(data stored in SCRATCH3701 zone)

EMBL: FM211688

ID   FM211688; SV 1; circular; genomic DNA; STD; PRO; 2979198 BP.
XX
AC   FM211688;
XX
PR   Project:PRJEA31327;
XX
DT   22-SEP-2010 (Rel. 106, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Listeria monocytogenes L99 serovar 4a, complete genome
XX
KW   complete genome.
XX
OS   Listeria monocytogenes L99
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RP   1-2979198
RA   Hain T.;
RT   ;
RL   Submitted (22-SEP-2008) to the INSDC.
RL   Hain T., Institute of Medical Microbiology, Justus-Liebig-University
RL   Giessen, Frankfurter Strasse 107, 35392 Giessen, GERMANY.
XX
RN   [3]
RX   DOI; 10.1186/1471-2164-14-47.
RX   PUBMED; 23339658.
RA   Kuenne C., Billion A., Mraheil M.A., Strittmatter A., Daniel R.,
RA   Goesmann A., Barbuddhe S., Hain T., Chakraborty T.;
RT   "Reassessment of the Listeria monocytogenes pan-genome reveals dynamic
RT   integration hotspots and mobile genetic elements as major components of the
RT   accessory genome";
RL   BMC Genomics 14:47-47(2013).
XX
DR   MD5; 829b8993783b6e74ac1f70d643351669.
DR   BioSample; SAMEA2272406.
DR   EnsemblGenomes-Gn; EBG00001165389.
DR   EnsemblGenomes-Gn; EBG00001165390.
DR   EnsemblGenomes-Gn; EBG00001165391.
DR   EnsemblGenomes-Gn; EBG00001165392.
DR   EnsemblGenomes-Gn; EBG00001165393.
DR   EnsemblGenomes-Gn; EBG00001165394.
DR   EnsemblGenomes-Gn; EBG00001165395.
DR   EnsemblGenomes-Gn; EBG00001165396.
DR   EnsemblGenomes-Gn; EBG00001165397.
DR   EnsemblGenomes-Gn; EBG00001165398.
DR   EnsemblGenomes-Gn; EBG00001165399.
DR   EnsemblGenomes-Gn; EBG00001165400.
DR   EnsemblGenomes-Gn; EBG00001165401.
DR   EnsemblGenomes-Gn; EBG00001165402.
DR   EnsemblGenomes-Gn; EBG00001165403.
DR   EnsemblGenomes-Gn; EBG00001165404.
DR   EnsemblGenomes-Gn; EBG00001165405.
DR   EnsemblGenomes-Gn; EBG00001165406.
DR   EnsemblGenomes-Gn; EBG00001165407.
DR   EnsemblGenomes-Gn; EBG00001165408.
DR   EnsemblGenomes-Gn; EBG00001165409.
DR   EnsemblGenomes-Gn; EBG00001165410.
DR   EnsemblGenomes-Gn; EBG00001165411.
DR   EnsemblGenomes-Gn; EBG00001165412.
DR   EnsemblGenomes-Gn; EBG00001165413.
DR   EnsemblGenomes-Gn; EBG00001165414.
DR   EnsemblGenomes-Gn; EBG00001165415.
DR   EnsemblGenomes-Gn; EBG00001165416.
DR   EnsemblGenomes-Gn; EBG00001165417.
DR   EnsemblGenomes-Gn; EBG00001165418.
DR   EnsemblGenomes-Gn; EBG00001165419.
DR   EnsemblGenomes-Gn; EBG00001165420.
DR   EnsemblGenomes-Gn; EBG00001165421.
DR   EnsemblGenomes-Gn; EBG00001165422.
DR   EnsemblGenomes-Gn; EBG00001165423.
DR   EnsemblGenomes-Gn; EBG00001165424.
DR   EnsemblGenomes-Gn; EBG00001165425.
DR   EnsemblGenomes-Gn; EBG00001165426.
DR   EnsemblGenomes-Gn; EBG00001165427.
DR   EnsemblGenomes-Gn; EBG00001165428.
DR   EnsemblGenomes-Gn; EBG00001165429.
DR   EnsemblGenomes-Gn; EBG00001165430.
