALFSELPMDE
FT                   VRRLGALQGAELNEAKVVLANAATALAHGEHAARSAADAARGVFADGTRDSGLPVMKLS
FT                   RARLAQGLSLTDLLLEHAIQPSRSAVRRLAAGGGLRLDGTPVSDPDAPLAGEVDGLRLS
FT                   LGKKQHLHLRLED"
FT   CDS_pept        complement(907338..908594)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08341"
FT                   /product="probable porin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08341"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25561"
FT                   /protein_id="CAW25561.1"
FT                   /translation="MITACPRPCAWRSYALGLGLLPLAAQAEFLADSSAHLDLRNFYQL
FT                   RDYRQHDAPQSQAGNWSQGFVLRLQSGFTGGPLGFGLDATGLLGVKLDSGRGRSNDGTL
FT                   PFGANSKEPVDDYSHLGLTAKLRYSQTQLQVGILMPQLPVAFRDDVRLLPQTFDGALLT
FT                   SSEIEGLTLTAGQLWKSRTRESAGSDDMYIMGRDKAHASDEFNLAGATYAFTPRLSASY
FT                   YYGQLKDIYRQHYLGLLHTLPLGEGLSLRSDLRYFDSGEDGAAISGPVDNRNLNAMLTL
FT                   RAGAHAFGIGVQKMIGNDAFPVLNGYTTPYVANLMAYQTFTRPQEKSWQLRYDYDFAGL
FT                   GLPGLNLMTRYVQGRDIDRGAGRADDSEWERNTDLSYVIQSGPLKSVALKWRNITYRSR
FT                   YGADLDENRFIVNYTLKLW"
FT   CDS_pept        908959..910167
FT                   /transl_table=11
FT                   /locus_tag="PLES_08351"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08351"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25562"
FT                   /protein_id="CAW25562.1"
FT                   /translation="MPASASRIQVGSGEGRLLLLLSALVAFGPLSIDMYLPSLPAIAAD
FT                   LGASDAQVQRSISGFLVGFCFGMLFYGPLSDRFGRRPVLLAGIALYLFSSLACVLADSA
FT                   GQLVLLRVLQALGGGAASVLARAMVRDLYPLGEAARMLALMHMVTMLAPLAAPLLGGYL
FT                   MLWAGWRALFVVLALFAGLCLLAVWRVAESHPPERRGGSLAQAFLAYGRLLGDRRALGY
FT                   VLCMGLAFAGMFAYISAAPFVFIEHFGVRAERFGWFFGLNILGVMLATWCSARLVRRHG
FT                   PRPLLRAGSLLACVSGLFLLGYAALGERGGLWALVPGLLCFVSVTGLLGANCIASLLAL
FT                   YPGQAGAASAVAVSGQFGLGCLASLAVGWLALPGVLPMALVMAVCGVGSLLALGLALHG
FT                   GNR"
FT   CDS_pept        910253..910675
FT                   /transl_table=11
FT                   /locus_tag="PLES_08361"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08361"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25563"
FT                   /protein_id="CAW25563.1"
FT                   /translation="MSTPRPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQ
FT                   QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVS
FT                   MSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP"
FT   CDS_pept        complement(910691..910933)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08371"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25564"
FT                   /protein_id="CAW25564.1"
FT                   /translation="MEFSWSEILLELLAVAVLFFGVHWSLRHAKTLDQASMLPFADDEE
FT                   VARRVERETGRSRTGCGCPGRCQGDCRHWDKNWPA"
FT   CDS_pept        complement(911017..912444)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08381"
FT                   /product="cytochrome c oxidase subunit (cbb3-type)"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08381"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25565"
FT                   /protein_id="CAW25565.1"
FT                   /translation="MNKATTEPAYNYKVVRQFAIMTVVWGVIGMGLGVLIASQLVWPQM
FT                   NFDLPWTSFGRLRPLHTNLVIFAFGGCALFATSYYTVQRTCQVRLFSDTLAAFTFWGWQ
FT                   AVAVILLVSLPLGNTTTKEYAEIEFTGAIWLAIVWVAYAVVFFGTLIKRKVKHIYVGNW
FT                   FFGSFILTTAMLHIVNHMSLPVSWFKSYSMYSGATDAMVQWWYGHNAVGFFLTTGFLGM
FT                   MYYFVPKQAGRPVYSYRLSIVHFWALITLYIWAGPHHLHYTALPDWAQSLGMVMSLILL
FT                   APSWGGMINGMMTLSGAWHKLRDDPILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYT
FT                   DWTIGHVHAGALGWVAMITIGSLYHLIPKVYGVEKMHSVGLINAHFWLATIGTVLYIAS
FT                   LWVNGITQGLMWRAVNEDGTLTYSFVESLVASHPGFIVRLVGGGFFLTGMLLMSYNTWR
FT                   TVRQARPEGILAAARMA"
FT   CDS_pept        complement(912708..914123)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08391"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08391"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25566"
FT                   /protein_id="CAW25566.1"
FT                   /translation="MKRYEKFADEIAELIRTGVLAPGQKVPSVRHASRTYGVSASTVFQ
FT                   AYYLLESRGLIMARARSGYFVCQHVQRPLPEPEISPRQADATEVDVSELVFSVLSSIKD
FT                   PDTVPFGSAFPSPQLFPLPRLARSMAHAVRDMDPQSVVADMTPGNHGLRRQIALRYMVG
FT                   GLLLPVEELVISNGALEALNLCLQVVTRPGDLVAIEAPAFYATLQVLERLKLKAVEIPV
FT                   HPREGIDLEVLADSLERLPIKACWFMSNFQNPMGASMDDEKKRALAELLARHQVPMIED
FT                   DVYAELYFGQQAPKPVKAYDQEGLVMHCSSFSKSLAPGYRVGWVAGGRYAEQIERLKLM
FT                   TSLSASIPAQAAIADYLQHGGYDRHLRKLRYALETQQNAMLAAVARYFPEQTRVSRPSG
FT                   GYFLWLELPEAVDSLRLFQLALAQGISLAPGPIFSATRRFAHCARLNYGHPWSARQEKA
FT                   METLGRIAQSLAG"
FT   CDS_pept        complement(914221..915942)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08401"
FT                   /product="probable iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08401"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25567"
FT                   /protein_id="CAW25567.1"
FT                   /translation="MFTGTHYRPRTDSETAADSAEKNTSDGRRRRIRAACDRLPRGAYL
FT                   YCPRSPGNPRQCWAAAFRRHLIRFFPLDLPLFRPSAGSYSRNRLSSLMGLRKMSERIPA
FT                   IQVEPAAPAAPSKQPPAPGKLPSAVNGPIYTRSFTGLFRNFRRLGGGLLFLLFFGTLWL
FT                   NWNGRQAVLWDLPERKFYIFGATFWPQDFILLSALLIIAAFGLFFITVFAGRVWCGYTC
FT                   PQSVWTWVFMWCEKVTEGDRNARIKLDQGPASAAKLLRKTAKHALWLGVSLVTAITFIG
FT                   YFTPVRPLVADLFSFQLDLESLFWVLFFTAATYVNAGWLREQVCIHMCPYSRFQSVMFD
FT                   KDTLIVSYDAARGESRGARKKGSDPRAQGLGDCIDCQQCVQVCPTGIDIRDGLQIACIG
FT                   CAACVDACDSIMDKMGYERGLVRYTSERALEGGQTRFLRPRLVGYAAVMLAMIGAFVVA
FT                   LDARPLASLDVTRDRGLFRENAAGQIENIYTLKVINKTQQPQRYRLQLDDAPEFRLQGE
FT                   HTLSLKPGEILDFPVSVASTAERARAGSQPLAFSLRGIDDPSLAVGSTSTFVSPAR"
FT   CDS_pept        916048..917721
FT                   /transl_table=11
FT                   /locus_tag="PLES_08411"
FT                   /product="probable sulfite or nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08411"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25568"
FT                   /protein_id="CAW25568.1"
FT                   /translation="MYQYDEYDQALVSERVAQFRDQIARRLDGELSEEEFLPLRLQNGL
FT                   YLQKHAYMLRVAIPYGTLSSPQLRALAHVARHYDRGYGHFTTRQNIQFNWIELEQVGDI
FT                   LEHLAGAQMHAIQTSGNCVRNITTEAFAGVAADEWTDPRPLAEILRQWSTVNPEFLFLP
FT                   RKFKIALSSAVEDRAAVQMHDIGLYLYRHPDAGELRLRVLVGGGLGRTPMLGQVIRDDL
FT                   PWQHLLSYVEAILRVYNRYGRRDNKYKARIKILVKALGIEAFAREVEEEWQHLRDGPAQ
FT                   LTAEECQRVAERFVLPRYLPPAGGELAYGSARAADPAFARWASRNVQAHKVPGYASVVL
FT                   STKPGASAPPGDVTAEQMERVADWAERYGFGEIRVAHEQNLVLPDVRLENLHALWREAC
FT                   AAGLGTPNQGLLSDIIACPGGDYCALANAKSIPIAQGIQQRFEDLDHLHDIGELSLNIS
FT                   GCMNACGHHHIGNIGILGVDKNGSEWYQVTLGGAQGKDSALGKVIGPSFSAAEVPAVIE
FT                   RIVETFTDLRVGPERFIDTFNRVGLEPFKARVYARMEEPA"
FT   CDS_pept        917718..918206
FT                   /transl_table=11
FT                   /locus_tag="PLES_08421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08421"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25569"
FT                   /protein_id="CAW25569.1"
FT                   /translation="MNNLIRLRDGVAEVCRDDPWQLLRELPDALPPGPLLLPLAAWLER
FT                   RGEAGAAAPWLAPDDEVEALLPHFAELPLIAVDFPSFRDGRGYSLAYLLRVRLGWSGEL
FT                   RAVGDVLRDQLSHMRQCGFDAFAVREDKNVEDALKGLAGLSVLYGRSAIEPRPLFRRR"
FT   CDS_pept        complement(918288..919094)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08431"
FT                   /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08431"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25570"
FT                   /protein_id="CAW25570.1"
FT                   /translation="MDLPVNRFKQRLRSGEAQIGLWLGLADPYCAELAANAGFDWLLLD
FT                   GEHAPNDLRSLLGQLQALAPYPGQPVIRPVQGDTALIKQLLDIGAQTLLVPMVDSAAQA
