(data stored in ACNUC1104 zone)

EMBL: FM211047

ID   FM211047; SV 1; linear; genomic DNA; STD; PRO; 123991 BP.
XX
AC   FM211047;
XX
PR   Project:PRJEA31267;
XX
DT   01-NOV-2008 (Rel. 97, Created)
DT   01-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 BAC clone 5
XX
KW   .
XX
OS   Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Morganellaceae; Photorhabdus.
XX
RN   [1]
RP   1-123991
RA   Thomson N.R.;
RT   ;
RL   Submitted (12-SEP-2008) to the INSDC.
RL   Thomson N.R., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1073/pnas.0711114105.
RX   PUBMED; 18838673.
RA   Waterfield N.R., Sanchez-Contreras M., Eleftherianos I., Dowling A.,
RA   Wilkinson P., Parkhill J., Thomson N., Reynolds S.E., Bode H.B., Dorus S.,
RA   Ffrench-Constant R.H.;
RT   "Rapid Virulence Annotation (RVA): identification of virulence factors
RT   using a bacterial genome library and multiple invertebrate hosts";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(41):15967-15972(2008).
XX
DR   MD5; 001e133d75afaedf275a3f5745c5eb45.
DR   EuropePMC; PMC2572985; 18838673.
DR   StrainInfo; 113360; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..123991
FT                   /organism="Photorhabdus asymbiotica subsp. asymbiotica ATCC
FT                   43949"
FT                   /sub_species="asymbiotica"
FT                   /strain="ATCC 43949"
FT                   /mol_type="genomic DNA"
FT                   /note="Genomic BAC clones"
FT                   /db_xref="taxon:553480"
FT                   /culture_collection="ATCC:43949"
FT   CDS_pept        <1..50
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3167"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKT9"
FT                   /protein_id="CAR66769.1"
FT                   /translation="EGNAILYLMTKELHL"
FT   CDS_pept        47..3412
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3168"
FT                   /product="similar to putative membrane protein of y.
FT                   pestis"
FT                   /db_xref="GOA:B6VKU0"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU0"
FT                   /protein_id="CAR66770.1"
FT                   /translation="MKANHYHHGLWGYVFITLSLAGVFFLLIYLNQTLLAEKGLLELAW
FT                   YAGAVVSLVILTGLLGSKIWEHIWQNKAQQKFRPETQQAKIIPSQSALILSELGARLHR
FT                   RYGRFWWFKVRILLVMGEGEQVEAIAPGLTAGHWLEGHRTLLVYGGSVQSEPDAAQLAA
FT                   LRRLRRFRPLNGVVWALTETQSAQPVLMDKALRMLQKQAQQLRWQAPVYLWQVCHSVWS
FT                   QEDRVTQPVGCFFPERTTPEAVAAQLQRLIDPMRRQGMQQLLAKNAHDFLYRLSSTLEK
FT                   QGMAHWRDVLTPVLQEYADVVLLRGLMFSLPVRVNQDGAPQSWLPDPVWQGVLSDCRQA
FT                   PGRRLGWVQKRQVYHGLMALALLWGAGMVLSFFSNRDQIMVVQAAVADLKTHPAASGAE
FT                   LMALNTLRNEVGRLQSRVEHGAPWYQRFGLNQNETLLARVMPDYTEVNNRLIRDKAAAV
FT                   LQAKLRALVNLPPNSPLWANRATAGHDLLKAYLMMARPEKAEGAFLTRILSENEPARAG
FT                   IASGIWLSAVPDLWDFYAHNLAAHPAWKITPDTDLIRQVRQKLLTQLSRHNADATLYQQ
FT                   MLQSVAKDYADLTLRQMTGDTEAARLFTTDKVVPGMFTRQAWEGQIQTAIDKAVASRRE
FT                   AIDWVLSDRHQTVPAAVSPAELKARLTERYFTDFAGAWQTFLNSLRWNTAQSLSAVVDQ
FT                   LTLMADARQSPLIALMNTVAYQGQTGQQGATLSDSLVKSAKALWNKKTPPGIVPQAAGT
FT                   PGPMEATFGPLRALMGDSQTDGGMKADSSLNLQTFLTRVTQVRLTLQQMNTSDDPPAMA
FT                   NTLARAVFTGKSTALTETQGYGRLIAASLGEQWQGLGQTLFVQPLTQAWQGVLNPAAAN
FT                   LNTQWQTAIVDSWNRAFAGRYPFAGGESEVSLPMLGQFIRSDSGRIEQFLNRQLGGILH
FT                   KAGNRWRVDEVNSQGLRINPRFLQAVNQLSQLSDVLFADGSQGLRFELRARAVRDVAET
FT                   DLTIDGQPLRYFNQMESWQRFRWPGETYRPGVMLSWTSVNAGSRLFGDYQGNWGLIRWL
FT                   AQAKVERLDESRYQLTFMAPDGLPLRWILRTEMGSGPLALLKLRGFQLPKAIFEVAPGQ
FT                   ERPAETTDEDWAAE"
FT   misc_feature    join(71..130,173..241,1103..1171)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PA-RVA5-3168 by TMHMM2.0 at aa 9-28, 43-65 and 353-375"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   misc_feature    1253..2203
FT                   /inference="protein motif:HMMPfam:PF06761"
FT   misc_feature    2543..2932
FT                   /inference="protein motif:HMMPfam:PF06744"
FT   CDS_pept        4466..6991
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3169"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU1"
FT                   /protein_id="CAR66771.1"
FT                   /translation="MTVSTPALIFEHNRYKLDVRKNTAPLDILAFTGREALSQPFCYTI
FT                   EFTSPVKTIEPGQMLMHKAAFTLHSPRVNPGIRGMPIIPPMPLRTLYGVISRFRLLSTS
FT                   HDESRYEVTLVPRLALLANSHQSAIYQNMSVPEIVEKILRERHGFRGQDFLFTLARTYP
FT                   KREQVMQYGEDDLRFVQRLLAEVGIWYKLTADERLKIDVVEFYDKQRHYQFNVYLPALD
FT                   PSGMHGRDTDAVWGMETAHQVVEGKIQTRDYNYRDALPQYGMDVEADVTRGDPTVYGEA
FT                   YHYINNYQALGNRYALEPEAESGVFYARLHHERYLNQQTRLRGLTSSPTLVPGQELKVQ
FT                   GEAPDVFRRGVIITEITSSARRDESFVMAFTAIPYSETVCFRPAFIPKPVMAGTLPARV
FT                   SSTTVNDAYGDIDKDGLYRVSFDFDRATWPQGGESLWVRLARPYAGDTYGFHWPLLIGT
FT                   EVAIAFEGGDPDRPYIAHALHDSKHPDPVTLYNYKRNVLRTPANNKLRMDDERGKEHIK
FT                   LSTEYGGKSQLNLGHLVDSQRPHPNKRGEGFELRTDDWGAIRAGKGLFISADKQAAAGG
FT                   PVLEMQVAISQLQQAQALTEALRGAAETAQAELADLQHQKALLNDTLTELKKSALLLSA
FT                   PEGIAQTTAKSLQLSAGDNVIATSGKNTDFSVLKKFTVAAGGMISLFAEKLGIKLFASR
FT                   GRVEIQAQGDAMGLEALKDITVSSHEGKVIISAKQEILLACGGGYIRIGNGQVECGAPA
FT                   HIIQRAGEWQKFGGQRTSQLVQQWQTTSYSVTPKVAQAYNISPLARQNMQFHTGDGGVQ
FT                   ELSTAQDGKSALQKQIGVEISKLKIKDEE"
FT   misc_feature    5660..5887
FT                   /inference="protein motif:HMMPfam:PF04524"
FT   CDS_pept        6995..8605
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3170"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="GOA:B6VKU2"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU2"
FT                   /protein_id="CAR66772.1"
FT                   /translation="MSEPKENEIYIHPEYDELGSPYYNVPNARTEENLIATCLKYATKV
FT                   IPVIFLPGVMGSNLKSKQGESVWLLNRILSFDVLAWTCRGASYRKKTLDPNKTEVDDSG
FT                   AITPDHTEKNKFQTCSQRGWGEIAHISYGTFLPWLQSVLDDERLAFEYCLAGQGQQTLR
FT                   QRMVDMNLNAEWGEEPLTRPEVDHSYNFVYPVHVMGYNWLQSNVDSAKRLAKYVDKVLA
FT                   FYGRRCATNKVILVTHSMGGLVARHYSEQLNGRDKILGIVHGVMPDTGAPTTYKRMKTG
FT                   EDGITGLVIGSNGAEMTAVMAQSPGPLQLLPGMKYGKRWLHIADGKIMHKLPESDPYKE
FT                   IYLEKERWWGLCETRFLNPDKQDKWKDNESWEKYSAIIQNEVQQFIEELTGNYHSNTYA
FT                   FYGASEKHLSYGVISWQEQDNGNYDKTEDYSGMTFNQPVYDPIDLKTGSTRIVRFSVGP
FT                   LFRDIHDKTFKLAPPREQGDGTVPIQAGRITYNGLRGLLATEVDHEGAYKENNGTKETP
FT                   ARLFTLRSIVKMVQAVKIG"
FT   CDS_pept        8598..9716
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3171"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR040761"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU3"
FT                   /protein_id="CAR66773.1"
FT                   /translation="MDKKKCLLILFAIVAIYALWRWYFPVYDHPVLTEKEKKVTTEMLA
FT                   NMQTRCVGRYLIDLPAGFDNIVHDGISIGDARIETERLYPPEFEHRIRLREQELKTMQY
FT                   VNPKNMPFLKKVYRLQGDLNGVIFDRNQDTSVPGYARVLEAHFYNNGVAFTITMKFMEL
FT                   IDDKYSYQREGFIKAGFSERDLNTKDRTMMKMRDLLSRISGRKETEIPKVAGTCIPDGF
FT                   IAGSDNEKEDITFVYQRNKDDHFNFSIEILNDLQEKDHLLDRLKGMEGILLAMHAKVIR
FT                   KGKREINGTYTEEVLTTAPVETNLEPGTKMPGYAFSLIANETAGDYKNPFVNIDLKNDR
FT                   ISATPYSENELIAFWDAVTSTFRKRPGAFDSR"
FT   misc_feature    8616..8669
FT                   /note="1 probable transmembrane helix predicted for
FT                   PA-RVA5-3171 by TMHMM2.0 at aa 7-24"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   CDS_pept        complement(10706..10996)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3172"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU4"
FT                   /protein_id="CAR66774.1"
FT                   /translation="MRYYTVVYWKNLYIKNSLVNTGLYLSALKMIRETDVDFNTIIILV
FT                   VIRSGFKSKKQIQKNEKTRLMKMGKLNTGLKTGKTIRLKKISMKIICYINV"
FT   CDS_pept        complement(10993..12156)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3173"
FT                   /product="Conserved Hypothetical Protein"
FT                   /EC_number="4.1.1.2"
FT                   /note="similar to oxalate decarboxylase oxdc protein of
FT                   bacillus subtilis"
FT                   /db_xref="GOA:B6VKU5"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017774"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU5"
FT                   /protein_id="CAR66775.1"
FT                   /translation="MFSRRDILKASAIGAAASIGSMIKSAVADEQHNTVTTGNNKPPPA
FT                   AKSLYKYKFTDSEKRIFEYGWAREATVEQFPISEGIAGVDMTLEPGGVRELHWHAIAAE
FT                   WAYMLEGHARITIIDPEGKSEVADFGPGDVWYFPKGHGHSIQALEGGAHFILTFDDGHF
FT                   SEFGTFSITDWITHTPKEVLEKSVNMPAKVFSKIKPGEAYIVGGAIPPKLPLPVDDGGL
FT                   NDAPLTHRYQLLKNKPFFENDAGIIYRASSKEFPISTTITGLIEIVKPGAIRELHWHPN
FT                   ANEWQYYISGKGRMTVFSSHGHAQTSKFGPTDVGYVPQGFGHYIENIGKDDLKVLVVLD
FT                   NGIYQDISLSDWFAKTPSYLLADNFSNQISDWADRPKDKLVISRRRT"
FT   misc_feature    complement(11056..11466)
FT                   /inference="protein motif:HMMPfam:PF00190"
FT   misc_feature    complement(11140..11367)
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   misc_feature    complement(11572..12000)
FT                   /inference="protein motif:HMMPfam:PF00190"
FT   misc_feature    complement(11668..11895)
FT                   /inference="protein motif:HMMPfam:PF05899"
FT   misc_feature    complement(11683..11907)
FT                   /inference="protein motif:HMMPfam:PF07883"
FT   misc_feature    complement(12073..12156)
FT                   /note="Signal peptide predicted for PA-RVA5-3173 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.998) with cleavage
FT                   site probability 0.982 between residues 28 and 29"
FT   CDS_pept        complement(12487..15423)
FT                   /transl_table=11
FT                   /gene="ybtE"
FT                   /locus_tag="PA-RVA5-3174"
FT                   /product="yersiniabactin siderophore biosynthetic protein
FT                   (ec 6.3.2.-)"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="GOA:B6VKU6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019996"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU6"
FT                   /protein_id="CAR66776.1"
FT                   /translation="MAPFSIPGKTLTMTPDYLWNGKTLDQQLAGWSGIWGNKTALIYQE
FT                   QQLTYRELHQSAERLASGLFHRGVRRGDNVMVQLPNRISFVVTCFALFRLGAHPVLLMP
FT                   TQRAHDIHALCQIARPVAYIIPDCIHGFDYREMAREVAASCPDLKHIIVDGEAEEFTAL
FT                   ASIDDKPLNITGPTYGDIAVLLLSGGTTGTPKLIPRTHDAYTYDFVLSARLCAVNTESV
FT                   YLAVLPVAHNFTLGSPGILGTLSQGGCVLLSDTASCDEAMPLIEQHKVTHLALVPALAR
FT                   LWEQARDWEQSDLSSLRCLQVGGGRLTPELAELVMTRLGPLQQVFGTAEGLLCYTRLDD
FT                   PYEVIINTQGRPLSEEDEIKIVDANLQPVALGEVGELITRGPYTITGYYRAGQHNAVAF
FT                   TTDGFYRTGDLVRMNSDGNLIVEGRIKEQINRSGEKISTQEVETLLLQHPDIDDVVVIA
FT                   VPDELLGERICACLLKSGNQPESAQMQAFLHQKGVQRHKIPDQWLSVAYWPLTTVGKID
FT                   KRQLVQIAQTEHGNSMQQYHERTIAITSTPLDLITHLLSDDNDSQPCTLYETKGEWSLG
FT                   MGCAATISADASGQLIDSQGNHHPYNINTLSQKLEQALNALPIKDWRAYGRTLFEFSHM
FT                   TYGLPLAQQNEALIKITVPQHELRITQGQVLIRTLEEDQIATLSEKIRQADQSGTPAFP
FT                   YTKEIEIINPVTAAKNYQDNVANAVKDIAAGHYQKVILSRKVELGSNIDMTHSYWLGRQ
FT                   ANTPARSFFLRDEDFSAYGFSPETVVEADGSGWVSTQPLAGTRALTHDKEQDQRLRADL
FT                   LSDPKEISEHAVSAKLALEELAPICQIETLCVSEFMAIRERGSVQHLASRVKGLLQTDK
FT                   NRWDAFIALFPAVTASGIPKKPSLQAISRYEGEPRQLYSGCVMLLDSAGKLDAALVLRS
FT                   LYQHKGRCWLQAGAGLVRDSKPEREWLETCEKLDCIIKYVRPYSDKQD"
FT   misc_feature    complement(12514..13305)
FT                   /inference="protein motif:HMMPfam:PF00425"
FT   misc_feature    complement(14056..15279)
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   CDS_pept        complement(15423..16229)
FT                   /transl_table=11
FT                   /gene="irp4"
FT                   /locus_tag="PA-RVA5-3175"
FT                   /product="yersiniabactin synthetase, thioesterase
FT                   component"
FT                   /db_xref="GOA:B6VKU7"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU7"
FT                   /protein_id="CAR66777.1"
FT                   /translation="MMTWVLPTHPMIRPCLTTHGKPKYTLLICPFAGGSSSAFRQWSTL
FT                   ENSDIAASLVIYPGHDSRMNERATTRIEPLAQSLADLIVSFTPAQRENLILVGHSMGAQ
FT                   VAFETCQRLEQHNCSLKALVLSGCHAPHLQPRRQLSGLPDHEFIEQLIDIGGCSPMLRE
FT                   DPGLLALFLPMLRADFFATEHYHHVIQPDSVKLQTPTLLLYGNEDKEASAMEVQQWHHW
FT                   LAGNTQNLSYCCQEVTGDHFYITQDPQSFIRHVTQFIQYVYLQEFA"
FT   misc_feature    complement(15453..16160)
FT                   /inference="protein motif:HMMPfam:PF00975"
FT   CDS_pept        complement(16229..17323)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3176"
FT                   /product="similar to irp3 protein of yersinia
FT                   enterocolitica"
FT                   /db_xref="GOA:B6VKU8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR010091"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU8"
FT                   /protein_id="CAR66778.1"
FT                   /translation="MIKPRRVLIVGSKFGELYLNAFLQPRPGLELAGILAQGSTRSQQL
FT                   ARDFNVPLFHSLDELPDDIDIACVVIRAEIIGGKGDQLTQALLARGISVIQEHPLDAEA
FT                   IKRHQSTANKHDAMFWVNSFYSQCHAGRSWLHAAQQINQLSQQRPVSGYLTTSRQLLFS
FT                   ALDLLLQACHCPEHMEIVYVGQRSNAFHCFELSFADTTITLNVQSYLDPRDPDMHNLVM
FT                   HKMTLIWPAGYLTQEASYGPVIWTPVLHAPNHLNNEQSLYLNASQPDGAYLHQTTSQIL
FT                   CPATKNWMTAFECDGAEGVAFLLNTLSSVLTGALRPTAFAYDYQLRLADLWQQILRIMG
FT                   EPVTQDLSPPVWIDPAQLMLTKEK"
FT   misc_feature    complement(16955..17311)
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   CDS_pept        complement(17320..29073)
FT                   /transl_table=11
FT                   /gene="irp1/HMWP1"
FT                   /locus_tag="PA-RVA5-3177"
FT                   /product="putative peptide/polyketide synthetase"
FT                   /db_xref="GOA:B6VKU9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKU9"
FT                   /protein_id="CAR66779.1"
FT                   /translation="MTDLTPHYDNCDPIAVIGLACRFPQASDSNAFWHNLQHGVECTAT
FT                   LSRQTLLDAGIPPEVIDSENFVSQAAILENAEQFDATLFGYSRQEAEMLDPQQRLFLQT
FT                   AWHALEHAGYAPRNVHLKTGVFGSSRVSTWPSWSQFTMTDVGKVKGLQALISNDKDYLA
FT                   TRTAYKLNLKGPALTVQTACSSSLVAVHMACENLRAGECDMALAGGVAVSFPQESGYLY
FT                   QPGMIFSPDGHCRPFDSQANGTYGGNGVGVVTLKRLSDALRDGDPIMAVLRGSAINNDG
FT                   NEKVGFTAPSVNGQLSVITEALQLADVSIDDVGMIEAHGTGTPLGDPIEVDALRNIFAE
FT                   RSVAVPPCYLGSVKSNIGHLDTAAGIASLIKAVLSVWHGYIPPTINVEQPNPALRLEQS
FT                   PFKLATQGQRWTQKLRTAGVSSFGIGGTNCHIVVQSLPEELHRRRAHNPQASPLLLSAA
FT                   SESSLRQLAQRYATALHDAPEHHADLAWTALQGRDLSLPWRLALTLTPQSAESLSAFAN
FT                   TPFANNSPTPNIFSGQVNSESKQLWQFSGQGCQWPGMGEAMYASSPVFAAMLDRCCAAC
FT                   TSELALPLKAVMFGEHDAALATTEYAQPAIVAHQIALAAHWQALGLKPDYVLGHSVGEF
FT                   AAAVVAGIFTPEQVMPLVAVRGKLMQKCSQGGAMLAIFANEEDILPFTHSLALDLAVCN
FT                   GPQHWVWAGTEAEIDILAQRLEQQQIHCQRLNVACAAHSAMLDSVLDTFSQRCNGLQPT
FT                   LGEIPLISTLTANIATSEQLGSPDYWRNHMRQTVRYYQAVEFARQQGVALFVEFGADAQ
FT                   LTGIGRRFRLPQETWIAGAQRQSSPETAQQTALMQLYCAGVHLDWQHLFPITGVKCHAP
FT                   LYPFDEQHYSFPAAKSVPHSANVNTGLDVNFLLDPAIEQNSDATILRALYTDALVYQCH
FT                   GRDAEQGFSAIDTIRAGRLQPCWHPLLEQLLTYCVQQGYYREASGPTASKMYRPDSALP
FT                   YAKRRSLEARLLAAFPALIYAGERLFALLSDRADLPRQTVAARSMTKHAMTKSWLPVPQ
FT                   PCPETHYVLHWRTINTADKPRSSTAYTLRSSTANDEMIHHWRQAGINLQPESGNTLLLL
FT                   EGHDVVKLCDQVISALKCDETAPLTVITCCAQPETTLSKEDINPAQYAVWALLRVAVEE
FT                   YPHRHIQAIDIADINDADSLSLALGYLNKHNHEHQRWLKVRGNQISVPVLQRQPLPLSQ
FT                   QPMSIPREGWHIVTGGMGGIGQISIRWLLAQGARKIAVFARRQNADWAAFVQELSLSTE
FT                   CEIRWINVDVTDTSALLKAIQTLAQEDRIAGVIHAAGVADHTRLAELEPPRLSQMLSVK
FT                   AQSASTLQTALVQHNAQYLLLHASAASMLGAQGQGAYAIANACLESLALTAPNQLIVKT
FT                   LVWGVWGGIGMARDRRLVEKLAQDGMLPFSINEGIWHFNQSLRTASPCYLAMRLDEHHP
FT                   DILRRLQAGITTTTPTLSHSADNTLYQDKEERLNWLRQRVATLLRLEQPEHLAPQQDLL
FT                   QFGLDSLLFLELNAVIHQQFGFRLTAGLAYQNMTLAGLNALIGDALPEQPIVSVQPEIM
FT                   IDNSQRHAPFPLTPIQHAYWIGRTQAIDFGGVACHVLFEWDLALDSFDIPRFEKAWNAL
FT                   IQRHGMLRMVVDEDGQQRILPETPWYALSQDDLRTLDDTACEQALAQRRHTLSYHVPPA
FT                   EQWPLFEVSISLLPNERCRLHMNLDLLQFDVQSFRIMMDDLQLAYRQQPLAPQAFTFRD
FT                   YVMAEQAQRESKEWRASWAYWQEQLLSLPPAPRLPLNPQLPQRGQPQFTTYEGRLVESD
FT                   WQRLKQSWKKWGVTPSAGLLTLFAHTLEWYSRHPLFTLNLTFFNRQPFHPEVQDLIGDF
FT                   TSVMLMDFDLRKTTSLRVSMEKTQALLWQRLSHNHVNGVEVLRELGRQQNGEAQSRQPL
FT                   TPVVFTSMLGMAQEGVAIKQSITQLLGDPVFVLSQTPQVWLDHQVMEVDGDLLFNWYCM
FT                   DDVLEPGVIEALFAAYNALLVQICRQPERIEHYDLRTPPSGHLRYDFWPQHPELRQAEQ
FT                   NLRAKPEIRLAEIQPRQDETQGYNLWLVAEDNLSLSLPEPRVINTDVLPLPALTEQQAF
FT                   ERSWQHIEQQALLGLGQTLLRHNLFTSPQQSHSREEIEQRLQLAPQYQRLLTQWLTLLN
FT                   KQGFIEKTADGYRCLQPLSHIPAPTTKLDDAVWCQTISRYVATCIGQHDTLLAGKGNAL
FT                   ELLFADKQTTASLYSENPALRCLNQTAAEIVRQLSQTSEHFTVLEVGAGTGATSAKVLA
FT                   HNAQVIENYHFTDVSPLFLDDARQLLNHYGETVKFALFDINQRIDFSQHPESGYDLIMA
FT                   VNVLHDAVHLKNTLQRLSRLLKPGGWLLIIESTKRESAMQLASVGFIEGINAWTDDRGD
FT                   SALLELADWRQCLEKSGYRVSLEWPGQDGPELHQQLILARTEQQARLNVREIAAQFSTL
FT                   PYSLHIQQQEQLPLPVTTKESMVQTLTTETGQPETEDEQLHDIEQQVIALWSSLLPQPI
FT                   KRQSDFFQSGGDSLIATRMVVQLRRQGYEQANLQQLFEHPKLNEFCRTLRVVETNSAPR
FT                   ATPDQAKEPASEQTLPLTALQYAYWLGESQLFQFGNGIAHFYAELAINGLDLPRFTTAW
FT                   NRVINHHGQLRGYVKDGQYHILPDIPCYTPTVIDCRNMMPNERETQLDDARDTLRTQGV
FT                   PSDNWPLFDLTLYHTDDRTHLLHLTIDLLVADGKSLTLILRDLHHWYQEPNWQPEPPVA
FT                   TIGDYIQALENEKTGEAWQQSRQYWLDRLPSLPDAPVLPLKDHQSQQLDQQCLTGYISP
FT                   QQWQRLQQRAAEHRVSPSQVMLTLFAHILSVWSNSEHFTINVLHGNRLLMPQHCDTLVG
FT                   NLSTTSLLEVDLRNITGFGDAVSRIQRQWLADLQHALFDGQLVLREKNQHRHNLNAGMP
FT                   IVFNDTTGTAGKGPSGLGMLNLFGAQTPHVYLDCMLISSADGGVTLQWAILPQLFQPQV
FT                   AENMFAHYQASIVALLEPDYPWNAPLPDWLPASDRTLCQNSNATKNVFPPHTLCSLLEQ
FT                   AVNRYPQHTAVVDTSRQLDYRTLWSQSLTLAAHLQAQENQTSSLIGVVMEKGWEQVVAV
FT                   IAILLAGRAYLPIDASYPQQRIHQLLASGEVDTVLTQPKFAQQMSWPDNVQVISLDETL
FT                   LNRLPVNPGVQSLSARPEDLAYVIFTSGSTGKPKGVMIDHQGAVNTILDINQRIALNEH
FT                   DSVLAISELTFDLSVYDLFGTLSCGAKLVIPSPGDSRQPDKLLTWLQQESVTVWNSVPA
FT                   FVQLLEEYARSYPHSLDSLRWILMSGDWIPTHLPAKLYALHPELNLLSLGGATEASIWS
FT                   IAYPIAHIDPNWRSIPYGKPLANQTFYVLNSALSPCPVWVTGELYIGGQGLALGYWADS
FT                   EKTEHAFITHPQTGERLYRTGDLGRWRPDGNIEFLGRNDHQIKIRGYRIELGEIEHRLC
FT                   EHPEIQQALVFAHTTSTGALQLVAGLRLTDNAPVSTELLPVLPHWLQQTLPVWMCPQRF
FT                   ITLDTIPVSDNGKIDRRTLVTLIETAQEVNSTPSAVTLNATGQAVLSLWESVLEQQGIN
FT                   VHESFFTLGGDSLAAVRLMVKINQTFNRQYPLSLLQTYDTVHSLAEFIEHQPENACQSV
FT                   ILNKGNVEQPALFIVHPIGGHLLGYRHLAANFSTQRMIGLAFAPDSLNTDKPSVAALAA
FT                   DYINQIRSFQPKGPYTLAGWSFGGLVAYEMAHQLRAAGESVSHCILIDSFAPNVRTDLT
FT                   LDDAFCHRHFLLDLQGQFPGLVLDNRVIAANTETFLQALHEALPQSAQIDSSLTALYSV
FT                   WRHNLSALLDYCPPRTSQPFCLIRAVQALPDFMDYLDPTTITSRDLGWQTFGPVNVTPL
FT                   DGDHYSLFQHKHVGSLVSCLKDILNSVPTIEPVKENI"
FT   misc_feature    complement(17362..18114)
FT                   /inference="protein motif:HMMPfam:PF00975"
FT   misc_feature    complement(18175..18369)
FT                   /inference="protein motif:HMMPfam:PF00550"
FT   misc_feature    complement(18643..19857)
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    complement(20179..20340)
FT                   /inference="protein motif:HMMPfam:PF08415"
FT   misc_feature    complement(20404..21297)
FT                   /inference="protein motif:HMMPfam:PF00668"
FT   misc_feature    complement(21949..22260)
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   misc_feature    complement(21955..22260)
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   misc_feature    complement(23161..23355)
FT                   /inference="protein motif:HMMPfam:PF08415"
FT   misc_feature    complement(23419..24321)
FT                   /inference="protein motif:HMMPfam:PF00668"
FT   misc_feature    complement(24388..24591)
FT                   /inference="protein motif:HMMPfam:PF00550"
FT   misc_feature    complement(24877..25374)
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    complement(26509..27453)
FT                   /inference="protein motif:HMMPfam:PF00698"
FT   misc_feature    complement(27766..28269)
FT                   /inference="protein motif:HMMPfam:PF02801"
FT   misc_feature    complement(28291..29040)
FT                   /inference="protein motif:HMMPfam:PF00109"
FT   CDS_pept        complement(29070..35165)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3178"
FT                   /product="putative peptide synthetase"
FT                   /note="similar to hmwp2 protein of yersinia enterocolitica"
FT                   /db_xref="GOA:B6VKV0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV0"
FT                   /protein_id="CAR66780.1"
FT                   /translation="MHTDLHSPDSLRQLISDLFNQKNILVDDNDDLIRNGLDSMQIMAL
FT                   LNQFRRQGHRVTLRELYQKPTLHAWSQLLQRHAPVAHTAPKDTTPQPLIVDARPFPLTA
FT                   VQHAYFVGRSPEQTLGGVGCHLYQEFDGVGLEPEQLEAAIHVLIQRHPMLRVRFLSDGR
FT                   QQGMTRVDLKKLTVHDLRNLTTNEQQQALNNLREQLSHRVLQVEEGETFDIQLSLFGDN
FT                   QHRLHANIDLLIMDAASFSLFFTELAALIAKRNLPAICSDYDFCSYLTQYQAQFKQARQ
FT                   EAEVFWRNRLDTLPLAPQLPLARDPSLIKNVHIQRRCFRLAPEHWERFKQLAQQNGVTP
FT                   TMALATAFAALLCRWNNATRLLFNLTLFDRAPLHTAVDNMLADFTNILLLDIPGDNLPF
FT                   CQLAQDAQATFAEAYEHRHWSGVEVLRELKKRGSHPHGAPIVFTSNLGRPLYGENTRDV
FT                   LGKPSWGISQTPQVWLDFVSFEHENSLNIQWDSNDELFPDGLMDTLFTAYQGLIENLTE
FT                   NAAQWNEKLPDLMPESQYHLRRQINNTVEPLPNALLHEGVFIQAERTPNAVALVTHHKK
FT                   MSYGELSLAARQLAAVLQKMPVMPGDRVAISMEKGIGQIVAVLAILYAGGVYVPVPVDQ
FT                   PLNRRRTICESAGINVVIIDPEQQNDDWSQDIHCISWHQDAQLPPLANMSKRAVTDPAY
FT                   IIYTSGSTGMPKGVVISHQSALNTCLDINRRHQVQSHDRLLALSALHFDLSVYDIFGIL
FT                   SAGGALVLINEAQRRDPSTWEMLIAQHNVTLWNSVPALFDMLLTYCEGMEVDAPKALRT
FT                   VMLSGDWIGLSLPERYRAFNPDGVLSAMGGATEAAIWSNEYIVKQVDAQWRSIPYGYPL
FT                   ANQRYRVVGEDGRDCPDWVVGELWIGGAGVALGYFNDEERTSAQFVVDQGERWYRTGDL
FT                   GCYHPAGWLEFMGRRDSQVKIGGYRIELGEIDAALNQVTGISKGVALASGEKEKSLVAF
FT                   LELEGDTLCQRVNRAPQLPISYRDLFPTAQAITDNSHDPQVAIFLLEHLSRHGMTFTAP
FT                   QSLTDCLKHYQPQPEYHDWFGRMLAYLCQCKLLAESTHHVYQAVSPATTFNNEAGCIPE
FT                   RWHSMLRSILTGQQAAVTLLDDPQFAPEQQLFVLPETQQWLAGLKQVIIALSQRLQRPI
FT                   TLMEFDARSGLCAQWLAEHITDQHLSYLGFERSQALINQAQTRLSGYAHASVHHWLEQI
FT                   PESLQHQADIILLNNVLHREGDPANCIKALMPLAQPGALVLAMELQQASSLSLITTELL
FT                   SPHGIQLRSASQWLPLLPLQAETPITIGNLSVLLMQASDNVTLPDREKIKSVLAQHLPG
FT                   YMIPQRLHVIPRLPLTPNGKIDRKVLSQALQSTTKTDVSHQNEMTSLNPVEQTVANLWQ
FT                   RLLNTEQLGRHSDFFQLGGDSLLATRLIGELTQQGFKGELGHLFRNPQLAEFAATLAPL
FT                   SETASETYSIPKEQDEYQPFPLTEVQQAYLVGRHPGFALSGVGAHFFIEYRLEQLDVQR
FT                   LNRVLNRLIQRHPVLRTIVINGQQQVLKDVPMFSVKQHQFTDITQADTLRERLSHQVLD
FT                   ASHWPVFDFQLAQDNSLVSRLFVSLDNLLLDGLSMQILLAELEQLYLNEQYELPPLKVT
FT                   FRDCVLRQQQTPAHQNSLQYWQEQVKTLPLAPQLPLRIAPEDVQSPRFVRYSDRLSAHE
FT                   WNQLKQHAASHQITPSALLIAAYAAVLSAFSARPELTLNLTLFDRPHWHEDINHILGDF
FT                   TSLSLLAWHPEKNWLLSARRLQQQLWQDLDHRHISAIRVMRELAQSRGPDAAIMPVVFT
FT                   SALGTHEGRFLSRSSWMKPVWGISQTPQIWLDHQVYESDNELCLNWDAVEELFEPHQLQ
FT                   NMFNSYMALLRTLAAQPESWHSALEQLMPRQQCTIVGDNAAVVIASSPRSEGLDPQICN
FT                   EIQRLFLSVTNHPINAQQNFFEAGANSLQLIQLHSKLQHAGFHHLAVTDLFAYPTPETL
FT                   SLRCRKDAHDGNRQSITPRQRQQQKRLQQREKRHKGAAQ"
FT   misc_feature    complement(29637..29807)
FT                   /inference="protein motif:HMMPfam:PF08415"
FT   misc_feature    complement(29865..30737)
FT                   /inference="protein motif:HMMPfam:PF00668"
FT   misc_feature    complement(30792..30983)
FT                   /inference="protein motif:HMMPfam:PF00550"
FT   misc_feature    complement(31371..31661)
FT                   /inference="protein motif:HMMPfam:PF08242"
FT   misc_feature    complement(32238..33434)
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    complement(33753..33920)
FT                   /inference="protein motif:HMMPfam:PF08415"
FT   misc_feature    complement(33981..34880)
FT                   /inference="protein motif:HMMPfam:PF00668"
FT   CDS_pept        complement(35218..36969)
FT                   /transl_table=11
FT                   /gene="ybtP"
FT                   /locus_tag="PA-RVA5-3179"
FT                   /product="putative inner membrane abc-transporter"
FT                   /db_xref="GOA:B6VKV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV1"
FT                   /protein_id="CAR66781.1"
FT                   /translation="MGLFNRLQQHLSPKLQRVWFSGLLYKQLDTVAIIAQLAIAAWAFA
FT                   HLEESGNNRLPLIILALLVILLLLRFAFMTRALRKLTIAAYGLGIEIRRSLLQRLVSMS
FT                   VATIRGLSAGKIALTLSEDVQWQENQSAYTTPQIACQVMMLTLIYLALFWFDWVVAGSA
FT                   LLVLMVGMLILGAIRKKLNEILRLRAVMMADASEAIVEYAQGMSFIRAAAATTTVEQRF
FT                   NRKIDQLRVAFRHGVFRSIPLLSLFYIIIDTSVVVGILAGALRFNSPEALTLSEMLITI
FT                   LLLFATITPLRGIIPLLNITALTQVGETHIAEIEAVTTQVSGPLAAPTKYDVEVNNISF
FT                   SYPGTCQPAIQTVSFYAPQGSMTAIVGPSGSGKSTLAYLLLSFYQLDKGEIRLGGNHIH
FT                   HYQTQALYDTVTMVFQETALFQDTVANNLRLGDPNATQLQLEQAARLANIHDTIMALPQ
FT                   GYNTPLGVDGGTLSGGERQRLAIARAILKQSPVLFLDEATASLDPENEQLIQEAFDSLT
FT                   QNKTVFVIAHRLSTITRADQILVMDHGTLCDSGTHDELLQRCPLYQSLWKNHLGSEEHW
FT                   HLHPHKV"
FT   misc_feature    complement(35329..35925)
FT                   /inference="protein motif:HMMPfam:PF02463"
FT   misc_feature    complement(35338..35892)
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(join(36070..36138,36181..36249,36436..36495,
FT                   36505..36558,36748..36807,36835..36903))
FT                   /note="6 probable transmembrane helices predicted for
FT                   PA-RVA5-3179 by TMHMM2.0 at aa 23-45, 55-74,
FT                   138-155,159-178, 241-263 and 278-300"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   CDS_pept        complement(36956..38755)
FT                   /transl_table=11
FT                   /gene="ybtP"
FT                   /locus_tag="PA-RVA5-3180"
FT                   /product="putative inner membrane abc-transporter"
FT                   /db_xref="GOA:B6VKV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV2"
FT                   /protein_id="CAR66782.1"
FT                   /translation="MLSNDSSIQNSPEQRAADAGVIKELWNMMRPYRTLSYVAIALAIV
FT                   SAGLQILPAAVAGLITQSIYDGQYDTLLNYGVMLLSFTFAAMLTFSGSTFVSHLIAADV
FT                   QADVRRNISSKLKSVPLGFFTRTDSTEIKKMMLDDVEQLEDGIAHIIPEMSATLFGPLI
FT                   ALSVMLAIDWRLALAAFAPTLGACLLFIYIQIKVQTTTQRFYAAQNRIASTMGEVINAI
FT                   PVVKTYSGGNVALQRAEGAFTALTRIIDVWVEKVQVKSSRFFVLSSANLLFVLPLAVWL
FT                   FNRQEISLFEFTFFILAAMAFGNIASSMFAVMTRLQQQEALITRYRWLMNQPELVPCTQ
FT                   SQTPADHSVTLHNVSFSYQDEQDNALNNISFSIPAGNSLALVGASGSGKSTVANLIARL
FT                   WDPQQGQITVGGVDIRNMDEPTLRNNISFVFQRVFLFNDTIANNIRLARPDASQAEVET
FT                   AAVAAQAHQFIQQLPQGYNTVLNHGISLSVGEKQRIAVAAAILKNAPILVLDEATAYAD
FT                   PECEKEMQQALNALCRNKTVIVIAHRLPTIRHFDQILVLDKGQIIEQGTHDELVAQQGA
FT                   YASQWSAWRRENTGTGANYHGAI"
FT   misc_feature    complement(37079..37630)
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(join(37814..37882,37910..37969,38171..38239,
FT                   38252..38320,38450..38518,38576..38644))
FT                   /note="6 probable transmembrane helices predicted for
FT                   PA-RVA5-3180 by TMHMM2.0 at aa 38-60, 80-102,
FT                   146-168,173-195, 263-282 and 292-314"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   misc_feature    complement(37838..38647)
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   CDS_pept        complement(38745..39992)
FT                   /transl_table=11
FT                   /gene="ybtX"
FT                   /locus_tag="PA-RVA5-3181"
FT                   /product="putative cytoplasmic transmembrane protein"
FT                   /db_xref="GOA:B6VKV3"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV3"
FT                   /protein_id="CAR66783.1"
FT                   /translation="MMHNISHPRHVSLLLLALAGVYTIQSTIGMLTLQSMPAFLRSHGV
FT                   TPDKIGLLYLLMLPWAFKFLWAPIVERYRKSGSGDTNSRRIMLCGNVLITLLFCSMSLA
FT                   EPAEHMPLIITGLFLITLCLTVVDTTTDGHAIDRLSPQHRPWSNVMQVGGSYLGSIIGS
FT                   GLFLYLTSLYGWHIGAGVLAILILVMSLPVLFIKETPEKKASNISKTAVTPSLKSALRR
FT                   APVKQALILILLCMIGTRLSLGMLSPFLIDRGVDLTQLGIIAASGGALAGLSGVLLGGI
FT                   IVRKLGSIQTLLGLMLFECMVLVGIFWLAQQPEAPLSLLSTAYVFITLITAAKFVALYT
FT                   QMMSLAAGTQSGVDFALMQSADMSIAIICSVLGGMIVTKVSYASLFALASFFTLTGLFW
FT                   TFHKFRDFQKENVNAQ"
FT   misc_feature    complement(join(38790..38849,38862..38930,38967..39035,
FT                   39063..39131,39144..39212,39240..39308,39405..39473,
FT                   39483..39551,39612..39668,39681..39734,39792..39845,
FT                   39888..39956))
FT                   /note="12 probable transmembrane helices predicted for
FT                   PA-RVA5-3181 by TMHMM2.0 at aa 13-35, 50-67,
FT                   87-104,109-127, 148-170, 174-196, 229-251, 261-283,
FT                   288-310,320-342, 355-377 and 382-401"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   misc_feature    complement(38859..39941)
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   misc_feature    complement(39861..39992)
FT                   /note="Signal peptide predicted for PA-RVA5-3181 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.923) with cleavage
FT                   site probability 0.408 between residues 44 and 45"
FT   CDS_pept        complement(39989..41992)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3182"
FT                   /product="similar to the pesticin receptor fuya"
FT                   /db_xref="GOA:B6VKV4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV4"
FT                   /protein_id="CAR66784.1"
FT                   /translation="MKKKYAKASVLCCLISPMVWAEHSPEATEDTLVVTANKREEALNK
FT                   VDGSVLVKTGEELEQAGITQVQDLERAFPGLQIRSRGNRTYSATTIRGISSPDFYSPSI
FT                   RIYVDGVPQDHQFLTQELINVERVELLRGPQGTLYGGNAQAGVINIITRSPKEGPWLNL
FT                   SGNYSKLKQGGSFSGSMPLIEDVLYGSTSLRWVNESGQIDIPSRGDKNVDSSKTWLGKG
FT                   QLTFAPEDSPFSAELSFAHEDLDSHEELYLTDEQFRQKKYEGPIPDLTRRVNSYTLKAE
FT                   YDFGSSTLTSVTSYQDRDIFRDFIGGKWKEKHHATTQELRLNSNFSNGISSVLGGWFSD
FT                   ENNKHHTSGYPGYYGDAFNTIKGKSLALFGEVKLPIAAQWDLTLGGRLSHEKSQIDYAG
FT                   RSGMMAVDAFDNQVSSNEFTPKAALGWQFTPDTRFYVSATKGYKPGGFNNIVSSANDRK
FT                   PYDTETSDNYELGWHTSFFNNAMTLDSAVYYIRSKDKQIYVGPIGMQSIRNAGKAESKG
FT                   IELSSQIKPMQGLKFSLGGSVGKSNFTDATDTTNGISYNGKRLPYAPDVMLNASFDYLI
FT                   DQTLLPGNLYLNAGARYYSKSYFNEANTLEQGGYTLYDASLSLEMAHGINVKFYGENLG
FT                   NKKYRLSSFQQGNTLSMMSKGLNVGLDVSVAL"
FT   misc_feature    complement(39992..40738)
FT                   /inference="protein motif:HMMPfam:PF00593"
FT   misc_feature    complement(41552..41869)
FT                   /inference="protein motif:HMMPfam:PF07715"
FT   misc_feature    complement(41930..41992)
FT                   /note="Signal peptide predicted for PA-RVA5-3182 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.977 between residues 21 and 22"
FT   CDS_pept        42233..43273
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3183"
FT                   /product="transcriptional regulator, arac family"
FT                   /db_xref="GOA:B6VKV5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV5"
FT                   /protein_id="CAR66785.1"
FT                   /translation="MWKALLKWCLMLILQGDLMKTIYSKKLGVFAANHCNCMHLQVEEN
FT                   NTNPSLQTEELSDGIHINRIRFELNKDFTEYCEGPPTVSIAFILSGEGRMAIENGDVLD
FT                   INPGTMVFFYSPKTTRGMNFFGCGTWHILDIRFSLNEIEAQELPCFTKLTSGFEKNVSY
FT                   SDVLMMARPIYPPFMQIVNQIEECQLNGNVRKVYLKAKALEILACVTAQIYDCQYNVIN
FT                   SLQRRAVYNAIKIINNDYHSPWTIKSLSRAVGLNERKLKEGFRAVVFRTFHQYLENVRM
FT                   TTAEDLLKKGMSVIDVSTAVGYSSPSHFSKRFRQHYLINPKAWQAKYAVSHTLLAEHIA
FT                   VEGKYT"
FT   misc_feature    43076..43210
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS_pept        complement(43376..45229)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3184"
FT                   /product="secreted hemolysin-type calcium-binding
FT                   bacteriocin, putative"
FT                   /note="It has been suggested that the internally repeated
FT                   domain of haemolysin may be involved in Ca-mediated binding
FT                   to erythrocytes."