DR   EnsemblGenomes-Gn; EBG00001165431.
DR   EnsemblGenomes-Gn; EBG00001165432.
DR   EnsemblGenomes-Gn; EBG00001165433.
DR   EnsemblGenomes-Gn; EBG00001165434.
DR   EnsemblGenomes-Gn; EBG00001165435.
DR   EnsemblGenomes-Gn; EBG00001165436.
DR   EnsemblGenomes-Gn; EBG00001165437.
DR   EnsemblGenomes-Gn; EBG00001165438.
DR   EnsemblGenomes-Gn; EBG00001165439.
DR   EnsemblGenomes-Gn; EBG00001165440.
DR   EnsemblGenomes-Gn; EBG00001165441.
DR   EnsemblGenomes-Gn; EBG00001165442.
DR   EnsemblGenomes-Gn; EBG00001165443.
DR   EnsemblGenomes-Gn; EBG00001165444.
DR   EnsemblGenomes-Gn; EBG00001165445.
DR   EnsemblGenomes-Gn; EBG00001165446.
DR   EnsemblGenomes-Gn; EBG00001165447.
DR   EnsemblGenomes-Gn; EBG00001165448.
DR   EnsemblGenomes-Gn; EBG00001165449.
DR   EnsemblGenomes-Gn; EBG00001165450.
DR   EnsemblGenomes-Gn; EBG00001165451.
DR   EnsemblGenomes-Gn; EBG00001165452.
DR   EnsemblGenomes-Gn; EBG00001165453.
DR   EnsemblGenomes-Gn; EBG00001165454.
DR   EnsemblGenomes-Gn; EBG00001165455.
DR   EnsemblGenomes-Gn; EBG00001165456.
DR   EnsemblGenomes-Gn; EBG00001165457.
DR   EnsemblGenomes-Gn; EBG00001165458.
DR   EnsemblGenomes-Gn; EBG00001165459.
DR   EnsemblGenomes-Gn; EBG00001165460.
DR   EnsemblGenomes-Gn; EBG00001165461.
DR   EnsemblGenomes-Gn; EBG00001165462.
DR   EnsemblGenomes-Gn; EBG00001165463.
DR   EnsemblGenomes-Gn; EBG00001165464.
DR   EnsemblGenomes-Gn; EBG00001165465.
DR   EnsemblGenomes-Gn; EBG00001165466.
DR   EnsemblGenomes-Gn; EBG00001165467.
DR   EnsemblGenomes-Gn; EBG00001165468.
DR   EnsemblGenomes-Gn; EBG00001165469.
DR   EnsemblGenomes-Gn; EBG00001165470.
DR   EnsemblGenomes-Gn; EBG00001165471.
DR   EnsemblGenomes-Gn; EBG00001165472.
DR   EnsemblGenomes-Gn; EBG00001165473.
DR   EnsemblGenomes-Gn; EBG00001165474.
DR   EnsemblGenomes-Gn; EBG00001165475.
DR   EnsemblGenomes-Gn; EBG00001165476.
DR   EnsemblGenomes-Gn; EBG00001165477.
DR   EnsemblGenomes-Gn; EBG00001165478.
DR   EnsemblGenomes-Gn; EBG00001165479.
DR   EnsemblGenomes-Gn; EBG00001165480.
DR   EnsemblGenomes-Gn; EBG00001165481.
DR   EnsemblGenomes-Gn; EBG00001165482.
DR   EnsemblGenomes-Gn; EBG00001165483.
DR   EnsemblGenomes-Gn; EBG00001165484.
DR   EnsemblGenomes-Gn; EBG00001165485.
DR   EnsemblGenomes-Gn; EBG00001165486.
DR   EnsemblGenomes-Gn; EBG00001165487.
DR   EnsemblGenomes-Gn; EBG00001165488.
DR   EnsemblGenomes-Gn; EBG00001165489.
DR   EnsemblGenomes-Gn; EBG00001165490.
DR   EnsemblGenomes-Gn; EBG00001165491.
DR   EnsemblGenomes-Gn; EBG00001165492.
DR   EnsemblGenomes-Gn; EBG00001165493.
DR   EnsemblGenomes-Gn; EBG00001165494.