FT                   EGLVRAVRYPPAGVRGVGSALARASRWNSVAEYLNHADEQMCLLVQVENLEGLANLDAI
FT                   AAVEGVDGVFIGPADLSAAMGHRGNPGHPEVQAAIEDAIHRIRTAGKAAGILSADETLA
FT                   RRYLELGCAFVAVGVDTSLLMRSLRELAGRFKGGAPAPSASSSVYG"
FT   CDS_pept        complement(919107..919910)
FT                   /transl_table=11
FT                   /gene="hpcG"
FT                   /locus_tag="PLES_08441"
FT                   /product="2-oxo-hept-3-ene-1,7-dioate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08441"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25571"
FT                   /protein_id="CAW25571.1"
FT                   /translation="MLDPRLIQEAANRLDAAERSRQQVRQFSLDYPDIAIEDAYAIQRA
FT                   WVERKIADGRVLKGHKIGLTSRAMQVSSNISEPDYGALLDDMFFEEGSDIPFQRFIVPR
FT                   VEVELAFILGKPLKGPGCTLFDVLEATEWVIPALEIIDARIQQVDPQTKVTRKVFDTIS
FT                   DNAANAGVVMGGRAVRPGDIDLRRVPAILYRNGVIEESGVSAAVLNHPAKGVAWLANKL
FT                   APYGVCLEAGQVILGGSFTRPVAAAPGDTFHVDYDLLGSISCRFV"
FT   CDS_pept        complement(919928..921232)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08451"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08451"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25572"
FT                   /protein_id="CAW25572.1"
FT                   /translation="MSTASTLNSTTLPLSDSTHDRVTWRLMPLLLVCYVFAHLDRINIG
FT                   FAKLQMSADLHFSDTVYGLGAGLFFIAYALFGLPSNLMLERIGPRRWIACLMLVWGCLS
FT                   TAMLLVETARGFYLLRFLLGVAEAGFFPGILVYLNRWFPARRRGQITALFAIAVPMAGV
FT                   IGGPLSGWILEGFHDALGLRGWQWMFLIEGLPVVLLGVVVWCSLPESFERVTWLSDEQK
FT                   HLLREELAGEEQRKTITSFSGIFSNPQVWLLVAIYFAVMLAVNTIAFWMPSLIHGAGIA
FT                   QDSRIGMLSAVPYLAGCAFMIFIGRSSDRLRERRWHLGIPLLMAAAGLSLAALAPTSAW
FT                   LVMGGLVIAGMGASAALPMFWQLPPAFLSSATLAAGIALISSFGSIAAFLAPYLIGWMR
FT                   DTTQSASLALYLLAILIALGAGLVLRTPAAVVNPR"
FT   CDS_pept        complement(921325..921717)
FT                   /transl_table=11
FT                   /gene="hpcD"
FT                   /locus_tag="PLES_08461"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08461"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25573"
FT                   /protein_id="CAW25573.1"
FT                   /translation="MPHFIAEYTDNIEAEADLPGLFEKVHACLGASGVFPLGGIRSRGV
FT                   RLDTWRMADGRHDYAFVHMTLKVGAGRDLETRRQVAEALFEVITAHFAELQARRLLALS
FT                   FELTELDAELNYKRNNVHEFLNNPAD"
FT   CDS_pept        complement(921728..922651)
FT                   /transl_table=11
FT                   /gene="hpcB"
FT                   /locus_tag="PLES_08471"
FT                   /product="homoprotocatechuate 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08471"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25574"
FT                   /protein_id="CAW25574.1"
FT                   /translation="MGKVALAAKITHVPSLYLSELPGPRHGCRQPAIDGHREIGRRCRE
FT                   LGVDTIVVFDTHWLVNAGYHINCAPHFEGLYTSNELPHFIANMEYGFPGNPELGRILAE
FT                   GCNALGVETLAHDATTLGPEYGTLVPMRYMNQDRHFKVVSVSALCTVHYLNDSARLGWA
FT                   MRKAVEEHYDGTVAFLASGSLSHRFAQNGQAPDFSDRIWSPFLEVLDHEVVQMWQEGRW
FT                   AEFCGMLPEYASKGHGEGFMHDTAMLLGALGWSAYDGKAEVVTPYFGSSGTGQINAVFP
FT                   VTAQDGSAIPAAQAGNPAGASCASRL"
FT   CDS_pept        complement(922783..924243)
FT                   /transl_table=11
FT                   /gene="hpcC"
FT                   /locus_tag="PLES_08481"
FT                   /product="5-carboxy-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08481"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25575"
FT                   /protein_id="CAW25575.1"
FT                   /translation="MIKHWINGREVESKDVFENYNPATGELIGEVASGGAAEIDAAVAA
FT                   AREAFPKWANTPAKERARLMRRLGELIDRNVPHLAELETLDTGLPIHQTKNVLIPRASH
FT                   NFEFFAEVCTRMNGHSYPVDDQMLNYTLYQPVGVCGLVSPWNVPFMTATWKTAPCLALG
FT                   NTAVLKMSELSPLTANELGRLVHEAGIPPGVFNVVQGYGASAGDALVRHRDVRAVSFTG
FT                   GTATGRRIMEAAGIKKYSMELGGKSPVLVFEDADLERALDAALFTIFSLNGERCTAGSR
FT                   IFVQESVYPQFVAEFAARARRLIVGDPQDPKTQVGSMITQAHYDKVTGYIRIGLEEGAT
FT                   LVAGGLERPAGLPAHLSKGQFIQPTVFADVDNRMRIAQEEIFGPVVCLIPFKDEAEALR
FT                   LANDVEYGLASYIWTQDIGKAHRLARGIEAGMVFINSQNVRDLRQPFGGVKASGTGREG
FT                   GEYSFEVFAEIKNVCISMGSHHIPRWGV"
FT   CDS_pept        complement(924240..925019)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08491"
FT                   /product="putative 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08491"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25576"
FT                   /protein_id="CAW25576.1"
FT                   /translation="MKHARIRYQGRVHQVTVEDANAVRLADGTLLAEDRVEWLPPATGS
FT                   MFALGLNYADHAAELSFKAPSEPLAFIKSPGTYTGHRQVSWRPDNVDYMHYECELVAVI
FT                   GKPARNVRREDALGYLAGYTVCNDYAIRDYLENYYRPNLRVKNRDATTPVGPWIVDAAE
FT                   VPEPNRLVLRTWVNGELRQEGSTADMIFDIPYLIEYFSSFMTLQPGDMIATGTPEGLSD
FT                   VVPGDEVVVEVEGVGRLVNRIVSEAEFFRARAQEHAE"
FT   CDS_pept        complement(925030..925689)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08501"
FT                   /product="putative 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08501"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25577"
FT                   /protein_id="CAW25577.1"
FT                   /translation="MSRALNDVAAGTLFGVALNYKGLLDSRLPEFQQPPYQKPPVKPVL
FT                   FIKTPNTRNEHDAPVLFPRGVERLQPGPALGVVIARDASRVKEEEAMAHVAGYVIVNEF
FT                   SLPEDSYYRPAVKAKCRDGFCPFGPQLVPTQEIADPHALELKLYVNGELRQRNNTANLV
FT                   RDIPRLIAEISEFMTLHAGDVLITGTPEGRVDVHPGDRVEVEIDGLGRLANSIVAE"
FT   CDS_pept        925909..926820
FT                   /transl_table=11
FT                   /locus_tag="PLES_08511"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08511"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25578"
FT                   /protein_id="CAW25578.1"
FT                   /translation="MPERQPIPNINIGQVYDQRYADAEVHYDALGNLAGFFGRNMPAHR
FT                   HDRFFQVHYVKNGAVRVYLDERQYLESGPMFFLTPPTVPHAFVTEADADGHVLTVRQQL
FT                   VWSLTEAEPGLAPGPQVAPACVALGNLEGGAAEEAARLALLFEQLRSESMASRPGRQQT
FT                   LLALTRLVMISLLRLSANSVAARPMRHEDLQIFQRFNALIEERYAEHWPLSLYASRIGV
FT                   TEARLNDVCRRIADLPSKRLVYERLMQESKRLLLFTGGSVNEICYQLGFKDPAYFSRFF
FT                   VRYAGLTPSAYRQRQADGESRR"
FT   CDS_pept        926872..927675
FT                   /transl_table=11
FT                   /gene="aph"
FT                   /locus_tag="PLES_08521"
FT                   /product="aminoglycoside 3'-phosphotransferase type IIb"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08521"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25579"
FT                   /protein_id="CAW25579.1"
FT                   /translation="MHDAATSMPQAPSTWADYLAGYRWRGQGEGCSAATVHRLEAERRP
FT                   TLFVKQEVLSAHAELPAEIARLRWLHGAGIDCPQVLNETQSDGRQWLLMSAVPGDTLSA
FT                   LAQRGELEPERLVRLVAAALRRLHDLDPAACPFDHRLERRLDTVRQRVEAGLVDEADFD
FT                   DDHRGRSATELYRLLLDRRPAVEDLVVAHGDACLPNLLAEGRRFSGFIDCGRLGVADRH
FT                   QDLALAARDIEAELGAAWAEAFLVEYGGDIDGERLAYFRLLDEFF"
FT   CDS_pept        complement(927799..928368)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08531"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08531"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25580"
FT                   /protein_id="CAW25580.1"
FT                   /translation="MPRLRLRTVLACLAVFCAAPALARVEVHSLQHKSMGRVLTVRVSE
FT                   EIAPGDYETLLKGLRNNPGTYSRKLLLLNSIGGSVPEAIRMGRLLRESGFDALVPSSSV
FT                   CQGTCVYLLAAGKRKTVRGYVGLHRPYYAHGDSLHSRSANGMRYDSAAYFREMDIPSTL
FT                   VQAMQSTDPKRMRVLSAKELAQYRLN"
FT   CDS_pept        complement(928446..930632)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08541"
FT                   /product="probable bacteriophytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08541"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25581"
FT                   /protein_id="CAW25581.1"