FT                   /db_xref="GOA:B6VKV6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV6"
FT                   /protein_id="CAR66786.1"
FT                   /translation="MGVFQYKDFDDATSKELFSDAKAISGYAYHNLGSGFAEGYYNYGF
FT                   GLGMPLTLLKAIIGSTTSQGITPKLPWNPDSEKQARDKLNDAGWFTISADELGYQGKTD
FT                   ARGTFYGEKASHSTAQAEVMGKYDADGNLISIGIAFRGTSGPRETIITDTFGDIINNVL
FT                   VGLGKTEYSNNYTPNAFGRLLDHVANYAKANGLTGSDIVVSGHSLGGLATNSMAEASNE
FT                   KWGGFYSQSNYITFASPSQYEKDGKVLNVGYENDPVFRVLTGTSVTSSSVGVHDAPKDS
FT                   ATNNIVNFNDHYASDWWNVLPFSIANPSTWVSHVTPFYQSGMQRIMDSVFYDLTHKDST
FT                   IVVSNLSNVTRGNTWVQDLNRNAEKHTGSTFIIGTDGNDLIKGGKGNDYLEGRDGNDIF
FT                   RDDGGFNMIAGGRGHNTFDLQKSLKNAEIAYDKAGTLYLRDAQGGITIATDISTIKSKE
FT                   NTWLFFTKDVDSQVRNDGLYSASKGLTKYANSVTGNDGDNTLTAKTSGSWLFGLDGDDT
FT                   LIGFGNNNVFVGGEGNDVLKSQGNNNTFLFNGEFGQDIIYGYNKTDKLVFLGTEGSSDK
FT                   SSYLDHASMVDNNLVFTFGQNSVTLVGVSMDSLSADNIILA"
FT   misc_feature    complement(43535..43588)
FT                   /inference="protein motif:HMMPfam:PF00353"
FT   misc_feature    complement(43595..43648)
FT                   /inference="protein motif:HMMPfam:PF00353"
FT   misc_feature    complement(43649..43702)
FT                   /inference="protein motif:HMMPfam:PF00353"
FT   misc_feature    complement(44033..44086)
FT                   /inference="protein motif:HMMPfam:PF00353"
FT   CDS_pept        complement(45653..45808)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3185"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV7"
FT                   /protein_id="CAR66787.1"
FT                   /translation="MLIHDEILLIYLNEDIPFILQVAALLAAFTHPSHIVIYAPGDTFT
FT                   CRRAAT"
FT   CDS_pept        45870..46769
FT                   /transl_table=11
FT                   /gene="blaA"
FT                   /locus_tag="PA-RVA5-3186"
FT                   /product="ctx-m type extended-spectrum beta-lactamase"
FT                   /note="Beta-lactamase catalyses the opening and hydrolysis
FT                   of the beta-lactam ring of beta-lactam antibiotics such as
FT                   penicillins and cephalosporins"
FT                   /db_xref="GOA:B6VKV8"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV8"
FT                   /protein_id="CAR66788.1"
FT                   /translation="MRDPDMKHSPLRRSLLLAGITLPLVNFAFPAWAGALPSSLYKQLA
FT                   ELENSTKGRLGVTLINTANGQEIQYRGDERFPFCSTFKLIVVAAVLHKSMSQSELLAKH
FT                   INYSETDLLSYAPIARKHLNQGMSITQLCAATLQYSDNTAVNLLIKELGGVEAVNHFTQ
FT                   SLGDHTFRLDRWEPDLNSAIPDDHRDTTTPAAMAASVKKIVFGEVLAELQRDLLIDWLK
FT                   GNTTGDASIRAGVPTGWVVGDKTGGGDYGTTNDVAILWPPKGAPVILAVYFTQPQKDAE
FT                   SRRDVLASATRLVMEHLA"
FT   misc_feature    45870..45968
FT                   /note="Signal peptide predicted for PA-RVA5-3186 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.997 between residues 33 and 34"
FT   misc_feature    45906..45974
FT                   /note="1 probable transmembrane helix predicted for
FT                   PA-RVA5-3186 by TMHMM2.0 at aa 13-35"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   misc_feature    45999..46745
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   CDS_pept        46840..47106
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3187"
FT                   /product="prevent-host-death protein"
FT                   /note="Prevent host death - Addiction modules prevent
FT                   plasmid curing by killing the host cell as the longer-lived
FT                   killing protein persists while the gene for the
FT                   shorter-lived antidote is lost."
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKV9"
FT                   /protein_id="CAR66789.1"
FT                   /translation="MRCVMSITTLSSRELNQDVSRAKKAAKRGPVFITDRGKPAHVLLT
FT                   FEEYQRITKQRRNIADALAMPGVEDIEFNPPRATINSRPASFS"
FT   CDS_pept        47103..47198
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="PA-RVA5-3188"
FT                   /product="Hypothetical protein"
FT                   /note="plasmid stability-like protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW0"
FT                   /protein_id="CAR66790.1"
FT                   /translation="MMFVLDTNVVSELRNVIDFELTGVPILNPWV"
FT   CDS_pept        complement(47329..47421)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3189"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW1"
FT                   /protein_id="CAR66791.1"
FT                   /translation="MVDYGRSASSLAIAMLNEGQSPKEILVANL"
FT   CDS_pept        complement(47450..47863)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3190"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR028952"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW2"
FT                   /protein_id="CAR66792.1"
FT                   /translation="MLTINEIQEKVWSLGAKINAPKSILIVYSEPIGDGSGYIIIDNNQ
FT                   YHIIYSERGYEIFRQTTEDLNELLYWIMESVASQMASEYELKNRNDESKDFRRAYFEKQ
FT                   LEILGVLDKKWVLRAKKKIEEILERSPYIDNSD"
FT   CDS_pept        complement(48186..48866)
FT                   /transl_table=11
FT                   /gene="fhaB2"
FT                   /locus_tag="PA-RVA5-3191"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW3"
FT                   /protein_id="CAR66793.1"
FT                   /translation="MDNNSLANVLAAAEANKKGTVEKWQQDKQTEIQKACSGNTPLSCQ
FT                   TLVAAEGSILALPWLSGAAVTTGMIGAGANTGIQYLANGNVDPNDAISAYWTGVFTANT
FT                   GLWGTIAWNAGMGAASSYVKGDDPIKGGMISGAGSAIGYGVGKYVASSTNTVGKWITGG
FT                   WDPKFNPNLLKYTEVKGEFGISKEMSPSKIPGVVGNIGSSVATEITNDQISKGLKKLDE
FT                   DKKK"
FT   CDS_pept        complement(49142..58051)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3192"
FT                   /product="putative adhesin/hemagglutinin/hemolysin"
FT                   /note="filamentous haemagglutinin/hemolysin family of
FT                   adhesins"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW4"
FT                   /protein_id="CAR66794.1"
FT                   /translation="MNKQLYRLIFNRSRNRLMVVAEIARAGQGSTARRRGRPSAQRLCR
FT                   LTAFQFGLLLALGGISLTAQAAIVADGQAPGQQQPTIIPSANGTPQVNIQTPSAAGVSH
FT                   NTYRQFDVDKRGVILNNSAKATETQLGGMVAGNPWLAKGEAKVILNEVNSRDPSHLNGW
FT                   IEVAGRKAEVVIANPSGITCNGCGFINAHRTTLTTGEALMERGHLTGFDVNQGEVRIEG
FT                   QGMDSRQQNYTDIIARAVALNAKLHAQNLKVTTGRNRVDAAHQTITKKSAAEDEAHPLF
FT                   ALDSTALGGMYAHKILLIGTEAGVGVRNAGDIGVPAGEVFVTADGRIENRGTISSRDAL
FT                   QLTSTAGIDNQGKLLSQSTVTLQAGGPLHNRGRIEARGDITATAQTIQSDRHSIWAAGL
FT                   DDNGNTTRPGSLTLTAQQVQAGGKNLATHTLNIHGQQIDLSGSQTVAGDIQLTASQPGI
FT                   STAHATVTADRFTAKTPGQFNNDGGQLVAREIHVTTPDLSNHQGKMTQTGPGELTLHTR
FT                   TLNNRGGTLFNAGSRLTITTDQLDNRQGNLVNQGDNFHLTAQTADNTQGQVQLAGNGQL
FT                   SLTAQHWLGHQGKLLTNGALDIQAHDLQLNHAVTTANKITVIADTLNHQASVMQQSGTD
FT                   TLALTVNTLNNQGGKIAGNGNLHLNATAINNRQGQFVAAENGSLTLTVNDTLDNQNGRL
FT                   EAGKHIQLTATQLDNRRGTLAASGGSATLTIGQQIQNTHGHIEAKTRLTTTSQALDNTQ
FT                   GTLLAQHITSQTTGHRFTNTAGQVIAQDTLTLHSGELENTAGLLQSGGDMTVKTHGHWL
FT                   ANTATTDQKGGQLLSGGHLTLHTGDINNSGGIIAADGHTTLSSTALNNTRGQIAGNGGL
FT                   DIHSQQLTNRQGTLQSADALNLDTDGQGLDNQQGRILGDGITTVTSGPLDNRHGHLQGG
FT                   QLVIDTRQAQTDNRDGKLLSAGTFNLKTQQLDNRHGQVQAVGDTVLNVKTQTDNTGGLI
FT                   RGGAQLTLSTAHLINRDTAQTDKGLEAQNLTVSTQQADNSQGTLRAADHLQANISQTLN
FT                   NTQGRVSAGKQLTINREAQQPPLRINNQQGTLIAGKQVDIQANTLSGDGQLLSQGDMAV
FT                   TLTEDFHHTGNTAANGNLTLKTTGNLLNDRPIKAGQALHLGAQNLTNSATGEISAEQTQ
FT                   IKVHDTLTNTGLIDGNLTHLTAHTLTNTGTGRIYGDHLALQTGTLNNTAHAGNAAVIAA
FT                   RDRLAIGTDTLNNQHHAQIYSVGETHIGGQLDNTLSATGQARELTNHAATLEAGGNLTI
FT                   DANQLHNTNAGLVTQVAETEHARHHDAALSGQTARYDWSQVDTAQRDKYGVHTARMPDG
FT                   SRSDNFYEYQYTRTVTETQVKHSDPGKILAGGHLTLNSAKVTNHDSQIIAGGALTGTIG
FT                   ELHNLATQGERITTETGSQTHWYAKKKRNKLGIGGTKTSQGKSRSGYNPAPVVETIDLK
FT                   TLAWQDHARPQNTDITITDRQTGQIHAAPTAVKPVSGINDQPRVLPPGQPFELSLPPET
FT                   VKGQPIDPVIRVVTPNTRLPDNSLYTVQPASDSHYLVETDPKFTQYKQWLGSDYMRQQL
FT                   THDPALVHKRLGDGFYEQRLVREQITQLTGQRYLPGYHNDEAQFKALMDAGVAFGKEQQ
FT                   LTPGIALSPAQMALLTADIIWLTNQTVTLPDGSTQVVTVPQVYARVRPGDLSGDGALLA
FT                   GNTVALNSQGDITNSGTISGRDVTQLTANNLTNSGFIRGGKVDVTARQDITNRGGQIQG
FT                   ADKVVLQAGRDITSAATLRGDAANRWRDRPAGIYVQNDQGTLSLSAINNVQLTASEVKN
FT                   AGKDGRTEITAGHNLTLDTLSTHRTEQGDWGKDNYRHLSQQQDIGSQITGAGEVTLQAG
FT                   QDLTATAAHVNAGQQLTAQAGNNLTLTTGTASSDLVEHSKQTSKGWLSKSSVETHDEVH
FT                   DRQALSTTFSGDKVTLQAGKDLHIRGSNVAGTQDVRLNAGHQLTVTTAAESHGETHLRQ
FT                   EKKSGLMGTGGIGFTLGQASQKVTTDSDSQRNKGSTVGSSQGHVTLNAGTQLNLHGSDL
FT                   VASKDITLTGQNVNITSAANHHTTLTKTEQKQSGLTVALSGTAGGALNSAVQTARAAQQ
FT                   TEDPRLKALQHTQAALSGVQATQAARLAEAQGSDKGNNTLAGVSLSYGRQSSRSEQQHQ
FT                   QTTQQGSHLTAGDNLTITAHGDDKGASGPNGDIRIQGSQLQAGQDLQLHASRDIALSSS
FT                   QNTEQTTGKSRSHGSSLGVGLTAGPGGTGLNVSANVSRGNGRENGHGVSHNNTTLQAGQ
FT                   TVELNSGRDTTLKGAQVSGEQMTAEVKRHLTLSSEQGSQRYDSQQHNARAGVNATVGPL
FT                   TNGNGTLTLNASRNKLHSNYDSVQEQTGLFAGEGGYQVNVGDHTQLDGAVIASQADNAK
FT                   NTLNTGTLGFKDIQNKADFSVEQQSAGVSLGQPTTGQGLNNLAVNALTGSNNQGHDRST
FT                   THAAVSDGTLIIRDKDHQTQDIANLSRDTDNAANVLRPIFDKEKAQQRLKQAQLMGELS
FT                   AQMTEIAGTEGKIIATKAAKAKLNHISEQDKADAREKLINAGNKAPSPADINKQVYDTA
FT                   YTQALNDSGFGTGGPYQKALQAATAAIQGLAGNNLGQALAGGASPYLAGVIKELTTDPQ
FT                   THQVDIATNTLAHAILGAVAAEVSGNNAVAGAAGAASGELAAQVLIKQLYGDAAKVSEL
FT                   TEEQKQTISTLSTLAAGLAGGIAGDSTASALTGAQAGKNAIENNSLANVLAAAEANKKG
FT                   TVEKWQQDKQTEIQKACSGNTPLSCQTLVAAEGSILALPWLSGAAVTTGMIGAGANTGI
FT                   QYLANGNVDPNDAIFAYWTGVFTANTGLWGTIAWNAGMGAASSYVKGDDPIKGGMISGA
FT                   GSAIGYGAGKYITSWTNAAGKWLTHGWDPKFNPNLLKYSEVKGQFGISKEMSPSKIPGI
FT                   VGNMGASITTEGTNSLIQEQINKAQEKGNGSPK"
FT   misc_feature    complement(52175..52579)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(52622..52852)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(52856..53017)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(53909..54301)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(54521..54694)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(54701..54892)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(55094..55273)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(55427..55609)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(55853..56032)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(56069..56281)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(56312..56539)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(56693..56836)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(56840..57049)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(57056..57295)
FT                   /inference="protein motif:HMMPfam:PF05594"
FT   misc_feature    complement(57434..57841)
FT                   /inference="protein motif:HMMPfam:PF05860"
FT   CDS_pept        complement(58072..58347)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3193"
FT                   /product="Conserved Hypothetical Protein"
FT                   /note="similar to hemolysin secretion/activation protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW5"
FT                   /protein_id="CAR66795.1"
FT                   /translation="MKSSILVLAVFYSTASGSQAADLSDQQRIHQQARQQALEAQLAPS
FT                   PEAVRLSVLEKTSPAAFPTAAHGFPLARVPPFGTGRIHSNNPAARV"
FT   misc_feature    complement(58288..58347)
FT                   /note="Signal peptide predicted for PA-RVA5-3193 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.992 between residues 20 and 21"
FT   CDS_pept        59250..60266
FT                   /transl_table=11
FT                   /gene="Sc/SvQ"
FT                   /locus_tag="PA-RVA5-3194"
FT                   /product="similar to putative tail fiber protein"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW6"
FT                   /protein_id="CAR66796.1"
FT                   /translation="MSQKNDFKAFSIKNGANVVSQYSYENSPELQTGLTPNSPVDIHLL
FT                   NKALRQSSVISSVVADFIATQSGDDILDDGDIAKLTVQLNRALKQKVTAEIPSASLIQK
FT                   GVVQLTNEMGNNDTLAVTQKLVQEIVNSLRENINGKVPNSRRINGKALTEDINLNASDV
FT                   GAYTRTEVYTRAEVDKLIKTTSEIPVGSPIPWPLSHPPFGYVTCNGSAFSRSQYPKLAE
FT                   AYPSGRLPDLRGEFIRGWDDGRGIDSGRALLTNQSDAIRNITGGFSARRMQGHLNIFRS
FT                   TGCFGWKFDESYVIGTSQMSSVNYGTDDITFDASRVVPTANENRPRNIAFNYIVKAA"
FT   misc_feature    59817..59960
FT                   /inference="protein motif:HMMPfam:PF07484"
FT   CDS_pept        60269..60892
FT                   /transl_table=11
FT                   /gene="tfaE"
FT                   /locus_tag="PA-RVA5-3195"
FT                   /product="tail fiber assembly protein homolog from lambdoid
FT                   prophage e14"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW7"
FT                   /protein_id="CAR66797.1"
FT                   /translation="MTQENILDTEIAILGEDGLAIKAGWIKVYHVNPYSREFAGTNVEY
FT                   VAEGVGVSAHSYPDAPNLPDTDNMVVRRSADESHWEIVPDHRGKIAYSTQTGEQQEVIE
FT                   LGELPEILTFEQPVTDFDKWDGENWVTDIEAQQASQIKQAEQQRATFHQHASDAITVLQ
FT                   YAVETEMASEAEKTLLLDWKKYMVLLSRVDISLAPDITWPEKPQ"
FT   misc_feature    60476..60889
FT                   /inference="protein motif:HMMPfam:PF02413"
FT   CDS_pept        61216..62166
FT                   /transl_table=11
FT                   /gene="Sc/SvQ"
FT                   /locus_tag="PA-RVA5-3196"
FT                   /product="sc/svq protein"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW8"
FT                   /protein_id="CAR66798.1"
FT                   /translation="MSQKNDFKAFSISNNANVVSQEKYEESQGVKTGFPPENIPIHVLN
FT                   KVLRQSSTIASVVANFIAAQSDDDVLDDGNIAKLTDQLNLSLEQKITTVISNASLTQKG
FT                   VVQLTNEMGNNDTLAVTQKLVQEIVNSLRENINGKVPNSWRINGKALTEDINLNASDVG
FT                   AYTRAEVDRLIKKTSEIPVGSPIPWPLPHPPFGYVTCNGSAFNRSQYPKLAEAYPNGRL
FT                   PDLRGEFIRGWDDGRGADNGRKLLSWQEGSALSEYLGSFTTGVAQNIHQRDGVTYHDKD
FT                   HKRYKIPSLEIIGTGVDYFRFRPRNIAFNYIVKAE"
FT   misc_feature    61762..61905
FT                   /inference="protein motif:HMMPfam:PF07484"
FT   CDS_pept        62169..62792
FT                   /transl_table=11
FT                   /gene="tfaE"
FT                   /locus_tag="PA-RVA5-3197"
FT                   /product="similarities with putative tail fiber protein of
FT                   prophage"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKW9"
FT                   /protein_id="CAR66799.1"
FT                   /translation="MTQENILDTETAILGEDGLAIKAGWIKVYHVNPYSREFAGTNVEY
FT                   VAEGVGVSAHSYPDAPNLPDTDNMVVRRSADESHWEIVPDHRGKIAYSTQTGEQQEVIE
FT                   LGELPEILTFEQPVTDFDKWDGENWVTDIEAQQASQIKQAEQQRATFHQQASDAITVLQ
FT                   YAVETEMASEVEKALLLDWKKYLVLLSRIDISLAPDITWPEKPQ"
FT   misc_feature    62376..62789
FT                   /inference="protein motif:HMMPfam:PF02413"
FT   CDS_pept        62923..64182
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3198"
FT                   /product="putative tail fiber protein from prophage
FT                   cp-933h"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX0"
FT                   /protein_id="CAR66800.1"
FT                   /translation="MSKKNEFKAFSIKNGANVVSQDRYEASLDLQTGFPPNDVPTHLLN
FT                   KVLRQSSTIAAVVANFIVTQSGDDVLDNGDIAKLTAQLNLALKQKITAEIPDASLKQKG
FT                   VVQLTNVIGNSDTLAVTQKLVQEIINSLRENINSKVPNSRKINGKALTGDVSLNAGDVG
FT                   AASINDAMRFTNLNGWENIYNGYSWVAPNTPFVTRYGLPNVYGVQLRFSNVNGASSEGI
FT                   DGVWSHRLVFMHEGDTYRTDRINADSKRQYTRRFWDDRNAKPDTNGYLKRASPVVEIYP
FT                   DGTFSTNEESEGVEVKKQGIGIYHLSNILGYNADGGWGIHGGISVPHDNNNLELIFVKD
FT                   QVQPDGSIIIKTFHRQHAHLPEMFQNWQLKSVDDNGNEIFYQDGEPCDIPESCRLDIRV
FT                   QMPEDSLWNLRQKELQEEYK"
FT   CDS_pept        64849..65400
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3199"
FT                   /product="PvpA"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX1"
FT                   /protein_id="CAR66801.1"
FT                   /translation="MNTQRKLDKVRPPRVQITYDVELGGAVEKKELPLVIGVIGQFAEQ
FT                   SIPMRERRFMHVDKDNFNAVMEGLSPSLELQVESALPDQSGFINIDLQFQSMADFSPEN
FT                   LAKQIEPLRNLLEIRSKLSDLKGRALSNEKLRDRLAEILAEHADKLPPVNEEAETVATE
FT                   NTTDDVTPENNNIPEDNNAQ"
FT   misc_feature    64858..65325
FT                   /inference="protein motif:HMMPfam:PF05591"
FT   CDS_pept        65408..66889
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3200"
FT                   /product="PvpB"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX2"
FT                   /protein_id="CAR66802.1"
FT                   /translation="MEQSVVEQQELQATEASGDFLDQIIDNTQAIRRETDRDRVKSQLD
FT                   QFLSEVTAGSLVVSGDLVNSIEERIAAIDALMSAQLSLVLHHPEFQRLESSWTGLKGLL
FT                   DQSETDNTQIRMLNATKTDLIKDFKSASDFDQSMLFKNIYEHEYGTFGGEPYSAFVGDF
FT                   DFDNSPEDLYLLEQISHVAAAAHAPFISSANAGMLGLNDFGELPRPRDLSKLFDTSDYL
FT                   RWKRFRESDDSRYVGLTLPRVIGRLPYGAKTIPIEQFCFEEQMREGDSNSYLWINAAYA
FT                   LAGRMVAAFEQYGWCAAIRGVEGGGLVEALPTHHYSSVSGEKMLQCPTEVAISDRREKE
FT                   LAELGFIPLVYYKGTDYAAFFSVQSPNKPRKYNSDLANANAKLSTQLQYIMTTSRFAHY
FT                   LKMIVRDKVGSFMSRGECQTYLQSWINQYIVGSDTVGAEIKASHPLREARVDVVEVPGS
FT                   PGTYRAVAYLRPHFQLEGLSMSLRLVADLPPSSAA"
FT   misc_feature    65471..66874
FT                   /inference="protein motif:HMMPfam:PF05943"
FT   CDS_pept        66953..67447
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3201"
FT                   /product="PvpC"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX3"
FT                   /protein_id="CAR66803.1"
FT                   /translation="MSSSIFLQIDGIKGESTDSKHKDWIELEHVNFGAFNHARIADSGK
FT                   RKITVGAADFRTIDCVKVMDISSVKLLSAVAQGTAIKKVKLEICTIFKGEMHPYAEVEM
FT                   DECIISDVHETCSRGGEFPQEQFSITYSKIKWTFTPLSPDGTKGNKAGPEGWDLIENKK
FT                   Q"
FT   misc_feature    66962..67369
FT                   /inference="protein motif:HMMPfam:PF05638"
FT   CDS_pept        67505..67948
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3202"
FT                   /product="PvpE"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX4"
FT                   /protein_id="CAR66804.1"
FT                   /translation="MIQPSFLHRLKDDYPQNEERGVTFIWSRQEVVQSLMFDLNMLFSS
FT                   RPISAVLPLFGELPKSVLNYGVSDVISVDISDDERIDALSNNIYQAISWFEPRLKNVVI
FT                   TLQKNTPENITFWVSGIFFNEQIVFSISWSSTAYTYSISWDRS"
FT   misc_feature    67514..67912
FT                   /inference="protein motif:HMMPfam:PF07025"
FT   CDS_pept        67950..69761
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3203"
FT                   /product="PvpF"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX5"
FT                   /protein_id="CAR66805.1"
FT                   /translation="MMLLPQKILTYYNRELSYLRQYGAAFSQRFPKIAKRLGFAEGVSE
FT                   DPHVERLVESFAFLTAKIHQRIDEDMPELNNAMLEVLAPQFLRQVPSVSLVQFQQDPLA
FT                   SGVTGVMTVARHTPLISQPVDDVACRFRTVYPLEMLPLDLTHTELMPDPYDRDFILTLN
FT                   FTLWPGASFRARHIRLYLHGAPILAHSLYELLSAQVKQLECRLGEHVFNMDNRDIQVVG
FT                   FDPQDNLCADDLMINPTHHLFRDYFSFPERFLFLDIPLPDAGLITKLAGDLHYRFRLKD
FT                   CAALRRIERMSDKVDSETFRLNCVPVVNLFSHQAEPIIPLETEHEYLVQPDARRPQSME
FT                   VYTIDRVEIVSRQQEQLSSRSVPPLFGIEHTQDGEQPLLLWQASPRPSLRHNETGMNMF
FT                   IGFSDSSGEQLKPETDVVVLSLTCTNRDMPRLLSNGHPDGDFESEVALPGVKILGLIRP
FT                   RLPARPQPNCALNWRLVSQLNLNQMLLSGSQGVQCLKETLELYNLHGDPAISRLIAQLQ
FT                   QVAIVPVSARLNPADPYSLARGLEVTLTFQTQAGEFVDFYLFCSLLERFIAMYAPINSF
FT                   TQTVTQLESVNNSMRRWPRRSGRLTWL"
FT   misc_feature    67962..69758
FT                   /inference="protein motif:HMMPfam:PF05947"
FT   CDS_pept        69752..70714
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3204"
FT                   /product="PvpG"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX6"
FT                   /protein_id="CAR66806.1"
FT                   /translation="MALENRIRLAGGRFYQNVRRLLKRCHYRRSSEAAVIPDDVVQFSS
FT                   VLTLDAPESEVDALLPPQQEGEQYRMAVYHFGLLGTFGALPLRYTEWLIDRRYRYGDES
FT                   AQAFIDIFTHRLLSLRFQAWQKYRLFVNAELQSRRALPAVIPAVAGQFTTNEPQHIRPA
FT                   CVGLLATSVRSMMNLQHLLQREFNMPVSIQPFRGRWQYAEQMHCCCLGRSLLGDNPMLG
FT                   SAYWDIQSGFHIQLGPFAAQQSADFMPGNERYRRLTQWVWQFAGPLLSFSLELLVKHDG
FT                   QGNILNGSRRLGWDGCLGNTGDTHIQRVYLGECVGPYTV"
FT   misc_feature    69773..70651
FT                   /inference="protein motif:HMMPfam:PF06996"
FT   CDS_pept        70737..72743
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3205"
FT                   /product="VgrG"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX7"
FT                   /protein_id="CAR66807.1"
FT                   /translation="MLLGQKNRFLQVIGSLSDIVALNKISGEEHLSRPYSFSVQLYSSS
FT                   DWNKLEPYIGKPLAFRIGEAPNHRIVHGILTELQQQGFADGQFCYQARVEPWLKMLTLT
FT                   SNLRVYQRISVPDMVCDIFRKRGFNDVELALKSRYPKLEYCMQYKESDFDFVTRQLEQA
FT                   GIFYFFRHEEGRHVLVLADHPSTFVNAPLAVLPYQSKLGSQQGYGLRAWQIHRTMIPGM
FT                   AEMSGYNVKNASTVSASAKANSGYSINPKLSIYDDRRQEERNQLEAQAALCMEQWESQS
FT                   HYANAVNSYPGLQVGHQFTLKGHVSADGRYAVGSQQLKAESNLEEGGLLFSSQVTLFPA
FT                   NKTFRPRPSVTRPYIAGVLSALVVGAASEEIHTDAQGRIKIQFHWDKEHKKNDDSSCWV
FT                   RVSQFWNGAKFGAQFVPRVGSEVLVSFVDGDPDSPLVTGTVYNGVKMPPFALPGQKTQS
FT                   GIATRSSAKGTVEQGHQFCFEDKKGEEFILLHSQKDLRLKVKNDFSANIDRNASWEIAE
FT                   KRDTKIKKGNDTLILGEGNAVTEVKKGDKKQTLDHGNFTTTVSAGSYSLEVSRGSAKIN
FT                   AGQHCTITANQGIELKVGASKLSITPAGITIKAPSVTVEGSGKLALKSSGVAELTGTTV
FT                   KVQGSAMAQLKGGIVQVDATGIAMVKGILTKIG"
FT   misc_feature    71808..72044
FT                   /inference="protein motif:HMMPfam:PF04524"
FT   CDS_pept        72778..73374
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3206"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX8"
FT                   /protein_id="CAR66808.1"
FT                   /translation="MAKLRHCQLSSQAELVLQQHVAHDQNLSALSQEMLWQDAVFYTIF
FT                   MLPYTQALELALTFISRVYERDLKQEQRLLLQQVRHWRANGGDLLRHELFDQAQTIGFD
FT                   NPISCLALSVFWSEGSMTTPDLEDVYPQPWQSLAALADTLCLILHFYGEQPEQQVLYVE
FT                   QFFQLAQGQLKQLPPSQDQGRKNYLYHEAMLSGEK"
FT   CDS_pept        73371..73673
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3207"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKX9"
FT                   /protein_id="CAR66809.1"
FT                   /translation="MMPMPAARVGDMHICPMVSPAVPPVPHVGGPIMPPGVPTVLIGGL
FT                   PAATMGSLLVCVGPPDTVVMGSPTVLIGGRPAARLGDLCAHGGTITTGYPLVIIA"
FT   misc_feature    73371..73433
FT                   /inference="protein motif:HMMPfam:PF05488"
FT   misc_feature    73467..73556
FT                   /inference="protein motif:HMMPfam:PF05488"
FT   misc_feature    73557..73646
FT                   /inference="protein motif:HMMPfam:PF05488"
FT   CDS_pept        73666..74784
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3208"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY0"
FT                   /protein_id="CAR66810.1"
FT                   /translation="MPEREIRVNLAQTDIARFLHPISADAPAGCDIEYEPLFEQINAAR
FT                   EADEDLPQDDEWGYETRQADWPQVSVLCQEVLEKHSKDLQIACWLTQAQGKLYGLAGMA
FT                   GGMTLIASLLETFWSVLYPPLDNEEGNCADARLGRLSWLDKQLVKQLDNLTLTSDGKLS
FT                   LSVWQRVQYFEQRVAANSELRASLISDGYFGIAECDDSIRATLAEQFDQLLAQAEQVKQ
FT                   ALEKLHQIMVNLMPDAGNSMSFSTQRLQEMMALITRFHEIVAPEDAQQYHDEEALPGGR
FT                   ASNGINTTLAEDRSHHEIRAIAIGQMINIANYFRKNEPTSPVPYLMERAARWANMGIAE
FT                   WLEEMMEDNTSALQDIMRVIKGPDKNREQDEE"
FT   misc_feature    73858..74043
FT                   /inference="protein motif:HMMPfam:PF06812"
FT   CDS_pept        74774..75433
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3209"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY1"
FT                   /protein_id="CAR66811.1"
FT                   /translation="MKNKTNFYNVIKRSFSVLLIIFLINGCSDSISNNEKRLQAIEQAR
FT                   PVYANNAIRLKMTADPQLNVFNNMPNSCTILIAQAEKREQLDKLLANPTLLRNLFAGTG
FT                   ATENILQLDNYVMMPGQSVSLHIDRAEQARYIALIAGYYPAPDSAHVRVLSLPLRLEQR
FT                   GWWNKSWNAEFVPMNIDLMLGRYAITRSNVSAGNAGDEVIFPEQTAESDNRNLLRK"
FT   misc_feature    74774..74869
FT                   /note="Signal peptide predicted for PA-RVA5-3209 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.880) with cleavage
FT                   site probability 0.248 between residues 32 and 33"
FT   CDS_pept        75439..76836
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3210"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY2"
FT                   /protein_id="CAR66812.1"
FT                   /translation="MFEHKPMYWYSGLYLQPQHFQAHELQHEYWQGRYQLLTQPYAFGV
FT                   VRLVFNLAALSDEVLSIHKAVFVFPDGCYVDCDVNGVLSARSLRNCWPEREKPQRIYVG
FT                   LRTFNHNQSNVTGVVDADSVGNITSRWVTWPQEQRMRDAFGEGPEAEVQQLTYNLRFFL
FT                   HDEIAQATGYTLLPVGQLHCTSDGIELDNRYLPPCLTLYAVSQLGQRIDQLCQELTGRV
FT                   HQLEELKRPQTLEAEVYTQEKSTLLLTLRTLVRYVVQLHHCQETRDVHPLQIFGLLRQL
FT                   ISELSCFTDRCSFLGEWNGREETLEKYQHQDLALTFNSCERTIIDLLNALVLEPNTVIP
FT                   LQQECNGYYHAAFNVTGASEQQRIYLVLRSDNLTDSEREIPDDRLIKLAAAEQIDGIIN
FT                   RALPGVRLYYQEIAPHGLPNRMNTHYFRVENRGTLWRQVEDSERVAVHWADAPDDLQIE
FT                   IVIVRVS"
FT   misc_feature    75448..76830
FT                   /inference="protein motif:HMMPfam:PF05936"
FT   CDS_pept        76833..77456
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3211"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="GOA:B6VKY3"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY3"
FT                   /protein_id="CAR66813.1"
FT                   /translation="MMRLLDCYIPVFTCVLRMIQQQVNQAEELRQTLLAALTQAQNEAQ
FT                   RYGYGLQDIEEANFAVVVWADEAILCAGQKELHVWRQSSLQAQLYNAELGGNTFFDRLA
FT                   ALSPDNYQVRLVYVFCLLSGFYGRYGRRDNLELHNIIQQELDNFPDTLRRYIATKNHRI
FT                   MNTGDNILENKRPNNKWRRKLILLILSLISIYIFITVYLLNISR"
FT   misc_feature    77382..77450
FT                   /note="1 probable transmembrane helix predicted for
FT                   PA-RVA5-3211 by TMHMM2.0 at aa 184-206"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   CDS_pept        77472..80972
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3212"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:B6VKY4"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY4"
FT                   /protein_id="CAR66814.1"
FT                   /translation="MKKLFYAIGWLSVMVILLLLSLIIAVAFSWPTIGGLILFLCLLLL
FT                   LLLLRGAMALIPQITNKVSRINKFWRQGNNRLEYLLYQHWWWGGRLQSWRRFRSWLQRN
FT                   GSVPPWFLVVGELNSGKQSLLARSNVVPMTGRNLTSFSENTFTCRWWFFRRAMYMVVSG
FT                   RYTEGQSLYRQAWLRLIRWIAQVRNPAGVLVCLSAEQLLNSDNRALYTMARNVRAQLEP
FT                   LQIRLERRLPIWLILTHSEALPGFSRWCSQLSVEQRADLLGSFIDQHTDGNVTDVLDKS
FT                   ILTIVDTLKMMRLKLLNQQRQQPQAEVLALPETVAQLKPALDYYLNALFERDHYLEHGL
FT                   LRGVFFTAEHQTELQQTEGVFSHRLLGEYLPNQIRRSDSVLLTGWRTLTKRALISVFSL
FT                   MIVYGAGSALVNTWHGVTQLENIHETSPLERSYLRYQYVEQWLQQTVSYLLFYPVTYTL
FT                   EQRMEQEYQQQVPVDVFNPESIATRLLMRFREAETPQKRLLVLHWSRFINIEQAMARGA
FT                   SLETLQHMPAYSASLLSGKDDPLRPDQRVALRLAQYRQGNAQQAFDQWRDTLQTLLEDS
FT                   SDWQWLLADEQPTGTHSLTLADFWPLAEGDVAKVNARIRGIYTRAGERDIQATLNELAQ
FT                   ALDRPARFSPLQRSFCQQYQNQRQSEWLAFAQAMPQAEGLVRGKKNWQTLVLATGQFGS
FT                   PYIVFLSRLENDLSTVKQEDQQLWLQTQQRLWQLHGYIQKGSMMQRVSLGNISLRQRIM
FT                   SWLGISPQISVRLDDNALTRYRDYRQAIQLNSQRELLSDMETESLVKNALSDGKGELND
FT                   NGLRTLFNRFALWRHETESKNAGVNETLWRLYQGDAHLVLRYAFLSAASRLQTQWESKV
FT                   IWPMEKLGGQTLLDGRELNARLYEYSNAFVRDTADYALDIRPEGINRQEIEGVSFPFND
FT                   NFMFYINNLIQPNNMLSSTSDIRRRLQEKLALLESERELAAVQQEPEQEQSAEVVITSQ
FT                   PATANRGARVLPVGSSVTLSCNDGEQQLRSMNFNDSMTAHWNPASCGKVRIDVYFPSFT
FT                   LSKSYVGADSLLQFIRAFSHGELTLTAQTFPQRRNELGALGINDITVRYQIGGEKAVSS
FT                   LYQQWQQRQQQQTALLEQRNRLDSQLLDLSEPTVAKGSLSTLPLQITTYWNELRKPKSE
FT                   "
FT   misc_feature    77472..77558
FT                   /note="Signal peptide predicted for PA-RVA5-3212 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.998) with cleavage
FT                   site probability 0.609 between residues 29 and 30"
FT   misc_feature    join(77490..77558,77568..77636,78648..78716)
FT                   /note="3 probable transmembrane helices predicted for
FT                   PA-RVA5-3212 by TMHMM2.0 at aa 7-29, 33-55 and 393-415"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   CDS_pept        80965..83535
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3213"
FT                   /product="similar to clpa/b-type chaperone"
FT                   /db_xref="GOA:B6VKY5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY5"
FT                   /protein_id="CAR66815.1"
FT                   /translation="MSNYLKQIVGKLTVEARQCLDEAANLAVRRTHHEVEIEHLLLALF
FT                   EKQMPMMEQVCHHGGIDAIALLNACQRSLTLLRSGNHRPPVFSTNLTEWMEQSWMYAST
FT                   RSYLGSLQITAQALIVTLLVNPSLQHSLTSELQQALQCNSDAIEQWLCTQVHPEPQQMT
FT                   TTRDNTQSALSQYAHHLTQAARDNKLDPVLGREREIRQLIDVLLRRRQNNPLLTGDAGV
FT                   GKTALIEGLAQRIVDGRVPEVLTQAELFTLDMGLLQAGASVKGEFESRLQNLLDEVKEY
FT                   PAPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRAIAATTWAEYKKYFEKDAA
FT                   LARRFQVIKVEEPSLELATAMLRAITPAMEKHHGVKILAEAVTEAVTLASRYISGRQLP
FT                   DKSVSLLDSACARVSVSQTDEPAPIEDLRAMLANIATEQAALLREGGHETQLKKLAQRQ
FT                   AELQASLEEILPEYHIQRQLVNDILTCEEHDEQLPKLRAELHQRHRQHAYVFDCVDAAC
FT                   VADIVAGWTGIPLGRMVENERDVLRQLETRLGQRVMGQDHALSQIARQIRIAKAQLADP
FT                   VKPTGVFMLAGPSGVGKTETALALAHELYGGERHMITINMSEYQEAHSVSGLKGSPPGY
FT                   VGYGQGGVLTEAVRRQPYSVVLLDEVEKAHPDVLELFFQVFDKGMMEDAEGQQINFRNT
FT                   LIILTTNAASDLVMRAAMHGVKEQGENRPATLEDIQEIIQPELQRIFTPAFLGRLQVIP
FT                   YLPVHGEVLHAIVRHKLNKVVGRYHQATQCELHYSDGLVNFIAEECRIAESGAREIDNL
FT                   LMQFVLPLLSDQLLLGDTPVNEDVRLDVMDNKVQLLSDKTELSP"
FT   misc_feature    81031..81189
FT                   /inference="protein motif:HMMPfam:PF02861"
FT   misc_feature    81601..82185
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    82696..83220
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    82708..83118
FT                   /inference="protein motif:HMMPfam:PF07728"
FT   CDS_pept        83600..84859
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3214"
FT                   /product="hypothetical transmembrane secreted protein"
FT                   /db_xref="GOA:B6VKY6"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY6"
FT                   /protein_id="CAR66816.1"
FT                   /translation="MLRNEILMKMKKIVVFWFIFTLVNFALALLSLQVRDVWSLSSLVW
FT                   FPAGLLQGIFCARAPRYWPAWLITGALISLTASQWYGRPVNVSLIFSCINVVMLVVTGL
FT                   IWQFFYGAMWAPKRARDIFSLIILCSLSGIIERFMAKWVLHLLDYPTDISISLLLVVGS
FT                   VLSYLPFTFFIISFITHEKNRTGDRRVYGLCLVALFVMAILFTSPPPETGKIHWQGIAL
FT                   MFSFSLPMLLALSGDLLVLSSFLSLCTLGVVSATIFGFGPFSFPLMNLQQNVQMAAWYS
FT                   TAFTLPALLCCSCLYKTINALHRRKARFLLLSAMLEQEQINCFRLSADGHLYWHHDAAW
FT                   MRCGKAPAYWSQLMAWVHKEDRQKIEQLKSSVSLIPQVLKVRIADGKGEFNQVIIALII
FT                   HVGENAGFIEGTMREIADKK"
FT   misc_feature    83600..83683
FT                   /note="Signal peptide predicted for PA-RVA5-3214 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.907) with cleavage
FT                   site probability 0.756 between residues 28 and 29"
FT   misc_feature    join(83636..83695,83708..83767,83786..83845,83858..83926,
FT                   83963..84019,84062..84130,84167..84220,84248..84301,
FT                   84314..84382,84425..84493)
FT                   /note="10 probable transmembrane helices predicted for
FT                   PA-RVA5-3214 by TMHMM2.0 at aa 13-32, 37-56, 63-82,87-109,
FT                   122-140, 155-177, 190-207, 217-234, 239-261 and 276-298"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   CDS_pept        84877..85503
FT                   /transl_table=11
FT                   /gene="pvpR"
FT                   /locus_tag="PA-RVA5-3215"
FT                   /product="pvp response regulator (two-component response
FT                   regulator bvg protein)"
FT                   /db_xref="GOA:B6VKY7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY7"
FT                   /protein_id="CAR66817.1"
FT                   /translation="MSRRVIIADDHPVFLLGLRTVLATLPENYQVVGEAHDVTALFSLL
FT                   EEKEVDMLITDFNMPGDNQIDGLRMISRIRERYPSLPIVVITMISDRKIIASLIDYKVK
FT                   AILNKNSLSHELVKGLYSTTGCHEPYLSEQFLESPGEEVVKALTSKELEVIKLLGQGLS
FT                   VNDIAARLYRTKQTISAQKISAMKKLGLNNEAALYNYLHQVGLGL"
FT   misc_feature    84883..85239
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    85306..85479
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   CDS_pept        85555..89115
FT                   /transl_table=11
FT                   /gene="pvpS"
FT                   /locus_tag="PA-RVA5-3216"
FT                   /product="pvp sensor (virulence sensor protein bvgs)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="GOA:B6VKY8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY8"
FT                   /protein_id="CAR66818.1"
FT                   /translation="MLPLSGQSLNLFEFHNAQELPSDGLPVEFYSNVVTQEFVPLPVKE
FT                   HEILAPHFPTLKVGILCCIGSPLVTHRWDGKLEGIYADYLRLIETVLKRPVEVRLFGNW
FT                   ASAYEALQRGDIQLLSHSASSQSENRSDNTYPILVQPLALIMRKEQVNMPFDKMNIMAA
FT                   PGSNPNIIKQLSKYYRSVLVAKSQQEAIQAVVDGQVDAYLDGQSQIAYLLAFRPFSELT
FT                   YRRDLSQGERYNFLGRNGDGMVETINLILTAIPHEIRTKVYQRWVSGLALGNNNDTAIF
FT                   SPQEKAWIKKNPVINVATSRTEPPYSFLDKKGEITGLDVDILRLIGEKSGITFNFIPAD
FT                   GAAGVKKLLKNGEAQMTSLVNTPDRNRWLSFSHPYGTVEWVMITHNGRNAPYEFEQLKH
FT                   HRVAVPRDHALMSVLKQYPDISIVEVDSVTKGIEMVLAGAADATFDSLISADYLQANRY
FT                   GSNISIQFLRDSLQPEQYAILPSYPQLVSILNKSIDALPPNELRVLRLKWLSMANVTPY
FT                   DDNKISPWLKLWGGALFVIALSSAFWGSYLAHQIRRRKKAENNLQNLLAYWETLFNNIP
FT                   TPMFVCDPTMCITAANLYFRREMSQAGSDVIGRSLFSLCFLNPDDEQDISMIFLHCMEG
FT                   ELAHFSDRSIVVQSQNKDVYLWLESYSNTEGVVQGIIGGWFDVTERKLLAQELRQERDK
FT                   AELASLEKSDFLAHMSHEIRTPLQAIIGILDLEVKQQTQQSTPLHIAWHAAMSLQGIIG
FT                   DVLDFSKIEAGRMVLNLKSESLQDVLESCAATFSHRAKEKGLYFIRQFDLPSEYYHLLD
FT                   AIRVTQVVNNLLGNAIKFTEQGGVRISTSYQHIADSNRDEITLVVADTGCGIPETLYEA
FT                   VLLPYVQVTQNNGGKTGTGLGLPISVQLVELMGGSLKITGVPGGGAQVTVMLPLLRSTM
FT                   EKEVASEKTESISTEINEPLNILVVDDLPANLQVLSLQLAPSGHYVVLAESGEQAMNLM
FT                   ENGYFDIVLTDCQMPVMNGYELTQLLREYEQLRQLPPFIILGCTANAFSTEQTRCLEAG
FT                   MNGVLIKPLVQSKLLAEITRYYRQVNDEATLQFDEIQTLAQQDMVVERQLLSAIQKGMS
FT                   EDIAELRQQENQQFHEKVAHHAHRMKGAFALMRYQQGIRVCLRIEKGEFCDEKTVAVLL
FT                   TRAEHFQRQIEQRLEILQDG"
FT   misc_feature    86437..87087
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    87268..87603
FT                   /inference="protein motif:HMMPfam:PF08448"
FT   misc_feature    87655..87846
FT                   /inference="protein motif:HMMPfam:PF00512"
FT   misc_feature    87985..88332
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    88402..88755
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    88843..89079
FT                   /inference="protein motif:HMMPfam:PF01627"
FT   CDS_pept        complement(89318..89692)
FT                   /transl_table=11
FT                   /gene="pa-1L"
FT                   /locus_tag="PA-RVA5-3217"
FT                   /product="similar to pa-i galactophilic lectin of
FT                   pseudomonas aeruginosa"
FT                   /note="members of this family are similar to the
FT                   galactophilic lectin-1 expressed by P. aeruginosa
FT                   ((PA-IL,). Lectins recognising specific carbohydrates found
FT                   on the surface of host cells are known to be involved in
FT                   the initiation of infections by this organism."