DR   EnsemblGenomes-Gn; EBG00001165495.
DR   EnsemblGenomes-Gn; EBG00001165496.
DR   EnsemblGenomes-Gn; EBG00001165497.
DR   EnsemblGenomes-Gn; EBG00001165498.
DR   EnsemblGenomes-Gn; EBG00001165499.
DR   EnsemblGenomes-Gn; EBG00001165500.
DR   EnsemblGenomes-Gn; EBG00001165501.
DR   EnsemblGenomes-Gn; EBG00001165502.
DR   EnsemblGenomes-Gn; EBG00001165503.
DR   EnsemblGenomes-Gn; EBG00001165504.
DR   EnsemblGenomes-Gn; EBG00001165505.
DR   EnsemblGenomes-Gn; EBG00001165506.
DR   EnsemblGenomes-Gn; EBG00001165507.
DR   EnsemblGenomes-Gn; EBG00001165508.
DR   EnsemblGenomes-Gn; EBG00001165509.
DR   EnsemblGenomes-Gn; EBG00001165510.
DR   EnsemblGenomes-Gn; EBG00001165511.
DR   EnsemblGenomes-Gn; EBG00001165512.
DR   EnsemblGenomes-Gn; EBG00001165513.
DR   EnsemblGenomes-Gn; EBG00001165514.
DR   EnsemblGenomes-Gn; EBG00001165515.
DR   EnsemblGenomes-Gn; EBG00001165516.
DR   EnsemblGenomes-Gn; EBG00001165517.
DR   EnsemblGenomes-Gn; EBG00001165518.
DR   EnsemblGenomes-Gn; EBG00001165519.
DR   EnsemblGenomes-Gn; EBG00001165520.
DR   EnsemblGenomes-Gn; EBG00001165521.
DR   EnsemblGenomes-Gn; EBG00001165522.
DR   EnsemblGenomes-Gn; EBG00001165523.
DR   EnsemblGenomes-Gn; EBG00001165524.
DR   EnsemblGenomes-Gn; EBG00001165525.
DR   EnsemblGenomes-Gn; EBG00001165526.
DR   EnsemblGenomes-Gn; EBG00001165527.
DR   EnsemblGenomes-Gn; EBG00001165528.
DR   EnsemblGenomes-Gn; EBG00001165529.
DR   EnsemblGenomes-Gn; EBG00001165530.
DR   EnsemblGenomes-Gn; EBG00001165531.
DR   EnsemblGenomes-Gn; lmo4a_rRNA01.
DR   EnsemblGenomes-Gn; lmo4a_rRNA02.
DR   EnsemblGenomes-Gn; lmo4a_rRNA03.
DR   EnsemblGenomes-Gn; lmo4a_rRNA04.
DR   EnsemblGenomes-Gn; lmo4a_rRNA05.
DR   EnsemblGenomes-Gn; lmo4a_rRNA06.
DR   EnsemblGenomes-Gn; lmo4a_rRNA07.
DR   EnsemblGenomes-Gn; lmo4a_rRNA08.
DR   EnsemblGenomes-Gn; lmo4a_rRNA09.
DR   EnsemblGenomes-Gn; lmo4a_rRNA10.
DR   EnsemblGenomes-Gn; lmo4a_rRNA11.
DR   EnsemblGenomes-Gn; lmo4a_rRNA12.
DR   EnsemblGenomes-Gn; lmo4a_rRNA13.
DR   EnsemblGenomes-Gn; lmo4a_rRNA14.
DR   EnsemblGenomes-Gn; lmo4a_rRNA15.
DR   EnsemblGenomes-Gn; lmo4a_rRNA16.
DR   EnsemblGenomes-Gn; lmo4a_rRNA17.
DR   EnsemblGenomes-Gn; lmo4a_rRNA18.
DR   EnsemblGenomes-Gn; lmo4a_tRNA01.
DR   EnsemblGenomes-Gn; lmo4a_tRNA02.
DR   EnsemblGenomes-Gn; lmo4a_tRNA03.
DR   EnsemblGenomes-Gn; lmo4a_tRNA04.
DR   EnsemblGenomes-Gn; lmo4a_tRNA05.
DR   EnsemblGenomes-Gn; lmo4a_tRNA06.