FT                   /translation="MTSITPVTLANCEDEPIHVPGAIQPHGALIALRADGMVLAASENI
FT                   QALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNGPWSNSVETRIGEHLFDVIGHSYKE
FT                   VFYLEFEIRTADTLSITSFTLNAQRIIAQVQLHNDTASLLSNVTDELRRMTGYDRVMAY
FT                   RFRHDDSGEVVAESRREDLESYLGQRYPASDIPAQARRLYIQNPIRLIADVAYTPMRVF
FT                   PALNPETNESFDLSYSVLRSVSPIHCEYLTNMGVRASMSISIVVGGKLWGLFSCHHMSP
FT                   KLIPYPVRMSFQIFSQVCSAIVERLEQGRIAELLRVSTERRLALARRARDADDLFGALA
FT                   HPDDGIAALIPCDGALVMLGGRTLSIRGDFERQAGNVLQRLQRDPERDIYHTDNWPQPS
FT                   VDSPDGGDCCGVLAIRFHRQESGWIFWFRHEEVHRIRWGGKPEKLLTIGPSGPRLTPRG
FT                   SFEAWEEVVRGHSTPWSETDLAIAEKLRLDLMELCLNHAAEVDRMRQRLIAVLGHDLRN
FT                   PLQSISMAAALLSSSDTRTTELRQHISASSSRMERLVSQILDMSRLQSGIGLTVNPVDT
FT                   DVSQLVQQIVCETDVAYPGLVIEIAIDPQVRAVVDPDRYAQVAANLLSNARHHGLPGRP
FT                   VLVTLTRQGDEVCLSVLNETSGLSEAQLANLFEPFKRESADNQRNRNGLGIGLYISQAI
FT                   AQAHQGRIDVDCRDDVITFCLRLPVRQAETGSSS"
FT   CDS_pept        complement(930660..931247)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08551"
FT                   /product="putative heme oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08551"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25582"
FT                   /protein_id="CAW25582.1"
FT                   /translation="MSPSPSPALAALRDATRDLHAELDRRSPLGDDDLDDRAYLDHAGR
FT                   ILGWLEPLERALRDNRSGWPAALRADARLVKSAWLESDLLAGGMSRAQVEALPRCADLP
FT                   NATRAAEVFGVAYVMEGATLGGAYLYKRLAPRLPGLPLQWLQGYGQATGVRWQEFLEQL
FT                   ARQIDSPEAIGLAQDAAQATFLSFRRWVLDEA"
FT   CDS_pept        complement(931365..932750)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08561"
FT                   /product="putative decarboxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08561"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25583"
FT                   /protein_id="CAW25583.1"
FT                   /translation="MSHRPVINASVSPKGTLETLSQREVQQLSETANGKTYQLFRQCAL
FT                   AILNTGAHSDNAKTILDAYKDFEVRIHQQDRGVRLELINAPADAFVDGEMIASTREMLF
FT                   SALRDIVYTQSGLDSQHVDLDSSQGLTDYVFQLLRNARTLRPGVEPKIVVCWGGHSISS
FT                   EEYKYTKKVGHELGLRSLDVCTGCGPGVMKGPMKGATISHAKQRIVGGRYLGLTEPGII
FT                   AAEAPNPIVNELVILPDIEKRLEAFVRVGHGVIIFPGGAGTAEEFLYLLGILMHPDNQD
FT                   LPFPVILTGPRSAEAYLQQLHEFVGATLGHAAQRHYRIVIDDPAEVAKQMAQGLKEVKQ
FT                   FRRERNDAFHFNWMLKIDESFQRPFEPTHENMASLQLSRSLPPHELAANLRRAFSGIVA
FT                   GNVKDNGIRMIEQYGPYEIHGDPAVMLPLDRLLQAFVKQHRMKLPGGAAYVPCYRVVQT
FT                   EAA"
FT   CDS_pept        933170..933679
FT                   /transl_table=11
FT                   /locus_tag="PLES_08571"
FT                   /product="spermidine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08571"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25584"
FT                   /protein_id="CAW25584.1"
FT                   /translation="MIELRTITRDDWETCIDLKVARHQAHFVASNLYSLAQSRFLPGFR
FT                   AVGIHHGGRMVGFALYGPDADDGHYWLYRLMIDRRYQGKGHGRAALQRIIASVRRTRRR
FT                   SDRLMVAYAVDNDVARQLYRDAGFVEQGLAPWGETMACLMLPEPSHRSGKVAGAPGGRA
FT                   AHGVPA"
FT   CDS_pept        933833..935023
FT                   /transl_table=11
FT                   /locus_tag="PLES_08581"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08581"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25585"
FT                   /db_xref="GOA:B7V6N7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023495"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7V6N7"
FT                   /protein_id="CAW25585.1"
FT                   /translation="MDSTSETRSGSWLSVIALALAAFIFNTTEFVPVGLLSDIGHSFEM
FT                   PTSQVGLMLTIYAWVVSLASLPMMLLTRNIERRKLLVGVFLLFIASHVLSGLAWSFQVL
FT                   MLSRIGIAFAHAVFWAITASLAVRVAPPGQQAKALGLLATGTTLAMVLGIPLGRVVGEA
FT                   LGWRTTFMAIAGLSVLTLLYLARSLPLLPSQNSGSLRSLPMLFRRPALVCLYVLTVVVI
FT                   SAQFTAYSYIEPFAKQVARMSGEATTLLLLLFGGAGIFGSILFSRYSEAFPRGFLLAAI
FT                   LALGSSLALLLPLSAQPTWLMALSLLWGMSIMCFGLAQQSRVLRLASDATDVAMALFSG
FT                   LYNVGIGAGALLGSVVSERMGLASIGNVGAALALAGLLLALFAALRYAEALKSTSL"
FT   CDS_pept        935151..939404
FT                   /transl_table=11
FT                   /locus_tag="PLES_08591"
FT                   /product="probable sensor/response regulator hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08591"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25586"
FT                   /protein_id="CAW25586.1"
FT                   /translation="MNVQQSKFRLSRWAGATLALGLLLSGLGAWGLALVNEQQARMALE
FT                   REAELLAEAVTRRVELYQYGLRGVRGALLTAGEAHIDRELFRRYSLTRDIDREFPGARG
FT                   FGFIRRVAAADEAGFLRQARADGQPEFRIQQLTPHDGERYVIQYIEPVARNGQALGLDI
FT                   ASEANRREAARAALETGQVRLTGPITLVQASGLRQQSFLILMPIYRSGITPPPGPQREL
FT                   EGFGWSYAPLLTGEVLAGLPIDNAAIHLELSDVTGDGAAVPFFVNGAAAPAQRLFGHML
FT                   RREIYGRHWQMAFSALPLFVQRLHQPSPRILFLAGSLVSLLLAALVNASALGRLRRRRE
FT                   AATQARLAAIVGNSADGIIGVGLDGVISDWNRGAEALFGYREEQAVGRRVVDLLVPPSK
FT                   ENEELDILARIARKEQVVSFDTVRRHQDGHLLDVAVTVSPILGPDGGVVGASKTVRDIS
FT                   AKKAAEARIRELNTGLEHQIAERTAELRRLNVLLGSVLQAASEVSIITLDRDGIISGFN
FT                   LGAERMLGYRADEVVGKASPTLLHSERELLARGQELGEEGFRVLVARAEQEGAETREWT
FT                   YLRKDGSPLSVTLSVTVLRDEAGAINGYLGIAVDVTEWRNAEREMAAARDQLQMAADVA
FT                   RLGIWRWNLADDSLQWNERMCELYGQPLALRDGGLVYEHWRSRLHPEDLERTEASLRAA
FT                   VEGRGNYDVIFRVVLPDGGIRFIQAGAQVERDADGNPLQVTGINIDITSDQQLQARLRE
FT                   AKEQADAASAAKSSFLANMSHEIRTPMNAVLGMLQLARQTDLNERQRDYLDKASSAATS
FT                   LLGLLNDILDYSKIEAGKLVLEMLPFELEPLMQDLAVVLSGNQGDKDVEVIFDIDPELP
FT                   SAVVGDRLRLQQILINLAGNALKFTARGHVLVSLRRLAHDAHLVRLRVLVADTGIGISA
FT                   EQQQRIFEGFTQAEASTSRRFGGTGLGLFICKRLVDLMGGELRVESAPGSGSRFWFDLD
FT                   LDVAHDQPLRAACPGAGEPLRLLVADDNLVAGELLERTVGALGWRADCVGSGSEAVARV
FT                   QAAMAEGHRYDVVLMDWRMPDLDGLSAAQLIRQLQGDLPPPMVIMITAYGREVLADARD
FT                   HSAPPFVDFLTKPVTPKQLADSVLHALHGEQGAPANPPPRPVERTQRLRGVRLLVVEDN
FT                   ALNRQVAAELLSSEGARVALADGGLAGVQQVLEASVPFDAVLMDMQMPDIDGLEATRRI
FT                   RADGRFAGLPILAMTANASLADREACLAAGMNDHVAKPIDKERLVLCLLGHLGRSGARG
FT                   APATAADAGELVEARGDIVGRFGGSLELIVQVLRRFVPDMQDLFAQLERQLGEGDVQGS
FT                   AATLHTIKGSASTVGASALAGRASELEQALRRADPLRGMEILAGIRLDELRTLCDACLL
FT                   RLQAMFGDVQAESAS"
FT   CDS_pept        complement(939568..939966)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08601"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25587"
FT                   /protein_id="CAW25587.1"
FT                   /translation="MSASPPLRQPCPPGACVCERERLEAPGADRRILLLTRQEEQRLAA
FT                   RLEALRSLEDLEHLLRRMEEQLGIRLRIAPAFGEVRSMRGIRMRFEEQPGLCRKTRQAI
FT                   PAAIRRGLEKRPEVAYALLNAHDLLRDA"
FT   CDS_pept        complement(940031..941224)
FT                   /transl_table=11
FT                   /gene="ampC"
FT                   /locus_tag="PLES_08611"
FT                   /product="beta-lactamase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08611"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25588"
FT                   /protein_id="CAW25588.1"
FT                   /translation="MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPV
FT                   MKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYAL
FT                   AQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYR
FT                   QWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAA
FT                   LAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDA
FT                   THRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLL
FT                   NKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"
FT   CDS_pept        941373..942263
FT                   /transl_table=11
FT                   /gene="ampR"
FT                   /locus_tag="PLES_08621"