FT                   /db_xref="GOA:B6VKY9"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012905"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKY9"
FT                   /protein_id="CAR66819.1"
FT                   /translation="MYDWSGSVPANAKNGKPTGLILKQGDIISVIAKGWVKFGRGDNQW
FT                   AAPQGSIPTYQLNSSDALSAKIGDKTYDIGNGVLHKTVPVDGELILLFNDAPRYYGDNS
FT                   DKFLVDVIIESRYSPLKERK"
FT   misc_feature    complement(89345..89686)
FT                   /inference="protein motif:HMMPfam:PF07828"
FT   CDS_pept        complement(90645..92411)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3218"
FT                   /product="abc transporter, atp-binding protein, hlyb
FT                   family"
FT                   /db_xref="GOA:B6VKZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ0"
FT                   /protein_id="CAR66820.1"
FT                   /translation="MKYWDNIQNLRNALSLLWQAAPRALTIAIASNLVIGLIPSALLYI
FT                   NAHLIESLTTNIAAAAVIALVSAYFILSGFQDGLNAISNFIVDTLRDSAVMLLKRKVNE
FT                   IIATFPGLAIHEDTKLREMAILSTKVGDELGEMVSHLYAVCTGILMIIPILFLTGQVAW
FT                   WIPFLMLVGMVPTVMYRARTESESWDVQEHHAATFNELRILERILTQPEFAKDLRLYRM
FT                   QAHLLSRWQTLYDNYLKHIKLVRTRNAIKLLFTSLFASICLGVPLYVVVDGFQLGKFSI
FT                   AQLAFLLGALVQLKDGLSAVIFNFGDLLRVSYAVRPYRNLVSIHTAKQETNCEDTRKPQ
FT                   TMPKSSVIMPCLTLRNVELRYPGAECAALEQIDLNIQHGQTIAIVGENGAGKTSLLKML
FT                   CGLYAPTTGELTWSVSHIPPRVIGVFQDFARFPLDVSGNLFTRDTQSINEYLREVGLNF
FT                   LENRLDTPLTTEIEGGADISGGQWQRLAIARAMAHIDEADLLVFDEPTSALDPESEGEI
FT                   MRLILKLAKQRTTVIVSHRLSLTRFVDRIIVLHQGRLIEAGTHDELIAQNGKYARMFHS
FT                   QASFYQKRTEII"
FT   misc_feature    complement(90756..91277)
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(join(91599..91667,91896..91964,92187..92255,
FT                   92274..92342))
FT                   /note="4 probable transmembrane helices predicted for
FT                   PA-RVA5-3218 by TMHMM2.0 at aa 24-46, 53-75, 150-172 and
FT                   249-271"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   CDS_pept        complement(92431..94368)
FT                   /transl_table=11
FT                   /gene="wbmC"
FT                   /locus_tag="PA-RVA5-3219"
FT                   /product="Conserved Hypothetical Protein"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="GOA:B6VKZ1"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ1"
FT                   /protein_id="CAR66821.1"
FT                   /translation="MGNFNMKLWSVVINATTIDIDAYVNALFNAMTDIQIDSMKKMDHQ
FT                   WATMIEADVRLCDTERKLTGIEISTAHSSYSGWIRDLDNDLLISSFRQNAPILDPSQGR
FT                   VIGEFSYISIQPGHVHAVTDHYATHPVYYWQGKNRQWVISNDLRMLLLFHHVPLNIRHE
FT                   SCFEFLTQSVMVGENELADGATFFAEIRKMPINSVLKINRTDGIFKLAPMNTSAASQYS
FT                   KTLSYHENFQHAFRECFDTCVADRLKAGADGILLSGGIDSSTVLGASLALNESPPMFCA
FT                   NMSFRDADLAMSQDDKIVEALVHHCNLPHNIVYADDFLRLPAPDDPIAYVDGPEPSANP
FT                   LAKEALASVFQHNNVSLIMTGEGGDIILGESMHQWILDSIRIHDGIGELHKYITENLRV
FT                   RPFSLDYFRHILTSLSPYLGRRALIKEVSNDQRLPDYFGAVLHNSMSQQAKLQKIKIAC
FT                   SQAKYLGHDYIKTLLFPRATYFDSLNIYCTHSHPLLDPRMTAFMLSCPPHLNHDYKRLN
FT                   LANPYATSKMLARKAYSDILPNFATDKQSKTSYALMARRMFYNSAKEMLRLTDRPMILD
FT                   SWKFIDQAQFRRYLMAYIIATEDPNTQLGVEYHYLRGVIDLEAWLMKFTQERTSVIHYL
FT                   KFSPLRTFVN"
FT   misc_feature    complement(92731..93669)
FT                   /inference="protein motif:HMMPfam:PF00733"
FT   CDS_pept        complement(94350..94823)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3220"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ2"
FT                   /protein_id="CAR66822.1"
FT                   /translation="MYFMKSNNAYIFLIHSLVRAILLEKPIKDAYLSIFKSIYPCTVRG
FT                   NFSDAAKHIDQSYFQEICDFIYQADSSEITSASCYSASIVVQLLASLHGIPSDMVIGIK
FT                   KQDEKIVGHAWIELCSDKFKTKIVNPGHVDLSGYSPLQRMSPDTAISEWATSI"
FT   CDS_pept        complement(95171..95287)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3221"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ3"
FT                   /protein_id="CAR66823.1"
FT                   /translation="MIKPTKIVSYGSFLAVILSKKSRPGDGVFGRGVKGGGR"
FT   CDS_pept        complement(95957..96430)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3222"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ4"
FT                   /protein_id="CAR66824.1"
FT                   /translation="MIMGILTGNDTPIPGKTYIIHPYPAGNYATAVTVASKFHAVPGSV
FT                   SLAIWESTEPLQQFECVERGNGDYLGFICRASPVNKHGAYLGYNAHEILVCQAQYQKKW
FT                   EDMVVIKRQSGGFEWCMRKDNHLAFVGVHGSIQLKILRKFTRTWGFTEWSPDL"
FT   CDS_pept        97149..98717
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3223"
FT                   /product="major facilitator superfamily mfs_1 precursor"
FT                   /db_xref="GOA:B6VKZ5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ5"
FT                   /protein_id="CAR66825.1"
FT                   /translation="MEFKMNVSQQIPAPNNYSEERNRYSVLLPLCAAGIIIPIVFTGPA
FT                   IATPMIALELGGSSIELGGIVNAYNVAFGSCVMAGGTLADRFGRKRCFLSGLILFFITS
FT                   LLIGFAPDIISLNILRGIEGIAGALTLTSSSALIAQEFDEHLRLRAFSFLGTSFGIGLA
FT                   FGPMLVGTMIANFGWRSLFFFIALVSLLVLLFSAKKVNESKDPEAKSIDWPGIILFTLA
FT                   LSTLTLGIVFAPERGWTDIYIIGLFLTSALLLVVFVIAEVKSRYAMLDLSLFRYPRFIG
FT                   VQLLPISTGFCFVALLVSLPIWFIGIQGFNEGRVGLAILPLTAPMLVVPFIAGYLSKYV
FT                   SPGLICSIGLLVAAVGGCWLAFSLQVDGNINSLVGPLLMIGIGSGLPWGLMDGLSMSVV
FT                   PKERAGMAAGIFTTMRVSGEALAIAIIGALLAAKTSAILVSAKADHAFSNIVSSEWGGK
FT                   IASGQMSSILESVTDADRASLGHWLATIYQNSFGSILLIIAALTALSALACALLLRREK
FT                   QNSIR"
FT   misc_feature    join(97221..97289,97332..97400,97425..97493,97503..97562,
FT                   97599..97667,97680..97739,97776..97844,97857..97925,
FT                   98001..98069,98097..98156,98175..98234,98277..98345,
FT                   98406..98465,98619..98687)
FT                   /note="14 probable transmembrane helices predicted for
FT                   PA-RVA5-3223 by TMHMM2.0 at aa 25-47, 62-84,
FT                   93-115,119-138, 151-173, 178-197, 210-232, 237-259,
FT                   285-307,317-336, 343-362, 377-399, 420-439 and 491-513"
FT                   /inference="ab initio prediction:TMHMM 2.0"
FT   misc_feature    97236..98441
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS_pept        98760..99563
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3224"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ6"
FT                   /protein_id="CAR66826.1"
FT                   /translation="MDLQLTGKRALVTGSNSGIGRAIAISLANEGVQVVVHGRRKKETE
FT                   EVMQEILDYGGQACMVIGDLTDDDQAQNVVRVAQVAFGGIDILVANAGAFPPTPILEST
FT                   AQDWLNLYDQNVGSIIRLLRFIVPSMVENGWGRVITLGSIAASRPFASFGAYATTKSAC
FT                   VSLAVTIAKEFAGTGVTSNCISPGDVITPAAEQHWRTVAKRNDWSDEWEKIESHVATNI
FT                   SPTLVGRLGRPEEIADLVTFLASPKSNYINGSNFRIDGGFLASTA"
FT   misc_feature    98781..99284
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    98787..99536
FT                   /inference="protein motif:HMMPfam:PF01370"
FT   CDS_pept        99724..100839
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3225"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="GOA:B6VKZ7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ7"
FT                   /protein_id="CAR66827.1"
FT                   /translation="MDTHYAALFAPMSFGSQMLKNRIVMSPMTRQLSPNGIPGQVNAAY
FT                   YRRRAEGGVGLIITEGVCIPHIAANGYADVPVMYGDEALNGWKTVVKQVHEYGALIIPQ
FT                   LWHVGPMRRPGIGPDPLVPGYGPMTISDGGQTIVKGIDEKDIKDIIDAYVQAAKNALDI
FT                   GFDGIEIHGAHEYLLDSFIWQVTNQRTDKYGGTFNNRIRLASEVVSAIRKATTPEFPIV
FT                   FRFSQWKIRDYGAKIIETPDQLEKFVTTLVKAGVDIFDVSTRRFWEPAFEGSPDSLAVW
FT                   TRRLSGKPTIMVGSVGLDKAYAIAQLRGDEKPDAGRADLAPAIELLASGSVDLVALGRM
FT                   LLADPEWPTKVYEGRLSEILPFNKSSMTTRL"
FT   misc_feature    99742..100797
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS_pept        complement(101033..102004)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3226"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ8"
FT                   /protein_id="CAR66828.1"
FT                   /translation="MTDCISVPPVSSSSTPQTTVLCTLLSRADSSSLTERRKDPNQMLD
FT                   VQGNPLVEPSLVINAFEKDANLAFEKWAEYWRKVHGPRFIHALPREAGGEYTLLRYDQI
FT                   HRFSSGPSSINPLPYKPPLDKDGHLFNTIIGHIPVHRRPQWDGMAYLSFPNRDNLYSLF
FT                   EHPEISRAILPEDQVIFRELCPVLCRQHVLIPGKIRSDPILLVNIHQRATELNRSDFHE
FT                   ILLYKYAKQIISQPSTQKFVQRYIQLHNIGPITVGEKFFHPIAKDIDAISIMTFASITD
FT                   LEDFLQDLDLSATLENNSLFNREKSEYWSALSHTLINQNSLK"
FT   CDS_pept        102349..104031
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3227"
FT                   /product="putative oxygenase"
FT                   /db_xref="GOA:B6VKZ9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6VKZ9"
FT                   /protein_id="CAR66829.1"
FT                   /translation="MHQPPSLDYKKPLDINLSVPRKVPVVIVGAGLVGLTLALDLARRG
FT                   VPSVVLETRQVLTEGSRAIVFAQRSLEILQRLGLGERLAEKGVNWSLSRVYHGERESFS
FT                   FDFKTEPYFGCPAFLNIQQTYIEQWLIEDCLASEWVDLRCLNTVSALESNSVGASVMVT
FT                   CPDGSYQLDCDWLIACDGARSFVRNTLNLPLIGRHFDDHFLIVDVEMKPDFPAERRFWF
FT                   DPPFHPGHSVLLHKQPDNLWRVDFQLGVEADPVFERHPARVTERLKAMLDPKIAFKIDW
FT                   ISIYTFRCRRLENFVHSRVVFAGDSAHEVSPFGGRGGNGGIQDADNLAWKLCAVVKHGA
FT                   SSKLLQSYNEERIHAADENIMNSTRSAQFITPPNHAIETLRRASLVLSETTAMGRTFVN
FT                   SGRLSSPARLNGIGQFLYDTSVKGKVKPGDVALDAPVKNGDESSWLLHFIGRKGFTLLC
FT                   YRQSSNYDGGVNHLEDISSPYPLEIITVVPATVEQLAVTSIDVTLVDHYGLVAKRYDLA
FT                   GGSVVLFRPDQHVLEIFSSFNRDDIERTLAYSIPIATHAESKI"
FT   misc_feature    102412..103437
FT                   /inference="protein motif:HMMPfam:PF01494"
FT   CDS_pept        104031..104264
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3228"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL00"
FT                   /protein_id="CAR66830.1"
FT                   /translation="MKSYNHFLAESLITYSHLTDPDACYEMITEACQELGDELGNLFYA
FT                   QLVLLLVNHIGDSNILREAITVTRKGLMTAAN"
FT   CDS_pept        104309..107821
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3229"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein"
FT                   /db_xref="GOA:B6VL01"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL01"
FT                   /protein_id="CAR66831.1"
FT                   /translation="MILDTSYRLESRYRRGIDEPQGKIFISGQQALVRMLLAQSALDRS
FT                   VGLNTAGFVSGYRGSPLGGVDKELWAAKNLLEQANIRFQPGINEDLAATTLIGTQRVET
FT                   DKMRRFDGVFGLWYGKGPGVDRSGDALRHGNAYGSSPHGGVLVVIGDDHGCVSSSMSHQ
FT                   SDQALIAWGLPVIHPINLQDYEYCGLWGWALSRFSGLWVGFKAITETVEATASVNVSGF
FT                   PSFKQPEVDVGPDGLHWRWPDLPGMQIERRFAYKLEAARRFIRENPLDKVDCAPVTPKL
FT                   LIAAVGKAYLDVRGALDELGITLTELEAAGIALLGIRVVYPLSPILKDWAQRSEKVWII
FT                   EEKAGVVENSLKASIFNSVLNTQPLIIGKSDENGIKLLPNEDELKPSRIVDVLVKQLRE
FT                   CGLSVEVPSFWSMKLIERSVNWVKRTPYLCSGCPHNSSTMIPEGSQARLGIGCHALAAR
FT                   IPERATTGSVQMGGEGVDWIGQMSFVKTEHIFQNMGDGTFFHSGYLAIRQAIAAKANIT
FT                   YKILYNDAVAMTGGQPLDGSLSVEQVATLVCNEGAQEVVIVAKEPERYKTKGRLPEQVK
FT                   VYHRDQLNEVQLRLRTIPGVTVLIYDQVCAAEDRRRRKRQPVPAKKTYVTINELVCEGC
FT                   GDCQIQSNCLSVVPVDTEFGAKRAIDSESCNTDLSCLKGFCPSFVTVTGKPRLVNTDKT
FT                   KQTKRQLIMTRADELPLPQLPSINQCYEILITGVGGTGVVTMAATIGLAAHLQDFSVSV
FT                   LDFTGFTQKGGSVFSHIRIGAKDHILHQHRIDRGCANVLIAADLTVASEDEALNALLSG
FT                   QTKIIANTHEMQTGSMVRDRNLKIDTSEIEKRLIALVGEDCYDAINARYFATQFVGSIQ
FT                   TNILLLGYAWQKGVIPLSLQVFEQAINLQGGDITANKVAFACGRLLANDPEYIQSLVAP
FT                   AAKSYQPIRTSSGSGEPGLRKIIESRSRYLTDYQNERYAAKYRAQVDAVIKATANWGDF
FT                   TLAHAVARNLFKLMAYKDEYEVARLHSSPQFLNSLTESYIGHPKLNFHLAPPFLGKWLE
FT                   KNGYHRKITVSGWIIPFFRGLAALRCLRHTFFDIFAWSHERREERLLVSRYKDTLNDLL
FT                   SKISPNNLSLIVQWAEVPENIRGYGHIKERSIAAAYKRQDELLNQIANGGSTIYSAIPV
FT                   KEVS"
FT   misc_feature    106493..107056
FT                   /inference="protein motif:HMMPfam:PF01558"
FT   CDS_pept        complement(108420..109301)
FT                   /transl_table=11
FT                   /gene="ygfI"
FT                   /locus_tag="PA-RVA5-3230"
FT                   /product="putative lysr-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="GOA:B6VL02"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL02"
FT                   /protein_id="CAR66832.1"
FT                   /translation="MFFSKKIKQFIMIANKGSFKEAADELCLSPSALSKGMKEIEEQLG
FT                   VQLFQHSRRNAKLTVNGELLYRELFPYYQDVNSTTKRLMKSFSNSKKNVINIATDGTLF
FT                   PSLSSIISKICSSESSFLVDVRTYPNHLISDIIFHEKADIFIGLRNEDNLHSSIESMDL
FT                   TPNFLGLAVTKHIIKYSKSNMDLLLTNNIIQTENMLFLKEFEQIKKHLLNLNYNRSIIT
FT                   IPNIYDVLQALRDGAGISFVPQCEENLLLIKKYDLALISPPSPFNIKINRKIYYKRENK
FT                   EELQWLIKLIHI"
FT   misc_feature    complement(109113..109292)
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   CDS_pept        complement(109686..109832)
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3231"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL03"
FT                   /protein_id="CAR66833.1"
FT                   /translation="MGRRKRGKSDTIDVEDAHRITLKSLAQRYLELHVEIGELDIMIGC
FT                   HCY"
FT   CDS_pept        110442..112007
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3232"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL04"
FT                   /protein_id="CAR66834.1"
FT                   /translation="MNTAQEIINRLSGRAVTLGWDVVIAYDRKKINTLLEQQYVEKVKN
FT                   GENFPLINWENQRKTLQFKDLQLGVPLISFENSTLENSRALATIEFISGAIIEFSDSGQ
FT                   IINYKKIEPSHGYGMVLTIDLMAGTGSVEEQGRVIINLNEGAILDLHVIQQPPAEVVEF
FT                   FRTWLMANKMTYELGKLDLSSQAGLVPRSFRIRTQRAPEKIRKATSDEGNGAVLLFVAT
FT                   NYNPTSGTLPAKDYPWLIPEEYSGALLIGNKCLFKDILKPNLDQLFDKGEWTLKVQQTD
FT                   SDQLLHYLEANSAYITDKPYMADFEGTQDGVWTGRYKFETGRGHYGVYENVRFPINGML
FT                   MKPAKTGLQLSIDSPQSHQFNVDFGMKWFHCANIMCGYSWFNETYPFYLDGKSFYQVHI
FT                   DPDKEVIYFTGPDEDINIVGNYSPPAWWQSKWQKHISDDFTDISSEKFKRLSQIKLPEI
FT                   CMFAVNHLLFPGHNTLLLKDVYLPGDMVIFGDINPSLTAFRVTPLKATVVAKGTQQFKA
FT                   IETN"
FT   CDS_pept        112007..112123
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3233"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL05"
FT                   /protein_id="CAR66835.1"
FT                   /translation="MIIPFILQVAALLATFTHPSHIVSYAPGDSLPGRRDAS"
FT   CDS_pept        112215..112664
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3234"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="GOA:B6VL06"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL06"
FT                   /protein_id="CAR66836.1"
FT                   /translation="MSITQEQIAAEYPIPSYRFMVSIGDVQVPFNSVSGLDRKYEVIEY
FT                   KDGIGNYYKMPGQIQRVDITLRKGIFSGKNDLFNWINSIELNRVEKKDITISLTNDTGS
FT                   KVLMSWVVSNAFPSSLTAPSFDASSNEIAVQEISLVADRVTIQVP"
FT   CDS_pept        112690..114063
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3235"
FT                   /product="phage tail sheath protein fi-like"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL07"
FT                   /protein_id="CAR66837.1"
FT                   /translation="MSVQTTYPGIYIEEDASLSLSINNSPTAIPVFIGKFYNLDGSLPK
FT                   VGTCSRITSWLDFTKKFSVAPPQTISLIASPIADTQESVPKAVQYTYKAEFETSENLAN
FT                   GAYAVQHYFQNGGGICYIIPLVSVKKEDAAIELTKLPELIERQQEITLIVCPEDDKTLT
FT                   VDSSKKSDVYNSINTLLSNKVGYFLIADSDDGKAVPDTLPEKTAVYYPGLLTSFTQRYA
FT                   RPADSAIKVTGITNISTLADIHTNLADDYSTASQVINDVLEKNNKLASSPIILPPSAAV
FT                   AGAYAAVDVSRGVWKAPANVMLSNATPIISISDAEQGVMNPLGINAIRSFTGRGTLIWG
FT                   ARTLDKTDNWRYVPVRRLFNSAERDIKLAMRFAVFEPNSQPIWEKVKAAINSYLQSLWQ
FT                   QGALQGNKPDEAWFVQIGKGVTMTDDDIKNGRMIIKIGMAAVRPAEFIILQFTQNIAQ"
FT   misc_feature    112699..114060
FT                   /inference="protein motif:HMMPfam:PF04984"
FT   CDS_pept        114371..115537
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3236"
FT                   /product="phage tail sheath protein, putative"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL08"
FT                   /protein_id="CAR66838.1"
FT                   /translation="MSPTLPGVTMTQAQITAFGVSTLNMPVFIGYCTRLPAFSAPVKVN
FT                   SLAETEQIIGKEGRLYALLRHFFDNDGIQAFILSLGAPAGENANSWLEALQQPDLYAAV
FT                   AAEPLITLLAVVEASELNQKEGNEAVEAWRQYWKAVLALCQARSDLFAILEAPDDTALI
FT                   KRSLQDFHHKARQFGALYWPRLETSYQSSQLKILSPIGAVAAVIQSNDVRRGVGHAPAN
FT                   IALKQTIRPIKSRLELEELYEESDGSLNLICSFPARGTRIWGCRTLAGIDSPWRYIQTR
FT                   LLTSHVERQLSQLGCMLMFEPNNAVTWMKFKGHAGNLLRQLWLQGVLYGQREDEAFSVE
FT                   IDENETMTRQDIDEGRMIARIHLALLAPAEFIAVTLNFDTRSGIATST"
FT   CDS_pept        115555..116025
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3237"
FT                   /product="Conserved Hypothetical Protein"
FT                   /note="putative conserved hypothetical phage tail region
FT                   protein"
FT                   /db_xref="GOA:B6VL09"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL09"
FT                   /protein_id="CAR66839.1"
FT                   /translation="MTLPAELYTPAVSHRFIVNFLFKGLLPSPVDIRFQRVSGLGRELQ
FT                   VEQRHQGGENARNHWLAERIQHNSLILERGVMVVTPLTLMFDQVMRGETLNWADVVIIL
FT                   LDQAQRPITSWTLSHALPVRWQTGDLDANSNQVLINTLELRYEDMRIIGVKL"
FT   CDS_pept        116022..116204
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3238"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL10"
FT                   /protein_id="CAR66840.1"
FT                   /translation="MTIEIRELIVQARVVGTDTKTTRTVPLSIVQMETLIEQRLVEKVK
FT                   REILDVLREEQGGGL"
FT   CDS_pept        116201..116884
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3239"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL11"
FT                   /protein_id="CAR66841.1"
FT                   /translation="MSLLERGLAKLTITGWKERERKHQIGKLEAMYNPETLQLDYQTDY
FT                   LPDVSNNQVTVSNRYVLSKPAGLTLSLLFDANMAGLTTTVESQITTLKSLCLVNASTDE
FT                   PNFLEINWGAMRWENKNYFVGRASGLSLTYLRFDRNATPLRVSAQLTLVADESFVLQDN
FT                   QAKLDAPPVSVVNVPDLTSLPALANIASVTTMLGVDYLMLARTNDMDNLDDMQPGQTLR
FT                   TPEAS"
FT   CDS_pept        116881..118437
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3240"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL12"
FT                   /protein_id="CAR66842.1"
FT                   /translation="MSFLDNSNFKPSDIKLFVNIQGVEKELNELIVSELKISRRINAIP
FT                   QAVVKLRAKESESGVYQSDVQRMLKSCRPGVKAELRILNTRLFSGDIVQQKTELVYAKT
FT                   HTIKLVLRHDLQRITGNFRTRVFANTRDRKVIADLLNTATLKPAFSGTSHWDIDHEQLV
FT                   QYRCSDWQFLLQRLYATNSWLLAEEDKDNTQGKVTIIAPNSLPLNERWTLQHQADHQAI
FT                   RLYSTELMLDNRFDTAEAVVSAWDIDDQALLVAWKETLSQVGKDALASDNFSQTNKDSS
FT                   ELLLSCPLSTKEVQFLTRSQLVMRRLTAVRGSLKVEGSTKYRLGHELMLSGFGENMDGS
FT                   QILTGVDHRITAEESWKTTLHVGLELPLKAEYVTQVNGVHIGKVADYQSDSKKWDRIPV
FT                   LIPAFGTNIPLFARLGKPYASHQSGFCFYPETGDEVILSFLEGDPRYPVIIDSLHNPKQ
FT                   QTPLQISKENNLKMLMIKQSDKDEQQLLFDSQQQTVALIGKKNIEVKGEYINLTKSKGT
FT                   R"
FT   CDS_pept        118437..118883
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3241"
FT                   /product="similar to base plate protein gp25 of
FT                   bacteriophage"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL13"
FT                   /protein_id="CAR66843.1"
FT                   /translation="MANTLIGQVYGQGWAFPIKFIPDNKETADQTAGIVMAQGIEDVSQ
FT                   SLEILFLTEPGERIMREDFGCGLQDFVFENISDTLISAIKNRIQQAILRYEPRAYLLNV
FT                   DIQTKENQPGHLLIQINWKLRGSDISQRLDGVLRLHSGQALELL"
FT   misc_feature    118554..118850
FT                   /inference="protein motif:HMMPfam:PF04965"
FT   CDS_pept        118880..119305
FT                   /transl_table=11
FT                   /gene="afp10"
FT                   /locus_tag="PA-RVA5-3242"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL14"
FT                   /protein_id="CAR66844.1"
FT                   /translation="MTNYIIIDGDLIQINPKFEGDRTLTINGIPKISGNGDAQIEGKNI
FT                   CVSGDHLTVSIPAIYITSRHPVAGSGKVKITNLSDDQLAEFCVSGDVVIIEGSQFEAQF
FT                   TPDKPATNPSNQDADNPAPSNGSGRFIHSQNFVKAEK"
FT   CDS_pept        119358..121157
FT                   /transl_table=11
FT                   /gene="afp11"
FT                   /locus_tag="PA-RVA5-3243"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL15"
FT                   /protein_id="CAR66845.1"
FT                   /translation="MDLAELNNTLMNDLPTTNFKLETKDPLTQLKWLQRYTENIRFYAN
FT                   DDYFWHQFWFLKNHTPEALFARLQGETLADGELPPHQALLLAFLQQLKTPGIMLDTFSA
FT                   RHRQLYYQELLGITQKDAQPDHVALGVVLSTGIAEYLLPTGTLVDGGQDSSGNSLQYAL
FT                   DTDLLVNPGQLTDVRYSYLDHKTYKIFILQDDKANISWPSSGARLFVAPEGNGQEKAPE
FT                   QKLALYLGFDDIQPGQTLSLFWQFIASTPLTLKWFYLNEINNWVKLDSVRDNTDGFFIS
FT                   GLWQAILPDDAVKMYFPETTSVKRYWIKAEVESLTESGDLWQPLLEGILYNAQTATLVD
FT                   ADNTDEKHFHDGLMPFSVQHLVNTVSEVKKIEQPWSSWGGTPQEDTTDFFHRAATRLQH
FT                   RQRALTWDNQIAMLKAEFPRIYDVISPNITWMNQLQTSNTQTLIVIPDVNYSDNKDRLR
FT                   PQFSPASLRQMSDWLQIHTSAWANPQVENPIYIDVSVTYEVQFSAGVNPDYALRQLQQW
FT                   LSSIYMPWYHADKKGVAAGDQIDFYQLFADIQRVPYVEHVKTLTLTTKDTSLTNGGVIK
FT                   AQQNEVLVLVWQQGEQIRQGESK"
FT   CDS_pept        121154..>123991
FT                   /transl_table=11
FT                   /locus_tag="PA-RVA5-3244"
FT                   /product="Conserved Hypothetical Protein"
FT                   /db_xref="UniProtKB/TrEMBL:B6VL16"
FT                   /protein_id="CAR66846.1"
FT                   /translation="MRQHNELFPVVKDAISFENLQAQGEKVISDQSGNIWSDKDKHDPG
FT                   ITLLDSLSYGVSDLAYRHSLPLTDLLTIAGKDTLFPAEFGPQQTLTCGPITLDDYRRAL
FT                   LDLHGNDAFKISASDPRDFLFQDIQLICEPKSKRYKYYFNPETLEYTFTPPSGDKFKTL
FT                   TLRGNYWLYWIPTRWAGKSANLPLVKRVMEDFLRENRNLGENVVQVTRVISTPIYPELV
FT                   IELADDITDAASVLASIYMLLEQWAMPMPARFTTEALQAKGLTNEEIFDGPWLRHGWIP
FT                   QLPTSQNYHTGMVLKMNHLINQLLAVEGIKRVVSLTLPETEYLHQIKDDNWSWQLDVGY
FT                   YPLLWGANPLEVITEKNNNYVKLFAKGGVRLQPDQKSVERLLSQESLINNAASTLPAGK
FT                   VRDLKAYTPISRRLPACYGLQNTLQKLKPEQRHLYQFLLPLEQMLADGCARLAFLPHLL
FT                   AFRDRSGNISDTLWPFKNTEDTIAQQVHQEYAGTLKAFQQQEISLFDDKNRPHHGNINR
FT                   ELDILDYLLGYFGTQRAKRPLTQDIHDFLQTQRGYLAQQPELGYQRDNIRIDRVSALQK
FT                   RIAARIGLDGTIFKESVDLSKLPFYLIEHRQLLPNLPHLDFQHDQTPQSFVISDNIVKV
FT                   KQAGIADKIVRGQLIDFIDIESKFTVRAQMIVAVEGNEFSLDTKNSIQLEKNLQLLQSA
FT                   SEKNNLRWRNSTAWLEDMTYRINYTDDQVIDDKTKQCRLQSNTKSPFPALIAPKNKITI
FT                   IKQSSPLSSIAEFTDEPEFKLVATVTEIDRIEGILTIERDDNQLPFPTKEESNQYIWYI
FT                   SDENYISSDRFSFVVSVVLNRGLVEREDIDQYKLEEWIERETLAEFPAHISLITHWLAS
FT                   ENFDDFAKTYQRWQNNGAQLGDESYTILEKLTLGHLPTGLTGISNMFIATEAQRLEVVG
FT                   ESGNEWNTQAIINNEL"
XX
SQ   Sequence 123991 BP; 33364 A; 25660 C; 30125 G; 34842 T; 0 other;
     ctgagggtaa cgcgatactt tatttaatga cgaaggaatt acatttatga aagcgaatca        60
     ctaccaccat ggcctttggg gatatgtttt tattactctg agtctggccg gagtattttt       120
     tttgctgatt tatcttaatc aaacgttgct ggcggaaaaa gggctgcttg aactcgcgtg       180
     gtatgccggt gctgtggttt ctctggtcat actgaccggt ttattgggca gcaagatctg       240
     ggagcatata tggcaaaata aagcacaaca aaaattccgg ccagagactc aacaggccaa       300
     gattatcccc agtcagtctg cgttaatact gagtgaatta ggtgcccgcc tgcaccgccg       360
     ttacggtcgg ttctggtggt tcaaagtgcg tattttgctg gtgatggggg agggggaaca       420
     ggtggaggcg attgcgccgg ggctgactgc cggacactgg ctggagggcc atcgcacgct       480
     gttggtgtac ggcggcagtg tgcagagtga gccggatgct gcccagttgg cggccctgcg       540
     tcggttgcgc cgtttccggc cactgaatgg ggtggtttgg gcgctgaccg aaacccagag       600
     tgcccagccg gttttgatgg acaaggcgct gcggatgtta cagaaacagg cccagcagtt       660
     acgctggcag gcaccggttt atttgtggca ggtgtgtcac agtgtctggt cgcaggaaga       720
     ccgtgtcact cagccggtgg gctgcttttt cccggaacgc acgacaccgg aagcggtggc       780
     ggcacaatta cagcgactga ttgacccgat gcgccggcag ggcatgcagc aactgttggc       840
     aaaaaatgcc catgattttc tgtatcgcct gtcgtctact ttggaaaagc agggaatggc       900
     tcactggcgt gatgtgctga cgccggtatt gcaggaatat gcggatgtcg tgttgttgcg       960
     ggggctgatg ttcagtctgc cggtcagagt caatcaagat ggcgcgcccc agagctggct      1020
     gccggacccg gtatggcagg gggtactcag tgactgccgg caggcccccg gcagacggct      1080
     gggatgggtt cagaaacggc aggtttatca cggcctgatg gcgttggcgt tgttgtgggg      1140
     ggcgggtatg gtgctgtcat ttttcagcaa ccgcgaccag ataatggtcg tccaggcggc      1200
     ggtggcggac ctgaaaacgc acccggccgc atccggggct gaactgatgg cgttaaacac      1260
     gctgcgcaat gaagtgggcc ggttgcagtc ccgggtggaa cacggggcgc cctggtatca      1320
     gcgttttggt ctgaatcaga atgagacgct gctggcgagg gtgatgccgg attacaccga      1380
     agtgaataac cggctgatac gggataaagc cgcggcggtg ttgcaggcga aactgagagc      1440
     gctggtgaat ttaccgccga acagtccgct gtgggcgaat cgggcgacag ccggtcatga      1500
     cctgttgaaa gcctacctga tgatggcccg cccggagaaa gcggaggggg catttttaac      1560
     ccggatactc agtgaaaatg aaccggcccg ggccgggatt gcgtcgggta tctggctgag      1620
     tgcggtgccg gatttatggg atttttacgc gcacaatctg gcggcccatc cggcatggaa      1680
     aatcaccccg gatacggact taatccggca ggtgcgtcag aaactgttga cccagttaag      1740
     ccgtcacaat gcggatgcca cgctctacca gcagatgctg caatcggtgg cgaaggatta      1800
     tgcggacttg acgctgaggc agatgaccgg cgacacggaa gcggcgcggt tgtttaccac      1860
     ggataaagtg gtgccgggga tgtttacccg tcaggcatgg gaagggcaga tacagacagc      1920
     gattgataag gcggtggctt cccggcgtga agcgattgac tgggtgctga gtgaccgcca      1980
     tcagaccgtc ccggcggcgg tgtcaccggc ggagctgaaa gcccggctga ccgaacgtta      2040
     ctttacggat tttgccgggg cgtggcagac gtttctgaac agcctgcgct ggaatacagc      2100
     ccagagtctg tcggcggtgg tcgaccagtt aaccctgatg gcggatgcgc gtcagtcccc      2160
     gctgatagcg ttgatgaaca cggtggcgta tcaggggcag acgggtcagc aaggcgccac      2220
     gttatcggat tcactggtga aatcggcgaa agcgctgtgg aataaaaaaa cgcccccggg      2280
     gattgtcccg caggcggcag gcacgccggg accaatggag gcgacctttg ggccactgcg      2340
     ggcattgatg ggagacagtc agacggacgg gggaatgaag gcggatagca gcctgaattt      2400
     acagaccttt ctgacgcggg tcacacaggt gcgactgaca ctgcaacaga tgaacaccag      2460
     tgatgacccg ccggccatgg cgaatacgct ggcccgggcg gtatttaccg ggaaaagcac      2520
     ggcgttgaca gagacgcagg gttatgggcg tctgatagcg gccagtctgg gggaacaatg      2580
     gcaggggttg ggtcagacgc tgttcgtgca gccgttaacg caggcgtggc agggggtact      2640
     gaacccggcg gcggcgaatc tgaatacgca gtggcagacg gcgatagtgg acagctggaa      2700
     cagggcgttt gcggggcgtt atccgtttgc tgggggggag agtgaagtgt cgttaccgat      2760
     gctggggcag tttatccggt cggattcggg gcggatagag cagtttctga accgtcagct      2820
     aggcgggata ctgcataaag cgggcaaccg ttggagggtg gatgaggtga acagtcaggg      2880
     gttgcggatt aacccgcggt ttttgcaggc ggtgaatcag ctgagtcagt tatcggatgt      2940
     gctgtttgcg gatggcagtc aggggttacg gtttgagctg cgggcgagag cggtgcggga      3000
     tgtggcggaa actgacctga cgatagacgg ccagccgctg cgttacttta accagatgga      3060
     aagctggcag cgttttcgct ggccggggga gacttaccga ccgggggtga tgctgagctg      3120
     gacgagtgtg aatgcggggt cccgtttatt tggggattat caggggaact gggggctaat      3180
     tcgctggctg gcgcaggcga aagtggagag gctggatgag agtcgttatc agttaacgtt      3240
     tatggccccg gatggtttgc cgctgaggtg gattttacgc acggaaatgg ggagtggccc      3300
     gctggcgttg ctgaaactgc ggggctttca gttgccgaag gcgatttttg aggtggcacc      3360
     gggtcaagag aggccagccg agacgactga tgaggactgg gcggcggaat aaggcagata      3420
     gctctggttt ggaaattatc cgtatgttgt tcattaccgc actgatttat caccatgacg      3480
     cagtgaaaat aatgacagcg ggcggtcacc ggtaaaatag ggataaattg agtcgatagg      3540
     ataataatat tctgattaat gtatcgtgct ttattcgtgg atggatagac tggcaacaaa      3600
     attatttttg ttgcccagtt tcaaccgaca tcgtttattt tcattcgcat aaattaattg      3660
     ataatcattc tttttctcac gctgatttta ttgtatctat tgctggcctg aaaaataata      3720
     gaccttgttc gcgggtgtga tgtcatttat tgaaagaaat aaattatgcg attttcatta      3780
     tcatggcatt gttcggcaat aatcgaattt ttccgccctg ctatcttacg aagatacatg      3840
     ccatcttttt attcaacaaa aggtatgtcg tttaggtttg attgatatat tgtgtgttta      3900
     atatggtgat gttcagtctt tacggctgac ctgatttaaa caaaaagtgc tttctgacaa      3960
     aaattatctt gattttatac taatctgttt agaaaatcgc cggggttaag aaataactga      4020
     ttgggtcagt gtgaatattt attttgacgg acatgatcgc tttgctctta ttttctgccg      4080
     gctaaaggtc tgcttggaaa tagcgggatt cggtttttca ttgctgcaat gcgtgatgac      4140
     atcaccagga tattttgcgt tttgttttat gactgaggcg gggttggtgg taccacgttt      4200
     tcaagccgaa atatcccaat cccatcttaa tattataccc aatagatttc aatttgcagc      4260
     gcggcggcaa atgaacgcat ccccaggagc atagataact ctgtgactgg ggtaagtgaa      4320
     agcagccaac aaagcagcaa cttgaaagat gaaggggata aatgggattg gcatacccgt      4380
     aatagacaaa gaaaagtggc atggccgctg agagtatttc tcgaatatcg cttttatctt      4440
     ttactgaaat aacggagagc ccgccatgac tgtttcaacc ccggcgctta tctttgagca      4500
     caatcgctac aaactcgacg tacggaagaa caccgcgccg ctggatatcc tggcctttac      4560
     cgggcgggaa gcattaagcc agcctttttg ttacaccatt gaattcacca gcccggtgaa      4620
     aacgattgag ccggggcaga tgctgatgca taaagcggcg tttaccctgc actcgccgcg      4680
     ggtgaatccc ggtatccggg gcatgccgat aatcccgccc atgccgctgc gcacccttta      4740
     cggcgtgatt agccgtttca gattgctgtc tacctcgcat gacgaaagcc ggtatgaagt      4800
     gacactggtg ccccggctgg cgctgttggc gaacagtcat cagtcggcga tttaccagaa      4860
     tatgtcggtg ccggaaatcg tggaaaaaat cctgcgggag cggcacggct tccggggcca      4920
     ggattttctg ttcacgctgg cgcgcaccta cccgaagcgg gaacaggtga tgcagtacgg      4980
     cgaggatgac ctgcgatttg tgcaacggct gctggcggaa gtgggtatct ggtacaaact      5040
     gacggcggac gaacggctga aaattgacgt ggtggagttt tacgacaaac agcgtcacta      5100
     ccagtttaac gtgtacctgc cggctctgga cccgtcgggc atgcatggcc gggacacaga      5160
     tgcggtgtgg ggtatggaaa ctgcgcatca ggtggtggag gggaaaatcc agacccggga      5220
     ttacaactac cgcgatgctt tgccgcaata cgggatggat gtcgaggcgg atgtgacgcg      5280
     gggggacccg acggtttacg gggaagcgta tcactacatc aataactacc aggcactggg      5340
     aaaccgttat gcccttgagc cggaagcgga aagtggggtg ttttatgccc ggctgcacca      5400
     tgagcgctat ctgaatcaac agacgcggct gcgggggtta accagttcgc cgacgctggt      5460
     accggggcag gaattgaaag tgcagggtga ggcgcccgac gtgtttcgtc gaggggtgat      5520
     tatcaccgag ataaccagca gcgcccgccg ggatgaaagt tttgtcatgg cgtttaccgc      5580
     catcccctat tcagaaacgg tgtgcttccg cccggcattc attccgaaac cggtgatggc      5640
     ggggacgctg ccggcgcggg taagcagtac caccgtgaat gacgcctacg gggatatcga      5700
     caaagacgga ttgtatcggg tgtcgtttga ctttgaccgg gcgacgtggc cgcagggggg      5760
     agaaagcctg tgggtacgat tggctagacc ctatgcgggt gacacctacg gttttcactg      5820
     gccgttgctg ataggcacgg aagtggcgat agcatttgaa gggggcgacc cggatcggcc      5880
     ttatatcgcc cacgcgctgc atgactcgaa acacccggac cccgtcacgc tgtacaacta      5940
     caaacgtaac gtcttgcgca cgccggcgaa taacaaatta cggatggatg acgagcgcgg      6000
     gaaggagcac atcaaactca gtaccgaata tggcggcaag agccagctca atctggggca      6060
     tctggtggac agtcagcgtc cgcacccgaa taaacggggg gaaggctttg agctgcgtac      6120