DR   EnsemblGenomes-Gn; lmo4a_tRNA07.
DR   EnsemblGenomes-Gn; lmo4a_tRNA08.
DR   EnsemblGenomes-Gn; lmo4a_tRNA09.
DR   EnsemblGenomes-Gn; lmo4a_tRNA10.
DR   EnsemblGenomes-Gn; lmo4a_tRNA11.
DR   EnsemblGenomes-Gn; lmo4a_tRNA12.
DR   EnsemblGenomes-Gn; lmo4a_tRNA13.
DR   EnsemblGenomes-Gn; lmo4a_tRNA14.
DR   EnsemblGenomes-Gn; lmo4a_tRNA15.
DR   EnsemblGenomes-Gn; lmo4a_tRNA16.
DR   EnsemblGenomes-Gn; lmo4a_tRNA17.
DR   EnsemblGenomes-Gn; lmo4a_tRNA18.
DR   EnsemblGenomes-Gn; lmo4a_tRNA19.
DR   EnsemblGenomes-Gn; lmo4a_tRNA20.
DR   EnsemblGenomes-Gn; lmo4a_tRNA21.
DR   EnsemblGenomes-Gn; lmo4a_tRNA22.
DR   EnsemblGenomes-Gn; lmo4a_tRNA23.
DR   EnsemblGenomes-Gn; lmo4a_tRNA24.
DR   EnsemblGenomes-Gn; lmo4a_tRNA25.
DR   EnsemblGenomes-Gn; lmo4a_tRNA26.
DR   EnsemblGenomes-Gn; lmo4a_tRNA27.
DR   EnsemblGenomes-Gn; lmo4a_tRNA28.
DR   EnsemblGenomes-Gn; lmo4a_tRNA29.
DR   EnsemblGenomes-Gn; lmo4a_tRNA30.
DR   EnsemblGenomes-Gn; lmo4a_tRNA31.
DR   EnsemblGenomes-Gn; lmo4a_tRNA32.
DR   EnsemblGenomes-Gn; lmo4a_tRNA33.
DR   EnsemblGenomes-Gn; lmo4a_tRNA34.
DR   EnsemblGenomes-Gn; lmo4a_tRNA35.
DR   EnsemblGenomes-Gn; lmo4a_tRNA36.
DR   EnsemblGenomes-Gn; lmo4a_tRNA37.
DR   EnsemblGenomes-Gn; lmo4a_tRNA38.
DR   EnsemblGenomes-Gn; lmo4a_tRNA39.
DR   EnsemblGenomes-Gn; lmo4a_tRNA40.
DR   EnsemblGenomes-Gn; lmo4a_tRNA41.
DR   EnsemblGenomes-Gn; lmo4a_tRNA42.
DR   EnsemblGenomes-Gn; lmo4a_tRNA43.
DR   EnsemblGenomes-Gn; lmo4a_tRNA44.
DR   EnsemblGenomes-Gn; lmo4a_tRNA45.
DR   EnsemblGenomes-Gn; lmo4a_tRNA46.
DR   EnsemblGenomes-Gn; lmo4a_tRNA47.
DR   EnsemblGenomes-Gn; lmo4a_tRNA48.
DR   EnsemblGenomes-Gn; lmo4a_tRNA49.
DR   EnsemblGenomes-Gn; lmo4a_tRNA50.
DR   EnsemblGenomes-Gn; lmo4a_tRNA51.
DR   EnsemblGenomes-Gn; lmo4a_tRNA52.
DR   EnsemblGenomes-Gn; lmo4a_tRNA53.
DR   EnsemblGenomes-Gn; lmo4a_tRNA54.
DR   EnsemblGenomes-Gn; lmo4a_tRNA55.
DR   EnsemblGenomes-Gn; lmo4a_tRNA56.
DR   EnsemblGenomes-Gn; lmo4a_tRNA57.
DR   EnsemblGenomes-Gn; lmo4a_tRNA58.
DR   EnsemblGenomes-Gn; lmo4a_tRNA59.
DR   EnsemblGenomes-Gn; lmo4a_tRNA60.
DR   EnsemblGenomes-Gn; lmo4a_tRNA61.