FT                   /product="transcriptional regulator AmpR"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08621"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25589"
FT                   /protein_id="CAW25589.1"
FT                   /translation="MVRPHLPLNALRAFEASARHLSFTRAAIELCVTQAAVSHQVKSLE
FT                   ERLGVALFKRLPRGLMLTHEGESLLPVLCDSFDRIAGLLERFEGGHYRDVLTVGAVGTF
FT                   TVGWLLPRLEDFQARHPFIDLRLSTHNNRVDIAAEGLDYAIRFGGGAWHGTEALALFEA
FT                   PLTVLCCPEVAAQLHSPADLLQHTLLRSYRADEWPLWFQAAGLPAHAPLTRSIVFDTSL
FT                   AMLEAARQGVGVALAPAAMFARQLASESIRRPFATEVSTGSYWLTRLQSRGETSAMLAF
FT                   RGWLLEMAAVEARGR"
FT   CDS_pept        complement(942280..942501)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08631"
FT                   /product="hypothetical protein"
FT                   /note="orf01261"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08631"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25590"
FT                   /protein_id="CAW25590.1"
FT                   /translation="MLESEIVAARRAYAASLGVTLSGAISNADEPVHIRHAVSNSNHNP
FT                   NASNRINLGRARAYKKRREEGDYFFIDT"
FT   CDS_pept        complement(942822..944066)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08641"
FT                   /product="putative HDIG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08641"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25591"
FT                   /protein_id="CAW25591.1"
FT                   /translation="MLKRIPVTQLRLGMFVQSLCGSWLDHPFWKRGGFLLDSQADLQRL
FT                   RESAVKEVWIDASKGLDLPEEAAVSAAAVLPVTMPAGPSPARVALEEEIRHAALLCSRA
FT                   KAAVVSMFRDARMGQAIDTAHASDLVDEISASVLRHPNALLSLVRLKTSDEYTYMHSVA
FT                   VCALMIALARQLELPDPLVREAGLAGLLHDIGKMAVPDPILNKPGKLTDQEFGLVRRHP
FT                   QNGARMLLDCRQVSALVVDVCLHHHERIDGTGYPFGLAQEQISLLARMGAVCDVYDAIT
FT                   SDRPYKKGWNAAEAIRRMAEWNGHFDPQVFRAFVKAVGIYPVGALVRLESGRLGVVLEQ
FT                   HGRSLLTPRVKVFFSARSKVPIPQQVLDLGRAGQTDRIVGFEPAEAWNFRNLDEMWTGL
FT                   AKSTGSYFDAGTGNP"
FT   CDS_pept        944390..944857
FT                   /transl_table=11
FT                   /locus_tag="PLES_08651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08651"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25592"
FT                   /protein_id="CAW25592.1"
FT                   /translation="MSVFDSRQKTSASLLGAVLVGGMLLGGSAFAVEPLGQGLQVAAAS
FT                   AGEGKCGEGKCGSGGSAKTPAKAGAEGKCGEGKCGDASFARTDTDHDGKVSRAEFLAVA
FT                   KDRAGEFDSIDSDHDGFISEAEAYEHLRKTYEANGKPMPAGLFSKLEQGRH"
FT   CDS_pept        944932..945762
FT                   /transl_table=11
FT                   /locus_tag="PLES_08661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08661"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25593"
FT                   /protein_id="CAW25593.1"
FT                   /translation="MTLIDNAAGLGLRRGLLPQLLAMAPGAVDFLECAPDNWIDVGGAF
FT                   GADLERLVERFPLTCHGLSLSLGGSTPLDAAFIEQTRRFLVRHRVALYSEHLSYCSDDG
FT                   HLYDLLPLPFTEAAVRHVAARIREAQERLERRIAVENISYYAAPYREMSEIEFVNAVLD
FT                   EADCDLLLDVNNLFVNACNHGYDALDFLARLPPGRVAAYHVAGHYDEAPDLKIDTHGAA
FT                   VKPGVWALLGAAYRRFGVRPTLLERDFNYPPLGELLLEVEQIRQWQRDEGRRHG"
FT   CDS_pept        945755..946510
FT                   /transl_table=11
FT                   /locus_tag="PLES_08671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08671"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25594"
FT                   /protein_id="CAW25594.1"
FT                   /translation="MDERLRQQQFSLARHLRDPLGNAPPPDIEERRLRVYRELFYNAIE
FT                   GLLASGFPRLRGLLGEQQWHGLVREFYREERSHTPLFTRIAGVFVDYLRQRGEYRPAWQ
FT                   AELAHFEWSETRLYLAEPDDPPYRREGDLLDGVPLLSSLALPLGYRWPVHRLEEDVALA
FT                   EAPAEPTLLLMHRDSSHRVHTARLTPLAYRLLESLARRRLSGREHLAALALEARSAPGA
FT                   LDAAGLELLAALRTQGVVLGTLERDWAGG"
FT   CDS_pept        complement(946763..947272)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08681"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25595"
FT                   /protein_id="CAW25595.1"
FT                   /translation="MQASDLRAWRRPFALLDRCGGWSADLSLRLFLAWEFFESGWEKWN
FT                   GENWFGDIQSAFPFPFDRLPAAFNWELSLWAELLGALFLLLGLGTRLTALVLIVVTLVA
FT                   TAAVHWPAEWSSLAELARGYSITDHGFGNFKLPAIYLAALLPLLLAGAGKLSLDHWLGR
FT                   RLGLSR"
FT   CDS_pept        complement(947304..947933)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08691"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25596"
FT                   /protein_id="CAW25596.1"
FT                   /translation="MTVPTSQSAWHGWRLFAVLAVAVLCMTALVLALQAQPVEGLRSAI
FT                   RATARSSFALFLAAFLASSLATLVPGPGTRALLRERRYLGLAFAFSHAVHALLILAYWK
FT                   LFPETFWSGRSVAANIPGSIGYLFILLLTLTSFRTPARLLGPRAWKALHSTGTWVLAGI
FT                   FCLSFFKRIPMGGWYVLAFATIFSAIVLKLTAKLAVRLRRRDVQPA"
FT   CDS_pept        complement(948063..949367)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08701"
FT                   /product="probable two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08701"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25597"
FT                   /protein_id="CAW25597.1"
FT                   /translation="MKLAVPRPRSLAARLALILFPGLVLAYGLSFASQFYERYQTAKHM
FT                   MLDSLEQDVAISVAMLDRLTPAEREAWLPRLERRTYRYRLDAGEPGQPLALADAPVAAH
FT                   SIERALDGQYPLTLRKVADSRPHFQVLLRLRDGSPLTIDVTPAPVPLSGWLPLVLLVQL
FT                   FLLLLCTGLAVRTAIGPLTRLVKAVEHLDPNRPAQPLAETGPREVAHAAAAFNAMQARI
FT                   ADYLKERMQLLAAISHDLQTPITRMKLRVEFMDASSDRDKLWNDLEEMQHLVREGVAYA
FT                   RSMHGSTETSCRVDLDAFLDSLVFDYQDSGKQVQLDGRTGAVIDTRPHALRRVLVNLVD
FT                   NALKFAGAARLEVERRTDGGTRIQVLDNGPGIPAEELDEVLKPFYRVENSRNRDTGGTG
FT                   LGLAIAQQLSLALGGRLTLANRAGGGLCARIELDP"
FT   CDS_pept        complement(949364..950104)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08711"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08711"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25598"
FT                   /protein_id="CAW25598.1"
FT                   /translation="MEHVDHILIVDDDREIRELVGNYLKKNGLRTTIVADGRQMRAFLE
FT                   ANTVDLIVLDIMMPGDDGLLLCRELRVGKHKATPVLMLTARNDETDRIIGLEMGADDYL
FT                   TKPFSARELLARINAVLRRTRMLPPNLTVSESSRLIGFGQWQLDTSARHLLDDAGTVVA
FT                   LSGAEYRLLRVFLDHPQRVLSRDQLLNLTQGREADIFDRSIDLLVSRLRQRLGDDAREP
FT                   EYIKTVRSEGYVFSLLVRLVEAHP"
FT   CDS_pept        950461..950721
FT                   /transl_table=11
FT                   /locus_tag="PLES_08721"
FT                   /product="predicted protein"
FT                   /note="orf01272"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08721"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25599"
FT                   /protein_id="CAW25599.1"
FT                   /translation="MTRTLLATTLLAALALPAFAAQAAAPVPTESYRYGMPLDVHKVVA
FT                   TQEQASTTCEIVDARMDYLDSAGKLHSLAYRKYASACSQGG"
FT   CDS_pept        complement(950722..952401)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08731"
FT                   /product="probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08731"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25600"
FT                   /protein_id="CAW25600.1"
FT                   /translation="MTSTARRSFDYIVVGAGSAGCVLANRLSADPAVSVCLVEAGPSDR
FT                   TPLPAAYIRTPAGIIRLIANPKWNWMHRFAAQPGTANQPIACPRGKVWGGSSAINGMIY
FT                   IRGDRHDYDRWASLGNRGWSYDELLPYFRRSEHFEPGESPWHGRGGELNVAAQRSPGPI
FT                   NQVFFQAAEEMGWPYNADFNGERQEGIGPFHVTQVNGERCSAARAFLHPALARPNLTVL
FT                   SSALTLRVLLEGTRATGVEISQAGEVVQLQARREVILSAGSINSPQLLLLSGIGPAAEL
FT                   ARHGIVQRHELPGVGENLQDHQDIVLMYRTEAKLGYGLGFSPKGWLPLLRSPWQYLFGR
FT                   RGALTSNTVESGGFLRLDPQAETPELGLIVAPALKNQPQRLVPFGHGVSLHVAVMHPQS
FT                   RGRVRLNSPDPHDRPLIEANFLSHPADLDTLVQGFQLVRKLAASRSFARHLKGELVPGP
FT                   QVSSRGQIEAWIRANLGTVFHPVGTCKMGHDQLAVVDDQLRVHGLQGLRVADASIMPTL
FT                   ITGNTNAPAIMIGEKAADLILGKPAPHAPPARQPAVQALAGA"