     cgatgactgg ggggcaatcc gggcgggtaa ggggttgttt atcagtgcgg ataaacaggc      6180
     ggctgccggg ggaccggtgc tggagatgca ggtggcaatt agtcaattac agcaggcgca      6240
     ggcgttaacg gaagccttac gcggtgcggc agaaaccgcc caagctgaac tggcggattt      6300
     gcagcaccag aaagcgttat taaatgacac cttaacggag ctgaaaaaat cggcgctgtt      6360
     actttccgcg ccggagggga ttgcccaaac gacggcgaaa agtctgcaat tgtctgcggg      6420
     ggacaatgtc attgccacca gtggtaaaaa tactgatttc agcgtactga aaaaattcac      6480
     ggtggctgcc ggtgggatga tcagcctgtt tgctgaaaag ctggggatca aattgtttgc      6540
     cagtcgaggt cgggtagaga ttcaggcgca gggtgatgcg atgggacttg aggcgttgaa      6600
     agacatcacg gtaagcagtc atgaaggcaa agtgatcatc agtgcaaaac aggagatttt      6660
     gctggcctgt ggcgggggat atattcggat tggcaacggg caggtggaat gcggtgctcc      6720
     ggctcacatt atccagcggg caggggaatg gcagaagttt ggtggacaac ggaccagcca      6780
     gttggtccag caatggcaga ccaccagtta ttctgtgacg ccaaaggttg cacaggctta      6840
     taacatttct ccgttagctc gtcagaatat gcaattccat accggagatg gtggcgtgca      6900
     ggagttatca actgcacagg atgggaaaag cgccctgcaa aagcagattg gtgtggaaat      6960
     cagtaaattg aaaataaaag atgaggagta gattgtgagc gaaccgaagg aaaatgagat      7020
     ttatattcat ccggaatatg atgaattagg ctccccttat tacaacgtcc ccaatgccag      7080
     aacggaagag aatctgatag caacctgttt gaaatatgcg actaaagtga tcccggtgat      7140
     ttttctgccg ggggtgatgg ggagtaattt aaaatcgaaa caaggggaat cagtctggct      7200
     gctaaacagg atattgagtt ttgatgtttt agcctggacc tgtagaggag cgtcttacag      7260
     aaaaaaaacc ttagacccga ataaaacaga ggttgatgat tccggggcta tcacacctga      7320
     ccacacggaa aagaataaat tccagacttg cagtcagcgt ggctggggag agatagccca      7380
     tattagctat ggcactttcc tgccctggct tcagtcggtg ctggatgatg aacgtttggc      7440
     atttgagtac tgtttggcag ggcagggaca acaaaccctc cggcaacgca tggtagatat      7500
     gaacctgaat gcggagtggg gtgaagagcc gctgacacgg cccgaggttg accacagcta      7560
     taactttgtc tacccggttc atgtgatggg ttataactgg ctgcaatcca atgtggattc      7620
     tgccaagagg ctggcgaaat atgtggataa ggttttagct ttctatggca ggcgctgtgc      7680
     aactaacaag gtgattttag tcactcactc gatgggcggg ttagtggccc gtcattactc      7740
     tgagcagcta aatggtagag ataaaatttt aggtattgtg catggcgtga tgcctgatac      7800
     cggtgcgcca accacttata aaaggatgaa aaccggtgaa gatggcataa ctggattggt      7860
     tatcggcagt aatggtgcgg agatgacggc ggtgatggcc cagtctcccg gaccgttaca      7920
     gctgttgccg ggaatgaagt atggtaaacg ttggctacat atcgcggatg gtaaaatcat      7980
     gcacaaactg ccggaatcag atccttataa ggaaatctat ctggaaaaag agcggtggtg      8040
     gggattatgt gaaacccggt ttttaaaccc ggataaacag gataaatgga aggataatga      8100
     aagttgggaa aaatattcag caattataca aaacgaagtt cagcaattta ttgaagagct      8160
     aaccggtaac tatcattcga atacttatgc cttttatggt gccagtgaga aacacttatc      8220
     gtatggcgtt atctcttggc aagagcaaga taatggtaat tatgacaaaa cggaagatta      8280
     ttccggtatg acctttaatc agccagttta tgatcctatc gatctgaaaa ccggttcaac      8340
     acgtatagtt cgtttttccg ttgggccgct gtttcgggat attcatgata aaacttttaa      8400
     gctggctcct cccagggaac agggagatgg tacggtaccg atacaagctg gtcggattac      8460
     ctataacggt ttacgtggct tgctggcaac ggaagtcgac catgaagggg cttataaaga      8520
     gaataatgga acgaaagaga ctcccgctcg gttatttacc ttacgctcaa ttgtcaagat      8580
     ggtgcaggcg gtgaaaattg gataaaaaaa agtgtttact gattttattc gcgatagtgg      8640
     cgatttatgc cctgtggcgg tggtatttcc cggtttatga tcatcctgta ttaactgaaa      8700
     aggaaaagaa agtgacaact gaaatgttag cgaatatgca gacccgttgt gtgggccgtt      8760
     atttaattga tctccctgcc gggtttgaca atattgtcca tgacgggata tcgattggtg      8820
     atgcgagaat agaaactgag cgtctgtatc cccctgaatt tgaacatcgg atacggttaa      8880
     gagagcagga attaaagacg atgcaatatg ttaatcctaa aaatatgcct tttttaaaga      8940
     aggtttatcg tcttcagggg gatctgaatg gcgtgatttt cgacaggaat caggacacga      9000
     gtgtgcctgg ttatgcccga gtattggaag cgcatttcta taataatggg gttgctttta      9060
     ccataacaat gaaatttatg gagctgattg atgataaata ttcctatcaa agagagggtt      9120
     ttatcaaagc aggtttttct gaaagagatt taaatacaaa agatagaaca atgatgaaaa      9180
     tgagggattt gttatccaga atcagtggca gaaaggaaac ggaaattcct aaggtagccg      9240
     gtacctgtat tcctgatggt tttattgccg gtagtgataa tgaaaaagag gatattacct      9300
     ttgtctatca acgaaataag gatgaccatt ttaatttcag tattgagata ttgaatgatt      9360
     tgcaagagaa agaccatctt ttagatcgtt tgaagggaat ggaaggtata ttactggcca      9420
     tgcatgccaa ggtgataagg aaaggaaagc gggaaattaa tggcacttat acggaggaag      9480
     ttttaacaac tgccccggtg gaaacaaacc tggagccggg aactaagatg cctggatatg      9540
     catttagctt aattgccaat gaaaccgctg gagattacaa gaatcccttt gtgaatattg      9600
     atctgaaaaa tgaccggata tccgcgacgc cgtacagtga aaacgaatta atagcatttt      9660
     gggatgcggt aacgagcact tttcgtaaaa ggccgggtgc tttcgattca cgataaaaag      9720
     cgttttaaat taaacccctt atagggatat aagggttaat acaatcaagg agtataaaat      9780
     cactaaaata ccaataggta tttcacgttc agttatcagg ttagtgcagg cggtgaaaat      9840
     tggatatgcc gctgtggctg tggtattttc cagtctatta ttatcttgta tttaatttaa      9900
     aataaattaa gaaacgctat tgtgaaggtc aggaagatta attgggaatc atgacttttt      9960
     ttaacttctg attttaatcg gtataaagtc taaacggttt tttttaccac ttttaacatc     10020
     tgttttttat tgagtttaat catcatggga tattgtgttt tcagccagta aataatctta     10080
     ttatgtaaaa ataccctttt atgttttatc agctagttaa tttttttgtt caggggttaa     10140
     attctatcat attaaccgtt ttatcccttt tttattgcgt tgtttttatg ggttatttag     10200
     taaaataatg gtaaaaaata cctgagtgta tcccttttaa tagagtattt actgagttaa     10260
     atccactttt tatatacaac tttaatcttt ctgtgttcgc gttttcaaat ggttatggta     10320
     ggttaaataa atataaaata agcgaaggat aataatgttg ataaatgaat taaacatggc     10380
     agggaatagg tcgtttttag tcactcagta cctttttaaa atctggtatt aatgggggac     10440
     ttgttttttt aacacttata cccttcatct ttcaagttgc tgctttgttg gctgctttca     10500
     cgcaccccag tcacatagtt atctatgctc ctggggatgc gttcacttgc cgccgcgctg     10560
     caactcgaaa tctattgggt atataccctt catctttcaa tttgctgctt tattggctgt     10620
     tttcacttac cccagtcatg aactatgtta aaaaatgatt aacctgtaaa acgattatca     10680
     tttagcaggg ttttttattg tttaattaaa cattaatata gcaaatgatt ttcattgaaa     10740
     ttttttttaa tctaatggtt tttcccgttt tcagacccgt atttaacttc cccattttca     10800
     ttaaacgggt tttctcgttt ttctgtattt gttttttaga tttaaaacca gagcggataa     10860
     caacaagtat gataatggta ttaaaatcaa cgtccgtttc tctaatcatt tttaatgctg     10920
     ataaataaag ccccgtgtta acgaggctat ttttgatata caggtttttc caatacacca     10980
     cggtgtaata tctcaagttc tacggcgtga tataacgagt ttatccttcg gacggtccgc     11040
     ccaatcggag atctgattgc tgaagttatc tgccagcaaa taagacggag ttttagcgaa     11100
     ccaatcagag agtgagatat cctggtagat gccgttatct agcacaacca gcactttaag     11160
     atcatccttg ccaatatttt cgatatagtg accaaatccc tgtggcacgt aaccaacgtc     11220
     ggttggccca aatttcgagg tttgggcatg tccgtgggaa ctaaacacgg tcatacgtcc     11280
     tttgcctgaa atgtaatatt gccattcgtt agcattcgga tgccaatgga gttcacgtat     11340
     tgcacccggt ttaacgattt cgatgagacc ggtgatagtg gtagaaatgg gaaattcctt     11400
     cgatgatgcc cgataaataa tccctgcgtc gttctcaaag aagggtttgt ttttcaagag     11460
     ttgataacgg tgggtgagtg gggcatcgtt caatcctccg tcgtctaccg gtaggggaag     11520
     ttttggcggt atggcaccac cgacgatgta agcttcaccg ggtttgattt tagaaaaaac     11580
     ctttgctggc atgttaacac ttttctctag tacttctttc ggcgtatgcg ttatccaatc     11640
     agtgatgctg aatgtgccaa attctgagaa gtgcccatca tcaaaagtta gaatgaaatg     11700
     cgcgccacct tcaagcgctt gaatagaatg accatgacct ttgggaaaat accatacatc     11760
     gccggggcca aaatcggcga cttcactttt gccctctgga tcgataatgg taatacgtgc     11820
     atgtccttca agcatatatg cccattcagc ggcaatggca tgccaatgga gttcacgcac     11880
     accacccggt tcgagtgtca tatcaacacc agcaatccct tcagagatag gaaattgttc     11940
     tacggtagct tcccgtgccc atccgtattc aaatatacgt ttttcgctgt ctgtaaattt     12000
     atatttatac aaacttttag ctgccggagg tggtttatta ttacccgttg taacagtatt     12060
     gtgttgttcg tcagcaacag cggatttaat catactacct atgctggctg ctgcaccaat     12120
     tgcagatgct ttcaagatat cacgacgtga gaacatattt ttgcctccaa aatggaaccc     12180
     gtaagcgtgg ttgtaagctg atatatattc gtttgttttt cttagctaat cattgtcact     12240
     gaaaggaaaa atcagaggtg acttactaat catagtaaaa agatgaattt tgcaatgagg     12300
     aaaaaatgtt tatttttatt ttaggattag cggaggcatt tatttgccga aaagatacag     12360
     gaatagtacg cccatctgta ttactttctc gaaaggagca aagtttcatt ggatgagcga     12420
     ctattttact actgactgat taacctggga aaatcagcgc tgtctcagat tttttccgta     12480
     gtatgattaa tcttgtttgt cggaataagg acgaacgtat ttaataatac agtcaagttt     12540
     ttcgcaggtt tccagccatt ctctctctgg tttggaatct ctgaccagcc cagcgccagc     12600
     ctggagccaa cagcgtcctt tatgctgata gagagagcgt aataccagcg cggcatccag     12660
     tttacctgcg ctatctaata acatgacgca accgctataa agctgacgtg gttcaccttc     12720
     ataacgtgaa attgcctgta aagaaggttt cttcggtatc cccgaagcag tgactgccgg     12780
     gaataaagcg atgaacgcat cccaacgatt tttgtctgtt tggagtaatc cttttacccg     12840
     tgatgccaaa tgttgtactg aaccacgttc acgaatagcc ataaattctg acacacaaag     12900
     tgtttcaatc tggcaaatcg gcgccaactc ttctaatgcc agtttggcag aaactgcatg     12960
     ttcggagatt tcttttgggt cagaaagtaa atctgcccgc agccgttgat cctgctcttt     13020
     gtcatgggtc aatgctctgg tacctgccaa tggttgggtg ctgacccaac ctgaaccatc     13080
     tgcctcaacg acggtttctg ggctgaaacc ataagctgag aaatcttcat cacgcaggaa     13140
     gaaggagcgg gccggtgtgt tagcctgacg gccaagccag taactatgcg tcatatcaat     13200
     attggaccca agctcaactt tgcgtgacag gatcactttt tggtagtgac cagcggcaat     13260
     atctttaacc gcatttgcta cgttgtcttg ataatttttt gcggcggtta ccgggttgat     13320
     aatttctatc tctttggtat atgggaaagc cggtgtgcct gattgatcag cttgcctgat     13380
     tttttcgctc aatgtagcaa tctgatcttc ttcaagtgtc cgtatcagaa cctgcccttg     13440
     agttatgcgt aattcatgct ggggaacagt gattttgatt agtgcttcat tttgttgtgc     13500
     taatggtagt ccatatgtca tatgggaaaa ctcaaatagt gttctgccat aagcacgcca     13560
     gtctttgata gggagagcat taagcgcctg ctcaagcttt tggcttaatg tattaatatt     13620
     gtatggatga tgattacctt gtgaatcaat taattgtccc gatgcatcgg cacttatagt     13680
     cgctgcacag cccatcccta atgaccattc accttttgtt tcataaagtg tacaaggttg     13740
     tgaatcatta tcatctgaga gcaaatgagt gatgagatct aacggagtac tggtaatagc     13800
     aatcgtgcgt tcatgatatt gttgcattga attgccatgt tctgtttggg ctatctgtac     13860
     taattggcgt ttgtcgattt ttcccacagt ggttaatggc caatacgcca cagacaacca     13920
     ttgatcaggg attttatggc gttgaacgcc tttctgatgc aaaaatgctt gcatctgtgc     13980
     ggattctggt tgattgccac ttttaagcag gcaggcgcag attcgttcac ctaatagttc     14040
     atcagggaca gcaatgacaa ccacatcatc aatatcagga tgttgcagca ataatgtttc     14100
     tacttcttgg gtcgaaattt tctcaccact gcggttaatc tgctctttaa ttctcccctc     14160
     aacgatcagg ttgccatctg aattcatgcg aaccagatcg ccggtacggt agaatccatc     14220
     tgtggtaaaa gcgacggcgt tatgctgtcc ggcgcgataa tatccggtga tggtgtaggg     14280
     gccgcgtgta atcagttcac cgacttcacc aagggcgaca ggttgcaaat tggcatcaac     14340
     aattttgatc tcatcttctt ctgacaatgg gcgcccttgg gtattaatga tgacctcgta     14400
     gggatcgtct agtcgggtat agcagagtaa tccttccgcg gtaccaaata cctgctgcaa     14460
     aggaccaagg cgtgtcatga ccagttctgc cagttccggt gtgagtctgc caccaccgac     14520
     ttgtaagcag cgcagggatg aaaggtcgct ttgttcccag tcgcgggctt gctcccagag     14580
     acgcgccaga gccggcacta atgctaaatg tgtcaccttg tgctgttcga tcaatggcat     14640
     ggcttcatca cagctggcgg tatcactcag gagtacacat cccccttgag aaagggtacc     14700
     cagaataccg gggctgccta aggtgaagtt atgggcaaca ggcaatacgg ctaaatacac     14760
     actttccgta tttactgcac acagacgggc agagaggaca aaatcatagg tataggcgtc     14820
     gtgagtacgc ggaattaatt tcggtgttcc cgtcgttcct cctgagagta acaaaacggc     14880
     aatatcacca taggttggtc cagtaatatt gagcggttta tcatcaatgg atgctaatgc     14940
     ggtaaattct tccgcttctc catcaacgat aatgtgtttc agatcgggac aagatgccgc     15000
     aacttcccgc gccatttccc ggtaatcaaa accatgaata caatcaggga taatgtaagc     15060
     cactgggcgc gcaatctggc aaagcgcgtg aatatcatgt gcccgttgag tcggcattaa     15120
     taacactggg tgagcaccca gtctaaataa agcaaaacag gtgacgacaa aagagattcg     15180
     gttaggcagt tgtaccatga cgttatcacc acgacgtact ccccggtgaa ataacccact     15240
     ggccaatctt tctgcggatt ggtgcaattc acggtaagtt agctgttgtt cttgatagat     15300
     cagcgctgtt ttattacccc aaataccaga ccaaccagca agttgttggt ccagcgtttt     15360
     accattccaa agatagtctg gcgtcatagt caatgttttc cctgggatag aaaaaggtgc     15420
     cattatgcga actcctgtaa atagacatat tgtataaatt gtgtaacgtg acgaataaag     15480
     ctctgaggat cttgagtaat ataaaaatgg tcgccggtaa cttcctggca acaataagaa     15540
     aggttttgcg tgttacctgc aagccaatga tgccattgct gaacttccat agcagaagct     15600
     tctttgtctt cgttgccata aagcaatagc gttggtgttt gcagttttac tgaatcaggt     15660
     tgaataacat ggtgatagtg ctctgtagca aaaaaatcag cacgtagcat tggtaagaac     15720
     aatgcaagca atcctggatc ttctcgtaac atcgggctgc aaccgccgat atcaatcaat     15780
     tgctcaatga attcatgatc aggcagtccg ctcagttggc ggcgaggttg aagatggggg     15840
     gcatgacacc ccgaaagtac cagtgccttg agggaacagt tatgttgttc aaggcgttgg     15900
     caagtttcaa aagcaacctg agctcccatg ctatgaccaa ctaatatcag gttttctctc     15960
     tgtgcaggag tgaatgatac gatcagatcg gcaagtgatt gtgctaatgg ctcaatccgg     16020
     gtggtcgcgc gttcattcat acggctgtca tgtccggggt aaatcaccag tgaagccgct     16080
     atatctgaat tttctaatgt ggaccattgg cggaatgcac tggaactgcc cccagcaaag     16140
     gggcagatta gcaatgtgta tttgggcttg ccgtgagtcg tcaggcatgg gcgaatcatc     16200
     gggtgtgtag gaagtaccca cgtcatcact atttttcctt agttagcatc aattgagctg     16260
     gatcaatcca gactggaggc gataaatcct gggtaacagg ctctcccata atgcgtaaaa     16320
     tttgttgcca taagtctgcc agccgtagtt ggtagtcgta ggcaaaagca gtagggcgga     16380
     gagcgccagt taatacagaa cttaaggtat tgagtagaaa tgccacacct tcagcaccat     16440
     cacattcaaa tgctgtcatc cagtttttgg ttgccggaca aagaatttgt gatgttgtct     16500
     ggtgcaaata agccccatct ggctgactgg cgtttaggta aaggctttgc tcattattta     16560
     gatgatttgg tgcatgaaga accggtgtcc agataaccgg cccataactg gcttcctgcg     16620
     taagataacc ggcaggccaa atcagcgtca ttttatgcat aaccaggtta tgcatgtctg     16680
     gatctctggg gtccagataa gattgaacgt ttaacgttat cgttgtatcc gcaaagctga     16740
     gttcaaagca atgaaatgca ttgctccgtt gaccgacata aactatctcc atgtgttccg     16800
     ggcaatgaca tgcctgtaat aacaggtcaa gtgcggaaaa tagtaactga cggctggttg     16860
     tcaggtagcc acttaccgga cgttgctgtg ataattggtt gatttgttgt gccgcatgta     16920
     accagcttct accagcatgg cattggctgt aaaagctatt tacccaaaac atagcatcat     16980
     gtttgttagc tgttgattgg tgtcttttga tggcttctgc atcaagcggg tgttcctgaa     17040
     tgacagaaat accccgcgcc aataatgcct gagttaattg gtcgcctttg ccaccaataa     17100
     tctctgcacg gatgaccaca caggcaatat cgatgtcgtc tggcagttca tccaatgagt     17160
     gaaatagtgg cacgttgaaa tcacgagcaa gttgttgcga acgcgtactt ccttgcgcca     17220
     gaatcccagc cagttccaga cctggccgag gttgtagaaa cgcattaagg tacagttcgc     17280
     caaattttga accgacaatc agaacccgcc gtggctttat catatgttct ccttaacagg     17340
     ctcaatagtt gggactgaat tcaggatgtc tttcagacaa ctaaccagag agccgacatg     17400
     tttgtgttgg aatagactgt aatgatcacc atcaagtggt gtcacattaa ctggcccgaa     17460
     agtctgccag ccaagatccc ttgaagtgat tgtggttgga tcaaggtaat ccataaaatc     17520
     aggcaatgct tgtactgccc ggataagaca gaaaggctgc gaagtccgcg gtggacagta     17580
     atcaagcaat gcactcagat tgtggcgcca taccgagtaa agtgcagtca gcgagctgtc     17640
     aatctgtgcc gattgtggta aggcttcgtg cagcgcctga aggaatgtct cagtattagc     17700
     cgcgataaca cggttatcca gcaccaaacc ggggaattgt ccctgtaaat cgagcaggaa     17760
     atgacgatga cagaatgcat catccagagt cagatcagtg cgcacgtttg gcgcaaaact     17820
     atcaatcagg atgcaatgag aaacgctttc acccgccgcg cgtaactgat gtgccatttc     17880
     ataggccacg agtccaccga aagaccagcc ggccagtgta taaggtcctt taggctggaa     17940
     gctacggatt tgattgatat agtcagcagc cagcgcagca acggaaggct tatcggtatt     18000
     taagctatct ggcgcaaatg ccaatccaat catacgttgg gtgctgaaat tagctgccaa     18060
     atggcgatac cccagtagat gtccaccaat aggatgtacg ataaataagg ctggttgctc     18120
     aacatttcct ttgttcagta tcacactctg gcaagcgttt tccggttgat gttcaataaa     18180
     ttcagccaat gaatgtacgg tatcgtaagt ttgtaacagg ctgagtggat attgacgatt     18240
     gaacgtctgg ttgattttca ccattagcct cactgccgca agagaatctc cgccaagagt     18300
     aaagaaactc tcgtgcacgt tgataccttg ttgctctaat accgattccc aaaggcttaa     18360
     taccgcttgt cctgtcgcgt tgagggtcac cgccgatggc gttgagttaa cttcttgcgc     18420
     tgtttcaatc agagtaacca gtgtacgtct gtcgatttta ccgttgtctg atacaggtat     18480
     cgtatcaagc gtgataaatc gctgtggaca catccaaacc ggcaaggttt gctgcaacca     18540
     gtgaggcagt accggtaaaa gttctgtaga tacgggggcg ttgtcagtta aacgtaagcc     18600
     cgcgacgagt tgcaatgcgc cggttgatgt ggtgtgtgca aacactaatg cttgttgtat     18660
     ctcagggtgc tcacataaac ggtgctcaat ttcgcccagc tcaattcgat aaccacgaat     18720
     tttaatctgg tgatcattgc gtcccagaaa ttcgatatta ccgtctggcc gccagcgtcc     18780
     taagtcaccg gtgcggtaaa gtcgctcacc ggtttgagga tgagtgataa atgcgtgttc     18840
     agttttttct gaatcggccc aataacccag cgccagccct tgtccgccaa tataaagctc     18900
     accggttacc cagaccggac aaggtgaaag tgctgaatta agtacataga aggtctgatt     18960
     agccaaaggc ttaccatagg gaatgctacg ccagttggga tcaatgtgtg cgataggata     19020
     ggcgatagac catattgatg cttcggtagc acctcccaaa ctgagaagat ttagctcagg     19080
     gtggagagca tataattttg ctggcaaatg ggttggtatc cagtcaccac tcatcaatat     19140
     ccagcgcaga ctatccagag aatgtgggta gcttcgggca tattcttcaa gcagttgtac     19200
     aaatgccgga acagagttcc aaactgtgac cgattcttgc tgtaaccatg tcaataattt     19260
     gtcaggttga cggctgtcac caggagaagg aataaccaat tttgccccac agctcaaagt     19320
     accgaataga tcataaactg agaggtcaaa tgttaattct gatattgcca gtacgctatc     19380
     gtgttcattg agtgcaatgc gttggttaat atcaaggatg gtgttgaccg cgccctgatg     19440
     atctatcatc acgccttttg gttttccggt agagccggag gtgaagatga cataagctaa     19500
     atcctcaggg cgtgcggata aactctgcac accgggattg acaggtaagc ggttaagtaa     19560
     tgtttcatcc agagagatga cttgcacatt gtcaggccag ctcatctgtt gagcaaattt     19620
     aggttgagtc agtacggtat cgacttctcc tgaggctaat agctgatgga tgcgctgttg     19680
     cggataacta gcatcaatag gcagataagc ccgtcctgct aataaaatcg caataaccgc     19740
     gacaacttgt tcccagcctt tttccattac tacaccaatc agagatgaag tctgattttc     19800
     ctgcgcttgc agatgagccg ccagtgtcag gctttgtgac cacaaagtgc gatagtctaa     19860
     ctgacgagag gtatcgacaa cagcagtgtg ttgtggataa cgatttactg cctgttcaag     19920
     taatgagcaa agtgtatgag gcggaaaaac gtttttcgtc gcattactgt tctgacataa     19980
     agtgcgatca ctggccggga gccagtcagg aagtggggcg ttccatgggt aatctggttc     20040
     gagcagtgca acgatactgg cttgataatg ggcaaacatg ttttctgcaa cttgtggttg     20100
     gaacagttgc ggcaaaattg cccattgtag ggtgacacca ccgtctgcgc tggaaattag     20160
     catacagtca agataaacat ggggtgtttg cgcaccaaaa agattcagca ttcctaaccc     20220
     tgatggccct ttgcccgccg taccggtggt atcgttgaat acgattggca ttccagcatt     20280
     caggttgtgg cgatgctgat ttttctctct gagtaccaat tgcccgtcaa acagcgcatg     20340
     ttgcagatcg gctaaccact gtctttgtat ccggcttact gcatcaccga agcctgtaat     20400
     attgcgtaaa tccacttcta ataatgatgt ggtagacaga ttgccgacta atgtatcgca     20460
     atgctgtggc attaacaggc ggttgccatg caggacatta atagtgaaat gttcgctgtt     20520
     actccatact gacagaatat gggcaaataa tgtgagcata acttgtgaag gtgatacccg     20580
     gtgttctgcc gcacgttgtt gcaaacgttg ccactgttgt ggactgatat atcctgttag     20640
     gcactgttga tcgagttgtt gtgactgatg atctttcagt ggtaacactg gtgcatcagg     20700
     aagtgaaggt aagcgatcaa gccagtattg ccggctttgt tgccaggctt ctccggtttt     20760
     ctcattctcc agtgcttgaa tatagtcacc gatagtcgcc actggcggct ctggctgcca     20820
     gttaggctcc tgataccaat ggtgtaaatc acgcaagatt aacgttagac ttttaccatc     20880
     agctaccagc aggtcgatgg tcaaatgcaa taggtgtgtc cgatcatcag tatggtagag     20940
     cgttaagtca aacagcggcc agttgtcgct gggaacccct tgagtacgca gtgtgtcacg     21000
     ggcatcatcc aactgggtct cgcgctcatt tggcatcatg ttacggcaat caatgaccgt     21060
     cggtgtatag cagggaatgt ccggcagaat atgatattgc ccatctttca cataaccgcg     21120
     taattgccca tgatggttta tcacacggtt ccaggcggtg gtgaaacgag gtagatcaag     21180
     tccgttgata gccagttcag cgtagaagtg ggcgataccg ttaccaaatt ggaacagttg     21240
     actttctcct aaccaataag cgtattgcaa tgcggtgagt ggcagagtct gttctgatgc     21300
     gggttcttta gcctgatcgg gtgtagcacg cggagctgaa tttgtctcaa ctacccgcag     21360
     ggtacggcaa aattcattca atttaggatg ttcgaatagc tgttgcagat tagcctgttc     21420
     gtacccttgg cggcgtagtt gcaccaccat tctggtcgca attaagctat caccaccact     21480
     ttggaaaaag tcactttggc gttttattgg ctgaggaagc agtgaactcc agagcgcaat     21540
     cacttgctgt tcaatatcat ggagttgttc atcttctgtt tccggttgcc cagtttccgt     21600
     ggttaacgtt tgtaccatgc tctctttcgt tgtcactggc agcggcaatt gttcttgctg     21660
     ttgaatatgc aatgagtaag gcaaggtaga aaattgtgct gctatttcac ggacattaag     21720
     ccgcgcttgc tgttcagtcc gcgccagaat cagttgttga tgcagttcag gtccgtcttg     21780
     tcccggccat tccaatgaaa cccgataacc agacttctcc agacattgac gccagtcagc     21840
     aagttccagc aatgcactgt caccgcgatc gtcggtccag gcgttaatac cttcaataaa     21900
     tccaacactg gcgagttgca tagcactttc acgcttggtt gattcaatga tcagcaacca     21960
     tccgccgggt ttcagtaacc gagacagacg ttgcagggta tttttcaggt ggactgcatc     22020
     atgtaatacg ttaaccgcca taatcaggtc ataacccgat tcaggatgct gactaaaatc     22080
     aatacgttgg ttaatgtcga acagggcaaa ttttacagtt tcgccatagt gattgagtaa     22140
     ctggcgtgca tcatccagaa atagcggtga aacatcagta aagtggtaat tttcaatgac     22200
     ttgtgcattg tgcgccagta ctttcgctga ggttgcccca gttcctgcac cgacttccag     22260
     tactgtgaaa tgttcggatg tttggctcaa ttggcggaca atttcagcgg cagtttggtt     22320
     caggcaacgt aacgccgggt tctcactgta gaggctggct gtggtttgtt tatcggcaaa     22380
     cagcaattcc aatgcattgc cttttccggc aagcagggtg tcatgttgtc cgatacaagt     22440
     tgctacataa cgactgatag tttggcacca tactgcatca tccagttttg ttgtaggagc     22500
     aggaatatga ctaagcggtt gcaaacaacg gtatccgtca gcggtttttt caataaatcc     22560
     ttgcttgttt aataacgtca gccattgggt aagcaggcgt tgatactgtg gcgccagttg     22620
     taaacgttgt tcaatctctt cacgagagtg gctttgttgt ggagaagtga ataggttatg     22680
     gcgtagtaaa gtctggccca gacccaataa tgcttgttgt tcaatgtgtt gccaggaacg     22740
     ttcaaacgct tgttgctctg ttaacgcagg caacggtaac acatcggtgt tgataacccg     22800
     tggttctggc agtgataatg acaaattatc ttctgcaacc agccataaat tataaccttg     22860
     tgtttcgtcc tgacgtggct gaatttctgc caaccgtatt tcaggcttag cacgtagatt     22920
     ttgttcagcc tgacgcaatt caggatgttg tggccagaag tcataacgca ggtgaccaga     22980
     aggtggtgtg cgaagatcat aatgctctat gcgttcaggc tggcggcaaa tttgcactaa     23040
     tagcgcattg taagcagcaa acagcgcttc aatgacacct ggctctaaca catcatccat     23100
     gcaataccag ttaaatagca gatcaccatc gacttccata acttgatgat ccagccagac     23160
     ttgtggcgtt tggctcagaa caaacaccgg gtcaccgagt aattgcgtga tagattgttt     23220
     gatggcgaca ccttcttgtg ccatccccaa catactagtg aaaaccactg gtgttagtgg     23280
     ttgtctgctt tgagcttcgc cattttgttg gcgaccgagt tcccgcaata cttcaacacc     23340
     attgacatga ttgtggctca gccgttgcca gagcaaggct tgggtttttt ccatgctgac     23400
     acgtagggag gttgtcttgc gtaaatcgaa atccatcaac atgactgagg taaaatcacc     23460
     aatcagatct tgcacctctg gatggaaagg ctgtcggtta aagaaggtca ggttgagggt     23520
     aaacaacgga tgacggctgt accattcaag agtatgagca aatagtgtca gcaggccagc     23580
     agaaggcgtc acgccccatt ttttccagct ttgtttaagt ctctgccagt cagattcaac     23640
     caatcgacct tcataagtcg taaattgtgg ctgaccacgc tgaggcagtt gtgggttcaa     23700
     cggtaatctt ggcgcagggg gcagtgaaag taattgttcc tgccagtatg cccatgacgc     23760
     ccgccactct ttactttcac gttgcgcttg ttctgccatc acatagtcgc ggaaagtaaa     23820
     tgcttgtgga gctagtggtt gctggcgata agcaagttgt agatcatcca tcatgatccg     23880
     gaaactctgt acgtcaaact gcaacaggtc caggttcata tgtaagcgac aacgttcatt     23940
     tggtagcaac gaaatagaga cttcaaacag tggccactgt tccgcaggtg gtacgtgata     24000
     ggaaagggta tgacgacgct gagccaaagc ttgttcgcag gctgtatcgt ctagcgttcg     24060
     caagtcatcc tgtgataaag cataccaagg cgtttcaggc agaattcttt gttgtccatc     24120
     ttcatccact accatgcgta acatgccatg acgctgaatt aaagcattcc atgccttctc     24180
     gaaacgcggg atatcaaaac tatccagtgc cagatcccat tcaaataaga catggcaagc     24240
     tacaccacca aaatcaatgg cctgagtacg accaatccag taagcatgtt gaattggcgt     24300
     cagagggaat ggtgcatgac gctgggaatt gtcaatcatg atttcaggtt gaacagagac     24360
     gattggctgt tcaggcaatg cgtcgccaat tagtgcattg agtcccgcca gcgtcatgtt     24420
     ctgataagcc aatccagcgg ttaatctaaa gccaaattgc tggtggatga ctgcattcag     24480
     ctccaggaac aacagggaat ccaaaccgaa ttgcaataaa tcctgttgcg gtgctaaatg     24540
     ttcaggctgt tctaatcgca ataatgttgc gacacgttgg cgcaaccaat tgagccgttc     24600
     ttctttatcc tgatacaacg tattatcggc agagtgcgaa agggtaggcg ttgtcgttgt     24660
     aataccagcc tgtaaacggc gcaaaatatc gggatgatgt tcatctaatc gcattgccag     24720
     atagcaagga gatgcagtac gcagagattg attaaaatgc cagatacctt catttatgct     24780
     gaatggtaac atgccatctt gcgccagttt ttctactaat cgccggtcgc gggccatacc     24840
     aataccaccc caaacgcccc aaactaacgt tttcactatc aattgatttg gtgctgtcag     24900
     tgctaaagat tccaaacaag cattggcgat tgcataagca ccttgtccct gagcgcctaa     24960
     cattgatgca gcagaagcgt gaagcagtag atattgggcg ttatgttgca caagcgccgt     25020
     ttgcaacgtt gatgcacttt gggcttttac agataacatc tgtgacagtc gtgggggctc     25080
     aagttctgcc agccgggtat gatcagccac acctgcggca tgaatcacac cagcaatacg     25140
     atcttcttgt gccagcgttt gtattgcttt taatagggct gacgtatcag tgacatcaac     25200
     gttaatccaa cgtatttcac attcagtact cagtgacaac tcttgtacaa aagcagccca     25260
     gtccgcattt tggcggcggg caaacacggc aatcttacgc gcgccttgtg ccagtaacca     25320
     acggatggaa atctgaccga taccgcccat accaccggta acaatgtgcc aaccctcacg     25380
     aggaatcgac atcggctgtt gcgataatgg taatggttga cgttgtaaaa ccggtacaga     25440
     gatttgattc ccacggactt tcagccagcg ctggtgttca tgattgtgtt tattcaaata     25500
     gccaagtgcc aatgacaaag agtctgcatc gttgatatca gcaatatcaa tcgcctgaat     25560
     atgacgatgg ggatattctt caactgcgac acgcagcaat gcccaaacag catattgagc     25620
     cggattgata tcttcttttg ataaggtggt ttccggctga gcgcagcagg ttataacggt     25680
     taacggtgct gtttcgtcac attttaatgc gctaataacc tgatcacata atttaacaac     25740
     atcatggcct tcaagcagta ataacgtatt tccgctttca ggctgtaaat taatccccgc     25800
     ctgacgccaa tgatgaatca tctcatcatt ggcagttgaa gaacggaggg tatacgccgt     25860
     tgaagatctt ggtttatccg cggtattgat tgtacgccaa tgcaggacat agtgagtctc     25920
     agggcatggc tgtggcaccg gaagccatga tttggtcata gcgtgttttg tcatagatcg     25980
     tgctgctaca gtttggcgcg gaagatcggc acgatcactt aacagcgcga ataagcgttc     26040
     gccagcatag atcaaggcag ggaaagcagc gagtaaacgg gcttccagtg accggcgttt     26100
     ggcatagggt aaggcgctat cagggcgata cattttactt gccgttggcc cggaagcttc     26160
     ccggtaataa ccttgctgga cacagtaagt caataactgt tccagcagag ggtgccagca     26220
     aggttgtagg cgacctgctc gaatagtgtc gatggcacta aaaccttgtt cagcatctcg     26280
     cccatgacat tgataaacca atgcatcggt atacagcgct cgtaggatag tggcatcaga     26340
     gttttgctca atggcagggt cgagcaggaa attgacatca agcccggtat tgacattggc     26400
     tgagtgcggc acagacttag ccgcagggaa gctgtaatgc tgctcatcaa atggatagag     26460
     tggagcatgg cattttactc cggtgatcgg gaaaaggtgc tgccaatcga gatgtacacc     26520
     ggcacagtaa agttgcatga gggccgtttg ctgagcggtt tctggggagc tttgacgctg     26580
     tgcaccagca atccaagttt cttgtggcag acggaaacgt cgcccaatcc cggttaactg     26640
     tgcatcagcc ccaaactcaa cgaataatgc aacaccttgc tggcgggcaa attcaactgc     26700
     ctgataatag cgtacagttt gacgcatatg attacgccag tagtctggtg agcctagttg     26760
     ctcagaagtt gcaatattcg cggtcagggt agaaatcagc ggaatttctc ccaatgtagg     26820
     ctgtaagccg ttacagcgct gggaaaatgt atccagaact gaatcaagca tggctgaatg     26880
     tgctgcacag gcaacgttaa gacgctggca gtgaatctgc tgttgctcca gacgttgtgc     26940
     cagaatatca atttctgcct ctgtaccagc ccaaacccag tgttgcgggc cattgcaaac     27000
     cgccagatcc aatgccagtg aatgggtaaa gggaagaata tcttcttcgt tggcgaagat     27060
     tgccagcatc gctcccccct gggagcattt ttgcatcagt ttgccccgta ccgcgactaa     27120
     cggcatcact tgttcaggcg tgaaaatccc ggcaaccacg gctgcggcaa attctccgac     27180
     ggagtgcccc agtacgtaat caggctttaa tccaagtgct tgccaatgtg ctgccaatgc     27240
     aatttgatgt gccacaatgg cgggttgtgc gtattcggtg gtggctaatg ccgcatcatg     27300
     ctctccgaac atcacggctt ttaatggcaa tgccaattcg gatgtacagg cagcacagca     27360
     acgatccaac atagcggcga aaaccggaga gctggcatac atggcttctc ccataccagg     27420
     ccattgacaa ccctgcccgc tgaattgcca aagctgcttg ctttcgctat taacttgccc     27480
     gctgaaaata tttggtgttg ggctattgtt tgcaaagggg gtatttgcaa aggcagataa     27540
     gctctcggca ctttgtggtg tcaaggtcag tgctaaacgc caagggagtg aaaggtcgcg     27600
     tccttgcaaa gcggtccagg ccagatctgc atgatgctct ggtgcatcat ggagtgccgt     27660
     cgcgtaacgt tgtgctaatt gtcgcaatga ggattcagaa gcagcagaga gtagtaacgg     27720
     cgaagcttgt ggattatggg cacggcgacg atgtaattct tctggcaatg attgcaccac     27780
     aatatgacag ttagtaccgc caataccgaa tgaagagacg cctgcggtac gcaatttttg     27840
     cgtccagcgc tgtccttgtg ttgctagttt gaacggactt tgttccagcc gtaatgccgg     27900
     attaggttgc tccacattga tagttggcgg aatgtaacca tgccagacag acaaaaccgc     27960
     tttaatcaag ctggcaatac ctgcggcagt atcaagatgg cctatgttgc ttttcactga     28020
     gccaaggtag cagggtggta ctgccacact acgctcagcg aatatgttgc gtaacgcgtc     28080
     aacttcgatg ggatcgccaa gtggtgttcc tgtaccgtgc gcttcaatca tgccgacatc     28140
     atcaatactg acatctgcca gttgtaatgc ttcggtaata acgctgagct gaccattaac     28200
     cgaaggtgca gtgaagccga ctttttcgtt gccatcgtta ttaattgcac tgccacgcaa     28260
     taccgccatg atgggatcgc catcgcgtaa agcatcactc agacgtttca gcgtgacaac     28320
     accaacacca ttgccgccgt aggtgccatt tgcctgacta tcaaaggggc gacaatgtcc     28380
     atcaggcgag aagatcatcc cgggttgata caaataaccg ctttcttgtg ggaaagaaac     28440
     tgccacacca ccagccagtg ccatgtcaca ctcaccggcg cgtaggttct cacaagccat     28500
     atgcacggca accagtgaac ttgagcacgc ggtttgtacc gtgagtgcag gacctttcag     28560
     gtttaattta taggccgtac gcgtcgcaag ataatctttg tcgttactga ttagcgcctg     28620
     aagtccttta actttgccga catcggtcat cgtgaattgt gaccatgaag gccaggtgct     28680
     aacccggcta ctaccgaaaa cgcctgtttt caggtgtaca ttacgcggtg cataacccgc     28740
     atgttcaaga gcgtgccagg cggtttgcag gaataggcgc tgttgaggat cgagcatctc     28800
     tgcttcctga cgtgaatagc caaacagggt agcgtcaaat tgttccgcat tctccagtat     28860
     cgctgcctga ctgacaaagt tttcactatc aatgacttca ggaggaatac ctgcatctaa     28920
     taatgtttga cgggagagtg tggcagtaca ctcaacccca tgttgcaggt tatgccagaa     28980
     cgcattgcta tctgatgcct gcggaaagcg gcaggcaagg ccaatcactg cgatgggatc     29040
     acaattatcg tagtgaggcg ttaaatctgt cattgtgcag ctcctttatg acgtttttcc     29100
     cgttgttgca gacgcttttg ttgttggcgc tgacgagggg taatcgactg gcgatttccg     29160
     tcgtgggcat cctttcggca gcgcaagctg agcgtctctg gtgttggata agcgaataaa     29220
     tcagtaacgg caagatgatg gaaacccgca tgttgtaatt tgctatgcag ttgaattaac     29280
     tgtagcgagt tggctcctgc ctcaaaaaag ttttgttgtg cattaatagg atgatttgtt     29340
     accgataaaa acaggcgttg aatttcattg catatttgtg gatcgagtcc ttccgaacgt     29400
     ggtgatgacg caataacaac agcggcgtta tctccaacta tggtgcattg ctggcgtggc     29460
     atcagttgtt ccaatgctga atgccagctt tctggttgtg cagcaagggt acgcaagagt     29520
     gccatatagc tattgaacat gttttgtaac tgatgcggtt caaataactc ttcgacagca     29580
     tcccagttta ggcaaagctc attgtcagat tcgtaaacct gatgatccaa ccagatttgt     29640
     ggcgtttgtg agatacccca aaccggtttc atccatgatg aacgtgaaag gaatcgtcct     29700