DR   EnsemblGenomes-Gn; lmo4a_tRNA62.
DR   EnsemblGenomes-Gn; lmo4a_tRNA63.
DR   EnsemblGenomes-Gn; lmo4a_tRNA64.
DR   EnsemblGenomes-Gn; lmo4a_tRNA65.
DR   EnsemblGenomes-Gn; lmo4a_tRNA66.
DR   EnsemblGenomes-Gn; lmo4a_tRNA67.
DR   EnsemblGenomes-Tr; EBT00001732168.
DR   EnsemblGenomes-Tr; EBT00001732170.
DR   EnsemblGenomes-Tr; EBT00001732171.
DR   EnsemblGenomes-Tr; EBT00001732173.
DR   EnsemblGenomes-Tr; EBT00001732175.
DR   EnsemblGenomes-Tr; EBT00001732176.
DR   EnsemblGenomes-Tr; EBT00001732179.
DR   EnsemblGenomes-Tr; EBT00001732182.
DR   EnsemblGenomes-Tr; EBT00001732184.
DR   EnsemblGenomes-Tr; EBT00001732186.
DR   EnsemblGenomes-Tr; EBT00001732188.
DR   EnsemblGenomes-Tr; EBT00001732191.
DR   EnsemblGenomes-Tr; EBT00001732193.
DR   EnsemblGenomes-Tr; EBT00001732195.
DR   EnsemblGenomes-Tr; EBT00001732197.
DR   EnsemblGenomes-Tr; EBT00001732198.
DR   EnsemblGenomes-Tr; EBT00001732200.
DR   EnsemblGenomes-Tr; EBT00001732202.
DR   EnsemblGenomes-Tr; EBT00001732204.
DR   EnsemblGenomes-Tr; EBT00001732205.
DR   EnsemblGenomes-Tr; EBT00001732206.
DR   EnsemblGenomes-Tr; EBT00001732207.
DR   EnsemblGenomes-Tr; EBT00001732209.
DR   EnsemblGenomes-Tr; EBT00001732211.
DR   EnsemblGenomes-Tr; EBT00001732212.
DR   EnsemblGenomes-Tr; EBT00001732213.
DR   EnsemblGenomes-Tr; EBT00001732215.
DR   EnsemblGenomes-Tr; EBT00001732216.
DR   EnsemblGenomes-Tr; EBT00001732218.
DR   EnsemblGenomes-Tr; EBT00001732219.
DR   EnsemblGenomes-Tr; EBT00001732220.
DR   EnsemblGenomes-Tr; EBT00001732222.
DR   EnsemblGenomes-Tr; EBT00001732224.
DR   EnsemblGenomes-Tr; EBT00001732226.
DR   EnsemblGenomes-Tr; EBT00001732228.
DR   EnsemblGenomes-Tr; EBT00001732230.
DR   EnsemblGenomes-Tr; EBT00001732231.
DR   EnsemblGenomes-Tr; EBT00001732232.
DR   EnsemblGenomes-Tr; EBT00001732233.
DR   EnsemblGenomes-Tr; EBT00001732234.
DR   EnsemblGenomes-Tr; EBT00001732235.
DR   EnsemblGenomes-Tr; EBT00001732236.
DR   EnsemblGenomes-Tr; EBT00001732237.
DR   EnsemblGenomes-Tr; EBT00001732238.
DR   EnsemblGenomes-Tr; EBT00001732239.
DR   EnsemblGenomes-Tr; EBT00001732240.
DR   EnsemblGenomes-Tr; EBT00001732241.
DR   EnsemblGenomes-Tr; EBT00001732242.
DR   EnsemblGenomes-Tr; EBT00001732243.
DR   EnsemblGenomes-Tr; EBT00001732244.
DR   EnsemblGenomes-Tr; EBT00001732245.
DR   EnsemblGenomes-Tr; EBT00001732246.
DR   EnsemblGenomes-Tr; EBT00001732247.
DR   EnsemblGenomes-Tr; EBT00001732248.
DR   EnsemblGenomes-Tr; EBT00001732249.
DR   EnsemblGenomes-Tr; EBT00001732250.
DR   EnsemblGenomes-Tr; EBT00001732251.