FT   CDS_pept        complement(952556..953860)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08741"
FT                   /product="putative porin"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08741"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25601"
FT                   /protein_id="CAW25601.1"
FT                   /translation="MKTLRTLPALLCAGFLGLSAQAAEDSRSGPLAGFGERLQRHGVKT
FT                   HAQFWSLSLKNLDTGPRQHSFGNSGDLFLGADLDLATLAGLDGASLHIEETLFILDRGT
FT                   GQPTGPSWQGAVGSYFGGAPLHNDIGANQLSLLTWQQQWLGGRLDSHLGRTNARRYFLI
FT                   YNCETVVTCNDPIIDASTGILPPPYGAWGGYLKYRATPTLYLHAGAFESNPVDYLKKRH
FT                   GLDFGTDDASGTSLLLGIGDKREESLDPYRSHYELNAYLNTANQVDPLTGASDHGSAGG
FT                   FFKFQQLFWRADGGRLDSPRALGLFGSLSVSADDKQPFRHFAELGLTYHAPFDRTRDKL
FT                   NLKASYLRLNDHQLEFQRQARIAAGGDAKLGQRDVYALETNAHIALTPHIALEPSVQYI
FT                   FNPDNYYNPGARELSGDGFVVGLQLMVDMGSLLGL"
FT   CDS_pept        complement(953945..954670)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08751"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08751"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25602"
FT                   /protein_id="CAW25602.1"
FT                   /translation="MVFQHDIYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDAD
FT                   GVHAPRHPRIRREELDITDSQRLQRLFEALPRLDVLVNNAGISRDREEYDLATFERVLR
FT                   LNLSAAMLASQLARPLLAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACE
FT                   YAAERIRVNAIAPGWIDTPLGAGLKADVEATRRIMQRTPLARWGEAPEVASAAAFLCGP
FT                   GASFVTGAVLAVDGGYLCA"
FT   CDS_pept        complement(954685..955743)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08761"
FT                   /product="probable alcohol dehydrogenase (Zn-dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08761"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25603"
FT                   /protein_id="CAW25603.1"
FT                   /translation="MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQ
FT                   SGPHSIPQAEAHPLSGCRAPLTLGHEFCGVVAALGPGVEGLRIGDRVAVEPEYRCGECR
FT                   YCREGRYNLCESMGFIGLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHA
FT                   LRRSSLAPGQRCAVFGLGPIGLLLVMLARLRGIEDIVAIDVSPERLALAGEFGASRALD
FT                   ARDGDTAARLREGGALDCAFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLV
FT                   NRELRLLGSVGYRDAYPELIALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQVK
FT                   VLVNPNPALADA"
FT   CDS_pept        complement(955740..956999)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08771"
FT                   /product="probable major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08771"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25604"
FT                   /protein_id="CAW25604.1"
FT                   /translation="MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQL
FT                   SNSHLGMLSSVLALAWAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLS
FT                   LLLFRGIMGLAEGPILPLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPLLVAL
FT                   AEALGWCHAFIVSLLPGLLIAWLIWRHVRPDPPRAQRPAPRAEEAKGKRLALLKSRNIL
FT                   LCTLISCVFVTWFIVLISFTPTFLVNARGFSPATMGRLMSCLGVAWVVWGFAVPAISDR
FT                   IGRRPTLVAFSLLAACCPLALLYAPNATSLGLLLLLTYTGLGCFTLFMATIPAETVSRG
FT                   VIATALGLIMGLGELVGGFLAPTVAGFAADRFGLSIVMWMSCGGALLAAFLSLFLRETA
FT                   PAVLARQRSAPTSVLQGNQP"
FT   CDS_pept        complement(957070..957603)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08781"
FT                   /product="putative 2,4'-dihydroxyacetophenone dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08781"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25605"
FT                   /protein_id="CAW25605.1"
FT                   /translation="MPELATREFWKDLQPIPDCFKPDAKPEVYLRNAPTEDERLYVPFT
FT                   ETVKSRPLWISPSENRWCDILMATSAGLVNRHYHPHEVFAYTISGKWGYLEHDWTATAG
FT                   DFVYETPGEGHTLVAYEHEQPMRAFFIVKGPLVWLDEKGNADGIFDVHDYIAMCREHYD
FT                   KIGVGAAYIDSLFR"
FT   CDS_pept        957922..958881
FT                   /transl_table=11
FT                   /locus_tag="PLES_08791"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08791"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25606"
FT                   /protein_id="CAW25606.1"
FT                   /translation="MPAHALLETRRASTQDIPLEQRLAFWEDYNASILVGLKCSSYSQA
FT                   GFAATQDNLCLERLRLARIGGNEHVVERDRSMIRAVPKESIFVSLVQGSQSFFYQDNGC
FT                   NLLQPGELVIYRTDKPYLFGFSGPMRQFIFDIPQDDFAERCLRDFKGPLKIGAESPVQR
FT                   LLVRTLGERTRDFLDSPHGEDAERYQEEAYDLLASIISDHAGEHRASALGASYLLAAKQ
FT                   YIQQHLDEPALSCERVAAATGVSSRHLARLFAQEGSSPGRYLQERRLERARQLLASPQG
FT                   RRLDVAEVAYRHGFSSQAHFARAFKARYGMTPSEARGR"
FT   CDS_pept        958929..959345
FT                   /transl_table=11
FT                   /locus_tag="PLES_08801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08801"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25607"
FT                   /protein_id="CAW25607.1"
FT                   /translation="MTDKKEQIARFIQREFPQTRVVVEAVGERSATVWQAVDASDLRPG
FT                   GTVSGPTLMAIADVALYVAVLGEIGIVPLAVTTSLTINFLRRPAADRRVVAECRLMKVG
FT                   KTLAMGEVSLFSEGDAEPVAHVVGTYSIPPAHRR"
FT   CDS_pept        complement(959355..960467)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08811"
FT                   /product="possible ferridoxin oxidoreductase subunit"
FT                   /note="orf01286"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08811"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25608"
FT                   /protein_id="CAW25608.1"
FT                   /translation="MSLPNANLIASSRKAAAQMATRDTSFIFNEWYVAAFAEEVGRELL
FT                   ARTLLGKRVVLYRTLAGQAVALEDRCAHRSFPLSRSRLEGDGIVCGYHGFRYDSQGELI
FT                   ETPSQKACPRGVGIRHYPLLERGPLVWIWLGDPRLADPKRLPQRPWLEDPGWACSKGYF
FT                   LHPGNYVSMHENLMDLTHLTYLHANTIGTPDYAGAPYELDLKEGHYRLVRHVLPTTLSP
FT                   VWGRTTGLDGCPTAARITTSEFLSPGLHQVSATFYDTALPAERRPEFHIRTAHILTPET
FT                   HGSMHYFIVHGRDFAQDDETVGAFMHEQLFAAFVEDVEGLGALEKVLAEADEDSYEISV
FT                   ASDAPAVATRTYLKRRADEEARQRAAHRVA"
FT   CDS_pept        complement(960496..961461)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08821"
FT                   /product="putative flavodoxin reductase"
FT                   /note="orf01287"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08821"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25609"
FT                   /protein_id="CAW25609.1"
FT                   /translation="MSASPSSRLHLQVTDFRAVARDVVLVELAAVDGTELPAFTPGAHL
FT                   ELHLGNGLIRHYSLLNDCRERLRYQLAIGLGDDSRGGARFIHRQLRTGDRLHAAAPRNH
FT                   FMLREDAARYCFVAGGIGITPILSMVRWCQAQGKDWRLLYAVRERQRAAFLAELMTLGG
FT                   ERTRLHCSEEGDPLDSTALIAGLGADEELYCCGPDGLMQAIRDAGSDCAERLHFERFDA
FT                   PVTPASSSGGTDAFRLELRRSALSLRVESHQSILEVLEEQGLEPPYACRAGICRTCETR
FT                   VCAGEPEHFDHVLSDTERASGETLLICVSRCRGNYLELDL"
FT   CDS_pept        961647..962426
FT                   /transl_table=11
FT                   /locus_tag="PLES_08831"
FT                   /product="hypothetical protein"
FT                   /note="orf01288"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08831"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25610"
FT                   /protein_id="CAW25610.1"
FT                   /translation="MISFWNAPPGSPSADLRPFVELACALGGEGFPAALLETLGHWVAA
FT                   RHFNVLRIGAPRPELLLAGTRHRDAQLVWRCWQAYSRYYHSHDPLFLRMQRQRRGPVPL
FT                   LGHLLAEDIEFDAYREAIYRDNGLSERLSSLHWDEEGRPLLFNLYRHREDGYFSEREIA
FT                   AFEQWVPALLQLLRGHLALRRGRSATDEWRLALLHRATDLTPQELAVCLHLLRGLSHAG
FT                   IAAELGLKESTVKTYRNRAFARLDIHFRSQLFALVQG"
FT   CDS_pept        complement(962470..962982)
FT                   /transl_table=11
FT                   /gene="hpaC"
FT                   /locus_tag="PLES_08841"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase small