     tcatgtgttc ccaatgcact ggtgaaaacg actggcataa tagctgcatc gggaccacgg     29760
     ctctgtgcca gttcacgcat cactctgata gctgaaatat ggcggtgatc cagatcctgc     29820
     cataattgtt gttgcagtcg tcgggcgctt aataaccaat ttttctctgg atgccaggcc     29880
     agtaatgaca gtgaagtgaa atcacccaga atgtgattaa tgtcctcatg ccaatgcgga     29940
     cgatcgaaaa gggtaagatt aagggttaac tccggtctgg cgctgaatgc ggacaaaaca     30000
     gccgcataag ccgcaattaa gagcgccgaa ggggttatct gatgggaggc agcatgttgc     30060
     tttaactgat tccattcatg tgcagataac cgatcgctgt agcgcacaaa acgcggagat     30120
     tgaacatctt ccggtgcaat acgtaatggt aattgcgggg ccagtggtaa tgttttcact     30180
     tgctcctgcc aatattgcag tgagttctga tgtgccggcg tttgttgctg gcgtaacaca     30240
     caatcccgga atgtgacttt cagtggcggc aattcgtact gttcgttgag atatagctgt     30300
     tctaattcag ccagcaatat ctgcatgctc aacccgtcca atagcaaatt atccaggctg     30360
     acaaataatc gggagacaag gctgttgtct tgagcaagtt ggaaatcgaa caccggccag     30420
     tgactggcgt ctaatacctg atgtgacaga cgttcgcgta gtgtgtctgc ctgcgtaata     30480
     tccgtgaatt ggtgttgttt aacggagaac atcgggacat ctttcaatac ctgctgctgt     30540
     ccattaatca caatagttct aagcacagga tggcgctgga tcaggcgatt taatacccgg     30600
     ttcagtcgtt gaacatctaa ctgttctagc cggtattcga taaagaaatg agcaccaaca     30660
     ccactgaggg caaaaccggg atggcgtcca accaaataag cttgctgaac ttcggttaat     30720
     gggaaaggct gatattcatc ttgctctttt ggtattgaat aggtttctga tgcagtttca     30780
     gacagaggcg ccagtgtagc agcaaactct gccaattgcg ggttacggaa aagatgtcca     30840
     agttcgcctt tgaagccttg ttgtgtcaat tcaccaatca gacgtgtagc cagaagacta     30900
     tcaccgccaa gttggaaaaa gtcactatga cggcctaatt gctctgtatt tagcaggcgt     30960
     tgccagaggt tggcaacggt ttgttctacc ggattcaacg aggtcatttc attctggtgt     31020
     gacacgtctg tttttgtcgt ggattgcagg gcttgtgaca gcaccttccg atcaattttg     31080
     ccgttaggtg tcagaggcag acgcggaata acatgtaaac gctgtgggat catatatccc     31140
     ggcaaatgtt gcgccaatac ggatttaatt ttttcccgat caggaagggt gacgttgtca     31200
     cttgcctgca tcaacaacac actaagatta ccgatggtaa tgggtgtttc cgcctgtagt     31260
     ggtaaaagag gcaaccactg tgacgcagaa cgtagctgaa taccgtgagg tgataacaac     31320
     tcagtcgtaa tcagggagag agatgaggct tgttgcaact ccattgccaa caccagcgca     31380
     ccgggttgtg ccagaggcat taacgctttg atgcaatttg caggatctcc ctcgcggtgt     31440
     aagacattgt ttagcaggat gatatcggcc tgatgctgta gcgactctgg aatttgttca     31500
     agccaatgat gtactgatgc gtgggcataa ccgcttaacc gtgtttgcgc ctgattgatc     31560
     agggcttggg aacgttcaaa cccgaggtaa gacagatgtt ggtcagtgat atgttctgct     31620
     agccactgag cacagaggcc gctacgggcg tcaaactcca tcaacgtaat agggcgttgt     31680
     aaccgttggg aaagggcaat gattacctgt tttagtcctg ctaaccattg ctgggtttct     31740
     ggtagtacga agagctgctg ttctggcgcg aattgcggat catcaagtaa tgtaactgcg     31800
     gcctgttgcc cggtaagaat gctacgtagc atagagtgcc agcgttctgg gatgcatcct     31860
     gcttcattat tgaatgtcgt ggctggcgat acggcctgat agacatgatg tgtagattca     31920
     gctaatagct tgcattgaca aaggtatgcc agcatacggc caaaccagtc atgatattcc     31980
     ggttgaggct gatagtgttt cagacaatcg gtgagcgatt gaggtgcagt aaacgtcata     32040
     ccgtgacgag acaaatgttc taacagaaat atggcaacct gagggtcatg gctgttatcg     32100
     gttattgcct gagcggtggg aaacagatca cggtagctta tgggtaattg tggtgcacga     32160
     ttgacgcgtt ggcataaagt atcgccttcc aattcaagga atgccaccag cgatttctct     32220
     ttttcgccac tggctaaggc aaccccttta ctgattccgg ttacctgatt cagggcagca     32280
     tcaatctctc ctaactcaat tcggtatcca ccgattttta cctggctatc gcgacgtccc     32340
     ataaactcaa gccagcctgc gggatggtaa cagcctagat caccagtacg gtaccagcgt     32400
     tctccttgat cgacgacgaa ttgggcagaa gtgcgctctt catcattaaa atagcctaat     32460
     gctacaccgg caccaccaat ccaaagttca ccgacaaccc agtcagggca atcacgacca     32520
     tcttcaccaa cgacacggta acgctggtta gccaaaggat aaccataagg aatagagcgc     32580
     cactgtgcgt caacttgttt gacgatatat tcatttgacc agatagcagc ctccgttgcg     32640
     ccgcccatag cacttaatac accatcagga ttgaatgcac ggtaacgctc aggcagtgat     32700
     aagccgatcc agtccccaga tagcatcacg gtacgaagcg ctttcggcgc atctacttcc     32760
     attccttcac aataggtcag caacatatca aacagcgccg gtacgctgtt ccacaatgta     32820
     acgttatgtt gcgcgatcag catttcccaa gttgatgggt cgcggcgttg ggcttcgtta     32880
     attaatacca gtgcacctcc agcactgaga atgccaaaaa tgtcataaac agagaggtcg     32940
     aaatgcaggg ctgagagtgc cagtaaccgg tcatgacttt gaacctgatg acggcgattg     33000
     atgtccagac aggtattgag tgcgctttgg tggctgataa ccacaccttt tggcatcccc     33060
     gttgaaccag aggtatagat aatatacgcc ggatcagtaa ccgcgcgttt ggacatgttt     33120
     gctaaaggag gtaattgagc atcctgatgc caggaaatgc aatgtatatc ttgtgaccag     33180
     tcatcattct gttgttcagg atcaatgata acgacattga tcccggcact ttcacagata     33240
     gtacgtcgtc ggtttaatgg ttgatcaacg ggaactggaa cgtagacacc gccggcgtaa     33300
     agtatggcta atacggcgac aatttgtccg ataccttttt ccatgctaat agcaacccgg     33360
     tctcccggca tcactggcat tttttgcagt acggcagcta actggcgggc ggccagactt     33420
     aattcgccat aactcatttt tttatgatga gtcaccaaag ccacagcatt tggtgtacgt     33480
     tctgcttgta tgaacacgcc ctcatgcagc agagcatttg gtaggggttc aaccgtgtta     33540
     ttgatttggc gtcgcagatg atactgcgac tcaggcatca gatccggtag cttttcgttc     33600
     cactgcgcgg cgttttccgt caggttctca atcagcccct gataggccgt gaataaggta     33660
     tccattaagc cgtcagggaa gagttcatca ttactatccc actgaatatt cagcgagttt     33720
     tcatgttcaa aggaaacgaa atccagccat acctgagggg tttgtgatat tccccaactt     33780
     ggttttccca gtacatcacg ggtattttca ccatataaag gtcgacctaa attgctggta     33840
     aatacaattg gcgcgccgtg tgggtggcta cctcgtttct tgagttcacg taaaacttct     33900
     acaccagacc agtgacgatg ttcgtaagct tcggcaaagg tagcttgcgc atcctgagcc     33960
     agttggcaga acggtaaatt atcaccagga atgtctaaca gcagaatgtt ggtaaaatcg     34020
     gctagcatgt tgtcaaccgc ggtatgtagt ggcgctctgt caaatagcgt caggttgaac     34080
     aacaagcgcg ttgcattatt ccagcgacat aataaagcgg caaatgcggt cgcgagtgcc     34140
     atagttggcg taacaccatt ttgctgcgcg agttgtttaa atcgttccca atgttcaggc     34200
     gctaaacgga aacatctgcg ctgaatatga acatttttta ttagggaagg gtcccgagcc     34260
     aaaggcagct gaggggcaag cggcaaagtg tctaaccggt tgcgccaaaa cacctctgct     34320
     tcttgccgag cctgtttaaa ttgggcctga tactgtgtta gataactgca aaaatcatag     34380
     tcggaacaaa tagcgggcag gttgcgtttg gcaattaatg ctgccagttc ggtgaaaaat     34440
     agactgaaac tggcggcatc catgatcagt agatcaatat tggcatgcag ccggtgttga     34500
     ttatcaccaa acaggctaag ctgaatatcg aaagtttccc cttcttcaac ctgtaatact     34560
     cggtggctca gttgttcacg taggttgttc aacgcttgtt gttgctcatt agttgtcaga     34620
     ttgcgcaggt catgaacagt taattttttc aagtcaacac gggtcatacc ttgctggcga     34680
     ccatctgaca aaaaccgcac gcgcaacatc ggatgccgct gaatcagcac atgaatcgca     34740
     gcttccagtt gttcaggttc cagacccacg ccatcgaact cttgatacaa atggcaacca     34800
     actcccccca acgtttgttc tggtgaacgt ccaacaaagt aagcatgttg tactgccgtc     34860
     aatgggaatg ggcgcgcatc tacaatcagt ggttgtggcg ttgtatcttt gggcgcggtg     34920
     tgagcgacag gtgcatgacg ttgtagaagc tggctccagg cgtgcaatgt tggcttttgg     34980
     taaagttcgc gcagagtgac gcgatgtccc tgacgtctaa actggtttaa caatgccatg     35040
     atttgcattg aatccagtcc attgcgaatt aaatcatcgt tatcgtccac caaaatattt     35100
     ttttgattaa acaggtcaga tatgagctga cgcagcgaat ctggggagtg aaggtccgtg     35160
     tgcatgaaga aatcctataa aaatggcgat tacgtaataa gtcggatacc aggtgggtta     35220
     caccttatgc gggtgtaaat gccaatgctc ttctgagcca aggtgatttt tccaaaggga     35280
     ttggtaaagc ggacaccgct gtagtagttc atcatgggta ccgctatcac aaagggttcc     35340
     atgatccatc actaatattt gatcagcgcg agttatcgtg cttagccgat gagcgatgac     35400
     aaagacggtt ttattctggg taagagaatc aaatgcttct tgtatcaact gttcattctc     35460
     agggtccaat gaagctgttg cttcgtccag aaataaaaca ggagactgtt ttagaatagc     35520
     gcgagcaata gcaagccgtt ggcgttcacc accagacagc gtaccgccat ctacccccaa     35580
     aggtgtattg tacccttgcg gtaaggccat aattgtatcg tgaatattgg caaggcgggc     35640
     ggcctgttcc agttgcaact gagtggcgtt gggatcaccc aaacggagat tattagcgac     35700
     ggtatcctga aagagtgcgg tttcctgaaa caccatggtg acggtgtcat acagtgcctg     35760
     agtctggtaa tgatggatat gattcccgcc caaacggatt tcacctttat ccagttgata     35820
     gaaagagagc aataaatagg ccagcgtgga tttgccactg ccgctgggtc ccacaatggc     35880
     ggtcatgctg ccttgtggtg cataaaacga aacggtttgg atggcgggtt gacaagtacc     35940
     tgggtagcta aatgagatgt tattaacttc aacatcatat ttggttggcg ctgctaatgg     36000
     tccagagact tgtgtagtaa cggcttctat ctctgcaatg tgtgtttcgc ctacttgcgt     36060
     caatgcagtg atattgagca gaggaatgat cccgcgtaaa ggggtaatag tggcaaacag     36120
     cagcagaata gtgataagca tttccgaaag ggttaatgct tctggtgaat tgaagcgtag     36180
     ggcgcccgcc agaatgccaa cgaccacgct ggtatcaata atgatgtaaa acaggctcaa     36240
     cagcggaata cttctgaata ccccgtggcg gaatgcgaca cgtaattggt cgattttgcg     36300
     gttaaaacgt tgttctaccg tcgtggtcgc tgccgcagca cgaataaagg acataccttg     36360
     ggcgtactct acaattgctt cagatgcatc agccatcata acggcgcgca ggcgcaatat     36420
     ttcattcagt tttttgcgga tggcccctaa gatgagcatt ccaaccatca gtaccagtaa     36480
     tgcgctaccg gcaacgaccc aatcgaacca gaataaagcc agatagatga gagtcagcat     36540
     cataacctga caggcgattt gtggtgtggt ataggctgac tgattttcct gccattgcac     36600
     atcttcagat aacgttagcg ctatttttcc ggcacttaat ccccgaatcg tggctaccga     36660
     catactgacc aagcgttgta ataaagaacg acggatttcg atacctaacc cataagcggc     36720
     aatggtgagt ttacgcaatg cgcgggtcat aaaagcgaac cggagcaaca gtaaaataac     36780
     taataatgcc agaatgataa gcggcagcct gttgttgcca ctttcctcca gatgagcgaa     36840
     agcccaagca gcaatagcaa gttgagcaat aattgccacg gtatcaagct gcttatataa     36900
     caatccactg aaccaaaccc gttgcagttt tggtgacaga tgttgctgga gacgattaaa     36960
     tagccccatg ataatttgct cctgtcccgg tattttctct ccgccaggca gaccactggc     37020
     tggcgtatgc gccttgctgt gcgactagtt catcatgagt tccttgttca atgatttgtc     37080
     ctttatccag gaccagtatt tgatcaaaat gacggatagt cggcaggcga tgggcaataa     37140
     caatcactgt cttgttgcga cataaggcat tgagtgcttg ttgcatctct ttttcacatt     37200
     ctggatcggc ataggcggtg gcttcatcca ataccagaat gggggcgttt ttcaggatgg     37260
     ctgcggcaac ggcgatacgc tgtttttctc ctacagacaa gctgataccg tggttaagca     37320
     cagtgttgta gccttgtggt aattgttgga taaattgatg tgcttgtgct gcgacagccg     37380
     ctgtttcaac ttcagcttgt gaagcatcag gacgggcaag ccgtatgtta ttggctattg     37440
     tatcgttgaa cagaaatacc cgttggaaaa caaaagagat gttattacgc agagtgggtt     37500
     catccatatt gcggatatca accccaccaa ccgtaatttg gccttgttga gggtcccaaa     37560
     gacgagcaat caggtttgct accgtggatt tacccgaacc actggcacct actaaagcta     37620
     atgaatttcc ggcaggtatg gaaaacgaaa tgttatttaa cgcgttatcc tgttcatctt     37680
     gataagaaaa actgacatta tgcaaagtaa cactatgatc ggcaggtgtt tgactctgag     37740
     tacacggcac cagttcaggc tgattcatta accagcgata gcgtgtgatc aacgcctctt     37800
     gttgttgcaa acgtgtcatc acagcgaaca tggatgaagc aatattgccg aatgccatcg     37860
     ccgccagaat aaagaaagta aattcaaata aagatatttc ttgtcggttg aatagccaaa     37920
     ctgctaaagg gaggacaaat aacagattag cgctggataa cacgaaaaac cggctggatt     37980
     taacctgcac tttctcaacc caaacatcga taatacgtgt tagagcggta aatgcccctt     38040
     cagcgcgctg gagggcaaca ttaccacctg aataagtttt tactacggga attgcgttaa     38100
     taacttcacc cattgtcgaa gcaatacgat tttgggctgc ataaaagcgc tgagtagtgg     38160
     tttgtacttt tatctgaata tagatgaata ataaacaggc acccaaagtt ggcgcaaatg     38220
     ccgctaatgc taaccgccag tcaatggcta gcatgacact cagtgcgatg agtggaccaa     38280
     acaaagttgc tgacatctct ggaatgatat gggcaatacc atcctcaagt tgttcgacgt     38340
     catctaacat catcttcttt atttcggtgc tgtcggtccg tgtgaagaag cctaaaggaa     38400
     cggacttcaa cttactgctg atgttacgac ggacatcggc ttgaacgtcg gcggcgatca     38460
     aatgagaaac aaacgttgaa ccactgaaag tcaacatagc ggcaaaagtg aagctcaata     38520
     acatgacacc gtaatttaat agcgtgtcat attgtccatc ataaatagat tgggtaatca     38580
     gcccggcgac ggctgccggt agtatttgca gaccagcgga aacaatggca agtgcaatag     38640
     caacgtaact cagagtgcgg tatgggcgca tcatgttcca cagctcttta atgacaccgg     38700
     catcggcggc acgttgttct ggtgagttct ggatagaaga gtcattactg agcattcacg     38760
     ttctcctttt ggaaatcgcg gaacttgtga aatgtccaga acaggccagt gagggtgaaa     38820
     aatgatgcaa gagcgaaaag ggaagcatag cttactttag tgacaatcat tccacctaac     38880
     acggaacaga tgatcgcaat gctcatatct gcggactgca tcaacgcaaa atccacacca     38940
     gactgtgtgc ctgccgccaa agacatcatt tgggtataca aggcaacaaa tttagccgcg     39000
     gtgattaacg tgatgaagac atatgccgtt gaaagtaggg atagcggggc ttctggttgt     39060
     tgggcaagcc agaaaatacc cactaatacc atgcattcaa acagcatcag gcctaacaat     39120
     gtttgaatgg aacctaattt acgtacaatg ataccgccaa gtaagacacc ggataaccca     39180
     gctaatgcac caccactggc ggcaatgatg ccaagttggg ttaaatctac tccgcgatct     39240
     atcaagaacg gagagagcat gccgagtgaa aggcgcgtac caatcataca gagcaatatt     39300
     aaaattagag cctgtttaac tggggcacga cgcaatgcac tctttaatga aggtgttacc     39360
     gcagtctttg aaatattcga tgctttcttt tccggtgttt ccttgataaa taaaacaggc     39420
     agtgacatca ctagaatcaa tatggctaac acaccagcac caatatgcca gccatacagt     39480
     gaggtaagat ataaaaacag accgctgcct ataatagacc ccagataact gcctccaacc     39540
     tgcatgacat tgctccaggg gcgatgctgt ggggataacc ggtcaatagc atggccgtct     39600
     gtagtggtgt ctactacggt cagacaaagg gtgatcagaa acagacccgt gataatcagc     39660
     ggcatatgct cagcaggttc tgctaatgac attgaacaaa aaagcagtgt aattaacaca     39720
     ttaccgcaga gcatgatgcg gcgagagttg gtatctcccg aaccggattt acgatagcgt     39780
     tctacaatgg gagcccaaag gaatttgaat gcccaaggta acatcaacag ataaagtagc     39840
     cctatcttgt ccggggtaac accgtggctg cgcagaaatg ctggcatgct ttgtaacgtt     39900
     aacataccga tggtactttg gatggtgtaa acaccagcca aagccaaaag tagcaacgag     39960
     acatgacggg ggtgtgagat attgtgcatc atagtgcaac gctcacatcc aacccaacat     40020
     tcaagccttt actcatcatg ctgagcgtgt ttccttgttg gaaactcgaa agacggtact     40080
     ttttgttgcc taaattttcg ccataaaatt taacattgat accatgtgcc atttctaaac     40140
     ttaatgaagc gtcgtagagc gtatatcccc cttgttcaag ggtatttgct tcattaaagt     40200
     agctttttga atagtagcgt gcaccggcat ttaaatagag gttacccggt aacaatgttt     40260
     gatcaataag atagtcgaaa cttgcattga gcatgacatc tggcgcataa ggcagacgtt     40320
     tgccattata acttatgcca tttgttgtat cggttgcatc agtgaaattc gatttaccta     40380
     cactgccgcc aagagaaaat ttaagtcctt gcattggctt gatctgacta cttagctcaa     40440
     tacctttact ttccgctttc ccggcgttgc gaatagattg cataccaatg ggaccaacat     40500
     agatttgctt gtcttttgaa cgaatataat aaacagcgct atctaacgtc attgcattat     40560
     taaagaacga cgtatgccag ccgagttcgt aattgtcgga ggtttcggta tcgtaaggct     40620
     ttctatcatt ggcggaggac acaatgttat tgaatccgcc gggcttataa cctttagttg     40680
     cagaaacata gaaacgggta tcgggtgtaa attgccagcc cagagccgcc ttaggtgtga     40740
     attcgttgct ggagacttgg ttatcaaaag catcaactgc catcatgcca gagcggcccg     40800
     catagtctat ctgcgatttt tcatgtgaca aacgaccgcc aagggtcaga tcccattgag     40860
     cagcaatcgg taatttaact tcaccaaaca gtgccagtga ttttcctttt attgtgttaa     40920
     aggcatcacc atagtaacca ggatagccac tggtgtgatg tttattattt tcatctgaaa     40980
     accagccgcc gagaacgctg ctaatcccat ttgagaaatt ggaatttaaa cgcagttctt     41040
     gagttgtggc gtgatgtttc tctttccatt tacccccgat aaaatcacgg aaaatatcgc     41100
     gatcttgata ggaagtcacg cttgttaatg tactgctacc aaaatcgtat tcagctttga     41160
     gtgtataact gttgaccctt cttgtcagat cagggatagg gccttcatat ttcttctgtc     41220
     gaaattgttc gtcggttaaa taaagctcct catgtgaatc gagatcttca tgagcaaagc     41280
     taagttcagc gctaaaaggg gaatcttctg gcgcaaatgt cagttgccct ttaccgagcc     41340
     aggttttact ggagtcaaca tttttatcac cacgacttgg tatatcgatt tgtccagatt     41400
     cgtttaccca gcgcaggctg gtactgccgt aaagaacgtc ctcgataagg ggcattgatc     41460
     cgctgaagga accgccctgt ttcaacttag agtagttgcc agaaagatta agccaagggc     41520
     cttcttttgg cgaacgggtg ataatattga taacgccggc ttgggcgttt ccaccatata     41580
     aggtgccttg aggaccgcgt aataattcta cgcgctctac attgattaat tcttgtgtta     41640
     ggaactgatg atcttgagga acaccatcaa catagattcg aatggaaggc gaatagaaat     41700
     cgggtgaact gataccccga attgtggttg ctgaataggt ccggttacca cgtgaacgga     41760
     tttgtaaacc tgggaaagca cgctcaagat cttgcacttg ggtaatacct gcttgctcaa     41820
     gttcttcgcc tgttttaacc aaaacgctgc cgtcaacttt atttaacgct tcttcccgtt     41880
     tgttagccgt cacaaccaaa gtatcttctg tggcttcagg cgaatgttct gcccaaacca     41940
     taggagaaat taggcaacat aagacagaag ccttagcata tttttttttc atatgaatac     42000
     tctctatgcc ttttcaaatc atgttttaca aaaattaagt gtggtaaaac aaaaaacata     42060
     tagagaaggc tagcgggagt aacaaaagag agctaacggg atagggacaa aagtagcgcg     42120
     atacgtacta ttgataatga ttatcattaa tgataaattg cgtgatattc acattccgta     42180
     tatatataaa ataaaaatat aatgtcttta atatgcacaa tatactgttt tagtgtggaa     42240
     agcgcttttg aaatggtgtc tgatgctaat tttacagggg gatctcatga agacgatcta     42300
     tagcaagaaa ttgggagttt tcgctgctaa ccattgcaat tgcatgcatt tacaagtgga     42360
     ggaaaataat acaaatccct cattacaaac tgaggaatta tcagacggaa ttcatataaa     42420
     tcgaattcgt tttgagctta acaaagattt tacagaatat tgtgaaggac cgccgacggt     42480
     atcgattgcg tttattttaa gcggggaggg gagaatggcg attgagaacg gcgatgtttt     42540
     agatattaat cctggcacaa tggtattttt ctattcacct aagacgacac gtggcatgaa     42600
     tttctttggc tgtggaacgt ggcatattct cgatatccgt ttttctctga acgaaattga     42660
     agctcaggag ttgccatgtt ttaccaaatt gacgtcgggt tttgaaaaaa atgttagcta     42720
     tagtgatgtt ttgatgatgg ctcgtcctat ttatccgcca tttatgcaga tagtcaatca     42780
     aatagaagaa tgtcaattaa atggcaatgt tagaaaggtt tatttaaagg cgaaggcgtt     42840
     agagatactc gcttgtgtga cggctcaaat ttatgattgt caatataatg tgattaacag     42900
     tttacagcgc cgtgctgtgt ataatgcaat aaaaataatt aacaatgatt atcattctcc     42960
     ctggacaata aaatcgttat caagagcggt tggtttgaat gagagaaaat taaaagaggg     43020
     attccgtgct gttgtttttc gtactttcca tcaatatttg gagaacgttc gtatgaccac     43080
     agcggaagat ttattgaaga aagggatgag tgttattgat gtttctaccg cggtaggtta     43140
     ttccagccca agtcattttt ctaaacgttt tcggcaacat tatttgatca accctaaagc     43200
     atggcaagcg aaatatgccg taagccacac attactggca gaacatattg cagtggaagg     43260
     taaatatact taatagattt cgagccgcag cgcggcggca agtgagcgta ggttcccaaa     43320
     aggtggccat ttttgatggc cactttatgg atagggatat cgcatgattt ttatgttatg     43380
     ccagtattat attgtctgcg gatagactat ccatgctgac gccaaccaaa gtgactgagt     43440
     tttggccgaa ggtaaacact aagttattgt ctaccattga ggcgtgatcc agataactgc     43500
     ttttatcgct gctgccttcg gtacccaaga acaccagttt gtctgtttta ttgtaaccgt     43560
     agatgatatc ttgtccaaat tcaccgttga acaggaaggt attgttattg ccttggcttt     43620
     tcaacacatc gttaccttca ccgccaacaa aaacattatt attaccaaag ccgatcaaag     43680
     tatcgtcacc atccagaccg aataaccaag agccggaggt tttagctgta agagtattat     43740
     ccccgtcgtt gccagttact gaattagcgt atttcgttag ccccttactg gcggagtaca     43800
     aaccatcgtt tctgacttga gaatctacat ctttggtgaa aaacagccag gtattttctt     43860
     tgctttttat tgtggagata tcggtggcaa tggtgatacc gccttgtgca tcgcgcagat     43920
     ataatgtacc cgctttgtca taggctattt ccgcattttt taacgacttt tgtaaatcaa     43980
     aggtattatg gcctcgtcct ccggcaatca tattaaatcc gccatcatca cggaatatat     44040
     cattcccgtc gcgtccttcc agataatcgt ttcctttacc acctttaatt aggtcgttgc     44100
     catcggtacc gataataaaa gtactgccag tgtgtttctc agcatttcgg tttaaatcct     44160
     gcacccaggt atttccacgg gtgacgttgg aaagattgct gacaacaata gtagaatctt     44220
     tatgagttag gtcgtagaac acggaatcca taatgcgttg cataccgctc tggtaaaatg     44280
     gagtgacatg cgaaacccag gttgatgggt tagcaataga gaaaggtaat acattccacc     44340
     agtctgatgc atagtgatca ttaaagttaa caatattatt tgttgcagaa tcctttggtg     44400
     cgtcgtgtac gcctactgat gaggaagtga cgctggtacc cgtcaagacg cggaatactg     44460
     ggtcattttc gtatcccacg ttcaacactt tgccgtcctt ctcatactgt gatggtgaag     44520
     cgaaagttat atagttagac tgagagtaga atccacccca tttttcatta ctagcctccg     44580
     ccatactgtt agtcgctaat cctcctaaac tatgaccact gaccacaatg tcacttccgg     44640
     tcaggccatt agctttagcg taattagcca catgatccag caaccgacca aaagcgtttg     44700
     gtgtatagtt attcgagtat tctgtctttc ctaagcctac caacacattg ttgataatgt     44760
     caccaaatgt atcggtgatg atggtttccc ttgggccgct ggtaccacga aatgcaatgc     44820
     caatagaaat caaattgccg tcggcatcat atttgcccat tacttccgcc tgggcagtag     44880
     aatgacttgc tttttcgccg taaaaggtac cgcgggcatc cgttttaccc tgatagccta     44940
     actcgtcagc gctgatagta aaccatccgg cgtcgttaag cttatctcgt gcttgttttt     45000
     ctgaatctgg gttccaaggc aatttaggcg tgatgccttg tgaggtggta ctgccgataa     45060
     tagccttcaa taacgttaat ggcatcccta agccaaaacc gtaattgtaa tatccctcgg     45120
     caaatccact acctagatta tggtaagcat acccggaaat ggctttagcg tcggaaaata     45180
     actcttttga agtagcgtca tcaaaatctt tatactgaaa aacacccatg atgcatatcc     45240
     ttgtaaggtt aaaataaggt taaaagagtg ttctaaaaat attaacgaac taggtaagta     45300
     tagattgtta tagagcattt aaagtgtaat tatctgataa tttataaatt agtgagccat     45360
     catgaatatt tgatattttt gtgtaacttg tgttgaataa ttgttgcaaa tatgctaatt     45420
     accgaacgaa caagattaaa aatggggtaa atgacggatg gcaacagttc ataccactat     45480
     atggagggat ttgttcattc gatttggtat ttataaaaga gaagtgtgaa tatggtggaa     45540
     aaattctatc gttgattcat tcaatcaatc gaataaatct gtaaaatttg cattgattgc     45600
     attcaaatta attcacgata ttgatttgaa caaattatat acccaataga tttcaagttg     45660
     cagcgcggcg gcaagtgaac gtatccccag gagcatagat aacgatgtga ctggggtgag     45720
     tgaaagcagc caacaaagca gcaacttgaa ggatgaaggg tatatcttca tttaagtata     45780
     taaggagtat ttcatcgtga ataagcatgc cattttaacg attctctctc tataatgagc     45840
     tattcctcat gtagttctac tattttattt tgcgagatcc tgatatgaag cattctccat     45900
     tgcggcgttc attgttattg gctggtatta ctcttccatt ggttaacttt gcttttccag     45960
     cctgggctgg tgcgcttcct tcatcactgt ataaacaact tgcagaactg gaaaacagca     46020
     cgaaaggtcg tttgggagtg acattgatca atacggcaaa tggtcaggag attcagtacc     46080
     gtggggatga gcgttttcct ttctgtagta cttttaagct gatagttgtt gcagcagtgt     46140
     tacacaaaag tatgtcccag tcagagttgc tggcaaaaca tatcaattat agtgaaacag     46200
     atttgctgtc ttacgctcct attgctcgta agcacctgaa tcaaggtatg agcatcacgc     46260
     aattatgtgc tgcaacattg caatacagtg acaacacggc agtaaatctg ttgattaaag     46320
     aattaggtgg ggtagaggct gttaaccatt ttacccaaag ccttggtgac catacattcc     46380
     ggctcgatcg ctgggagcct gatttgaaca gtgccattcc tgatgatcac agagatacca     46440
     caacaccggc agccatggcg gccagtgtga agaaaattgt atttggtgag gttctggctg     46500
     aattgcaacg tgacctgctg atcgactggc tcaaaggaaa tactaccgga gatgccagta     46560
     ttcgtgctgg tgttccgaca ggttgggtgg ttggtgataa aactggcggc ggtgattatg     46620
     gtaccactaa cgatgttgcc atactttggc cgccaaaggg agcacctgtg attctggcag     46680
     tttactttac tcaacctcag aaagatgccg aatcacgccg tgatgtgctg gcttcggcaa     46740
     cgcggttggt gatggagcat ttggcttaat ttttcctggg actaaagttt gcgcacccta     46800
     gtattatgta gtaacgtgcc tacataaatt actgttatat tgaggtgtgt tatgtcaatc     46860
     acaactttat caagccggga gcttaatcaa gatgttagca gggcaaagaa ggcggctaaa     46920
     agaggccctg tgtttatcac agatcgcggc aagccagcgc atgtcctgct gacttttgaa     46980
     gagtaccaac gaatcaccaa gcaacgccga aatattgctg atgctttggc aatgcctggt     47040
     gttgaggata ttgaattcaa tcccccacga gccactatca atagtcggcc tgcgagtttt     47100
     tcatgatgtt tgttcttgat actaatgtgg tgtccgagct gcgaaatgtc attgattttg     47160
     agttgactgg cgtaccaata ttaaatcctt gggtttaagg atttaatatc ttaaacacca     47220
     aacggggagg tcgcctgagt gaaaaatttt ttaattaatc catcaatccc ataccttgtg     47280
     aacccattta ttcatcgtcc aataaacgtg cagcaaaaag cgttttactc agagatttgc     47340
     cactaaaatc tctttagggg attgaccttc atttaacata gcgatagcca gacttgatgc     47400
     tgaccgaccg taatccacca tccctatttg gcaaactcag tgcatattgt cagtcactat     47460
     tgtctatgta tggtgatctt tctaatattt cctcaatttt tttcttggct cttaataccc     47520
     actttttatc taatacacct aatatttcta gctgtttttc aaaataagct ctacgaaaat     47580
     ctttactttc atcattcctg ttttttaatt catattcaga tgccatttgg ctagctacac     47640
     tttccattat ccaatataga agctcattta aatcttcagt tgtttgccta aatatttcat     47700
     atcctctttc agagtaaata atatgatatt gattattatc aataattata tatccagaac     47760
     catcaccaat aggctctgaa taaactatca atattgattt aggtgcatta atcttagcac     47820
     ctaaagacca cactttttct tgtatttcat ttatagttag cattctttac ttcctttgtg     47880
     cacattattc tccacaatga aaataataat ctaaacttaa aggttaggac taatatttca     47940
     ttattttcgt gagttatact cacggtagta tataaaacaa catcctatac cgccaatagt     48000
     tcctcccatc gttcctacct ttaaacaaag caagaaatct tcttgagtaa aatcaaaatc     48060
     tccagataag aaaaagaaaa ttaaggcaat aattagtttt aaaatcaatc ctgttaggat     48120
     cataccaaca ataattgagc tgaataagtg tagaaaaagg agaaaaaaac ttagtttact     48180
     tagtttcatt tcttcttatc ctcatctaat ttttttaacc ctttactaat ctgatcatta     48240
     gtaatttcag ttgctacaga tgaacctata ttgccaacaa ctccagggat cttactgggt     48300
     gacatctctt tcgatatccc gaactcacct ttgacctctg tatatttaag taaattggga     48360
     ttaaatttcg ggtcccagcc accagttatc cacttgccta cagtatttgt actggaggca     48420
     acatacttac ccacaccata tcctattgct gaacccgctc cgctgatcat ccctcccttt     48480
     attggatcat cgcctttcac ataacttgaa gccgccccca tacccgcatt ccaggctatt     48540
     gttccccaca ggccagtatt ggctgtgaat acccccgtcc agtacgcaga aatagcatca     48600
     ttggggtcaa cattgccatt agcaagatat tggataccgg tattggctcc ggcaccaatc     48660
     atgcccgttg ttacagcggc tcccgataac cacggcaagg ccaagatact cccttctgcg     48720
     gcaaccaggg tttggcaaga gaggggcgta ttaccactac aggctttctg gatttcggtt     48780
     tgcttatcct gttgccattt ttcaactgtg ccttttttat tcgcttctgc cgctgccagt     48840
     acattcgcta aagagttatt gtccacaata aaaataacaa tttcgattta agggtgagga     48900
     ttaactccac tatttacgtg agttatattg gcggtgatac ataatccaag tacctgttcc     48960
     gcctattggt ccaatagata ttcctacttt gaaagccttt tttatatctt caaatgaaaa     49020
     aagaaacatt ccacctataa aataccaacc taagcacctg atgataaaaa aaatagtcaa     49080
     actcatgaga aatatagcca ctatccatat aatgtttgta ataaagaaga atttcattcg     49140
     attattttgg ggaaccattg cctttctcct gagctttatt aatttgctct tgaataaggg     49200
     agttcgttcc ttcagtcgtg atggaagctc ccatattacc aacaataccg gggatcttac     49260
     tcggtgacat ctctttcgag atcccaaact gaccttttac ttctgagtac ttaagtaagt     49320
     tggggttaaa tttcgggtcc cagccatgag taagccattt acccgccgca tttgtccaag     49380
     aggtaatata tttacctgcc ccataaccta tcgctgaacc cgctccgctg atcatccctc     49440
     cctttattgg atcatcgcct ttcacataac ttgaagccgc ccccataccc gcattccagg     49500
     ctattgttcc ccacagacca gtattggctg tgaatacccc cgtccagtac gcaaaaatag     49560
     catcattggg gtcaacattg ccattagcaa gatattggat accggtattg gctccggcac     49620
     caatcatgcc cgttgttaca gcggctcccg ataaccacgg caaggccaag atactccctt     49680
     ctgcggcaac cagggtttgg caagagaggg gcgtattacc actacaggct ttctggattt     49740
     cggtttgctt atcctgttgc catttttcaa ctgtgccttt tttattcgct tctgccgctg     49800
     ccagtacatt cgctaaagag ttattctcaa ttgcgttctt cccagcctgt gccccagtga     49860
     gcgcgctggc ggtggagtca ccggcaatgc cgccggccag tcccgctgcc agggtggaga     49920
     gggtactgat agtctgtttc tgctcctccg ttaactcgct gactttagcc gcgtcgccgt     49980
     aaagctgctt tatcagcacc tgagccgcca gctcgcccga cgcggccccg gctgctcctg     50040
     ccacagcgtt gttaccactg acttccgctg ctaccgcccc taaaatcgca tgggccagcg     50100
     tgttggtggc gatatccacc tgatgggttt gcgggtcggt ggtcagctct tttatcacgc     50160
     ccgccaaata aggcgaagca ccgccggcca gtgcttgccc cagattattt ccggccagtc     50220
     cctgaatcgc tgccgtggcc gcctgtaagg ctttctggta tgggccaccc gtgccaaaac     50280
     cggagtcatt caacgcctgc gtgtaagcgg tgtcataaac ttgcttattg atatccgctg     50340
     gcgagggggc tttattacct gcgttgatca acttttctct ggcatcggct ttatcctgtt     50400
     cactgatatg attgagtttc gctttcgccg ccttagtggc gataattttc ccttccgtgc     50460
     cggctatctc ggtcatctgg gcgctgagtt cgcccatcag ttgcgcctgt ttcagccgtt     50520
     gttgcgcttt ctccttatca aatatcggcc tcaggacatt ggccgcatta tcggtatcac     50580
     ggcttaagtt cgcgatatcc tgcgtctggt ggtccttatc ccgaataatt agggtgccgt     50640
     cactgaccgc tgcgtgcgtg gtactgcggt catggccctg attatttgag ccggtcagcg     50700
     cattgaccgc cagattattc agcccctgac cggtggttgg ctgaccaagg ctgacgccgg     50760
     cactttgctg ctcaacgcta aagtccgctt tattttgaat atctttaaag cccagtgttc     50820
     cggtattgag ggtgtttttc gcgttgtcgg cctgactcgc tatcacggcc ccgtccagtt     50880
     gggtgtggtc gccgacgtta acctgataac cgccttcacc agcaaacagc ccggtttgct     50940
     cctgcactga atcgtaattg ctgtgcagtt tattgcggct ggcattgaga gtcagggtgc     51000
     cgttgccgtt ggtgagcggg cctacggtgg cattgacccc ggcccgggcg ttgtgttgct     51060
     ggctgtcata gcgctggctg ccctgctcgc tgctgagtgt cagatggcgt tttacctcgg     51120
     cggtcatctg ttcgccgctg acttgtgccc ctttcagggt ggtatcccgg ccactgttta     51180
     gctcgacggt ctgtcccgcc tgtaacgtgg tgttattgtg gctaacaccg tgaccgtttt     51240
     cacggccgtt accccggctg acattggccg agacgttcaa accggtgccc ccgggtccgg     51300
     cagtcaggcc cacgcccagc gagctgccgt ggctgcggct cttgccggtg gtctgttcgg     51360
     tgttctggct ggacgagagc gcaatatccc ggctggcatg cagttgcagg tcttgaccgg     51420
     cctgtaactg gctgccctga atgcggatat cgccgttcgg accggatgcc cctttatcgt     51480
     caccgtgcgc cgttatcgtg aggttatccc cggcggtcag gtggctgccc tgttgggtag     51540
     tctgctggtg ctgctgttct gaacgggaag actgacgacc gtaggacagg ctcactccgg     51600
     ccagggtgtt attgccttta tcactgccct gggcttcggc cagccgggca gcctgtgtcg     51660
     cctgtacccc actgagggcg gcctgagtgt gttgcagggc tttgaggcgc gggtcttcgg     51720
     tttgctgcgc ggcccgggcc gtctgcaccg cactgttgag ggcgccgcct gccgtgccac     51780
     tcagcgccac cgtcaggcca ctttgtttct gttcggtttt ggtcagggta gtgtgatggt     51840
     ttgccgcact ggtgatattc acgttctggc cggtcagggt gatgtccttg ctggccacca     51900
     ggtcactgcc gtgaaggttg agctgggtac cggcattgag ggtgacatgg ccctggctgc     51960
     tgcccaccgt gctgccttta ttccgctggc tgtcgctgtc ggtggtgact ttctggctgg     52020
     cctggcctaa tgtgaaacca ataccgcccg tgcccatcaa gcccgatttt ttctcctgcc     52080
     gcaaatgggt ttcaccgtga gattctgcgg cggtggtgac ggtcagctga tgaccggcgt     52140
     tcaggcggac atcctgcgtg cccgccacat tgctgccgcg gatatgcagg tctttaccgg     52200
     cctgtaaagt cactttatcg ccgctgaagg tggtgctcag ggcttgtcgg tcatgcactt     52260
     cgtcgtgggt ttccactgac gacttggaca gccagccttt gctggtttgc ttactgtgct     52320
     ccactaagtc ggatgaggcg gtaccggttg tcaatgtcag gttatttccg gcctgcgccg     52380
     tcaattgttg accggcattg acgtgggcgg cggtagcggt caaatcctgc ccggcttgca     52440
     gggtcacctc accggcaccg gttatctggc tgccgatatc ctgctgttgg ctcagatggc     52500
     gatagttatc tttcccccag tcgccctgtt ctgtacggtg cgtgcttagg gtatccagcg     52560
     tcaggttatg gccggcggtt atctcggtgc gaccgtcttt accggcgttc ttcacctcac     52620
     tggcggttaa ttgcacattg ttgatggcac tcagcgacag ggtgccctgg tcgttctgca     52680
     cataaatccc cgccggacgg tcccgccagc ggttcgcggc atctccgcgc agggtcgcag     52740
     cgctggtgat atcccgaccg gcttgcagca caactttatc cgccccctga atctggccgc     52800
     cccggttggt gatgtcctgc cgggccgtca catccacttt accgccgcga ataaagccgc     52860
     tgttggtcag gttgttggcc gtcaattggg taacgtcacg cccgctaatc gtgccgctgt     52920
     tggtgatatc gccctgactg ttaagggcca cggtattacc ggccagtaaa gcgccgtctc     52980
     cgctcaggtc gccgggtctc acccgggcgt aaacctgggg caccgtcacc acctgcgtgc     53040
     tgccgtccgg cagagtcacc gtctggttgg tcagccagat aatgtcggcg gtcagcagcg     53100
     ccatctgggc cggactcagg gcaatgccgg gggtgagttg ttgttcctta ccgaaagcca     53160
     ctccggcatc catcagcgcc ttaaactgcg cttcatcgtt atggtaaccg ggcaggtagc     53220
     gctggccggt cagctgggta atctgctccc gcaccagtcg ctgttcatag aacccatcgc     53280
     ccaggcgttt gtgcaccagc gccgggtcgt gcgttaactg ttgccgcata taatccgagc     53340
     ccagccactg tttatactgg gtaaatttcg ggtcggtctc gaccagatag tggctgtcac     53400
     tggccggttg caccgtatac aggctgttat ccggcaggcg ggtattgggg gtcacgacac     53460
     gtatcaccgg gtcgatgggt tgccctttca ccgtttctgg gggcaaactc agttcaaacg     53520
     gttgaccagg tggcaagacc cgcggctggt cgtttatccc gctcaccggt ttcaccgccg     53580
     tgggagccgc gtgaatttgg ccggtctgtc ggtccgtaat cgtgatatcg gtgttctgtg     53640
     gacgggcatg gtcctgccag gccagcgttt tcaggtcaat cgtttctacc accggcgcag     53700
     ggttataacc actgcgactt tttccctgcg aagttttggt gccgccgatg ccgagtttgt     53760
     tccgtttttt cttggcgtac cagtgggtct ggctgccggt ctcggtggtg atacgttcgc     53820
     cctgcgtggc gagattgtgc agttcgccaa tcgtgcccgt cagcgcgcca ccggcaataa     53880
     tttggctgtc gtggttggtg acctttgcac tgttaagggt gagatggccg ccggccagaa     53940
     ttttacccgg gtcgctgtgt ttgacctgcg tttccgtcac ggtacgggtg tactgatact     54000
     catagaagtt atcgctgcgg ctgccgtccg gcatccgggc ggtatgcacg ccgtatttgt     54060
     cccgctgggc ggtgtctacc tgcgaccagt catagcgggc agtctggccg ctaagcgccg     54120
     catcgtgatg ccgggcgtgt tcggtttcgg cgacctgagt caccagcccg gcgttggtgt     54180
     tgtggagctg gttggcgtca atcgtcagat taccgccggc ttcgagggtg gcggcgtggt     54240
     tagtgagttc acgcgcctga ccggtggcgg ataaggtgtt atccagctgg ccgccgatat     54300
     gcgtctcgcc cacactgtaa atttgcgcat gatgctggtt gttcagggtg tcagtgccga     54360
     tagccagccg gtcacgggcg gcaatcaccg ccgcgttgcc ggcgtgcgcg gtgttattga     54420
     gcgtccccgt ctggagggcg agatggtccc cgtaaatccg tccggtgccg gtgttggtca     54480
     acgtgtgagc cgtaagatgg gtcaggttgc cgtcaatcag tccggtattg gtcagcgtat     54540
     cgtggacctt gatttgcgtt tgttcggcgc tgatttcacc ggtggcgctg ttagtaagat     54600
     tttgcgcccc aagatgcagc gcctgaccgg cttttatcgg gcggtcattg aggagattgc     54660
     cggtggtttt cagggtcaga ttgccattgg ccgccgtgtt gccggtatgg tgaaaatcct     54720
     cggttaaggt caccgccata tcgccctgcg ataacagttg gccgtcaccg ctgagcgtat     54780
     tagcctgaat atcgacctgt ttcccggcaa tcaaggtgcc ttgttggttg ttaatcctca     54840
     gaggcggttg ctgagcctcg cggttgatag tgagctgttt gcctgcggag acccgcccct     54900
     gagtattatt caaggtctgg ctgatattcg cttgcaggtg gtcggctgcc cgtaaagtgc     54960
     cctgactgtt gtccgcctgt tgggtgctaa ccgttaggtt ttgggcttcc agtcctttat     55020
     ccgtctgcgc cgtgtcgcga ttaatcaggt gagcggtgct caaggtcaat tgcgcaccgc     55080
     cacgaatcaa gccgccggtg ttatcggttt gggttttaac attcaatacg gtgtcgccca     55140
     ccgcctgcac ctgcccatga cgattgtcga gctgctgggt tttcaggttg aacgtacctg     55200
     ccgacaacaa tttgccgtcc cggttatctg tctgcgcctg tcgggtgtca ataaccaact     55260
     gtccgccttg cagatgaccg tggcgattgt ccagcgggcc gctggtgacg gtggtgatgc     55320
     catcgccgag aatacggccc tgctggttat ccagtccctg tccatcggta tcgagattca     55380
     gcgcatcggc ggattgtaag gtgccctgac ggttggtcag ttgctgactg tgaatgtcca     55440
     gtccgccatt gccggctatc tgtccccggg tattgttaag cgcggtgctg ctcagggtag     55500
     tgtggccgtc tgcggcgatg atcccgccgg agttattgat atcgccggta tgcagcgtta     55560
     agtgtccgcc gctcaataac tggccgcctt tctggtccgt cgtggcggtg ttggcgagcc     55620
     agtgaccgtg agttttcacc gtcatgtcgc ccccggactg taatagtccg gcggtgtttt     55680
     ccagctcacc actgtgtaag gtcagggtat cttgcgcgat cacttgtccg gcggtattgg     55740
     tgaagcggtg cccggtcgtc tggctggtga tatgttgcgc cagtaatgtc ccctgggtgt     55800
     tatccaaagc ctgactggtc gtagtgagtc gggttttggc ttcgatatgg ccgtgggtgt     55860
     tctgaatctg ttgcccgata gtcagcgtgg cactgccccc agaggccgcc agggttcccc     55920
     ggcgattatc cagttgggtc gcggtgagtt ggatatgttt acccgcttcc agtcggccat     55980
     tctggttatc cagcgtgtcg ttaaccgtca atgtcaacga gccgttttca gccgcaacaa     56040
     actggccctg acgattgttt atcgccgtgg cattcagatg caggtttccg ttaccggcaa     56100
     tcttgccgcc ctgattattc agcgtgttga ccgtcagggc cagggtatcg gtgcccgatt     56160
     gttgcatgac actggcctga tggttcaggg tgtctgcgat taccgtgatt ttattcgccg     56220
     tggtgacggc gtggttcagt tgtaaatcgt gagcctgaat atccagtgcg ccgttggtca     56280
     gcagtttgcc ctgatggccc agccagtgtt gggctgtcag ggacagctga ccgttgccgg     56340
     ccagttgcac ttgcccctga gtgttgtctg cggtttgcgc ggtcaggtgg aagttatccc     56400
     cctgattgac gaggttgccc tgacggttat cgagctggtc ggtggtgatc gtcagccgtg     56460
     acccggcatt aaacagggtg ccaccccggt tattcagggt ccgggtgtgg agggtcagtt     56520
     caccgggacc ggtctgggtc attttgccct gatgattgga taaatccggt gtggtgacgt     56580
     ggatttcccg cgccaccagc tgaccgccgt cattgttaaa ctggcccggt gtctttgcgg     56640
     taaaacggtc cgccgtcacg gtagcatggg cggtgctgat gcccggttga ctggccgtca     56700
     gctgaatgtc gcccgctaca gtttgactgc cgctgaggtc aatctgttga ccgtgaatat     56760
     tcagcgtatg ggtcgccaga tttttcccgc cagcctgaac ctgctgggcg gtcagggtca     56820
     gtgagccggg gcgggtggtg ttcccgttat catccagtcc ggcggcccag atactgtggc     56880
     ggtcactctg tatcgtctgg gcggtggcgg tgatatcccc ccgcgcctca atccggcccc     56940
     ggttgtgcag tgggccccca gcctgcaaag tgaccgtcga ttgcgacagc agtttgccct     57000
     gattatctat cccggcggta ctggttaatt gcagcgcatc ccggctgctg attgtgcccc     57060
     ggttctcaat ccggccatcg gcggtgacga agacttcccc cgcgggcacg ccgatatcgc     57120
     cggcattccg caccccgaca ccggcttcgg tgcctatcag cagaatctta tgagcataca     57180
     tcccgccgag tgccgtactg tccagcgcga acagtgggtg ggcctcatct tcagcggcgg     57240
     attttttcgt gatggtctgg tgtgcggcat ccacgcgatt gcgcccggtg gtcactttca     57300
     ggttttgggc gtgtaatttg gcgttgaggg caacggcgcg ggcaatgatg tccgtgtaat     57360
     tttgctgccg gctgtccatc ccttgcccct caatacgcac ttcgccctga ttcacgtcaa     57420
     aaccggtcag atgcccccgt tccatcaggg cttcaccggt ggtcagggtg gtgcgatggg     57480
     cattgataaa accacaacca ttacaggtaa tcccggacgg attggcaatc accacctcag     57540
     ccttgcgtcc ggcgacttca atccagccat tgaggtggct ggggtcacgg ctgttgactt     57600
     cattgaggat cactttggct tcccctttag ccagccaggg gttgccggcg accatgccgc     57660
     ccagttgggt ctcggtcgcc tttgcgctgt tgttgaggat aaccccgcgt ttatcgacat     57720
     caaactggcg gtaagtattg tgggacacgc cggcagcgct gggggtctgg atattcacct     57780
     gcggcgtgcc gttggcactg gggataatcg tcggctgttg ctggcccggt gcctgtccat     57840
     cggccacaat cgccgcctgg gcggtgagtg aaatcccgcc cagggccagc aataaaccga     57900
     actggaacgc ggtaaggcga cacaaccgtt gagccgatgg ccgaccgcga cggcgcgcgg     57960
     tgctgccttg cccggcccgg gcaatctccg ccaccaccat cagcctattt cgggatcggt     58020
     taaagataag acgatataac tgtttgttca tggggggtct ccacgcacag actacacacg     58080
     ggcagccggg ttatttgaat gaatacggcc agtaccgaat ggcgggaccc gggcaagggg     58140
     aaagccgtgt gctgccgtcg gaaaggcggc gggcgaggtt ttttccagta cagacaggcg     58200
     aactgcttca ggcgatggag ctaattgggc ctccagtgct tgctgacgcg cctgttgatg     58260
     aatacgttgt tgatctgaga ggtcagcggc ctgactgcct gaagccgtgc tataaaaaac     58320
     cgctaatacc aaaatactgc ttttcattgc ttttctattc cacaattacg aagcggtatt     58380
     aaccataaat ttaacttagc gatcaatgtt tgaggtttat tgtcacgcag gtaactaaaa     58440
     gcagggatgg ggttaagata gcagcaaaaa caaggggttg tattttaatc aaaaaataga     58500
     tccaggttat tattgtgtta caaatcatat aaaaaataca ttaatattag ttatttaata     58560
     atcaatagta ataatttcaa attaatttca tttttttgtt ttattttgtg atattaatca     58620
     caaaaataga tctcattacc ggaaaaagtt acttgcaata aagaggattt tcgtcattac     58680
     ctgaacaggt aaaactattt acccttgtcc gataatactg aggctaaatc gcgtcaattg     58740
     agttatatcc ttcatccttc aaattgctgc tttgttggct gctttcactt accccagtca     58800
     cagagttatc tatgctccta gggatgcgtt cacttgctgc cgcgccgcaa cttgaaatct     58860
     attgggtata gctttttcac ggcaggggcc agaaaataat tggcaaaata tttatcttga     58920
     ccattttact atattatcct cctgctttta tcttcttatt tttttatatg gaaatattta     58980
     taatttttta ttatccgcgg atcataataa atccaggaaa tatttccata aaaatgacag     59040
     tagaaagtca gggtcatgaa tagttatcaa atattgacct gattattttt tgcctattat     59100
     ataaaaataa ttaaccctgt aagttataaa aacaatccat tattattttt atgaactaga     59160
     ctatgactga ccccaattgg gagtaattat ctgtataata atttaatatg ttgattatag     59220
     aagggcatta tttaatttaa gaggggtata tgagccaaaa gaatgatttc aaggcatttt     59280
     ctattaagaa tggtgctaat gtggtgagtc aatattctta tgaaaatagt cctgagttac     59340
     agactggatt gacacccaat agtcctgttg atattcactt gttaaataag gcgctgcgtc     59400
     aatcgtcagt tatatcatct gtggtagctg attttatcgc gacacaatct ggcgatgata     59460
     ttttggatga tggtgatata gctaaactca ctgttcaatt aaatagagcc ttaaaacaaa     59520
     aagttacggc agaaattccc agtgcctcat tgatacaaaa aggtgttgtt cagctgacta     59580
     atgagatggg taataatgac acattggcag taacacaaaa gttagttcag gaaatagtca     59640
     attcattgcg tgaaaatatt aatggcaagg tacccaatag ccggagaata aatggtaaag     59700
     cgttgactga agatattaat ctgaatgcga gtgatgtggg agcatatact cgtacagaag     59760
     tatatactcg agcggaagta gataagttga taaaaacaac cagtgaaatt cctgttggct     59820
     ctcctattcc ctggccgttg tcccatccac cttttggtta tgtcacttgt aatggctccg     59880
     cttttagtag atcacaatat ccaaagttag cggaagctta tcctagtggt aggttacccg     59940
     atttaagagg tgagtttatc cgtggttggg atgatggtcg tggaatagat agtggtagag     60000
     cacttctgac aaaccagagt gatgcaatta gaaatataac cggaggattc tcagcccgaa     60060
     gaatgcaggg tcatttaaac atattcaggt caactggctg ttttggttgg aaatttgatg     60120
     agtcatatgt tataggcaca agccagatgt cgagtgttaa ttatggaaca gatgatataa     60180
     cttttgacgc atcacgcgtt gtcccaacag caaatgaaaa tcgtcctcgc aatatcgcat     60240
     ttaactacat cgtaaaggca gcataataat gacacaagaa aatatcttag atactgaaat     60300
     cgcaatatta ggtgaagacg gcttagcaat taaggctggc tggataaagg tttatcatgt     60360
     taatccttat tcgagagaat tcgccggaac taatgttgaa tatgtggcgg aaggtgtagg     60420
     tgtatccgcg cattcttatc ctgatgctcc aaatcttcct gataccgata atatggttgt     60480
     acgtcgcagt gcggacgaaa gtcattggga aattgtccct gatcatcggg ggaaaatagc     60540
     ttatagcaca caaacaggtg aacaacagga agttattgaa ctgggtgaat taccagaaat     60600
     attgacattc gagcaaccgg ttactgattt tgataaatgg gatggtgaaa actgggtaac     60660
     agatattgaa gcgcaacaag ccagtcaaat taaacaggca gaacaacaac gtgccacttt     60720
     tcatcaacat gccagtgacg ctataaccgt gctgcaatat gcagttgaaa ctgaaatggc     60780
     atcagaggct gaaaaaacgt tattgctgga ttggaaaaag tacatggtgt tattaagtcg     60840
     agttgatatt tcattggcac cagatattac ttggcctgaa aaaccacaat aataatagcg     60900
     ttaccgtttt taaatattga tatacccgtt atctttcaag ttgcctcttt gttggctgca     60960
     ctcactcacc ccggtcacag agttatctat gctcccgggg attcgctccc ttgccgtcgc     61020
     gatgcatctt gaaatccata aggtataagg tataaaaagg ctagcttttt taatcataat     61080
     tttgacttag taaaagctcg tctaaaaacg agcttatcac tatgttatta ataatgggta     61140
     taaattctgg ggaattatgt ttaataattt aatatgttga ttataacata atattattta     61200
     atttaagagg gatatatgag tcaaaaaaat gatttcaaag ctttttctat tagtaataat     61260
     gctaatgtgg tgagtcaaga aaaatatgaa gaaagtcagg gggtaaagac ggggtttcca     61320
     ccagagaata tccctattca tgtattaaat aaggtgttac gtcaatcgtc aactatagcc     61380
     tctgtagtgg ctaattttat tgcggcccaa tctgatgatg atgttctgga cgatggtaat     61440
     atagctaaac tgaccgatca attaaatcta tctttagaac aaaaaatcac aacagtaatt     61500
     tccaatgcct cattaacaca aaaaggcgtt gttcagctga ccaatgagat gggtaataat     61560
     gacacattgg cagtgacaca aaagttagtt caggaaatag tcaattcatt gcgtgaaaat     61620
     attaatggca aagtacccaa tagctggaga ataaatggta aggcgttgac tgaggatatt     61680
     aatctgaatg cgagtgatgt aggagcatat actcgggcgg aagtagatag attgataaaa     61740
     aaaaccagtg aaattcctgt tggctctcct attccctggc cattgcctca tccacctttt     61800
     ggttatgtca cttgtaatgg ttctgccttt aatagatcac agtacccaaa gttagcggaa     61860
     gcttatccta acggaagatt acccgattta aggggcgagt ttatacgggg atgggatgat     61920
     gggcgcggag ctgataatgg gcggaaatta ttatcctggc aagaaggttc cgcattgtcg     61980
     gaatatcttg gaagcttcac aactggagta gcacaaaata tacatcagag ggatggagtt     62040
     acatatcacg ataaagatca taaaagatat aaaataccat cattagaaat cattggtact     62100
     ggagttgatt atttccggtt caggccacgc aatatcgcat ttaactacat cgtaaaggca     62160
     gaataataat gacacaagaa aatatcttag atactgaaac cgcaatatta ggtgaagacg     62220
     gcttagcaat taaagctggc tggataaagg tttatcatgt taatccttat tcgagagaat     62280
     tcgccggaac taatgttgaa tatgtggcgg aaggtgtagg tgtatccgcg cattcttatc     62340
     ctgatgctcc aaatcttcct gataccgata atatggttgt acgtcgcagt gcggacgaaa     62400
     gtcattggga aattgtccct gatcatcggg ggaaaatagc ttatagcaca caaacaggtg     62460
     aacaacagga agttattgaa ctgggtgaat taccagaaat attgacattc gagcaaccgg     62520
     ttactgattt tgataaatgg gatggtgaaa actgggtaac agatattgaa gcgcaacaag     62580
     ccagtcaaat taaacaggca gaacaacaac gtgccacttt tcatcaacaa gccagtgacg     62640
     ctataaccgt gctgcaatat gcagttgaaa ctgaaatggc atcagaggtt gaaaaagcgt     62700
     tattactgga ttggaaaaag tatttagtat tattaagtcg gattgatatt tcattggcac     62760
     cagatattac ttggcctgaa aaaccgcaat aataatagcg ttaaaatttt accgtattta     62820
     aatattggta aaaggttttt ttaaccgtcg tttttattta atagaagctc gtttttaaac     62880
     gagcttatcg ctgtgtttat tatatagcaa taggggggat atatgagtaa aaaaaatgag     62940
     tttaaagcct tttctattaa gaatggtgct aatgtagtga gtcaagatag atatgaagca     63000
     agtctggact tacaaacggg gtttccaccc aatgatgttc caacacattt gttaaataag     63060
     gtattacgtc aatcatcaac aatagctgct gtggtggcta attttattgt gacccaatct     63120
     ggcgatgatg ttttggataa tggtgatata gctaaactca ccgcccaatt aaatctggcg     63180
     ttaaaacaaa aaatcacggc agaaattcct gatgcttcat taaagcaaaa aggtgttgtt     63240
     caacttacaa atgtgattgg caatagtgac acattggcag tgacacaaaa attagtgcag     63300
     gaaatcatta attcattacg tgaaaatatt aatagtaaag tacccaatag ccggaaaata     63360
     aatggtaagg cattgaccgg tgacgttagt ctgaatgcgg gggatgtggg ggctgcatca     63420
     attaatgatg caatgcgttt tactaatttg aatggatggg aaaatatata taacggttat     63480
     tcttgggttg cccctaatac gcctttcgtc actcgatatg ggttgccaaa tgtatatggg     63540
     gtccagttaa gattcagtaa tgtgaatggt gcctcaagcg aaggcattga tggagtatgg     63600
     agccataggc tcgttttcat gcatgaaggc gatacatatc gtacagatag aataaacgcc     63660
     gatagcaaaa gacagtatac acgcaggttt tgggatgaca gaaatgctaa accggatact     63720
     aatggatacc ttaaacgagc ctctccggta gtagaaattt atcctgatgg cacattctca     63780
     actaatgaag aatcagaggg tgtggaagtt aaaaaacagg ggatcggcat atatcatcta     63840
     tcaaatattt tgggttataa cgctgatggt ggttggggga tacatggtgg tatttctgtt     63900
     ccccatgaca acaataatct cgaattgatt tttgttaaag atcaggttca gcctgatggt     63960
     tctattatta ttaaaacttt ccaccgtcaa catgcacatt tacctgaaat gtttcagaac     64020
     tggcaactca aatctgttga tgacaatggt aacgagatat tctaccaaga tggagaaccc     64080
     tgtgatattc ccgaatcttg ccgcttagat attcgtgtcc aaatgccaga agattcgctg     64140
     tggaacttga gacaaaagga gttacaggaa gaatataaat aacgtgcacc gctgatcaca     64200
     attcataatt tgtagtaata cggggcctaa tatggccctg tatcttattt tttacgcaat     64260
     tacccggcta tttgcaataa gtatttatct attaatccag atacaatttc cagtaaaaat     64320
     tcatcaggcc gtgacatctc aattaatcat atttaggtag ttaatcgatt tgtctttatt     64380
     aaaagccttg aatatgaatc aagtatttta tttcaacgtt aggaaatccg taattaaata     64440
     aaatcctaat tccatatata tttctatttt tctgacaaat cagatttcca ttattaaaaa     64500
     tagttaatcg agaaataaga caagtacgaa aattcatttt aataataata tttaatgttt     64560
     attttaatta ttaaatacaa tgagttatat aatttcatgg aattcaatgt atgatattta     64620
     accctagtga ggttgcatta aaacaatata cgtgagaatt tatttaccag ccgacacacg     64680
     gtgggtttta aatatcattg aatgtgccac agcatattaa gttgctataa atggacgtta     64740
     attgatctct tcgtccatct catcttgttc ggttatttaa tcaggtttgg tgcggtttaa     64800
     cgtaagtaag tttgcacttc ctgtcatata taaaggtaaa aaggtgccat gaatactcaa     64860
     cgtaagcttg ataaagtaag gccgccccgt gttcagatta cttatgatgt cgaattaggt     64920
     ggtgcggttg agaaaaaaga attgcctttg gttattggtg tgattgggca atttgctgag     64980
     caatcaattc ctatgcgtga acgtcgtttt atgcatgttg ataaagataa ttttaatgct     65040
     gttatggaag gtttatcacc ttctttggaa ttacaggttg aaagtgctct gccggatcag     65100
     agtggattta ttaatatcga tttgcaattt caatcaatgg ctgatttttc cccggagaat     65160
     ttggcgaagc agattgagcc acttcgtaat ttattggaaa ttcgcagcaa attaagtgat     65220
     ttgaaaggtc gtgcattgag taatgaaaaa ttgcgtgacc gtctggcgga aattcttgct     65280
     gaacatgcgg acaaattacc gccggtaaac gaggaagcag aaaccgttgc aacagaaaat     65340
     acaacggatg acgttacccc ggaaaataac aatattccgg aagataacaa tgcacagtga     65400
     ggacaacatg gaacagagcg ttgttgaaca gcaagaattg caagcaacgg aagccagcgg     65460
     cgattttctt gatcagatta ttgataacac ccaggccatt cgtcgggaaa cggatcgtga     65520
     tcgggtaaaa agccaactcg accagttttt atcagaagtg actgctggct cattagtggt     65580
     ttctggtgat ctggtaaaca gcattgagga gcgtattgcc gcgattgacg cgttgatgtc     65640
     agctcaactg agtttggtac tgcatcatcc agaattccag cgtctggaat cttcctggac     65700
     ggggcttaaa gggttactcg atcagagtga aacggataac acccagattc gcatgttgaa     65760
     cgcgacaaaa accgatttaa ttaaggactt taaatcggct tctgatttcg atcagtcaat     65820
     gctgtttaaa aatatttatg aacatgagta cggtaccttt ggtggtgaac cttactcggc     65880
     atttgtgggt gattttgatt ttgataacag cccagaagat ctttacttac tggagcagat     65940
     ttctcatgtg gcggctgcgg cacatgcacc gtttattagt tcagccaatg caggcatgtt     66000
     ggggctgaat gattttggtg aattaccgcg tccgcgtgat ttgtccaaac tgtttgacac     66060
     atccgactat ttgcgttgga aacgcttccg ggaatctgat gactcccgtt atgttggtct     66120
     gactttgcca agagtgattg gtcgtttgcc ttacggagca aaaacgattc cgattgaaca     66180
     gttctgtttc gaagaacaga tgagagaagg ggatagcaat agttatctgt ggattaatgc     66240
     cgcttatgca ttggctggcc gtatggtggc tgcgtttgaa caatatggct ggtgtgctgc     66300
     gattcgtggt gtagaaggtg ggggattggt cgaggcattg ccaactcatc attactcctc     66360
     tgtgtccggc gaaaaaatgc tgcaatgtcc aactgaagtg gctatttctg atcgccgtga     66420
     gaaagagttg gcagaattag gctttattcc tctggtttat tataaaggga ctgactacgc     66480
     cgcatttttc tctgtgcagt cacctaataa acccaggaaa tataattctg acctggcaaa     66540
     tgccaatgca aaattatcaa cacaattgca atatattatg acgacttctc gcttcgcaca     66600
     ttatttgaaa atgattgtgc gtgacaaagt gggtagtttt atgtcccgcg gagaatgcca     66660
     aacttatctg caaagttgga tcaaccaata tattgttggt tctgatactg tcggcgcaga     66720
     aattaaagcc agccatccgt tgcgggaggc aagagttgat gttgttgaag ttcccggttc     66780
     acctggaaca tatcgcgcag tggcttattt aaggccgcat ttccaattag agggattaag     66840
     catgtcttta cggttggttg ctgatttacc accgtcctca gctgcttgat tgttcattta     66900
     ttaatatttg tcttattcat tacaactaaa caactaactg gagtagttaa ttatgagttc     66960
     ttcaattttt ttgcaaattg atggtattaa aggtgaaagt accgacagca aacataaaga     67020
     ctggattgag ctggagcatg tgaattttgg cgcgttcaac cacgcacgta ttgcagacag     67080
     tggtaaacgt aagattaccg ttggtgcagc ggatttccgt acgatcgact gtgtgaaggt     67140
     gatggacatc agttctgtca aattgttgtc agcagtggca caggggactg cgattaagaa     67200
     agtgaaattg gaaatctgta cgattttcaa aggggaaatg cacccttacg cggaggttga     67260
     aatggatgaa tgtattatct ctgatgtcca tgaaacttgt tcacgtggcg gtgaattccc     67320
     acaagagcag ttttccatta cctattccaa aattaaatgg acattcacac cactcagtcc     67380
     agacggcacc aaaggcaaca aagcaggtcc agaaggctgg gatcttatcg aaaacaagaa     67440
     acagtaattt ttgttgttta ctgccggcct ttggccggcg gttttatccg caaagagatg     67500
     acttatgatt cagccttcat ttctccatcg cttgaaagat gattatccac aaaatgaaga     67560
     acgtggagta acgtttattt ggtcgcgtca ggaagttgtg caaagcctta tgttcgatct     67620
     gaacatgtta ttttcatcaa gaccgatttc cgcagtttta cctttatttg gtgagttacc     67680
     gaaatccgtt ttaaattatg gcgtttctga tgttattagt gttgatattt cggatgatga     67740
     gcgtattgat gcactgagta ataatattta ccaggctatt tcctggtttg aaccacgcct     67800
     aaaaaatgtc gttattacat tacagaaaaa tacaccggag aatattactt tttgggtgag     67860
     tggaattttt ttcaacgaac agattgtgtt ttctatctca tggagcagta ctgcttatac     67920
     ctattcaatt tcatgggaca gatcataata tgatgttatt accgcaaaaa atactgactt     67980
     attataaccg ggagctgagt tatttaaggc aatatggtgc cgctttttct cagcgttttc     68040
     ctaaaattgc caaacgtctt ggattcgcgg agggcgtttc agaagatccc catgtagaac     68100
     ggttagtaga atcttttgct tttctgacgg ccaagattca tcagcgtatt gatgaagata     68160
     tgccagagct gaacaacgcc atgctggaag tgttggcacc acaattctta cgccaggttc     68220
     cgtcagtatc gttggtacag tttcaacaag acccgttggc atcgggtgtg actggcgtga     68280
     tgacggtggc acgacatacg ccgttaattt ctcagccggt cgatgatgtg gcttgccgtt     68340
     tccgcacggt atatccgctg gaaatgttgc cactggattt aacccacacg gaactgatgc     68400
     cagatcctta tgatcgggat tttattttaa ctctgaattt cacgttgtgg ccgggtgcca     68460
     gctttcgggc gcgtcatatt cggttgtact tacatggtgc gccgatactg gcccatagct     68520
     tatatgagct gttgtcggcg caggtaaaac aactggaatg tcggctgggt gagcacgtat     68580
     tcaacatgga taaccgagat attcaggtcg tgggtttcga tccgcaagat aacctgtgcg     68640
     ctgatgatct gatgataaat ccgactcatc atctgttccg cgattatttt agttttcctg     68700
     aacggttctt atttctggac attccgttac ctgatgcagg tttgatcacc aaattagcgg     68760
     gagatctgca ttatcgtttc cggcttaagg attgtgctgc gttgcgtcgt attgagcgaa     68820
     tgagcgataa agttgatagt gaaacttttc ggctaaattg tgtcccggta gtgaatctat     68880
     tttctcatca ggcagagccg attattccgt tagaaactga gcacgaatac ctagtgcaac     68940
     cggatgcgcg tcgtccacaa agtatggaag tctatactat cgatagagtt gagattgtta     69000
     gccgtcagca agagcaattg agttctagat ctgtaccgcc attattcggt attgaacata     69060
     cacaagatgg cgagcaacct ctgttgctct ggcaagcatc accacgccct tcactcaggc     69120
     ataacgaaac gggaatgaat atgtttatcg gtttttccga tagcagtggt gagcaattaa     69180
     agccagaaac cgatgtggtg gtattgagtt taacctgtac taatcgtgat atgccgcggc     69240
     tgttgagcaa tggtcatccc gatggggatt ttgaatcaga ggttgcttta ccgggcgtaa     69300
     aaattctggg actgatccgt ccccggttac cggcgcgccc acaaccgaat tgcgcattga     69360
     actggcgttt ggtgtcacaa ctcaatctga accaaatgtt actgagtggc tcgcaaggcg     69420
     ttcaatgcct aaaagagacg ctagaactgt acaacttgca tggtgatccg gccatatcgc     69480
     ggttaattgc ccaactacaa caggttgcca ttgtgcctgt gagtgcacgt ctgaatcctg     69540
     ctgatcctta ttctctggcg cgtggattgg aagtgacgtt gacattccag acacaggcgg     69600
     gtgagtttgt cgatttttat cttttttgca gcctactgga acgttttatc gctatgtatg     69660
     cgccgattaa cagtttcacg cagacagtga ctcaattgga atcggttaat aatagtatgc     69720
     gtcgttggcc acgtcgtagc gggaggctga catggcttta gaaaatagaa tacgtctggc     69780
     tggggggcgc ttttatcaga atgttcgtcg tctgcttaaa cgctgtcact atcggcgaag     69840
     tagtgaggca gcagttattc ctgatgatgt ggtgcaattt agttcggtcc tcacactgga     69900
     tgcgccggaa agtgaagtgg acgctttgtt gccaccgcaa caagagggtg agcagtatcg     69960
     catggcggta tatcactttg gtttgttggg aacatttggt gcactgccgt tgcgctatac     70020
     cgaatggctg attgatcggc gttatcgtta tggcgatgaa tcagctcaag cgtttattga     70080
     tatttttacc catcgtctgc tcagtctgcg ttttcaggca tggcagaaat accggttatt     70140
     tgttaatgct gaattgcaaa gccgtcgggc gttacctgcg gtcattccgg cagtggctgg     70200
     gcaatttacg acgaatgaac cacagcatat tcgtcctgcc tgcgttggct tgttggcaac     70260
     atctgttcgt tcaatgatga acttgcaaca tctgttgcag cgggaattca acatgccagt     70320
     cagtattcag ccgtttaggg gacgttggca atatgcagag caaatgcact gttgttgtct     70380
     gggccgcagt ttgctgggtg ataatccgat gttaggtagc gcttattggg atattcagtc     70440
     gggatttcat attcagttag gaccgtttgc agcccagcag agcgccgatt ttatgccagg     70500
     aaatgaacga taccgcagat tgacgcagtg ggtgtggcaa tttgccggtc cgttgctctc     70560
     tttctcgttg gaattgctag taaagcacga tgggcagggc aatatattaa acggcagtcg     70620
     tcgattggga tgggatggtt gtttggggaa taccggcgat acccatattc aacgtgtgta     70680
     tctgggagaa tgtgtgggtc cttatacggt ttgaacaaaa aattcaggtg aaaaaaatgc     70740
     tgttagggca aaagaatcgt tttttacagg ttatcggcag tctgtcagat attgtggcac     70800
     tgaataaaat cagcggcgaa gaacacttgt ctcgtcctta ttccttttca gtccagctct     70860
     actccagttc ggattggaac aagttagagc cttatattgg taaaccactg gcatttcgta     70920
     ttggtgaagc accaaatcac cggattgtgc atggcatatt gacggaatta cagcaacaag     70980
     gttttgctga tggtcagttt tgttatcagg cacgggttga accgtggctc aaaatgttga     71040
     cgttaaccag taacctgcgt gtttatcagc gtatcagtgt gccggatatg gtgtgcgata     71100
     ttttccgtaa acgtgggttc aacgatgttg aactggcgtt aaaaagccgt tatccgaaac     71160
     ttgaatattg catgcaatac aaggaatcag attttgattt tgtgacgcgc caactggaac     71220
     aagcgggtat tttctacttt tttcgccatg aagaagggcg tcatgtgttg gtactggctg     71280
     atcacccttc gacgtttgtt aacgcgcctt tggcggtatt gccgtatcag tcgaagctcg     71340
     gtagtcagca aggatacggg ctgcgtgcct ggcagattca tcgcacgatg atccctggca     71400
     tggcggaaat gagtggctat aacgttaaaa atgcctcgac agtcagcgcc agtgctaaag     71460
     cgaatagcgg ttattccatc aatccgaaac tttctatcta tgacgatcgg cgtcaggagg     71520
     aacgtaatca gttggaggca caggcggcgc tgtgcatgga acagtgggaa tcacagtcgc     71580
     attatgcaaa tgcggttaat agttatcccg gtttgcaagt tgggcatcaa tttacgttga     71640
     aagggcatgt cagcgctgat gggcgttatg cggtgggcag ccagcaatta aaagcggaaa     71700
     gtaacctgga ggaaggagga ttgttgtttt cgtcgcaggt gacgctgttt ccggcgaata     71760
     aaacgttccg tccacgtcct tcagttacgc ggccctatat tgctggtgtg ttgtctgcgt     71820
     tggttgtggg tgcggcatcg gaggagattc ataccgatgc acaagggcgt atcaaaatcc     71880
     aatttcattg ggataaagag cacaaaaaaa atgatgacag ctcttgttgg gtacgcgtga     71940
     gccagttttg gaatggtgca aaatttggtg ctcaatttgt gccacgtgtg ggtagtgaag     72000
     tgttggtgag ttttgttgac ggcgatcccg atagcccgct agtgactgga acggtttaca     72060
     acggcgtgaa gatgccaccg tttgcgttgc cgggacaaaa aacacaaagc ggtattgcta     72120
     cccgcagcag cgcaaaaggt acggtggagc aagggcatca attttgtttc gaagataaga     72180
     aaggtgaaga atttattttg cttcattcac aaaaagacct acgtctgaaa gtgaaaaatg     72240
     atttttcagc gaatattgac cgtaatgcct cgtgggaaat tgcagagaag cgcgatacaa     72300
     aaattaaaaa aggcaacgat acgttaattc tgggtgaagg caatgctgtc actgaggtaa     72360
     aaaaaggcga taagaagcaa acactggatc acggcaattt caccacgact gtcagcgcgg     72420
     gcagttattc gctggaggta tccagaggca gcgccaaaat taacgcggga caacactgca     72480
     ctattacggc caatcaggga attgagctga aagtgggtgc cagtaaattg tcgattactc     72540
     cggcggggat caccatcaaa gcgccatctg tcacggtaga aggatcaggg aaactggcat     72600
     tgaagagcag tggagtggcg gaattaacgg gaactacagt caaagtacag ggcagtgcga     72660
     tggcacagtt aaaaggcggc attgttcagg tggatgcgac aggtattgcg atggtgaaag     72720
     ggatcttgac caagattggt taatagtgga atcaacggat aatgagagtt tgaagcaatg     72780
     gctaaattac gacactgtca gctttcgtca caagcggagt tggtattaca gcaacacgta     72840
     gcacatgatc agaatctatc ggcacttagt caggaaatgt tgtggcaaga tgctgtgttc     72900
     tacaccattt tcatgttgcc ttacactcag gctctggaat tggcactgac atttatctct     72960
     cgtgtttacg aacgtgatct gaagcaggaa cagcggttgc tgttgcagca agtgcggcac     73020
     tggcgcgcta atgggggtga cctgttacgt catgaattgt tcgatcaggc acagactata     73080
     gggtttgata accctatctc gtgtctggcg ctgtcggttt tctggagcga aggcagcatg     73140
     acaacgccgg atctggaaga tgtttatccg cagccgtggc agtcactggc ggcattggca     73200
     gatacgctgt gcctgatcct gcacttttat ggtgaacagc cggagcagca agtgctgtat     73260
     gtcgagcagt tttttcaact ggcgcagggg caattaaagc aattaccacc atcacaggat     73320
     cagggccgca aaaactatct gtaccatgaa gctatgttat caggagaaaa atgatgccaa     73380
     tgccagctgc tcgggtcgga gatatgcata tttgtccaat ggtatcgcct gcagtacctc     73440
     cggtgccaca tgtgggtggg cctattatgc cgccaggagt gccaacggtt cttattggtg     73500
     gtttgcccgc ggcgacgatg gggtcgttgt tggtgtgtgt tgggccaccg gatacggtgg     73560
     taatgggaag tccaacagtg ttaattggcg ggcggcctgc ggccagactt ggcgatttgt     73620
     gcgcccatgg cggcacgatc acgacaggct atccgttggt gattattgcc tgaaagggaa     73680
     ataagagtga atttagcaca gacagacatc gcacgttttt tacatcctat ctctgctgat     73740
     gcacccgcgg gatgtgatat cgaatatgaa cctctttttg aacagataaa cgctgcgcgt     73800
     gaagcagatg aggatctccc acaggatgat gagtggggat atgaaacccg gcaggctgac     73860
     tggcctcagg tttcagtgtt gtgtcaggaa gtactggaaa aacacagtaa agacttacag     73920
     atagcttgtt ggttaactca ggcacaggga aagctgtatg gtttagctgg catggctggc     73980
     ggtatgacat taattgccag cctactggaa accttttggt cagtactgta tccgccgttg     74040
     gataatgaag agggaaactg tgctgatgcc cgtcttggtc ggttgagttg gttggataaa     74100
     caactggtaa aacaattgga caacctgaca ctgacgagtg atggtaagtt gagtctgagc     74160
     gtttggcagc gggtgcagta ttttgaacaa cgcgttgcgg ctaatagtga attacgcgcc     74220
     tccctgatca gtgatggcta tttcggtatc gctgaatgtg atgacagtat tcgcgctacg     74280
     cttgctgaac aatttgacca actattggct caggctgaac aagtcaagca ggcattggaa     74340
     aaactgcacc aaattatggt gaacttgatg ccagatgctg gcaacagcat gagcttcagc     74400
     acacaacgat tacaggagat gatggcatta atcacgcgtt ttcatgagat tgttgcgccg     74460
     gaagacgcgc aacaatacca cgatgaggaa gcgttaccag gaggaagagc gtcaaatggt     74520
     attaatacga cgttggcaga agatcggtca catcatgaaa tacgcgctat tgccattggg     74580
     cagatgatca atatcgccaa ttattttcgt aagaacgaac ccaccagccc agtaccctat     74640
     ttaatggaac gggcagcacg ctgggcaaat atgggaatag ccgaatggct ggaggaaatg     74700
     atggaagata atacctcagc gctacaggac attatgcgcg tgataaaagg accagataaa     74760
     aatagagagc aagatgaaga ataagacgaa tttttataat gttattaaac gtagtttctc     74820
     agtattacta ataatttttt taatcaatgg ttgcagtgat tcaatttcta ataatgaaaa     74880
     acgattacag gcaattgaac aagccagacc tgtttatgct aataatgcca ttcgtttaaa     74940
     aatgacggct gatccgcagc tgaacgtttt taataatatg cccaatagtt gtacgatatt     75000
     aattgctcag gcggagaaac gtgaacaatt ggataaatta ctggctaatc ccacgctatt     75060
     acgtaattta tttgctggca cgggtgcaac cgaaaatata ttacagcttg ataattatgt     75120
     gatgatgccg gggcaatctg tatctttaca tattgataga gcggaacagg cacgttatat     75180
     cgcgctgatt gccggttatt atcccgcccc agatagtgca catgtgcggg tattatcgtt     75240
     accgttacgt cttgaacaac gcggttggtg gaataaatcc tggaatgctg agtttgttcc     75300
     tatgaatatt gatttaatgc tggggcgtta tgccattacc cggagtaatg tctctgcggg     75360
     taatgcgggg gatgaggtga ttttccctga gcagacagct gaatctgata atcggaattt     75420
     gttaaggaag taaccgccat gtttgaacat aaaccgatgt attggtattc aggattgtat     75480
     ttacaaccac aacattttca ggcgcatgaa ttgcaacatg aatattggca aggacgttat     75540
     caattattga ctcaacctta tgctttcggt gttgtgaggt tggtgttcaa tctggccgcg     75600
     ctgagtgatg aagtactcag tattcataaa gccgtgttcg tttttccgga tggctgttat     75660
     gtggattgtg atgtgaatgg tgtgctcagt gctcgctcac tgcgcaactg ttggccggaa     75720
     cgtgaaaaac cacagcgcat ttatgttggc ctgcggacgt ttaaccataa ccagagtaat     75780
     gtcaccggtg tcgtggatgc tgacagtgta ggtaatatca ctagccgttg ggtgacatgg     75840
     ccgcaagagc aacggatgcg ggatgcgttt ggtgagggac cagaggcaga agtgcagcaa     75900
     ctcacttata acttacgttt ttttctacat gatgaaattg cacaggcaac gggttataca     75960
     ttgttacctg tgggtcaact gcattgtact agtgatggca ttgaactgga taaccgctac     76020
     ttgccgccct gtttgacgtt atacgctgtg tcacaactgg gacagcgtat tgatcaactt     76080
     tgtcaggaat tgacaggacg tgtccatcaa ctggaagagc taaagcgccc gcaaacattg     76140
     gaagcggaag tttatactca ggaaaaaagt acattattgc tgacattgcg tactctggtg     76200
     cgttatgtcg tgcagttgca tcactgccag gagacgcgtg atgttcatcc tttgcagatt     76260
     tttgggctat tgcgtcaact gatcagtgag ctttcctgtt ttaccgaccg ttgctctttt     76320
     ttaggggaat ggaacggacg agaggagacg ttggagaaat atcagcatca ggatttagct     76380
     ttgacgttca atagctgtga acgaaccatt atcgacctgc tcaatgcact ggtattggaa     76440
     ccgaacacgg tgatcccgct gcaacaggaa tgcaatggtt attatcatgc agcgttcaac     76500
     gtaacaggcg caagtgaaca gcaacggatc tatttggtgc tgcgctctga caacttaact     76560
     gacagcgaac gtgaaattcc tgatgatcgt ttaattaagc tggcggcagc ggaacagatt     76620
     gacggcatta ttaatcgcgc tttacctgga gtgcgcttgt attaccagga gattgccccc     76680
     catggtttac ctaaccgaat gaatactcat tatttccggg tagaaaatcg gggaacgctg     76740
     tggcggcagg tagaagatag cgaacgcgta gcggtgcact gggctgatgc gccagacgat     76800
     ttacagatag aaatcgttat agtgagagtg tcgtgatgcg cttattggat tgttacattc     76860
     cggtatttac ctgtgtgttg cgtatgatcc agcaacaggt gaatcaagcc gaagagctac     76920