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08841"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25611"
FT                   /protein_id="CAW25611.1"
FT                   /translation="MSQLEPRQQAFRNAMAHLSAAVNVITSNGPAGRCGITATAVCSVT
FT                   DSPPTLMLCINRNSEMNTVFKANGRLCVNVLSGEHEEVARHFAGMTEVPMERRFALHDW
FT                   REGLAGLPVLHGALANLQGRIAEVQEIGTHSVLLLELEDIQVLEQGDGLVYFSRSFHRL
FT                   QRACRAA"
FT   CDS_pept        complement(963011..964573)
FT                   /transl_table=11
FT                   /gene="hpaA"
FT                   /locus_tag="PLES_08851"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase large
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08851"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25612"
FT                   /protein_id="CAW25612.1"
FT                   /translation="MKPEDFRASATRPFTGEEYLASLRDDREIYIYGDRVKDVTSHPAF
FT                   RNAAASMARLYDALHDPQSKEKLCWETDTGNGGYTHKFFRYARSADELRQQRDAIAEWS
FT                   RLTYGWMGRTPDYKAAFGSALGANPGFYGRFEDNAKTWYKRIQEACLYLNHAIVNPPID
FT                   RDKPVDQVKDVFISVDEEVDGGIVVSGAKVVATNSALTHYNFVGQGSAQLLGDNTDFAL
FT                   MFIAPMNTPGMKLICRPSYELVAGIAGSPFDYPLSSRFDENDAILVMDKVFIPWENVLI
FT                   YRDFERCKQWFPQGGFGRLFPMQGCTRLAVKLDFITGALYKALQCTGSLEFRGVQAQVG
FT                   EVVAWRNLFWSLTDAMYGNASEWHGGAFLPSAEALQAYRVLAPQAYPEIKKTIEQVVAS
FT                   GLIYLPSGVRDLHNPQLDKYLSTYCRGSGGMGHRERIKILKLLWDAIGSEFGGRHELYE
FT                   INYAGSQDEIRMQALRQAIGSEAMKGMLGMVEQCMGDYDENGWTVPHLHNPDDINVLDR
FT                   IRQ"
FT   CDS_pept        complement(964739..965029)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08861"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25613"
FT                   /protein_id="CAW25613.1"
FT                   /translation="MFRSTSHVRTESAARYVNRLCKHWGHKFEVELTPERGFIDFGDSN
FT                   CELLAHPDHVLMILNSPDEDSLAHMQNVVADHLQRMANSESLEIAWQPAES"
FT   CDS_pept        complement(965241..966002)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08871"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08871"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25614"
FT                   /protein_id="CAW25614.1"
FT                   /translation="MRRLENRVALVTGAGQGIGRAIAECFAAEGARVLLATRTASRGQA
FT                   VLEAIRLGGGTAELLAVDLSEHDAARRAVSATLERFGQLDILLHNAAAFPQCALAELDE
FT                   GTLERTLAVNLKSCFRLTQAALPALRRSVAGRVLVTSSVTGPRTAIPGLSHYAASKAGV
FT                   NGFIRAAALELAGDGITVNGVEPGLVATPALGSLGDAAALAAHIPLGRVGQPLDIAHAM
FT                   LFLASDEASYITGQTLVVDGGALLPENGGLA"
FT   CDS_pept        complement(965999..967384)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08881"
FT                   /product="probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08881"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25615"
FT                   /protein_id="CAW25615.1"
FT                   /translation="MDTTFGLDLARVEALFKRELRRFDELHPRSAQAYRENRRHWLYGA
FT                   PLHWMQQWPGNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQA
FT                   RRGSTLMLPTEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRLCRMLSGRDKVVVFN
FT                   CNYHGSVDESQVEFDAAGRMVPRAGVHPNGVRHATTTRLVEFNDLDALEAALAHGDVAA
FT                   VLTEPFMTNVGMVPPAEGFHAGLRELTRRHDVALIIDETHTISCGPAGYSGAHGLEPDF
FT                   FVLGKCIAGGIPSAVWGCSQAQAERIWAVLPHFRPGQAINHFGFGGTLAGNALQLAAMR
FT                   ATFAEVMTEDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIGARVEYLFMTHAPRNGG
FT                   EAHHARNGLVEACLHLYLLNRGVLLTPFHNMALTCPATRAEDVELHDRLLRDCLGELLE
FT                   RPS"
FT   CDS_pept        complement(967393..968217)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08891"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25616"
FT                   /protein_id="CAW25616.1"
FT                   /translation="MSAHSHSGWITVGALADGFAPDNHVLPACGDLAGLERVLHFANGW
FT                   VIEHAFDSQRLRWRLADGSASGESDYRASSLRENLYLVDFLKQENGRPVSVSLVLDFDN
FT                   QAFTAVLGHLPDRAACEQGLFARALAGRELTGVEAEFLHGSLDRPWQPGACPHVPSDEL
FT                   VGLRNRYVYSASEAYEHIYLNPAFYTWQCLRGAERGLADTDRCHCYRLAERLYLFVWRE
FT                   KIVPTLGVLLIDLEAGRTDGKIFGYQDDDFATPVNFPVGALAQVLNQTRHDL"
FT   CDS_pept        968691..969260
FT                   /transl_table=11
FT                   /gene="cupB1"
FT                   /locus_tag="PLES_08901"
FT                   /product="probable fimbrial subunit CupB1"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08901"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25617"
FT                   /protein_id="CAW25617.1"
FT                   /translation="MNKFKRAILAPLVASGTLLALMSPVAHAVDGIVNFSGNITDVACD
FT                   INGQAPGAGNVTNVDLGIVAPTHFTAVGTNSTFQEFDLVLSGAGCTNDKKVSIAFDTVT
FT                   NVDRISGNLMLMGPSKAKGVQIQIFNNSAANTTKIPLGLVEAAPQKATIDKNTATLKYK
FT                   ASYVSTEKTVIAGTGLSHIRYLLAYE"
FT   CDS_pept        969291..970037
FT                   /transl_table=11
FT                   /gene="cupB2"
FT                   /locus_tag="PLES_08911"
FT                   /product="chaperone CupB2"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08911"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25618"
FT                   /protein_id="CAW25618.1"
FT                   /translation="MAPLMHRFHSFVAASAVAIALCVGTAHAGLIAQGTRVVFPASERE
FT                   VTLRVSNTSGTPVLAQAWIDDGRQDVPPEELQVPFSVTPAVTRVDPNGGAVLRIAYLKA
FT                   PLPTDRESLFWLNILEVPPRDEDENNALQFSFRSRFKLFFRPSQLKSVDSAAGKLQWKF
FT                   LESGGAGKKTVVQVNNPTPYYVSFASVELIVDGRVMSVGKGMVAPFSTKEFDWQGNPKN
FT                   LEAASVRYEVINDYGGRNTLDRALGK"
FT   CDS_pept        970353..972887
FT                   /transl_table=11
FT                   /gene="cupB3"
FT                   /locus_tag="PLES_08921"
FT                   /product="usher CupB3"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08921"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25619"
FT                   /protein_id="CAW25619.1"
FT                   /translation="MAVASPAGGLDAPSRRIVFDAQMLALGPGGRSIDTSRFERGDVIE
FT                   PGRYRLDLLLNSRWRGVEEVELRRQPGRESAVFCYDRGLLERAGIDLEKSARGQDRSSA
FT                   RDPLPEGLHCDPLERYVPGARVKLDIAEQSVYVSVPSYYLSLDSSKTYVDPASWDSGIS
FT                   AALLNYNSNLHVRENHGRSATSGYAGMNAGFNFGRARLRHNGTATWSRRMGSHYQRSAT
FT                   YVQTDLPAWRAQLLLGENSTSSEFFDAVSFRGVQLSSDDRMLPDSLRYYAPVVRGTAST
FT                   NARVSVYQRGYLIYETTVAPGAFALDELQTASYGGDLEVRVTEASGEVRSFIVPFATTV
FT                   QLLRPGTTRYSLTAGRLNDPSLERRPNMLQGVYQRGLGNDVTAYAGGAFTGSYMSGLMG
FT                   AALNTPVGGFSGDVTLARTEVPGGDRLSGSSYRLAYSKNLPNTGTNFSLLAYRYSTGGY
FT                   LGLRDAAFMQDRVERGEPLESFSRLRNRLDANISQQLGNGGNLYLNGSSQRYWSGGGRA
FT                   VNFSVGYSNQWRDVSYSISAQRLRSQYEGFSSGDRRGETSTLFSLNLSIPLGGAGRGSP
FT                   TLSSYLTRDSNSGTQLTSGVSGMLGKRGEASYSLSASHDRDSRQTSKSASLDYRLPQVE
FT                   LGSSLSQGPGYRQLSVKAAGGLVAHSGGITAAQTLGETIGLVHAPNARGAAAGYSGSRI
FT                   DRHGYAVIPNLLPYQLNSVDLDPNGMADEIELRSSSRNVAPTAGAVVRLDYPTRVAKPL
FT                   LVDSRMPSGEPLPFAAEVLDAHSGQSVGAVGQGSRLVLRVEQDRGSVRVRWGNEPQQQC
FT                   LVDYALGPRETTPPVLQLACRPASAADRERTL"
FT   CDS_pept        972884..973624
FT                   /transl_table=11
FT                   /gene="cupB4"
FT                   /locus_tag="PLES_08931"
FT                   /product="chaperone CupB4"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08931"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25620"
FT                   /protein_id="CAW25620.1"
FT                   /translation="MTGVGLGRCGTAWVLLVALVADASASLSVIGTRFIYPAGVSALTI
FT                   RVGNVGTRPALVQAWLDRGDETADPSAVTVPFILSPPLLRMDPQETQALQLRHTGEPLP
FT                   DDRESLFWVNLLEVPGREDGSGNLLLVSYRLRMKLLFRPQGLAGDPRAAARQVVWRLRP
FT                   AVRPGQRALLEADNRSPYHVSLVRLELGEGDLAMSLGSVTLPPFALTPLSLPAVPGEAA
FT                   RVHFDAVGDDGQIERGDAPAERYP"
FT   CDS_pept        973712..976768
FT                   /transl_table=11
FT                   /gene="cupB5"
FT                   /locus_tag="PLES_08941"