     ggcaaacatt gttagccgcg ttgacgcagg cgcagaatga agcgcaacgg tatggttatg     76980
     gattgcaaga tattgaagag gcgaatttcg cagtggtggt ttgggccgac gaagctattt     77040
     tatgcgcagg tcagaaagaa ttgcatgttt ggcggcagtc atcattgcag gcgcagcttt     77100
     ataatgctga acttggcgga aatacctttt ttgatcgtct ggcagcgtta tccccggata     77160
     attatcaagt tcgattggtt tatgtttttt gcttgctttc tggattttat ggacgttatg     77220
     gcagacgtga taatttggaa ttgcacaata ttatccaaca agaattagat aattttcctg     77280
     atactttgcg tcgttatatt gccacaaaaa atcacaggat catgaacacg ggcgataata     77340
     ttctggaaaa taaacgacct aataataaat ggcgtaggaa gttaatatta ttaatattgt     77400
     cgcttatctc aatttatatt tttatcacag tttacttatt gaatattagc cgataaagtc     77460
     ggaaattaaa catgaaaaag ttattttatg ccattggctg gctcagcgtg atggttatcc     77520
     ttttgttact cagtttaatc attgctgtgg cgttttcatg gccaacaatc ggtggtctga     77580
     tattatttct ttgtttattg ctgttgttat tattgctgcg tggtgcgatg gcattaatac     77640
     cgcagataac gaataaggtg agtcggataa ataagttctg gcgacaggga aataatcgtc     77700
     tggaatattt actgtatcag cattggtggt ggggaggacg tttacaaagt tggcgtcgat     77760
     ttcgttcatg gttacaacgt aacggttctg ttcctccatg gtttctagtg gtgggagaac     77820
     tcaatagcgg caaacagtca ttgttagcac gcagtaatgt ggtgcctatg acagggagaa     77880
     atttgacatc gttttcggag aataccttta cttgccgttg gtggtttttc cgtcgggcga     77940
     tgtacatggt agtttctggt cgttataccg agggccaatc cttgtaccgg caagcgtggt     78000
     tgcgtctgat acgttggatc gcacaggtgc gtaaccctgc gggtgtactc gtttgtctgt     78060
     cggcagagca gttgctaaac agtgacaata gagcgctcta taccatggcg cgtaatgtac     78120
     gtgcgcagtt ggaaccgttg cagatacgtt tggaacgtcg tttaccaatc tggttaattc     78180
     tgacacacag tgaagcattg ccggggttca gccgttggtg ttcgcaattg tcggtagagc     78240
     agcgtgctga cttactgggt agttttattg atcaacatac agatggcaat gtcactgatg     78300
     tgctggataa gagtatactc acgattgttg atactctgaa aatgatgcgc cttaaattgc     78360
     tcaatcagca acggcagcaa ccacaagcag aagtgttggc gttaccggaa actgttgccc     78420
     aattgaaacc cgcattggac tattacctaa acgcattatt cgagcgtgat cattatctgg     78480
     aacatggtct gttacgcggc gtatttttta ctgcggaaca tcaaacagaa ttgcagcaaa     78540
     ccgaaggcgt ttttagtcac cgtttgttgg gagaatatct gcctaaccag attcgacgta     78600
     gtgattctgt tttgctaacc ggttggcgaa cattgaccaa acgtgcgttg attagtgtgt     78660
     ttagcttgat gattgtatac ggtgcaggta gcgcattggt taatacctgg catggcgtca     78720
     cgcaacttga gaatatccat gaaaccagtc cacttgagcg gagctacttg cgctatcaat     78780
     atgttgagca atggttacag caaacagtgt catacctgct tttttatcct gtcacctata     78840
     cgctggaaca gcgtatggag caggaatacc agcagcaggt tccagttgat gtgttcaatc     78900
     ctgagtcgat agccacacgt ttgctaatgc gtttcaggga ggctgaaaca ccgcaaaaac     78960
     gactgttggt tttacattgg tcgcgcttta tcaatatcga gcaggcaatg gcgcgtggtg     79020
     cttcactgga aactttacaa cacatgcctg cttattctgc ctcactatta agcggtaaag     79080
     atgatcctct acggccagat cagcgggtag cattgcgttt agcacaatat cgtcaaggca     79140
     acgcacagca agccttcgat caatggcggg atacattgca gacattattg gaagattcca     79200
     gtgattggca gtggcttttg gcggatgaac aaccgactgg aacgcattcg ctaacgttgg     79260
     cggatttctg gccgctggcg gaaggtgatg ttgctaaggt taacgcgcgt attcgtggca     79320
     tttatactcg cgcaggtgag cgggatattc aggctacctt gaatgagttg gcacaggctc     79380
     ttgaccgacc ggcacgcttt tctcctttgc agcgctcatt ctgtcaacaa tatcagaacc     79440
     agcgtcagtc agagtggttg gcatttgctc aagcaatgcc acaagcggaa ggattagtac     79500
     gtggtaagaa aaactggcaa acgttggtat tagcaaccgg ccagtttggc agtccttata     79560
     ttgtttttct gtcacgactg gagaatgacc tgtctacggt gaagcaggaa gatcagcagc     79620
     tttggttaca gacgcaacag cgtttatggc aactgcatgg ctatatacaa aaaggcagca     79680
     tgatgcagcg tgtctcgctg ggaaatattt ccttgcgcca acgcataatg tcatggcttg     79740
     gcatttcacc gcagatctct gtgcggttgg atgacaatgc attaacgcgc tatcgcgatt     79800
     accggcaggc catacagttg aatagtcaac gtgaattgct cagtgacatg gaaacggaat     79860
     cgttagtcaa aaatgcgttg agtgatggga aaggggaact aaatgataac ggtttacgta     79920
     cattgtttaa tcgcttcgca ttgtggcgtc atgaaacgga aagcaagaat gccggagtaa     79980
     atgaaacctt gtggcggctc tatcagggtg atgctcattt ggtactgcgt tatgccttct     80040
     taagtgctgc cagccgcttg caaacacagt gggaaagtaa agtgatctgg ccgatggaaa     80100
     aattaggcgg acagacgctg ttggatggtc gggaattgaa tgcacggttg tatgaataca     80160
     gcaatgcatt tgtacgggat acggcagatt atgcgctgga tattcgtcct gaaggcatta     80220
     atcgccaaga aattgaaggt gtgtcctttc cgtttaacga caattttatg ttctatatca     80280
     ataatttgat tcaaccgaat aacatgctgt catctacatc tgatattcgt cgccgtttgc     80340
     aagagaagct cgctttgttg gaaagcgaac gtgaattggc tgcggtacag caggaaccgg     80400
     aacaagagca atcagcagaa gtggtgatta ccagtcagcc tgcgacggct aaccggggag     80460
     cgagggtgtt accggttggt agttcagtga cgctaagttg taatgatggt gagcaacaac     80520
     tcagaagtat gaatttcaat gacagtatga ctgcgcactg gaatccggcc tcatgcggca     80580
     aggtacggat tgatgtgtat ttccccagtt ttacgctaag caaaagctat gttggtgctg     80640
     atagcttgct gcaatttata cgcgcttttt ctcatggcga actgacattg acagcgcaaa     80700
     cattcccgca gcggcgcaat gaattaggcg ctttgggtat caatgacatc acagtgcgat     80760
     atcagatcgg tggagagaaa gcggtttctt cattgtatca acagtggcaa caacgtcagc     80820
     agcaacaaac cgcactattg gaacaacgca accgactgga tagtcagttg ttggatttaa     80880
     gtgagccgac agtggcgaaa ggctctcttt ctacattgcc gttacaaatc acgacatatt     80940
     ggaacgaatt gaggaaacct aaaagtgagt aattatctga aacagatcgt gggtaaatta     81000
     acggtggagg cgcgtcagtg tcttgatgag gctgctaatt tggcggtacg acgcacccat     81060
     catgaagtgg aaattgagca tttgctgcta gctttgtttg aaaaacagat gccgatgatg     81120
     gagcaggtat gtcatcacgg tggtattgat gctatcgcgc tactgaatgc ttgccagcgg     81180
     tcgctgacgc tattgcgtag tggtaatcat cgtccgccag tattctctac caatctgaca     81240
     gagtggatgg aacagtcatg gatgtacgcc agcactcgtt cttatttggg atcgttgcag     81300
     attaccgctc aggcgttgat tgtgacatta ctcgtcaacc catcactgca acattcgctc     81360
     acatcggaac tgcaacaggc gttacagtgt aactctgatg cgatagaaca gtggttgtgt     81420
     acacaggtgc atccagaacc acagcaaatg acgactacca gggataatac gcaatccgca     81480
     ttgtctcaat atgctcatca tctaacgcag gcggcacgtg ataataaact ggacccggta     81540
     ctgggacgtg agcgggagat tcgtcaatta attgacgtgt tgctgcgccg tcgtcaaaac     81600
     aacccactgt taaccggtga cgcgggggtc ggtaagacgg ctttgataga gggacttgct     81660
     caacgtattg tcgatggccg tgtaccggag gtgttaacgc aagccgaatt attcacactt     81720
     gacatggggc tattgcaggc aggtgctagc gtgaaaggtg aatttgaaag tcgcctgcaa     81780
     aacttattgg atgaggtgaa agaatatcct gcacccgtga ttttgtttat tgatgaagcg     81840
     cacactttga ttggtgctgg tggtcaagcc gggcaaaacg atgcggctaa tttgttgaag     81900
     ccagcgttgg ctcgggggga attgcgggcg attgctgcaa ctacctgggc cgaatataag     81960
     aaatactttg aaaaagacgc cgcgttagcc cgtcgttttc aggtgattaa agttgaagaa     82020
     ccttctctgg aactggctac agctatgtta cgtgccataa caccggctat ggaaaaacat     82080
     catggcgtca aaatactcgc tgaagcggta acagaagccg tgacattagc cagtcgttat     82140
     atcagtgggc gtcagttgcc ggataaatca gtcagcctgt tggatagcgc ctgtgcccgc     82200
     gtctcagttt cacagactga cgaacctgca cctattgaag atttacgtgc catgctggca     82260
     aatattgcta ctgaacaggc agcattatta cgtgaaggtg gtcatgaaac tcagttaaag     82320
     aaattggcac aacgtcaggc cgaattacag gcttcactgg aagaaatttt gccggaatat     82380
     cacattcagc gtcagttagt gaatgacatc ctcacttgtg aagaacatga cgaacagcta     82440
     cccaaactgc gagcagaact gcatcaacgc catcgccaac atgcctatgt atttgactgt     82500
     gttgatgcag cttgcgtagc ggatattgtt gccggctgga cggggatacc gcttggccgg     82560
     atggtagaaa atgaacgtga tgtactgcgt caactcgaaa cgcgcctcgg tcagcgggta     82620
     atggggcaag atcatgcgct cagtcagata gcgcgtcaaa ttcggattgc caaagcgcaa     82680
     ctggctgatc cggtcaagcc tactggcgta tttatgcttg caggtccttc tggtgttgga     82740
     aaaacggaaa ccgctctggc attagctcat gaattgtatg gtggtgaacg tcatatgatc     82800
     acgatcaata tgtcggaata tcaagaggct cattctgttt ctggcttgaa aggttctcct     82860
     ccagggtatg tcggttatgg acaaggtggc gtgttgaccg aagcagttcg gcgtcaacct     82920
     tacagtgtgg tattactcga tgaagtggag aaggcgcatc ctgatgtgtt ggaactgttc     82980
     tttcaggtgt ttgataaggg catgatggaa gatgcagaag ggcagcagat taatttccgc     83040
     aatacgttga ttattcttac cactaatgcg gcatcggatt tggtgatgcg ggcagcgatg     83100
     catggggtaa aagagcaggg tgaaaatcgc ccggcaacac ttgaagatat tcaggagatt     83160
     atccaaccgg aactgcaacg gatttttact cccgcatttt taggccgttt gcaggttatt     83220
     ccttatttgc cagtacatgg cgaagttctg catgccattg tgcgtcataa actgaataaa     83280
     gtggttgggc gttaccatca agcaactcag tgtgaactgc actatagcga cgggctggta     83340
     aatttcatcg ctgaagagtg ccggatcgca gaaagtgggg cacgtgaaat tgataacttg     83400
     ttaatgcagt ttgttctacc gttgttatcg gatcaattgt tattggggga tacaccagtg     83460
     aatgaggatg ttcggttgga tgttatggac aataaagtac agttattatc agataaaacc     83520
     gaattatcac catagaatat tgtcaactta gggtaagaga ctgccttctc tgctattatt     83580
     atcttatgat gtaacatcag tgttacggaa tgagatcctg atgaaaatga aaaagatagt     83640
     ggtcttttgg tttattttta cgctagtcaa ttttgcgctg gcgctgctga gtttgcaagt     83700
     acgtgatgtc tggagcctgt cgtcattggt gtggtttccg gcgggtttgt tacaaggcat     83760
     tttttgcgcc agggctcccc ggtactggcc tgcctggtta ataacggggg ctttgatttc     83820
     tctgacagcg agccaatggt atgggaggcc ggtaaatgta tcgttgatat tttcttgcat     83880
     caatgtcgtg atgttagtcg tgacgggact aatctggcaa tttttctacg gtgcaatgtg     83940
     ggcgccaaaa cgagcaaggg acatctttag tctgataatt ctttgctcgt taagtggaat     84000
     tattgagcga tttatggcta agtgggtact tcatctattg gattacccta ccgatatctc     84060
     catttcatta ctgcttgtcg taggctctgt gttgagctat ctgccgttta cattttttat     84120
     tatttctttc atcacccatg aaaaaaaccg gaccggagac aggagagtct atggtttatg     84180
     cctagtggct ttgttcgtta tggcaatatt gtttactagc ccaccccctg aaacagggaa     84240
     aattcattgg caagggatag cgctgatgtt ttccttcagt ttaccgatgc tattagcatt     84300
     aagtggcgat ttattggtat taagtagctt cttatcctta tgtacactag gggttgtaag     84360
     tgcaaccatt tttggctttg ggccattttc atttccatta atgaatcttc aacagaatgt     84420
     acaaatggca gcatggtaca gtaccgcgtt tactttgcct gcgttactat gttgtagctg     84480
     tttatataaa acaatcaatg cattgcatcg tcgtaaagcg cgatttctgt tactgagtgc     84540
     gatgttggaa caagaacaga ttaattgctt tcgcttaagc gccgatgggc acttgtactg     84600
     gcatcatgat gctgcctgga tgcggtgtgg aaaggcgcct gcctactggt cacagttgat     84660
     ggcttgggta cataaagaag atagacaaaa gattgaacaa cttaaaagtt cagtttcttt     84720
     gataccacag gtgttaaaag tgcggattgc tgatggcaaa ggtgaattta accaggtcat     84780
     tatcgccttg attattcatg taggggaaaa tgccggtttt attgaaggaa ctatgcgtga     84840
     aatagcagat aaaaaataat atggagaaaa taacctatgt caagacgagt tattattgct     84900
     gacgatcatc cggtattttt attaggactg cgtacagtat tggcaacatt acccgagaat     84960
     tatcaggttg tgggggaagc gcatgatgtt actgcgcttt tttctctgct ggaagaaaaa     85020
     gaggtggata tgctaattac ggacttcaat atgccaggtg ataatcagat tgacggtctg     85080
     cggatgatta gccggatacg tgagcgatat ccgagtttgc cgattgtggt gattacgatg     85140
     attagtgacc ggaaaataat tgcttcgttg attgattaca aagtgaaagc gattttaaat     85200
     aaaaatagtc tatctcatga actagtgaaa ggattgtata gcacaacggg atgccatgag     85260
     ccttatttga gtgagcaatt tctcgaatct ccgggtgagg aagttgtaaa ggcactaacc     85320
     agtaaagagt tagaagtgat taaattattg ggccaagggc tgagtgtgaa tgatatcgct     85380
     gcgcgtttgt accgtactaa acagacgatt agcgcacaaa aaatcagtgc gatgaaaaag     85440
     ctggggttaa ataatgaagc cgcgctttat aattatttgc atcaggttgg attgggattg     85500
     taacaaatga aaggcgggcg gaacggactt ctatgggtcg ccatattgtt actcttgttg     85560
     ccattatctg gccagagtct caatctgttt gaattccata atgcgcaaga gctgccttca     85620
     gacggactgc cggtggaatt ttattcgaac gtcgtcactc aggagtttgt tccattacct     85680
     gtcaaagaac acgagatctt agccccgcat ttcccaacac taaaagttgg tattctctgc     85740
     tgtatcgggt cgccattagt gacccatcgt tgggatggca agttggaagg gatttatgct     85800
     gattatcttc gcctgattga aacggtgtta aaaaggcccg tggaggtacg tctgtttggc     85860
     aactgggcat ccgcttatga agcattgcag cgtggagata ttcagctgtt atcacattct     85920
     gcctcatcac aatcggaaaa taggagcgat aatacttacc cgattctggt gcagccactt     85980
     gccctgatta tgcgtaaaga acaagtgaat atgccatttg ataaaatgaa tattatggcg     86040
     gcgcctggca gtaacccaaa tatcattaaa caattgagca aatattaccg cagcgtttta     86100
     gtggcaaaaa gtcaacagga ggcaattcag gcggtggtgg atggtcaggt agatgcttat     86160
     ctggatggtc aaagccagat tgcctattta ctggcttttc gcccgtttag cgagctgact     86220
     tatcgtcggg atctttcaca gggagaacga tataattttc ttggtcgcaa cggtgatggg     86280
     atggttgaaa cgatcaatct tatcctgacc gcaattcccc atgagataag aactaaggtt     86340
     tatcaacgtt gggtttctgg gttggcccta ggaaataata acgacaccgc gatcttttca     86400
     ccacaagaaa aagcctggat taaaaagaat cctgtcatca atgttgcaac cagtcgtact     86460
     gagccgcctt attcgttctt agataaaaaa ggtgaaatta cagggctgga tgtcgatatt     86520
     ttacgtctga taggcgagaa aagcggcatc acctttaatt ttattccggc agatggcgct     86580
     gcgggggtca aaaaactgtt aaaaaatggt gaagctcaga tgacttcttt agtcaataca     86640
     ccagatcgta accgttggct ctctttcagt catccttatg gtactgtgga atgggtaatg     86700
     atcacccaca atgggcgtaa tgccccttat gagtttgagc aacttaagca tcaccgggtt     86760
     gcggttccgc gcgatcatgc actaatgtca gtattgaagc agtatccaga tatttccatc     86820
     gtggaagttg acagtgtgac aaaagggatt gaaatggtac tggccggagc ggcggatgca     86880
     acttttgata gcttgattag tgctgattat ctacaggcaa atcgctatgg ttccaatatt     86940
     tctattcaat ttcttaggga ttcgttacaa ccagaacaat acgccattct accttcctat     87000
     cctcaattag ttagcatatt gaataaaagc attgatgcac tgcccccaaa tgagctgcgt     87060
     gtgttgcgct taaaatggtt atctatggcg aatgtgacgc cttatgatga caataagatc     87120
     tctccttggt tgaaattgtg gggaggcgcg ttatttgtga ttgcactgag ttcggccttt     87180
     tggggcagtt atcttgcaca tcaaatcaga cgccgtaaaa aggcggaaaa taacttacag     87240
     aatttgctgg catactggga aacgttattt aataacattc ctacgccaat gtttgtctgt     87300
     gatccaacga tgtgtattac ggctgcgaac ctttatttcc ggcgtgagat gagccaggct     87360
     ggatctgatg taattggccg tagtcttttc tctctctgtt tcttaaaccc tgatgatgag     87420
     caagatatca gtatgatttt cttgcactgc atggaggggg aattggcgca tttttctgat     87480
     cgcagcattg tggttcagag tcaaaacaaa gatgtttatt tatggcttga aagttacagc     87540
     aataccgaag gcgttgttca gggcatcatt ggcggttggt ttgatgtcac tgagcgtaaa     87600
     ttgctagcgc aagagctacg ccaagagcgc gataaagccg aacttgccag tctggaaaaa     87660
     tcagattttc tggcgcacat gagccatgag atccgtactc ctttgcaggc aattatcggt     87720
     attctcgatt tggaagtaaa acaacaaacc cagcaatcta cgccgttaca tattgcatgg     87780
     catgccgcta tgtctttaca gggaatcatc ggtgatgtgc tggatttttc caagatagaa     87840
     gctgggcgta tggtgctgaa tctgaagtca gaatcattgc aggatgtttt agaaagttgt     87900
     gcggcaactt ttagtcatcg agcgaaggaa aaggggctgt atttcatccg gcagtttgat     87960
     ttgccatctg aatattatca tctactggat gctatacgtg taactcaggt agttaataac     88020
     ttgctgggca atgcgattaa atttactgaa cagggtggcg tgcggatcag cactagctat     88080
     cagcatattg cagacagtaa tcgagatgaa attacgctgg tggttgcaga taccggttgt     88140
     ggtattccgg aaaccttgta tgaggcggtt ttactgccgt acgtacaggt aacgcaaaat     88200
     aatggtggta agaccggtac tgggttggga ttacctattt ctgtacagtt agttgaatta     88260
     atgggaggaa gcctaaaaat cacgggtgtg cctggtggtg gtgcgcaagt aaccgtgatg     88320
     ttaccgcttc tacgtagcac gatggagaag gaagttgcga gtgaaaaaac tgaaagtatc     88380
     agcacggaga ttaatgaacc actgaatatc ttggtagttg atgacttacc tgccaattta     88440
     caagtgctgt cattacagtt agcgccatcg ggccattatg ttgtactggc tgaaagcggt     88500
     gaacaggcga tgaatctgat ggaaaatggc tatttcgaca ttgtactgac agattgtcag     88560
     atgccagtga tgaatggtta cgaactgacc cagttactga gagaatatga acagctacgt     88620
     caattaccgc cgttcattat tctagggtgt accgcgaacg cattttctac cgagcaaacc     88680
     cgttgcctgg aggcgggaat gaatggtgtg ttgattaaac cgttggtgca aagcaagtta     88740
     ttggcagaaa ttactcgtta ttaccgacaa gtcaatgatg aggcaacact ccagtttgat     88800
     gagattcaaa cgttggctca acaagatatg gttgtagaac gtcaattact cagtgcgata     88860
     cagaagggca tgtcggaaga tattgcagaa ctgaggcaac aggaaaatca acaattccat     88920
     gagaaagttg cacatcatgc acatcgtatg aaaggcgctt ttgccttgat gcgatatcag     88980
     cagggaatac gtgtctgtct gcgtattgag aaaggcgaat tttgtgatga gaaaacagtt     89040
     gccgttttgt tgactcgtgc tgagcatttc caacggcaaa tcgagcagcg attggaaata     89100
     ttgcaagatg ggtgacatta tttttttagt aattttacat attgtttact cgtgtagatg     89160
     tgaatcaagc gcctgatgtg gaatggccgc cacagcctaa attaaaatag gggctgtgaa     89220
     ttgctatccg ccaagtgaag atcacatgat ttttcacttg gcattatatt aatgagaatg     89280
     tttattactt tattgctaat acgtattcac tggattttta ttttctttcc ttaagagggg     89340
     aatatcgaga ctctattatg acatcgacaa gaaatttatc tgagttgtca ccgtaatacc     89400
     ttggcgcgtc attgaataaa agtattaatt ctccatctac gggaacagtt ttatgaagta     89460
     ctccattgcc tatgtcgtag gttttatcac cgattttggc actgagcgcg tcggatgaat     89520
     ttagttgata agtaggtata gagccctgag gtgcggccca ttgattgtct ccacgaccga     89580
     actttaccca tcctttggca ataacagaga ttatatctcc ttgtttgaga ataagtcctg     89640
     tgggtttacc gtttttagca ttagctggaa cacttcctga ccaatcatac ataatattac     89700
     ctccgaaatt atgttttata cctgttatct ttcaagttgc ctctttgttg gctgcactca     89760
     ctcaccccag tcacatagtt atctatgctc ccggggattc gctcccttgc cgtcgcgatg     89820
     catcttgaaa tctattgggt atatgggaat aatttttcca aagatatttg catatttggc     89880
     tgaaaaagaa tttatctttt tatgacagga ggagcaatga aatacatcag atattgtgaa     89940
     ctatgttagt aaaaatgatt tttagaacaa cggttaattt aatattataa ttatttactt     90000
     ttgtttttta taaaatctgt tggattcgac tgtatcgagc cgcgtaaatt gaaaaagtgc     90060
     gtcattttaa tttacgcggt tcgctacaat ggctcttact aaactgtgta ttagaaatat     90120
     atatgcgttg ttactcttca taaagtacac ccagatccag taacgtatct attcaatcca     90180
     gtattagttc aatatcttca gattttaatt ggctattatt ggcaatacga tcgataaggg     90240
     tttctacaat atagacgaaa aaaacattat tacacttgat attttttatg gtttttacaa     90300
     agtatttatt attataattc atattaactg ataataatta ctctcctctg taaatcataa     90360
     tatgtcacta tattagatct gaaataaagt attaggtaat ttatttaaac tgagcatgtc     90420
     accgaggtaa ttatcgtggg cattattcct gagatattcc tgtattagat atcgaaaata     90480
     tggttcgggt cacaaatcca gcacttaagt gctggatttg acaatttaga ggtcagaggc     90540
     cgcccgttga agcaagaact agacactgag caatcagcag tcacccacta acgggaatcc     90600
     ccctcctgag tcacgaagtc gaaggtgggg gaagatgtca actcttatat aatctcagtg     90660
     cgtttctgat agaaactggc ttgactgtga aacatccggg cgtattttcc gttctgtgcg     90720
     ataagttcat catgcgttcc tgcttcaata aggcggcctt ggtgcaatac gataatgcgg     90780
     tcgacgaagc gcgttaaaga aaggcgatga ctgacaataa cggtcgtccg ttgcttggcc     90840
     agtttgagta taagccgcat tatctcgcct tcagactccg gatcaagtgc tgaggtgggt     90900
     tcatcgaaaa caagcaggtc ggcctcatca atgtgagcca tcgcccgcgc gatagccagc     90960
     cgttgccatt gccctccaga tatatcggct ccaccttcta tttccgtcgt taacggcgtg     91020
     tccagccgat tttcaagaaa attaagacca acctcccgca gatattcgtt gatagattgc     91080
     gtatcgcggg taaaaagatt accacttacg tcaagtggaa aacgtgcaaa gtcttgaaat     91140
     acaccaatga cgcgtggagg aatgtgcgat accgaccacg ttagttcgcc agtggtcggt     91200
     gcatatagcc cgcatagcat tttgagcagg cttgtttttc cagcgccatt ttcaccaacg     91260
     atcgcgatcg tctgcccatg ttgaatgttc aaatcaattt gctccagcgc agcacattca     91320
     gcacctggat agcgtagttc aacattcctc agcgttagac agggcatgat caccgatgat     91380
     ttgggcatag tctgaggctt acgcgtgtcc tcgcaatttg tctcctgttt agccgtatgg     91440
     atggaaacca ggttgcgata tggacgtacg gcatatgaca ctcggagcag gtcaccgaaa     91500
     ttaaaaatga ccgctgatag gccgtctttc agttgaacga gtgcaccaag caaaaaggcg     91560
     agctgagcaa tgctgaactt acctagctga aatccatcga caacaacata aagcggtacg     91620
     cccagacaga tgctcgcgaa caaggaggtg aacaacaatt tgatggcgtt acgtgtacgt     91680
     accagcttga tatgcttaag atagttatca taaagggttt gccaccgact cagcaaatgc     91740
     gcctgcatac gataaagacg cagatcttta gcaaattcgg gttgagttaa tattcgctcc     91800
     agaatacgca gttcgttaaa tgtcgctgca tgatgttcct gcacatccca actttcgctt     91860
     tccgttcgag cacggtacat cacggtaggc accatgccca ccagcattag gaaaggtatc     91920
     caccatgcga cctgtcctgt caggaaaaga atcggaataa tcatcaaaat tcccgtacat     91980
     acggcgtata aatgtgacac catttcacct aattcatcgc cgactttagt cgagagaata     92040
     gccatttcac gcagtttggt atcttcatga atggcgaggc ccgggaacgt tgcaatgatc     92100
     tcattcacct tacgtttcag tagcatgact gctgagtctc gcagtgtatc tacgataaag     92160
     tttgagatag cattcagtcc gtcctgaaaa ccactgagta taaaataggc agatactaat     92220
     gcgatgacag ccgctgcggc tatattggtg gttagacttt ctatgagatg tgcgttgata     92280
     taaagtaacg cgctaggaat gaggccaatg acaagattag aggcaatagc aatagttaat     92340
     gcgcgcggtg ctgcttgcca taacagcgac aatgcgttgc ggaggttttg tatgttatcc     92400
     caatatttca tgacgatagt ctcggctcat ttagttcacg aaagtacgca agggtgaaaa     92460
     tttcaggtag tgaattacag aagttcgctc ctgcgtaaat ttcatcagcc aggcttcaag     92520
     atctatcact ccacgtaggt aatggtattc aacaccaagc tgagtgttgg gatcttccgt     92580
     cgcaatgata taggccatca aatagcgacg gaattgggcc tgatcaatga acttccaact     92640
     atccaagatc attggcctat ccgtcaaacg caacatctct ttcgcgctgt tataaaacat     92700
     acgacgagcc attaatgcat aacttgtttt gctctgtttg tcggtagcaa aattgggtag     92760
     tatgtcggaa taagcctttc tcgccagcat ctttgaagtt gcatatgggt tggcaagatt     92820
     gagacgtttg taatcatggt ttagatgcgg tggacaggac agcataaatg cggtcatcct     92880
     cggatctaga agaggatgag aatgtgtgca gtaaatgttc agcgaatcga aataagtggc     92940
     tcgaggaaaa agtaaagttt taatgtaatc atggccaaga tatttagcct gagagcacgc     93000
     tatctttatt ttttgtaatt tagcttgttg gctcatagaa ttatgcagca cagccccaaa     93060
     gtagtcgggc agcctctggt catttgacac ctccttaatc aatgcccgtc ttcccaaata     93120
     aggtgaaaga gaagtgagta tatggcgaaa gtagtccaga gaaaaaggac gcacccgcag     93180
     attctcggtg atatatttat gtaactcccc gattccgtcg tgtatacgaa tcgaatctag     93240
     aatccattga tgcatcgatt ctccaagaat gatatctccg ccttctcccg tcataataag     93300
     cgatacattg ttgtgctgaa aaacgctagc taaagcctcc ttggcaagtg ggttagcgga     93360
     tggctctggc ccgtcgacgt aggcgattgg atcatctggt gccggcaaac gaagaaaatc     93420
     atcggcatag acaatattgt gaggaaggtt gcagtgatga actagtgcct caacaatttt     93480
     atcatcttga ctcattgcaa ggtctgcatc tctgaagctc atattggcgc agaacatggg     93540
     agggctttca ttcaatgcga ggcttgcgcc gaggacagta cttgagtcta ttcctccgct     93600
     tagtagaatc ccatctgcgc cggctttgag gcggtctgcc acacacgtat caaagcattc     93660
     tcggaatgcg tgctgaaagt tctcatgata agagagcgtc ttgctgtact gagaagctgc     93720
     gcttgtgttc attggtgcca atttaaatat cccatctgtt ctattgatct tcaatacgct     93780
     gtttatcggc atctttcgta tttcagcaaa gaaagttgcg ccatcggcca gttcgttttc     93840
     tcctaccatg acggactgcg ttaggaattc aaagcatgac tcatgtctta tgttgagcgg     93900
     cacatgatga aacaacagta acattcttaa gtcattacta atgacccact gtctattctt     93960
     tccctgccag taataaaccg gatgtgtcgc atagtgatcg gtcacagcat gcacatggcc     94020
     gggctgaatc gatatgtagc taaactcacc tattactctt ccctgagatg gatcaagtat     94080
     cggcgcgttt tggcggaatg atgaaataag aagatcgttg tccaaatcac gtatccatcc     94140
     gctgtaagat gaatgagcag tagatatctc aatgccagtc aactttcgtt cagtatcgca     94200
     aaggcgaaca tcggcttcga tcattgttgc ccattggtga tccatcttct tcatgctatc     94260
     gatttggata tctgtcatgg cattgaagag agcgttaaca tatgcatcta tatcaatcgt     94320
     cgtagcgttt attaccaccg accaaagttt catattgaag ttgcccattc agagatggct     94380
     gtatctggac tcatgcgctg taacggacta tatccgctta agtctacatg ccccgggtta     94440
     acaatttttg ttttgaattt gtcactgcat aattcaatcc atgcatgacc gacgatcttc     94500
     tcatcttgtt ttttgatgcc aatcaccata tcgctgggga tgccgtgtaa agacgccaac     94560
     aattgaacga caatacttgc tgaatagcat gatgcactag taatttctga tgaatcggcc     94620
     tggtaaataa aatcacaaat ttcctgaaaa taggattgat cgatatgctt tgctgcatca     94680
     gagaaattcc ctctaacagt acatggatat atcgatttaa agatactgag ataggcatct     94740
     ttgattggtt tttccagcaa tatggctctt actaaactgt gtattagaaa tatatatgcg     94800
     ttgttactct tcataaagta cacccagatc cagtaacgta gctattccat ccaatattag     94860
     ttcaatatct tcagatttta attggctatt attggcaata tgatcgataa gggtttctac     94920
     atacaggcca ttcggtgcat cttggaaaac acccataata tcggcagcca ccccagacac     94980
     accaaaatac tctcctttgg tttcgctata tattattgcc tcaccgtcca acgaaatgta     95040
     ttcaagaggt tttttcgaat aaatgagttt tggatatctt tgcattacgt attttacata     95100
     cctattaaga gacattaagt tgagaagaaa aagcacgcac ctaaaaaact tagatacgtg     95160
     ccaaatacca ttatcttccg ccgcctttca caccgcgtcc aaagacacca tcaccggggc     95220
     gggacttttt agatagaatg actgccagaa atgatccata agaaactatt tttgtcggtt     95280
     taatcatttt ttaacctctt tacgttaaaa ttaaaaaaat attttttcgc tttagcataa     95340
     aaatagttta ctgaatattt aattaaggct cgtttcttgt acgcgggtat aataaactaa     95400
     gagaatgcat agaagctatt tgcttttaca ctataacggg taattatgta aagtaaaaaa     95460
     ttcacataat agagataaaa atacaaatta aaatagaaat catgatatta cagttctaat     95520
     aaccaataca caccaagtaa ttggcccaca aaaatataga cgaaaaaaac attattacac     95580
     ttgatatttt tttatggttt ttacaaagta tttattatta taactcatat taactgataa     95640
     taattactct cctctgtaaa tcataatatg tcactatacc caatagattt caagatgcat     95700
     cgcgacggcc agggagcgaa tccccgggag catagagaac tatgtgactg gggtgagtga     95760
     gtgcagccaa caaagaggca acttgaaaga taacaggtat atattagatc tgaaataaag     95820
     tattaggtaa tttatttaaa ctgagcatgt caccgaggta attatcgtgg gcattattcc     95880
     tgagatattc ctgtattaga tatcgaaaat atggttcggg tcacaaatcc agcatttaag     95940
     tgctggattt gacaatttag aggtcagggg accactcggt gaagccccac gtcctagtaa     96000
     attttcttaa tattttcaac tgtatgctgc catgaactcc aacaaatgca agatggttat     96060
     cctttctcat gcaccactcg aatcctccag attgacgttt aatcacaacc atatcctccc     96120
     attttttctg gtactgagct tgacagacaa gtatctcgtg agcgttgtag ccaaggtaag     96180
     ccccgtgctt atttacaggg gatgcccggc aaataaaacc aaggtagtcc ccatttcccc     96240
     tttcaacaca ctcaaattgt tgtagtggtt cagtgctctc ccatattgcc aatgacacgc     96300
     ttcccggcac tgcatgaaat ttactagcta ccgttacagc cgtcgcgtaa ttacccgctg     96360
     gatacggatg aataatataa gtttttcctg ggatcggagt atcgttgcct gtaagtattc     96420
     ccataatcat tcctcgttag tttataccct tcatccttca agttgctgct ttgttggcta     96480
     ccccagtcac agagttattt acgctcctag ggattcgttc acttgccgtc gcgctgcaac     96540
     tcgaaatcta ttgggtatat atagtattca ttgcattcat tttaattatt gtgttttttt     96600
     aatgaattaa aataataata aacatcagta ttctgatata taaatatcta aaaaattcat     96660
     aatatattcc tttaatttcc tcatcgttta cgaattactt ttaaaatatt ttcgttccct     96720
     aatgaaaact atgaatttcg atacagggat atcataactt ttattgttta ttttaatatt     96780
     caagggcttt ttatggcgta tggcgaaaaa atctttatat gtttttcaat gagtcctaat     96840
     gtattgggtt atttctgaag tctgttgagt tacttatttt tcattataaa tttccatttt     96900
     cctattctgc acgaactaaa aacaatttca tctgaaatac attacatcac tttattattc     96960
     tcattgatga gtttccaggg cattttagcc ttcaaatcac taccgtcttg caaccaactt     97020
     accttgtatc ctgtttgagc tatacttcat aaaaatagat tgcatgcgat ctattcgtat     97080
     gacaccattg tgtcattata gctccttaag ctgaagcaaa gatggcgtct gattaaccaa     97140
     accgagtcat ggagtttaaa atgaacgttt cacagcagat acctgcgcct aataattata     97200
     gtgaagagag aaaccggtat tcagtattac ttcctttgtg tgctgcggga atcatcatcc     97260
     ctatcgtatt cacagggcct gcaattgcta cgcctatgat tgctctcgaa cttggtggtt     97320
     cttcgattga attgggcgga attgttaacg cttataacgt tgcttttggt agttgtgtga     97380
     tggctggtgg aacattggct gatcggtttg gtcgtaagcg ttgtttttta agtggattaa     97440
     tcttgttttt tatcacttca cttcttattg gcttcgctcc cgatattatt tcactcaata     97500
     tactccgggg tatagaagga atcgccggcg ctttgaccct gacgagttca tcagctctga     97560
     tagcgcaaga atttgatgaa catttacgat tgcgagcgtt tagcttcctt ggtacctcct     97620
     ttggtattgg attagcattc ggccctatgc ttgtggggac gatgatagct aactttggtt     97680
     ggcgatcgct ctttttcttt atcgctttgg tatcactgct tgtccttttg ttcagtgcca     97740
     aaaaggtaaa tgaatcaaaa gatcctgaag cgaaaagtat agattggccg ggcatcattc     97800
     tttttacact tgccttgagt acattaacgt tgggaattgt ttttgcacca gaaagaggat     97860
     ggactgatat ttatattatt ggattgttcc ttacgagtgc tttgctttta gttgtttttg     97920
     ttatagcgga agttaagtct cgatatgcaa tgcttgattt aagtctattc cgctatccgc     97980
     gatttattgg cgtgcaatta ttgcctattt caacaggatt ctgttttgtc gcgttgttag     98040
     tttctctgcc aatctggttc atcggtattc aaggttttaa tgaggggcga gtaggtcttg     98100
     caattctccc actgacagcg ccgatgctgg ttgttccttt cattgctggg tatctctcaa     98160
     aatatgtctc ccccgggctg atttgtagca tcgggttgtt ggttgccgct gttggcggat     98220
     gttggttagc tttcagcctc caagttgacg gaaatataaa ttctttagtt ggtcctttat     98280
     taatgatcgg tattggtagt ggattgccgt ggggactcat ggatggttta tctatgagtg     98340
     tagtacctaa agaacgcgca ggcatggcag caggcatatt tacgactatg cgtgtatctg     98400
     gggaagcttt ggctatcgct atcattggtg ctttgctggc agcgaagaca tcggccattc     98460
     tggtttccgc caaagcagat catgcttttt caaatatagt ctccagcgaa tggggaggaa     98520
     agatcgcgag tggccaaatg tcatccatac ttgaatcggt cactgatgct gatagggcaa     98580
     gtttgggcca ctggcttgcg acaatatatc aaaattcctt cggttcaatt ttgttgataa     98640
     tcgcagcatt aacagcgttg agcgcgttag cttgtgcatt attgctacga cgtgaaaagc     98700
     aaaattcaat tcgctaatac ataattttaa taaattgact tgcaaaagcg aggtatctga     98760
     tggatttgca gctaacagga aaacgagctt tggtgacggg aagcaatagt ggaattggta     98820
     gagcgatagc aatttcctta gcaaatgaag gcgtgcaggt tgttgtacat ggacgaagga     98880
     aaaaggaaac cgaagaagtg atgcaggaaa tacttgatta tggtggacaa gcgtgcatgg     98940
     ttattggcga tctgactgat gatgatcagg ctcagaatgt tgtccgggtg gctcaagttg     99000
     catttggcgg aatcgatata ttagttgcaa atgctggcgc ttttccgcca acgccaatcc     99060
     tggaaagtac ggctcaggat tggttaaatc tttacgatca aaacgtaggt tctatcattc     99120
     gtttacttcg ttttatcgtt ccttcaatgg ttgaaaatgg atgggggaga gtgattactt     99180
     tagggagtat tgccgcatcc cgtccctttg cttctttcgg tgcttatgcg acaacaaaat     99240
     cggcctgtgt gagccttgct gtcaccattg caaaagagtt tgctggtaca ggcgtgactt     99300
     ccaattgtat tagtccaggt gatgtgatta ctccagcagc agaacagcat tggcgaaccg     99360
     tagctaaacg caatgattgg tcagatgagt gggaaaagat tgaatctcat gtggctacca     99420
     atatttcacc gactttggta gggcgattgg gccgcccaga agaaattgct gatttagtga     99480
     cttttttggc aagcccgaaa tctaattata tcaatggctc taattttagg atcgacggag     99540
     gttttttagc gagtacggct taattcgata gatatatacc caatagattt caagatgcat     99600
     cgcgacggca agggagcgaa tccccgggag catagataac tctgtgaccg gggtgagtga     99660
     gtgcagccaa caaagaggca acttgaaaga taacaggtat ataccctatg gtagagggat     99720
     attatggata cacattacgc tgcattgttt gcgccaatgt catttggctc tcagatgttg     99780
     aaaaatcgaa ttgtcatgtc gccaatgaca cggcaattat ctcccaatgg tattccaggg     99840
     caggtaaatg ctgcatatta tcgacgacgt gccgagggag gtgttggttt aattattacc     99900
     gagggagtat gtattccaca tatcgcagca aatggttacg ctgatgttcc agtaatgtat     99960
     ggagatgaag ctcttaacgg atggaaaaca gttgtaaagc aagtccatga atatggtgcg    100020
     ttgataattc cccaactttg gcatgttggt ccaatgcgta gaccgggtat tgggccagat    100080
     cctttagtgc ctggatatgg cccgatgacc ataagcgatg gcggccagac aatcgtgaaa    100140
     ggtatcgatg agaaagatat caaagatatt attgatgcgt atgttcaggc ggctaagaat    100200
     gcattggata ttggctttga tggtattgag atccatgggg cacatgagta tttgttagat    100260
     agttttattt ggcaggtgac aaatcagcgt acagataaat atggaggaac ctttaataat    100320
     cgtattcgtc ttgcatctga ggttgtcagc gcgatacgga aagccactac tccagaattt    100380
     cctatcgtat tcaggttttc acagtggaaa atacgagact atggcgccaa aataatcgaa    100440
     acacccgatc agttagagaa atttgtgaca acgctagtta aagccggtgt agatatattt    100500
     gatgttagta cccgccgttt ttgggaacca gcatttgaag gaagcccaga cagcctggca    100560
     gtttggacca gacgtttaag cggcaagcct accattatgg taggtagcgt tggcttggat    100620
     aaagcctatg cgatcgctca gttgcgtgga gatgagaaac cagatgcagg gagagctgat    100680
     ttagcgccgg caatagaatt gttagcatca ggttcagttg atttagttgc tttagggcga    100740
     atgttattag ctgatccaga atggcctaca aaagtttatg aagggagact gtcggaaatt    100800
     cttcctttta ataaatcgtc aatgacgacg cgtctttgat gttatttaca tatacccttc    100860
     atccttcaag ttgctgcttt gttggctgcg ttcacttacc gccgcgctgc aatttgaaat    100920
     ctactgggta tattacttat atttaatatt taatctgaca gctaccgatt atttgtctgg    100980
     tgtctgtcag atgaattttc gtatctgatt gtcaatccca aattataaaa agctatttta    101040
     gcgagttttg atttatcaat gtgtgagaaa gcgcactcca atattcgctt ttttctctat    101100
     taaataaaga attattctct agagtggcag ataaatccag atcctggaga aagtcttcta    101160
     aatctgttat cgatgcgaat gtcataatcg agatggcatc tatatctttt gctatcggat    101220
     ggaaaaactt ctctcctacc gtaatgggac caatattatg tagctgaatg taacgttgga    101280
     caaacttttg cgttgaaggt tgagagatta tttgtttggc atatttgtat aacagaattt    101340
     catgaaaatc actgcgattt aattccgttg cacgttggtg aatattgact aaaaggatag    101400
     ggtcgctacg tattttgccc ggaattaaaa catgttgacg acaaagtact ggacagagtt    101460
     ctcgaaagat cacttgatct tctggcagga tagctctact gatttctggg tgttcgaata    101520
     aagaatacaa gttatctcta tttgggaagc ttaaatacgc catgccatcc cattgtggcc    101580
     gacgatggac aggaatatgc cctatgatgg tattaaacaa atgcccgtct ttatcaagtg    101640
     gtggcttata aggaagaggg ttgatgcttg aaggcccaga tgagaatcga tggatttgat    101700
     cgtaacgtaa taatgtatat tccccaccgg cttcccgtgg tagggcatga ataaatctag    101760
     ggccatggac tttacgccaa tattcagccc atttttcgaa agctaaatta gcatcctttt    101820
     caaatgcatt tatcactaaa gacggctcta ctaaaggatt gccctgtacg tcaagcattt    101880
     gatttggatc tttacgacgt tctgttaacg aagagctgtc agctctggaa agcaatgtgc    101940
     aaagtacggt tgtctgaggt gtcgatgatg aactcactgg cggaacgcta atgcaatcag    102000
     tcatatgtta cttccttagc taagcgctgg tgcaatatta gtgcattaca aacgttcgac    102060
     gtgtccgata agtctgtgag ggacagtgaa cctaataatg gtatcatgcg attagtaagc    102120
     atgtaatgat atttttatgc tggcatgcat tcacttgccg ccgcgctgca actcgaaatc    102180
     tattgggtat ataacgaata gcaatgttat agctgtttat atttacatta aaatttaaag    102240
     aatatgtttg cttattacac gcaaacgatc taaattcaaa aaagaaataa tcccgttcag    102300
     ttctcatcaa tcgtttctgt tctcgcgtca ttccggagag ctaaaaaaat gcatcaacct    102360
     ccaagtttgg attacaaaaa acctttggat atcaacttat cagtgccaag gaaggttccc    102420
     gtagtgattg tgggagctgg attagtagga ttgactttgg cattagatct cgctcgtaga    102480
     ggtgtgccaa gtgtcgtgct tgaaacacga caggtattaa ctgaaggctc tcgagcgatt    102540
     gtctttgctc agcgttcttt agaaatactt cagcggttag ggttagggga acgattggct    102600
     gaaaaaggcg tcaattggag tttatccagg gtttatcatg gggaacgaga gtctttcagt    102660
     ttcgatttta aaactgagcc ttattttggt tgccctgcgt tcttgaatat tcaacagact    102720
     tatatagaac aatggttaat tgaggattgt ttagccagtg agtgggttga tttacgctgt    102780
     ttgaacacgg tttccgcgtt agagtcgaat agtgttggtg cttcggtgat ggtcacctgt    102840
     ccagatggtt cgtatcaact tgattgtgat tggctcatcg catgtgatgg cgcgcgatcg    102900
     tttgtgcgta atacgctgaa tttaccgtta attggtaggc actttgatga tcattttttg    102960
     attgttgatg tcgagatgaa accggacttt ccggcagagc gtcgtttctg gttcgatcca    103020
     ccgtttcacc caggacattc ggttctttta cataaacaac ctgataactt gtggcgcgtt    103080
     gattttcaat tgggggtaga agcagaccca gtatttgaga gacatccggc aagagttacc    103140
     gaacgtttaa aggcgatgct agatccgaaa atagctttca agattgactg gataagcata    103200
     tatacctttc gatgcaggcg attagagaac tttgttcatt cgcgggtagt attcgctggc    103260
     gatagtgctc acgaagttag cccttttgga ggaagggggg gaaatggagg aattcaggat    103320
     gcagacaatt tggcctggaa actctgtgct gttgtaaaac atggggcatc atcaaaactg    103380
     ttgcagtcct ataacgaaga acgaattcac gctgccgatg agaatattat gaattcgact    103440
     cgcagtgccc aattcatcac cccgccgaat cacgcaatag agactcttcg tcgagcaagt    103500
     cttgttttgt ccgaaacaac ggcaatggga cgtacctttg taaactctgg gcgtttatcc    103560
     agtcccgctc gtttaaatgg gattgggcaa tttttgtatg acacctcggt aaaaggaaag    103620
     gtaaagcccg gagatgtcgc gctggatgcc ccggtaaaaa atggagatga gagtagttgg    103680
     ttattgcact tcatcggtag aaaagggttc acacttctat gctatcgaca gagttctaat    103740
     tatgacggag gagtaaatca tctagaagat atcagtagtc cctatccatt agaaatcatt    103800
     acagtagtgc cggctacagt agaacaactt gctgtaacct caattgatgt cactttggta    103860
     gatcactatg gtttggttgc taagcgttat gatttggctg gtggatcagt cgtgttattt    103920
     agacctgatc aacatgtgtt agagatattt tcctcattta accgtgatga cattgaaagg    103980
     acgcttgctt attccatacc aatagctacc catgccgaga gcaaaatata atgaaatcgt    104040
     acaatcactt tttggcagaa tcattaatta cctatagcca cttaacagac ccagatgcct    104100
     gttatgaaat gataacagag gcatgtcaag agctggggga tgaactaggg aatctatttt    104160
     acgctcaatt agttttatta ctcgttaatc atatcggtga ttctaatatc ttacgagaag    104220
     cgataactgt tacacgtaag gggctgatga cagccgccaa ttaaatcgcg taataacctt    104280
     taaaaattta tatttgaggg gaattgatat gattctcgat acttcttatc gtcttgaatc    104340
     tcgttatcgt cgaggtattg atgagcctca aggcaaaata ttcatcagtg gacaacaagc    104400
     tctggtgcga atgttattag ctcaatcagc tcttgatcga tctgtgggtt taaatactgc    104460
     gggatttgtc agtggttatc gtggctcacc acttggtggt gttgataaag aactttgggc    104520
     tgcaaaaaat ttactggagc aagccaatat tcggtttcaa cccggtataa acgaggattt    104580
     agccgcaacg actctcattg gtactcaacg tgtagaaacg gataaaatgc gtcgctttga    104640
     cggtgttttt gggctttggt atggaaaagg gcctggagta gaccgatctg gtgatgcatt    104700
     aaggcatggt aacgcctatg gttcatcgcc acatggagga gtattagtcg ttattggtga    104760
     tgatcatggg tgtgtatcct cttcaatgtc gcatcaatca gatcaagcac taattgcctg    104820
     gggattaccg gttattcatc ctattaacct tcaggactat gaatattgtg ggctctgggg    104880
     ttgggcatta tcacgttttt caggtttatg ggtgggattt aaggcgatta ctgaaacggt    104940
     agaagcgact gcatcagtta acgtgtctgg gtttccatcg ttcaaacaac ctgaggtaga    105000
     tgttgggcct gacggattac attggcgctg gccagattta ccaggtatgc aaattgagcg    105060
     gcgctttgct tataaactag aagctgctcg tcgttttatc cgcgaaaatc cattagataa    105120
     agtggattgc gccccggtta caccaaaatt gcttattgcc gcagtgggta aagcttacct    105180
     ggatgttcgc ggagcattag atgaacttgg tataacgctg actgaattag aggcggcagg    105240
     cattgcatta cttggtattc gagttgttta tccactatct cctattttaa aagactgggc    105300
     tcaacgaagt gagaaagtat ggattatcga agaaaaagcc ggggtcgttg agaattcgct    105360
     aaaggccagt atatttaatt cagttctcaa tactcagcca ttaattattg gcaagtcaga    105420
     tgaaaatgga ataaaacttt tacccaatga agatgagtta aaaccatcgc gtattgtcga    105480
     tgttcttgtt aaacagcttc gagaatgcgg tctgtcagta gaagtcccat cattttggtc    105540
     aatgaaactc atcgaacgtt ctgttaattg ggtaaaacgt actccatatt tatgttccgg    105600
     ttgcccacat aatagttcga caatgattcc agaagggagc caggcgaggt taggcattgg    105660
     atgccacgct ctggccgctc gtattcctga acgtgccacg accggcagtg tacaaatggg    105720
     aggagaaggt gttgattgga taggtcaaat gtcgtttgtc aaaacagagc acatttttca    105780
     aaatatggga gatggaactt tctttcattc tggatatttg gccattcggc aagcaatcgc    105840
     agcaaaagcg aatatcactt ataagatctt atataacgat gctgtcgcaa tgacgggcgg    105900
     tcaaccattg gatggtagtt taagtgttga gcaagtagca acgttagtct gtaatgaagg    105960
     ggctcaagaa gtggttattg tcgccaaaga gcctgaacgt tataaaacaa agggccgttt    106020
     gcctgaacaa gtcaaagttt accaccgtga tcagcttaat gaggtgcaac ttcgattgcg    106080
     gacgatacct ggtgtcaccg tattgattta tgatcaagtg tgtgccgctg aagatcgcag    106140
     acgccgtaaa cgccaaccag taccggctaa aaagacctat gtaacaataa acgagcttgt    106200
     ctgtgaaggt tgcggagatt gtcaaataca gtcgaactgc ttatccgtgg tgcccgttga    106260
     taccgagttt ggcgctaaac gggcgataga ttctgaatca tgtaatacag atctttcatg    106320
     cttaaaaggt ttttgcccca gttttgtgac tgtgacagga aaaccgcgtt tggttaatac    106380
     ggataaaacc aaacaaacca aacggcagtt aattatgaca cgggcggatg agttaccact    106440
     gccgcaatta cccagtataa atcaatgcta tgaaatactg ataacgggtg ttggtggtac    106500
     aggtgttgtc actatggctg cgactatcgg tttagcggct catctacagg atttttcggt    106560
     tagcgtgctt gattttacgg gctttactca aaaaggcggc tctgttttta gtcacatacg    106620
     cattggcgct aaagatcata tattacatca gcatcgtatt gatcgaggat gtgccaacgt    106680
     tttaatcgct gcggatttaa ctgtcgcgtc agaagatgag gcattaaatg ctctgctttc    106740
     aggacaaact aaaatcattg ccaatacgca tgaaatgcag acgggttcaa tggttcgtga    106800
     tagaaacctc aaaatagaca cttctgagat tgagaaacga ttaatagcat tggtcgggga    106860
     agattgctat gacgctataa atgcacgtta ttttgcaact caattcgtgg ggagcataca    106920
     aacaaatata ttattgttgg gatatgcctg gcagaaaggc gtcatcccgt taagtttgca    106980
     agtttttgag caagcaatta atttacaagg cggtgatatt actgctaata aagtcgcgtt    107040
     cgcttgtggt cggttgctag ctaatgatcc tgaatatata caatccttag ttgctcctgc    107100
     cgctaaaagt tatcaaccta tcaggaccag cagtggtagt ggtgagccgg gactccgtaa    107160
     gattattgag tctcgtagcc gttatcttac ggactatcag aatgagcgct atgcggcaaa    107220
     atatagagca caggttgatg ccgttataaa agcgactgct aactgggggg atttcacact    107280
     agctcacgca gttgctcgca atttatttaa gctcatggct tataaagatg aatatgaagt    107340
     tgcccgccta catagttcac cgcaatttct taattctttg acggaatcat atattgggca    107400
     cccaaaatta aattttcatc tcgcaccgcc attcttaggt aagtggctgg aaaaaaatgg    107460
     ctatcatcgt aaaattactg tatctggttg gattattccc ttttttcgcg ggcttgccgc    107520
     tctccgatgt ttgcgccata cttttttcga catctttgcc tggtctcatg aacgacgtga    107580
     agagaggcta ttagtttcga gatataagga tacattaaat gacttattat caaagatttc    107640
     accaaataat ctctctttga ttgtccagtg ggctgaagta cccgaaaata ttaggggata    107700
     tggacatatc aaggagcgtt caattgcagc agcgtataaa cgtcaggatg aattacttaa    107760
     tcaaatagca aatggtggct caaccatata ttcagcgata cccgttaaag aagtgagtta    107820
     agaatctttg gataaataac cgaattaagt catcgctact ggttattcat tttcaaataa    107880
     aataaggttt gagagttact ggttctaata gttttctaca ttcttatata aaacaaaagg    107940
     taactctcat taattatgaa tttttagacc ctcgattgac agttttatgt atataccctt    108000
     catccttcaa gttgctgctt tgttggctgc tttctctcac cccagtcaca tagttatcta    108060
     tgctcctggg gattcgttca cttgccgccg cgctgcaact tgaaatctat tgggtatatt    108120
     taacaggtgt tagttgagca aaaatgaaga acagaaagtt agaagaaagc tcaaaatatt    108180
     ggctcattct gaagagggga ataatgtcaa tgaaacctgc cgttattagg caatatcccg    108240
     ggatactttt tcccgttggg aaaaaggatt atgctgccaa aggagaaaca taaacaacaa    108300
     tgtcactttt atcggcgggg agagcatctg tttacaaaac aattacggac gtagtacgag    108360
     taaacagaag tctccaaact aaaattatga tgttgaagtc aactgtgcaa taagtcagct    108420
     taaatgtgaa tcaacttaat tagccactgt agttcttctt tattttctct cttgtaatat    108480
     atttttctgt ttatttttat attaaaaggt gatgggggtg atatcagggc taaatcatat    108540
     ttttttatta ataataggtt ttcttcgcac tgtggaacaa atgatatacc tgctccatct    108600
     cgtaatgcct gtaaaacatc atagatattt gggattgtaa ttatacttct attataattc    108660
     aggtttaata aatgtttttt tatctgctcg aattctttta aaaataacat attttctgtt    108720
     tgaattatgt tatttgtcaa taacagatcc atattgcttt tgctatattt tataatgtgc    108780
     tttgtaacgg ctaaccctag aaaattcgga gttaaatcca tactttcaat gctagagtga    108840
     agattatctt catttcttaa cccaataaaa atatcggctt tctcatgaaa tataatatct    108900
     gatatcagat gattgggata ggtcctaaca tcaactagaa aactagattc acttgagcat    108960
     attttggaaa ttatcgagga taggctagga aataaggttc catccgttgc aatattgatg    109020
     acgttttttt tgctgttaga aaagctcttc attaaacgtt ttgttgtcga atttacatct    109080
     tggtaatatg gaaataattc tctatataat agttctccgt taactgtcaa cttagcattt    109140
     ctcctggaat gctgaaaaag ttgaactcca agttgttctt ctatttcttt cattcccttg    109200
     ctgagggctg aaggtgacaa gcataattca tcagcagctt ctttaaaaga acctttatta    109260
     gctatcatta tgaattgctt aatctttttt gagaaaaaca tactttcctc ctgaattgaa    109320
     agtcaatata agaatattta tatatttaat gtcatctatt tttttatatc aatttgtttg    109380
     gttgataaag aaaaaaacag tttatagtgt atttttgtat tttttctata attttgtata    109440
     taattgtaaa tttttgaact acacgagata actgaggtca tatataatcc atattatgag    109500
     taaaagtaga ttgaattgta ggaaacagga tttttattac gttatatttg tttaaggagt    109560
     aggagtatct gtactgatca atgtgaatga gtcctgtttc tgactatttc tattacctga    109620
     gaaagagcat tactgattat tttaaggaat tattattgta tttaggggga cattggcaag    109680
     acaggtcaat aacaatggca gcctatcatg atatccagct cgccaatctc aacatgtaat    109740
     tcgagatagc gctgagctag tgatttcagt gtaatacggt gggcatcctc aacatcaatc    109800
     gtatcacttt taccccgttt cctgcgcccc attctgtcgg gagctgtgac ctaaagactt    109860
     caatacctgc gggttgaaga tatcgcagca aacctgcgcc atacgaaccg gtacattaaa    109920
     tccccacccg gatgagcagc caaagtaatt tcaggataaa atagtttcaa atcaaaataa    109980
     ttaaaatgga aatgatatgg atgattgtgt aataatttta ttatagatgt acgaaaaagg    110040
     tgaaaaaaag tattttcaag gtgaaaaaaa agcgttttta ttacccatga gcatatacta    110100
     caattttaaa agataaatat taatatgacc taatgactat cttaactgtc tctgcatatt    110160
     gtatttttcg ttattttcag tgaagtgttg cacactatta ttaatatatt tttctgaaat    110220
     acaaaacgtt cagaaatggc ggtagcttta tcagatgtaa gcttataccc aatagatttc    110280
     gaggggcaac acggcggcaa gtgattgtct aatccaattt tttctcattt gaatatctaa    110340
     ttcaaattcc ttatctagga cagcccttta ttttggataa tgaaagtctt tgatgattta    110400
     aatttcatta atatttttat gatattttaa aggataatac tatgaataca gctcaagaaa    110460
     ttattaaccg tttatcgggg agagccgtta cgcttggttg ggatgttgtt attgcttatg    110520
     accgaaaaaa aattaacact ctgttagagc aacaatatgt tgaaaaggta aaaaacgggg    110580
     agaacttccc gcttatcaac tgggagaacc agagaaaaac acttcaattt aaagatcttc    110640
     aattaggtgt tccacttatt tcttttgaga attcaacact ggaaaattca agggcgcttg    110700
     ccacgataga atttatttca ggagctatta ttgaatttag tgactccggg caaataatca    110760
     actataagaa gattgaacct agtcatggtt atggcatggt gctgactatc gatctcatgg    110820
     ctggtacagg ttcagtagaa gaacaaggtc gggtgataat aaatcttaac gaaggcgcca    110880
     tactcgattt gcatgttatc caacaaccgc cagcagaagt ggtagaattt ttccgcactt    110940
     ggttgatggc taataaaatg acttatgaat taggtaagct ggatctgagt agtcaagctg    111000
     gtctagtgcc tcgttctttt cgtattcgta ctcagcgggc gcctgaaaaa attcgtaaag    111060
     cgacgagcga tgaaggaaat ggcgctgttt tgttgtttgt tgccactaac tataacccta    111120
     caagtggaac tttacctgcc aaggattatc cgtggctaat ccctgaggaa tattcaggcg    111180
     cattgcttat cggtaataaa tgcttattta aagacattct gaaaccgaat ctggatcagt    111240
     tgtttgataa aggggaatgg acattaaaag ttcagcaaac ggattctgat caactgctgc    111300
     attatctgga ggcaaactct gcatatataa cagataagcc ttatatggca gactttgaag    111360
     gaactcagga tggagtctgg acaggacgtt ataaatttga gactggccgg ggacattatg    111420
     gggtgtatga aaatgtacgc tttcctatca atggaatgtt gatgaaaccg gctaaaactg    111480
     gattacagtt atcaatagat tcaccacaaa gccatcaatt taatgttgat ttcggaatga    111540
     agtggttcca ttgtgctaat ataatgtgtg gttattcctg gtttaacgag acttacccat    111600
     tttatcttga tggaaaatca ttttatcaag ttcatattga ccctgataaa gaggtgattt    111660
     attttactgg gccagatgaa gatattaata ttgtaggaaa ttacagcccg cctgcgtggt    111720
     ggcaatctaa atggcaaaaa catatcagtg atgattttac ggatatttcc tcggaaaaat    111780
     ttaagcgact cagtcaaata aaattgccag aaatatgcat gtttgccgtg aaccatttat    111840
     tatttcctgg tcataatact ttgctgttga aagacgttta tttaccgggt gatatggtga    111900
     ttttcggtga tattaaccca tcacttaccg cttttcgggt tacgccatta aaagcaacag    111960
     tggtggcaaa gggaacccaa caatttaaag ccatagaaac taattgatga ttataccctt    112020
     catccttcaa gttgctgctt tgttggctac gttcactcac cccagtcaca tagttagcta    112080
     tgctcccggg gattcgctcc ctggccgtcg cgatgcatct tgaaatccat agggtatata    112140
     tttaattgga taagtctttt ttattttaac attataacct gattcttttt ggataaaatt    112200
     aaaggattat taacatgtct attacacaag aacaaatcgc tgctgaatat cctattccta    112260
     gttaccgttt tatggtttct ataggagatg tgcaagtccc ttttaatagt gtttcgggat    112320
     tagataggaa atatgaggtt attgaatata aagatggcat tggtaattat tataaaatgc    112380
     caggacaaat acagagggtt gatattacac ttcggaaagg catattctct gggaaaaatg    112440
     atttatttaa ttggattaat tccattgaac tcaatcgggt agaaaaaaag gatattacaa    112500
     ttagtttaac taatgatact ggcagtaaag tcttaatgag ttgggttgtt tcgaacgcct    112560
     ttccgagctc actgacggcc ccttcatttg atgcttcaag taatgaaatt gcagtacaag    112620
     aaatttcatt agttgctgat cgggtaacaa ttcaggttcc ctgataacta aaaactttaa    112680
     ggaaaaataa tgtctgtaca aacaacttat cccggaattt atattgaaga agatgcatca    112740
     ttgtctctat ctatcaataa tagtccaaca gcaatccctg tttttatcgg taaattttac    112800
     aacttggatg gttccttacc taaagtggga acatgttcta gaattaccag ttggttagat    112860
     ttcactaaaa aattttcggt agctcctcct caaaccattt cattgatcgc gtcgccaatt    112920
     gctgacacac aagaaagtgt acccaaagca gttcaatata cttataaggc cgagtttgaa    112980
     acctcagaaa atctggcaaa tggtgcctat gcggtacaac attatttcca gaatggcggt    113040
     ggtatttgct atatcatacc tttagttagc gtgaaaaaag aggatgctgc gattgagtta    113100
     acaaaattac ctgaattaat tgaaagacaa caagagatta cgttaatcgt ctgcccggag    113160
     gacgataaga cgctcactgt tgatagcagt aaaaaatcgg atgtttataa cagcatcaat    113220
     acattattga gtaataaggt aggttatttt ctcattgcag attcagatga tggcaaagca    113280
     gttcctgata cgttgccgga aaaaactgcg gtctattatc ctggtttact aacttctttt    113340
     acacaacgct atgcccgacc tgccgattct gctatcaaag tgaccggtat tacaaatata    113400
     tcaactctgg ctgatattca caccaacttg gccgatgact actcaacagc aagtcaggtt    113460
     attaatgatg ttttggaaaa aaataataag ctcgcatcgt ctcccattat tttacctccc    113520
     agcgccgctg ttgctggtgc ttatgccgct gttgatgtga gtcgtggtgt ttggaaagca    113580
     cctgcgaatg tgatgttaag taatgccacg ccaatcatta gtatttccga tgcggaacaa    113640
     ggtgtgatga acccattagg tattaatgct attcgtagtt ttactggtag aggtactttg    113700
     atttggggag ctcgtactct ggataaaacg gataactggc gctatgttcc tgtacgtcgt    113760
     ttattcaata gcgcagagcg agatattaag ttagcaatgc gttttgcagt ttttgagcct    113820
     aactcccaac caatttggga aaaggtcaag gctgctatca atagctattt gcagtcactt    113880
     tggcagcaag gtgcactgca aggcaataaa cccgatgaag cctggtttgt acaaattggt    113940
     aaaggcgtga ccatgacaga tgatgatatt aagaatggga gaatgattat caaaatcggc    114000
     atggcggcag tacgtccggc agaattcatt attttacagt ttacgcagaa tatcgcccag    114060
     taacttaggt ctatacccta tagatttcaa gatgcatcgc ggcggcaagg gagcgaatcc    114120
     ccgggagcat atacccaata gatttcaagt tgcagtgcgg cggcaagtga acgcatcccc    114180
     aggagcatag ataactatgt gactggggta agtgaacgca gccaacaaag cagcagcttg    114240
     aaagatgaag ggtatagata acgatgtgac cggggtgagt gagtgcagcc aacaaagagg    114300
     caacttgaaa gataacgggt atatttaata tgggcgattt attgcccatt tttgtgaaag    114360
     gaaatgagtt atgtcgccaa cgctacccgg tgtaacgatg actcaggcgc agataacagc    114420
     gttcggtgtc agtacattaa atatgcccgt attcataggg tattgtacga gattgcctgc    114480
     cttttcagcg cctgtaaaag taaacagttt agctgaaaca gaacaaataa tagggaaaga    114540
     agggcgtttg tatgctctat tgcgccactt tttcgataac gatgggatac aagcttttat    114600
     tctgtcgtta ggcgcacctg ctggggaaaa tgctaatagt tggcttgagg cattacaaca    114660
     gcccgatttg tatgcggctg ttgcagcaga gccgctaatt acacttttag ccgtcgttga    114720
     ggcaagtgaa ctgaaccaaa aagaaggtaa tgaggctgtg gaagcttggc gacagtactg    114780
     gaaagcagta ttagcgttat gtcaggcacg cagtgacttg tttgccatat tggaggcacc    114840
     agatgatacc gcattaatca agcgtagttt gcaggatttt catcataagg cacgtcagtt    114900
     tggcgctctc tactggccaa ggctagaaac atcttatcaa tcctctcagt taaaaatttt    114960
     gtctcctatt ggtgcagtag cagcggttat tcaaagtaat gatgtccggc gaggggtagg    115020
     acatgcacct gccaatatag cgttaaaaca gacgattcgc ccgataaagt cccgcctgga    115080
     attagaagag ttgtatgaag aatcggatgg ttcactgaat ctgatttgta gttttccagc    115140
     tcgtggtact cgtatttggg gatgtcgtac gttggcgggt attgattcac cttggcgtta    115200
     tattcaaacc cgattattga cttcacacgt ggaaaggcaa ctcagccagt tagggtgcat    115260
     gttgatgttt gaacctaata acgcagtcac ttggatgaag tttaaaggcc atgctgggaa    115320
     tctattaagg cagctttggt tacaaggggt gctgtatggg cagcgtgaag atgaagcctt    115380
     ttccgttgaa atagatgaaa acgaaacgat gactcgccag gatattgatg aaggcagaat    115440
     gattgctcgt attcatttgg cattgttagc accggcagag tttatcgctg tgactttgaa    115500
     ttttgatact cgctcaggca ttgcgacgag tacataataa atcggaatat ctccatgaca    115560
     ctaccagcag agctttatac cccagcggtt tcacatcgtt ttattgttaa ttttcttttt    115620
     aaaggtttac ttccttctcc cgtagatatt cgatttcaac gtgtttctgg tttagggcgt    115680
     gagttacagg ttgaacagcg ccatcagggg ggagaaaacg cacggaatca ttggttggct    115740
     gaacgtatac agcataatag cttgatatta gaaagagggg ttatggtcgt taccccttta    115800
     acactgatgt ttgatcaggt gatgcggggg gaaactctca attgggcaga tgtggtaatt    115860
     attcttctcg atcaggctca acgtccgata acaagttgga ccttgagtca tgcgctaccg    115920
     gttcgctggc aaacaggaga tttagatgcc aacagtaacc aagtgctgat taacacctta    115980
     gagctgcgtt atgaagatat gcgcattata ggggtaaaat tatgactatc gaaatccgtg    116040
     aactcattgt tcaagcccgt gttgtcggga ctgataccaa aacaacacga accgttcctt    116100
     tatctattgt gcaaatggaa acacttatag aacaacgtct ggttgaaaaa gtgaagcggg    116160
     agatattaga cgtactccgg gaagaacaag gtggtgggtt atgagcttgc ttgaacgagg    116220
     tctggctaaa ctcacgatta cgggttggaa ggagcgtgag cgtaaacatc agattggtaa    116280
     actagaagca atgtataacc cggaaacact tcaactggat tatcaaactg attatctccc    116340
     tgatgttagc aataatcagg taacagtgag taaccgctac gttttgtcaa agcccgcagg    116400
     gttaacacta tccttgttat ttgatgccaa tatggctggt cttacgacaa ccgtcgagtc    116460
     ccaaatcact accctcaaat cgctttgttt agttaatgca agtactgatg aacccaattt    116520
     tttggaaatt aattgggggg caatgcgttg ggaaaataaa aattattttg ttggtcgggc    116580
     tagtggattg tctctgactt atttgcgctt tgatcgtaac gcaacaccat tgcgtgtgag    116640
     tgcgcagctc acattagtcg cagatgaaag ctttgtgctc caggataacc aagccaagtt    116700
     agatgcgccg ccggtatcag tagttaatgt cccggatctg acttcattac ctgcactggc    116760
     gaatatcgct agcgtaacca ctatgttggg agtggattat ttaatgttag cccgcaccaa    116820
     tgatatggat aatttggatg atatgcagcc aggtcagaca ttgcgaacac cggaggcatc    116880
     atgagttttt tagataacag taacttcaag ccatcagata tcaaactgtt cgttaacatt    116940
     cagggagtgg agaaggaact caacgaactg atagtaagcg aattgaaaat ctcccgacgt    117000
     atcaatgcca ttccgcaggc agttgtaaag ctaagagcga aagagagtga aagtggtgta    117060
     tatcagtctg atgtacagcg gatgttgaag agttgccgtc cgggagtaaa ggcagagctt    117120
     cgtattttga atacccggct attcagtggc gatattgtgc agcaaaaaac agagttagtg    117180
     tatgcgaaaa cacacactat caaattggtg ctacgccatg acttacagcg catcaccggt    117240
     aattttcgta ccagagtgtt tgcgaatacc cgtgatcgta aagtgatagc cgatctattg    117300
     aataccgcaa cattaaagcc ggcattttcg gggacatcac attgggatat agatcatgag    117360
     caactggttc agtatcgttg cagtgattgg caatttttgt tgcaacggct ctatgctacg    117420
     aatagctggt tgttagctga agaagataaa gataacactc aggggaaagt gaccattatt    117480
     gctccaaatt ctttgcccct gaatgagcgt tggacactgc aacatcaggc tgatcatcag    117540
     gctatccggc tttacagcac ggagctgatg ctggataacc ggtttgatac agcggaggct    117600
     gttgttagtg cttgggatat tgatgatcag gcattactcg tggcgtggaa agaaaccctt    117660
     agtcaagttg ggaaagatgc gttagcgtca gataatttta gccagacaaa taaagattcg    117720
     agtgaactgt tattaagttg tccgctctct acaaaagaag ttcaattttt aacgcgtagc    117780
     caattagtca tgcggcgctt gacggccgtt cgtggttcac tgaaggttga aggcagtact    117840
     aagtaccgtt tagggcatga actgatgttg tcaggttttg gtgaaaatat ggatggctca    117900
     caaatactga cgggagtgga tcatcgaata acggcagaag aaagttggaa aacaacctta    117960
     catgtgggat tagaactgcc gttaaaggca gagtatgtca ctcaggttaa cggtgttcat    118020
     atcggcaagg ttgctgatta tcaatcagat agcaaaaaat gggatcgtat tcctgttttg    118080
     atccctgcat ttggaacgaa tattcccttg tttgcccgat tgggaaaacc ctacgccagc    118140
     caccaaagtg gattttgttt ctatcctgaa acgggtgatg aagtcattct cagttttttg    118200
     gaaggggacc ctcgttatcc tgtcattatt gattccctgc ataatcctaa acaacagact    118260
     ccattgcaaa tcagcaaaga gaataatctc aaaatgttga tgattaagca gagcgataaa    118320
     gatgagcaac aattgttatt tgatagccag caacaaacag tcgcgttaat cggtaagaaa    118380
     aatatcgagg ttaaaggtga gtatatcaac ctgactaaat caaaggggac tcgataatgg    118440
     caaatacgct tattggccag gtatatggtc aaggatgggc ttttcccatt aaatttattc    118500
     ctgataataa agaaaccgca gatcaaacag ccggtattgt tatggctcaa gggattgaag    118560
     atgtcagtca atcgctggaa atattatttc ttaccgagcc tggcgaacga attatgcgtg    118620
     aagattttgg ttgtggttta caagattttg tttttgaaaa tattagtgat acgctaattt    118680
     ctgccatcaa aaatcgtatt cagcaagcaa tattacgtta tgaacctcgc gcatatttat    118740
     tgaacgttga tattcaaacc aaagaaaacc aacctggaca tctgctcatt cagattaatt    118800
     ggaaattacg tggtagtgat atatctcagc gtttagacgg agtgcttaga ctccattcag    118860
     gtcaagcatt ggaactgtta tgaccaatta tattattatc gacggggatc tcattcaaat    118920
     aaatcccaaa tttgagggtg atcgaactct tacgattaat ggtattccta aaataagcgg    118980
     gaatggagat gcgcaaattg aaggaaaaaa tatttgtgtg tcaggtgatc acttaactgt    119040
     ctcaattcca gccatttata taacctccag acatcctgtt gcaggtagtg gaaaagtgaa    119100
     aattacaaat ttatctgacg accaactagc agaattttgt gttagtgggg atgttgtgat    119160
     tattgaaggc agtcagtttg aagctcagtt tacaccggat aagccggcca ctaatccaag    119220
     taaccaagat gcagataatc ctgcgccttc gaatgggagt gggagattta tacactcaca    119280
     gaacttcgtt aaggcagaaa aataaaaaat tttgccgaag cggttaataa gtatgaataa    119340
     gcggggcgga taaaaacatg gatcttgctg aattaaataa tacgttgatg aatgacttac    119400
     caacgaccaa ttttaagtta gaaacaaagg acccattaac gcaattaaag tggttacaac    119460
     gttatacaga aaatattcgt ttttatgcga atgatgatta tttctggcat caattctggt    119520
     tcttaaaaaa tcacacacca gaagcgctct ttgctcgttt gcaaggtgaa acgttggctg    119580
     atggagaatt gcctcctcat caagcgctat tgctggcctt tttacaacag cttaagacgc    119640
     caggaatcat gcttgatact ttttcagccc gtcatcggca attgtactat caggaattgc    119700
     tagggataac gcagaaagat gcacaacctg atcatgtggc gcttggcgtg gtattaagta    119760
     ctggtattgc agaatattta ttaccgacag gcacattagt ggatggtgga caagacagca    119820
     gcggaaattc actgcaatat gcgttggata ccgatttatt ggttaatcca gggcaattaa    119880
     cagatgttcg ctacagctat ttggatcata agacctataa aatcttcatc ttgcaagatg    119940
     ataaagcgaa tatcagttgg ccctcttcag gcgctcgttt atttgtagca cctgagggca    120000
     acggacagga aaaggcacct gaacaaaagt tggcacttta cctgggattt gatgatatac    120060
     agccagggca aactctttct ttattttggc aattcattgc atcaactccc ctgacattaa    120120
     aatggtttta tctgaacgag ataaataact gggtgaagct agatagtgtc agagataaca    120180
     cggatggctt ttttatcagt ggattatggc aagcgatatt acctgatgat gcggtgaaaa    120240
     tgtattttcc agagacaact tctgtaaaac gctactggat taaagctgag gtggaatcgc    120300
     ttactgaatc tggcgatttg tggcaaccgc tattagaagg catcttgtat aacgctcaaa    120360
     cagcaacgct ggttgatgca gacaacacag atgaaaagca ctttcatgat gggctgatgc    120420
     cttttagcgt gcagcatttg gtcaacaccg tttcagaggt aaaaaaaatt gagcagccct    120480
     ggtcttcttg ggggggaacg ccacaggaag acactactga tttcttccat cgagcggcaa    120540
     cacgtcttca gcatcgccag cgtgcgttaa cttgggataa ccaaattgcc atgttgaagg    120600
     ctgaatttcc gcggatttat gatgtcatct caccaaatat cacgtggatg aaccaacttc    120660
     agacatcaaa tacgcaaacg ctgatcgtta ttcctgatgt gaactacagc gacaacaagg    120720
     atcgcttacg gccacaattc agccctgcca gcttgcgaca aatgagtgac tggttacaga    120780
     ttcacactag cgcatgggcg aatccacaag tggaaaatcc aatttatatt gatgtctctg    120840
     tgacctatga ggtgcaattt agtgcgggtg tgaatcctga ttatgccctc cggcaattac    120900
     aacaatggtt gagttcaatt tatatgccat ggtatcacgc agataaaaaa ggtgttgccg    120960
     ctggcgatca aatcgatttt taccaactgt ttgcagatat tcagcgagta ccttacgtgg    121020
     agcatgtcaa aacattgaca ttgaccacaa aagacacctc attaaccaat ggcggggtta    121080
     ttaaggcaca gcaaaatgaa gtgctggtgt tggtatggca acaaggagaa caaattaggc    121140
     agggagaatc gaaatgaggc agcataatga gttatttcct gtagtaaaag acgcgataag    121200
     ctttgaaaac ctgcaagctc agggtgagaa ggttattagt gatcagtccg gtaacatatg    121260
     gagcgataaa gataaacatg atcctggtat aacattacta gactctttaa gttacggtgt    121320
     ttcggattta gcgtatcggc actcattacc tttaaccgat ttattaacca ttgctggaaa    121380
     agatacgctt tttccagccg aattcgggcc acagcagacg ctaacttgtg gccctataac    121440
     actggatgat taccggcgtg cgttacttga tttacatggt aatgatgcat ttaaaatatc    121500
     agctagtgac cccagagact ttttgtttca ggatatacag ttaatttgtg agccaaaaag    121560
     taagcgttat aaatactatt tcaatcccga aacgcttgaa tatacattca cgccaccttc    121620
     aggggataaa tttaaaactt taacactacg agggaattat tggctttatt ggataccaac    121680
     ccgttgggca ggtaaatcag ctaatttgcc gttagttaag cgggtgatgg aagattttct    121740
     ccgtgaaaat cgaaatttgg gggaaaatgt tgttcaagtg acacgggtga tatcaacgcc    121800
     tatttatcct gagctggtca ttgagctggc ggatgatatt acagatgcgg catcagtatt    121860
     agcatcaatc tatatgctat tagaacagtg ggcgatgccg atgcctgctc gctttactac    121920
     cgaagcatta caggccaagg gattaacaaa cgaagagatc tttgatgggc cgtggttgcg    121980
     tcatggttgg atacctcagt taccgacctc tcaaaactac catacaggca tggttctgaa    122040
     gatgaatcat ctgattaacc aattgctggc ggttgaaggt ataaagcgcg tagttagcct    122100
     gacgttgcca gaaacagaat atttgcatca gataaaagat gataattggt cctggcaatt    122160
     agatgttggt tattatccat tattatgggg agctaatcca ctagaggtaa ttacagagaa    122220
     aaataacaat tatgtcaaat tgttcgcaaa aggtggggta cgattacaac ctgatcagaa    122280
     aagtgttgag cggttattat cacaggaatc actcattaat aatgctgcat ccacgttacc    122340
     ggctggtaag gtgcgtgatc tcaaagccta tacacctata agccgcaggt tgcctgcctg    122400
     ttatggtttg cagaatactt tgcaaaagtt aaaacctgaa caacgacact tatatcagtt    122460
     cctattacca ttggagcaaa tgcttgctga tggatgtgcg cggcttgcat ttttgccaca    122520
     tttgttagca tttagggacc gaagcggaaa tatcagtgat acactctggc ctttcaagaa    122580
     tacagaggac acaattgccc aacaggttca tcaggaatat gccggtacat taaaagcctt    122640
     tcaacagcag gaaattagcc tgtttgatga taaaaataga ccgcatcatg gcaatatcaa    122700
     tcgggaatta gatattcttg attatctgct agggtatttt ggtacacaac gtgcaaagcg    122760
     tccattaacg caggatattc atgattttct gcaaacccag cgaggttatt tggcacagca    122820
     gccggagttg ggttatcagc gtgataatat ccgtattgat cgagtttcag ctttacaaaa    122880
     acgtatagca gcccgaattg ggctagatgg tactattttc aaagaatcgg ttgatttaag    122940
     taagttacct ttttatttga ttgaacatcg tcagctttta ccaaatttac cccatcttga    123000
     ctttcaacat gatcaaactc cccaatcttt tgtgatttcc gacaacattg ttaaagtgaa    123060
     acaagcggga atagcagata aaatcgttcg tggacagctt attgatttta tagatattga    123120
     aagcaaattt accgttcgtg cccaaatgat tgtcgctgta gagggaaatg aattttctct    123180
     ggatacaaaa aatagtattc aacttgaaaa gaatctgcag ttattacaat cagcgtctga    123240
     gaaaaacaat ttacgatgga gaaatagcac ggcgtggtta gaggatatga cgtatcgtat    123300
     caattatact gacgatcagg ttatagacga taaaacaaaa caatgtcgtt tacaaagtaa    123360
     tactaaatcg ccttttccag ccttaattgc accaaaaaat aagattacga ttattaagca    123420
     atcttctcca ctctccagta ttgctgaatt tactgatgaa ccagaattca aattagttgc    123480
     aacggtgaca gagattgatc ggattgaagg gatattgact atcgaacggg atgacaacca    123540
     actccctttc ccgactaaag aagagagtaa tcaatatata tggtacatat ctgatgaaaa    123600
     ctatatttca agtgatcgtt tctcttttgt ggtgagcgtc gtgctgaatc gcggtttggt    123660
     tgaaagggaa gatattgatc aatataagct agaggaatgg atagagcgtg aaacacttgc    123720
     agagtttcct gcacatattt cgttaattac tcattggctg gcatctgaaa atttcgatga    123780
     ttttgcgaag acatatcaac gttggcaaaa caatggggcg cagttagggg atgaatccta    123840
     caccattttg gaaaaactga cattagggca tttaccaaca ggacttactg gcattagtaa    123900
     tatgtttatt gctacagaag ctcagcgtct agaagttgtt ggcgagagtg gtaatgagtg    123960
     gaatacccag gcaattatta acaacgaact a                                   123991
//

If you have problems or comments...

PBIL Back to PBIL home page