FT                   /product="adhesive protein CupB5"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08941"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25621"
FT                   /protein_id="CAW25621.1"
FT                   /translation="MNKCYALVWNVSQGCWNVVSEGSRRRGKPAGAKAAIASALALLGA
FT                   TALAPAYALPSGGTVVGGSANGEIHLSGGNSLSVNQKVDKLIANWDSFSVAAGERVIFN
FT                   QPSSSSIALNRVIGTKASDIQGRIDANGQVFLVNPNGVLFGRGAQVNVGGLVASTLDIT
FT                   DAEFNGNSSRYRFTGPSTNGVLNHGGAITAAEGGSIALLGAQVDNRGTVLAQMGGVGLG
FT                   AGSDLTLNFDGNKLLDIRVDAGVANALASNGGLLKADGGRVLMAARTANALLNTVVNSQ
FT                   GAIEARSLRGKNGRIVLDGGPDGKVMVGGALSANALNGPGHGGTVEVRGQAVEVALGTQ
FT                   VNTLASNGLNGTWKIAADKIDVRPSAVSDGVTVHADTLSRNLASTNIELVSTKGDLDLD
FT                   GSVSWASGNRLGLGSAADLTLNGRLNASGAKAGLELKAEGAIDINDKIVLGGAGSALAM
FT                   DAGEGHRVNGTASVSLAGANATYVSGGYYYTVVQNLAQLQAINKNLDGLYVLGGNILGG
FT                   SYYCTALQSIGGPAGVFSGTLDGLGNSIGNLSISNTGPNVGLFARSSGTLSNLKLNNLR
FT                   VSDNTYGSGPSSLGALVGINSGRIANVSASGVSVVGSRLRSNALGGLVGRNINGQITNA
FT                   SVSGGVTAYAASTAVGGLVGENFTTAWGPEAVIENAHSNVHVAAQSTERNSLGGVGGLV
FT                   GLNAKATIRASGSQGKVETYRPGLNVGGLVGYNMFGHVSDSSASGQVEAGGAGYTGGLV
FT                   GLSSGGEIFRSQASGSVYSKGGLATGGLIGKAEGNGMLGNLKASGSVMDQGGADLGGLV
FT                   GNNSQGAIETAEATGKVSGGSNSRVGGLIGHNLGGSVAHAISRGDVSGGFNSLVGGLVG
FT                   HNGGELFNVDASGRVSAAASASVGGLVGSNAGSILSARSSSTVSGGGRSRIGGLVGENQ
FT                   IQGRIVSSMSEGTVSGDYYVSMGGLAGVNLGSIKYSGVSGKIDFKPQSHYGQIYGAQVG
FT                   ENRGVLGGNYVIGEAALLPPAGIDYGNIW"
FT   CDS_pept        976868..978013
FT                   /transl_table=11
FT                   /gene="cupB6"
FT                   /locus_tag="PLES_08951"
FT                   /product="fimbrial subunit CupB6"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08951"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25622"
FT                   /protein_id="CAW25622.1"
FT                   /translation="MSMRLFPGRVSLRRRPGAQARQALVLGLCCLTGGQAWALNDIALN
FT                   CSFGNGQGMPWRVVNELTSGTAKGTVLFARPVSLFLSYKPQASQEAHELVLGGNWSGVG
FT                   YPGPYGTVASDVKGIGYRISVDAQDGVKRVIPVDNQPHTLDKRVTSFSGSTTSDYLQEL
FT                   VLTVDPGELPAGDLKVTSVSGSATLSLWAVDRLKGEASIGSVLAVPADNYPTGVCRKPY
FT                   SLIGPASIAIGGGPPPPPIPKKCKVEVGREINVKLGSVALKNFPRVNDTSTERSFDISL
FT                   SECAALAKPEIAFRDKYVSAQQADPTILSLKSGGAAGFGIVVKNGLDQQRIRFDGTPYP
FT                   MRRVGDSADLPLSAAYIRIGAEGELKAGVADGAAEFTFTFP"
FT   CDS_pept        978658..979302
FT                   /transl_table=11
FT                   /locus_tag="PLES_08961"
FT                   /product="probable response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08961"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25623"
FT                   /protein_id="CAW25623.1"
FT                   /translation="MSLHRIRVMVADDHPAISLGISYELSQCGSLEMLGQVSNSTELIG
FT                   RLNEGDCDVVIVDYTMPGGKYGDGLALLSLLRRRYPHLQLVVFTMLNNPGLIRAILKQG
FT                   INCILSKSDSTSHLLAAVSAAYSRNQYFSPSIRDIFVNQVLSSHNERLTPREAEIVRLF
FT                   GSGLTITEIAERSHRSVQTISTQKVSAMKKLGIKRDADLIRYAAEGYCRMP"
FT   CDS_pept        complement(979317..980006)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08971"
FT                   /product="probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08971"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25624"
FT                   /protein_id="CAW25624.1"
FT                   /translation="MHNVLIVGASRGIGLGLADAFLQRGAQVFAVARRPQGSPGLQALA
FT                   ERAGERLQAVTGDLNQHDCAERIGEMLGERRIDRLIVNAGIYGPQQQDVAEIDAEQTAQ
FT                   LFLTNAIAPLRLARALSGRVSRGGVVAFMSSQMASLALGLSATMPLYGASKAALNSLVR
FT                   SWEGEFEELPFSLLLLHPGWVRTEMGGDSAPLSVEESAAGLVAAVEDAAGVNACRFVDY
FT                   RNQPLPW"
FT   CDS_pept        complement(980080..983055)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08981"
FT                   /product="probable nonribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08981"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25625"
FT                   /protein_id="CAW25625.1"
FT                   /translation="MSKDSVLGLFRQHADTHPERPALVDRERSFSYRELDRLSDRLAAH
FT                   LARRGVAQGELLPLLAERSAELVIAILAAAKCAAAYVPVDRRQPDRRKREILRQCQAPL
FT                   ALATQAEDLPGQPVEVIAQALATSAAGAAPRPALDGSEALYVIFTSGTTGEPKGVVIES
FT                   RSLANLVSWHNRRFNMDQRSRTTLMAGVGFDVSQWEIWSTLCAGACLHLVPDEVRPDPA
FT                   ALLAFFAEQRISHAFAPTVMVPALAEQPAPPSLALRYLFCAGEKLPPVATGGLPYTVVD
FT                   YYGPTEATVFATCRIVDAEAHRRPASIGTPIDGCEAFILDADDRPCHGDRPGELNLAGV
FT                   CLAREYLRDPDMTARRFHYSQALRRRLYRTGDKARWLADGSLQFLGRLDDQVKIRGHRV
FT                   ELGDVEAALLRQPAIHGAVVLAHADPRSGSQQLSAFVVPRQQDGDARAVLAAIKTALRQ
FT                   ELPDYMLPSRYLSLDSLPTTVNGKIDRQALRRHLDEQCQERLDEQRFGTPGELQVALSW
FT                   QEVLGHTDFGLDDSFFEVGGHSLLAAALVRELSRRFGNRAYIHDIYRTPSVRQLAASLA
FT                   RRAGEAPPALDSEPAQELQRDVRLPADVDFSRPMDTAQLLAPRHILLTGASGLMGAHLL
FT                   AELLASREADLHCPVRAQNDAHALERLRQAARQHRIELAETDWRRVRAYAADLAEPGFG
FT                   LPAETYRELAGSVDQVFHSASAVNFIQPYSYMKRDNVEGLGQVLRFCASGRCKPLMLLS
FT                   SISVYSWGHLHTGKRLMREDDDIDQNLPAVVTDMGYVRSKWVMEKIADLAAERGLPLMT
FT                   FRLGYATCHSRTGAYADYQWWSRLARTCLEYRAVPLLRELREGLTTVDYMVEAISVIAR
FT                   QPSALGKKFNLVPSIPRCLTLDEFFGRLGRRAGRPLRQMPFDDWVSLWEDNRDAPLYPL
FT                   LSMFRDNMYAGRSTVELYQDTYLWDCTNVEEHLRGSAVREPEFDDRLLDLYLAGLGGSA
FT                   MR"
FT   CDS_pept        complement(983265..983471)
FT                   /transl_table=11
FT                   /locus_tag="PLES_08991"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_08991"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25626"
FT                   /protein_id="CAW25626.1"
FT                   /translation="MRNRVRELRAERGWSQAELAGKLEVSRQTVNAIETGRYDPSLPLA
FT                   FKLARVFGLAIEAIFDDREGQLD"
FT   CDS_pept        complement(983468..983842)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09001"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25627"
FT                   /protein_id="CAW25627.1"
FT                   /translation="MTHKRFFLELLLALVGYAAAVLISGQSLAGTEPGAGRVFLALLPV
FT                   PPMVALALVVIRYLRRLDEMARRIHLEALALAFVGTALLTFTYGFLETTGFPKLSMFFV
FT                   WPLMGAFWVIGCVLGLRRYA"
FT   CDS_pept        983975..984271
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="PLES_09011"
FT                   /product="hypothetical protein (pseudogene)"
FT   CDS_pept        complement(984268..984936)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09021"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09021"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25629"
FT                   /protein_id="CAW25629.1"
FT                   /translation="MSSTLSPDLGLRCMQAFTQVVPASLCVFYRIDEDCRAHDFQLLRM
FT                   PAGMHRDYLRHYRDYDPLQPRHCLASASPVVPLRQGIARQPAKDSALYQGFLRRHGICD
FT                   VVEVLAHAQQRPVAALSLLRDARLGAFSDQELRQLRALHGLMELAAQACATPAASAERL
FT                   QGLTPREREIALLLRDGVSNKCLAQCLGLGLPTVKTHLLNLFRKTGARSRTELVKRLFL
FT                   "
FT   CDS_pept        985165..986652
FT                   /transl_table=11
FT                   /locus_tag="PLES_09031"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09031"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25630"
FT                   /protein_id="CAW25630.1"
FT                   /translation="MSIAIDPSVSAFLRSPHGLLIDGESGPARSGADMPLYDPATGAEL
FT                   ARVARAGAEDVDRAVAAARRAFEGSWAGQRPADRERLLLRLAERVEAHGEQLAQLETLN
FT                   NGKSINLSRALEVGASVEFIRYMAGWATKIEGRSLDLSIAAVPGARYRAYTVPEPVGVV
FT                   GAIVPWNFPLLMAIWKIVPALACGCTVVLKPADETPLTALRLGQLCLEAGIPPGVVNIV
FT                   TGTGAEAGAALAAHPGIDKLAFTGSTPVGKLIGHAAVENMTRFSLELGGKSPVIILDDT
FT                   SLDMAAAGSAGAIFFNQGQVCTAGSRLYVQRKRFDQVLERLAAIAGDLSIGPGLDPTTQ
FT                   INPLVSARQQERVLGMIESGVAEGASVVCGGARQGETGFYVQPTILADVTPGMQVVREE
FT                   IFGPVLVATPFDDLDEAVRLANDSIYGLGASIWSNDLRQVMDLVPRIKAGTVWVNAHNL
FT                   LDPSMPFGGFKQSGIGREMGHAAIEAYTENKSVCIAY"
FT   CDS_pept        986820..988310
FT                   /transl_table=11
FT                   /locus_tag="PLES_09041"
FT                   /product="probable amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09041"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25631"
FT                   /protein_id="CAW25631.1"
FT                   /translation="MSNSRLTQHLLRGRVGFPTALASSVGLIMASPVILTATTGFGLGG
FT                   GTFAVAMLVALLLMLAQSTTFAEAACLLPTRGSVYDYLSCGLGRFFAITGTLSAYLIVH
FT                   VFAGTAETMLSGTMALVNFESLNTLTEPGGGAWLVGVGMVLCFGLLNALGITAFGRAEV
FT                   ILTFGMWSTLMIFAVTGLLRLPAVELQGWFGASMVGNDLPTLLSLVGMAMFMFVGCEFV
FT                   TPLTPEVRHASRTLPRAMALGLIGVACCMFLYGAAMRRQVENLDLGGGLHLLETPMAIP
FT                   RFAEQVMGPFGRIWLGVGLLFAGAATINTLMAGLPRILYGMALDGALPKAFTYLHPRFK
FT                   TPLLCIAVAAAIPCLHAWWLGGDSEGIIHLVLAAVCAWGTAYLLVTLSVVLLRIRRPDL
FT                   PRAYRSPLFPLPQLFSSVGILLGMFYITPPGMNPADIYLPFALMLGLAAAYALFWTLCV
FT                   QRVNPFRPLAVEEVLEKEFAEEDQQQRERAHVRLGALV"
FT   CDS_pept        988285..988863
FT                   /transl_table=11
FT                   /locus_tag="PLES_09051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09051"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25632"
FT                   /protein_id="CAW25632.1"
FT                   /translation="MSAWARWYERHWRDWRPAAYRPGATLALVRRNLAACDGEAQDGRL
FT                   LLRTKELSLEVRERVQAHLFMHIVSTEFSLFVAAPGGPPASLELRHAGCLRRRGILCKV
FT                   RSGSGLEPLREALQGGDRVLLEQLMPLDFRSLRLCRDDRGWTVNLEHLGACEVVNRFPA
FT                   YRRYIPLVAEQRLALLGAFAQLQRLLSPA"
FT   CDS_pept        989024..989974
FT                   /transl_table=11
FT                   /locus_tag="PLES_09061"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09061"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25633"
FT                   /protein_id="CAW25633.1"
FT                   /translation="MHTLSSAHNSFEAWNQALRQVCGRFESQPALNRTLFIGDISRQDL
FT                   GGLELAQIRTNAGRIARQATHADHDDDRHCFLVVQRSGHAQLRQGGDSIELAPGEMALM
FT                   DSAGGCEIIPHGLIEHTSFHLSREEVCRHLPPSQRAFGKLSPNCASGRLLSLLVQQVCA
FT                   GELQPWAVADEGGALQEALIALLGPALQHAGEELEGPLAGLYGYSLRRHAERLIEQSLQ
FT                   EPRLSPDMLAGRLRISVRQLYRLFEEQGDSVCRYILRQRLSRSAADLGNPRLRGESITS
FT                   IAFKWGFSDSAHFSRAFKKQFEVSPKDYRAGALPA"
FT   CDS_pept        990243..991127
FT                   /transl_table=11
FT                   /locus_tag="PLES_09071"
FT                   /product="putative dTDP-4-rhamnose reductase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09071"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25634"
FT                   /protein_id="CAW25634.1"
FT                   /translation="MRMRLMLLGGGNALGQALIRLGAEEDIGFLAPRPPEQGWDAASLT
FT                   TLLDETRPDAVINLAFYHDWFQAEQVEAERLGAQERAVERLAELCQHYEILLVQPSSYR
FT                   VFDGARATAYSEKDETLPLGLRGQALWRMEQSVRAACPRHVLIRFGWLLDESPNGLLGR
FT                   FLSRAEQPQPLFLADDRRGNPTPVDDAARVVLSVLKQLDCQAPLWGTYHYGGLEATTTL
FT                   ALGQVILNEARTYRSNLIQEPSAEAHAARPDALDEPQHAVMVCKKILHTFGIKPRAWRA
FT                   GLPALLDRYYRHV"
FT   CDS_pept        991120..992049
FT                   /transl_table=11
FT                   /locus_tag="PLES_09081"
FT                   /product="probable epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09081"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25635"
FT                   /protein_id="CAW25635.1"
FT                   /translation="MFERPILITGGAGFIGSHLTDALLARGYRVRVLDNLSTGKRDNLP
FT                   LDDERVELLEGDAADAATLAAALKGCAAVAHLAAVASVQASVDDPVATHQSNFIATLNL
FT                   CEAMREQGVKRVVFASSAAVYGQNGEGTAIDEDTPKSPLTPYASDKLASEYYLDFYRRQ
FT                   HGLEPAIFRFFNVYGPRQDPSSPYSGVISIFTERALKGTPITVFGDGEQTRDFIYVADL
FT                   VDFLVQALEATAVEPGAVNVGLNRSISLKQLLAEIGQVLGGLPPVTHADARAGDIRHSR
FT                   ANNERLLRRFRFDQPTPMGVGLARLLGR"
FT   CDS_pept        complement(992050..992406)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09091"
FT                   /product="conserved hypothetical protein"
FT                   /note="orf01324"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09091"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25636"
FT                   /protein_id="CAW25636.1"
FT                   /translation="MYLWLKTLHITFALSSAALFVWRLAWNWSGRKASGIRRWGAHLVD
FT                   TLLLLSALGLVHLAMPWPLPLWLLAKLGLLLGYIVCAAFALRMARGPGKGLLSVLSLTL
FT                   LGGIFYLALNKPWW"
FT   CDS_pept        complement(992490..993188)
FT                   /transl_table=11
FT                   /gene="oprG"
FT                   /locus_tag="PLES_09101"
FT                   /product="Outer membrane protein OprG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09101"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25637"
FT                   /protein_id="CAW25637.1"
FT                   /translation="MRKSWLTASLLALTVASPFAAADIQGHKAGDFIIRGGFATVDPDD
FT                   SSSDIKLDGAKQRGTKATVDSDTQLGLTFTYMFADKWGVELVAATPFNHQVDVKGLGPG
FT                   LDGKLADIKQLPPTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKAQGFSSM
FT                   KLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALGVNKTKVDVDVDPW
FT                   VYMIGFGYKF"
FT   CDS_pept        complement(993336..993854)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09111"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09111"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25638"
FT                   /protein_id="CAW25638.1"
FT                   /translation="MLRSLTVLLLAFALLLGSAVARAAPRELTWSQLIPAGAPPAPAPL
FT                   PIHDLANALSEAGPAASQQSPNAPVVKALDGIEAKLPGYIVPLEISEAGLVTEFLLVPY
FT                   YGACIHVPPPPSNQIVYVKTAKGVQMDELYQPFWVEGTFKVENASSELAAAGYRMQASK
FT                   VTPYEYEGG"
FT   CDS_pept        complement(993872..995137)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09121"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09121"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25639"
FT                   /protein_id="CAW25639.1"
FT                   /translation="MYLFRLALASLANRRFTALLTIFAIALSACLLLAVERVRTEAKAS
FT                   FASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSYRHFAENPRVKWAIPISLG
FT                   DSHRGYRVMGTDAGYFEHYRYGRGQELQLAEGRAFGQDLFDVVLGAEVAEALHYRLGEK
FT                   IVLAHGVSTVSLVKHDDKPFTVVGILQRTGTPVDRTLHISLAGMEALHVDWRNGVPAMG
FT                   AGRVSAEQARHMDLQPQAITAFLVGLKSKVATFALQREVNDYPGEPLMAILPGVALQEL
FT                   WGLMGTAEKALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWHIFGLLL
FT                   AEAFSLALAGVALGLGLLYLGIAASQGYVQANYGIYLPLAWPSDYEWSLLGAILAAAVL
FT                   IGCVPAWRAYRQSLADGLSIRL"
FT   CDS_pept        complement(995140..995844)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09131"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09131"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25640"
FT                   /protein_id="CAW25640.1"
FT                   /translation="MSALITLTNLGFAWPGQAELLDIPSFHLERGESLFLKGPSGSGKT
FT                   TLLGLLGGVQKPGRGSIRLLGEDLEKLSAARRDHFRVDHTGYIFQQFNLLPFLSVRENV
FT                   ELPCHFSALRRQRARERHGSPAQAASHLLGQLGLGGELHERRADSLSIGQQQRVAAARA
FT                   LIGQPELVIADEPTSALDADSREAFLQLLFAECREAGASLLFVSHDQSLAGLFDRSLSL
FT                   SDLNRAARPAGL"
FT   CDS_pept        complement(995933..996505)
FT                   /transl_table=11
FT                   /locus_tag="PLES_09141"
FT                   /product="hypothetical protein"
FT                   /note="orf01330"
FT                   /db_xref="EnsemblGenomes-Gn:PLES_09141"
FT                   /db_xref="EnsemblGenomes-Tr:CAW25641"
FT                   /protein_id="CAW25641.1"
FT                   /translation="MRPLLLALVLLPFAAQAHDDHDHDHAHGSLGKHEHGVAQLNVALD
FT                   GKTLELELDSPAMNLVGFEHAASTDADKAAVAKARAQLEKPLELFALPVTAGCSVASQE
FT                   LRSPLFGDKAPAHAHKEKAGHEHEHGHADIHAHYQLSCEKPELLKLLTLAEFFKRFPAT
FT                   QKIQVQLIGPDGQKGADLAPASAELKL"
FT   CDS_pept        996638..996994
FT                   /transl_