DR   EnsemblGenomes-Tr; EBT00001732252.
DR   EnsemblGenomes-Tr; EBT00001732253.
DR   EnsemblGenomes-Tr; EBT00001732254.
DR   EnsemblGenomes-Tr; EBT00001732255.
DR   EnsemblGenomes-Tr; EBT00001732256.
DR   EnsemblGenomes-Tr; EBT00001732257.
DR   EnsemblGenomes-Tr; EBT00001732258.
DR   EnsemblGenomes-Tr; EBT00001732259.
DR   EnsemblGenomes-Tr; EBT00001732260.
DR   EnsemblGenomes-Tr; EBT00001732261.
DR   EnsemblGenomes-Tr; EBT00001732262.
DR   EnsemblGenomes-Tr; EBT00001732263.
DR   EnsemblGenomes-Tr; EBT00001732264.
DR   EnsemblGenomes-Tr; EBT00001732265.
DR   EnsemblGenomes-Tr; EBT00001732266.
DR   EnsemblGenomes-Tr; EBT00001732267.
DR   EnsemblGenomes-Tr; EBT00001732268.
DR   EnsemblGenomes-Tr; EBT00001732269.
DR   EnsemblGenomes-Tr; EBT00001732270.
DR   EnsemblGenomes-Tr; EBT00001732271.
DR   EnsemblGenomes-Tr; EBT00001732272.
DR   EnsemblGenomes-Tr; EBT00001732273.
DR   EnsemblGenomes-Tr; EBT00001732274.
DR   EnsemblGenomes-Tr; EBT00001732275.
DR   EnsemblGenomes-Tr; EBT00001732276.
DR   EnsemblGenomes-Tr; EBT00001732277.
DR   EnsemblGenomes-Tr; EBT00001732278.
DR   EnsemblGenomes-Tr; EBT00001732279.
DR   EnsemblGenomes-Tr; EBT00001732280.
DR   EnsemblGenomes-Tr; EBT00001732281.
DR   EnsemblGenomes-Tr; EBT00001732282.
DR   EnsemblGenomes-Tr; EBT00001732283.
DR   EnsemblGenomes-Tr; EBT00001732284.
DR   EnsemblGenomes-Tr; EBT00001732285.
DR   EnsemblGenomes-Tr; EBT00001732286.
DR   EnsemblGenomes-Tr; EBT00001732287.
DR   EnsemblGenomes-Tr; EBT00001732288.
DR   EnsemblGenomes-Tr; EBT00001732289.
DR   EnsemblGenomes-Tr; EBT00001732290.
DR   EnsemblGenomes-Tr; EBT00001732291.
DR   EnsemblGenomes-Tr; EBT00001732292.
DR   EnsemblGenomes-Tr; EBT00001732293.
DR   EnsemblGenomes-Tr; EBT00001732294.
DR   EnsemblGenomes-Tr; EBT00001732295.
DR   EnsemblGenomes-Tr; EBT00001732296.
DR   EnsemblGenomes-Tr; EBT00001732297.
DR   EnsemblGenomes-Tr; EBT00001732298.
DR   EnsemblGenomes-Tr; EBT00001732299.
DR   EnsemblGenomes-Tr; EBT00001732300.
DR   EnsemblGenomes-Tr; EBT00001732301.
DR   EnsemblGenomes-Tr; EBT00001732302.
DR   EnsemblGenomes-Tr; EBT00001732303.
DR   EnsemblGenomes-Tr; EBT00001732304.
DR   EnsemblGenomes-Tr; EBT00001732305.
DR   EnsemblGenomes-Tr; EBT00001732306.
DR   EnsemblGenomes-Tr; EBT00001732307.
DR   EnsemblGenomes-Tr; EBT00001732308.
DR   EnsemblGenomes-Tr; EBT00001732309.
DR   EnsemblGenomes-Tr; EBT00001732310.
DR   EnsemblGenomes-Tr; EBT00001732311.
DR   EnsemblGenomes-Tr; EBT00001732312.
DR   EnsemblGenomes-Tr; EBT00001732313.
DR   EnsemblGenomes-Tr; EBT00001732314.
DR   EnsemblGenomes-Tr; EBT00001732315.
DR   EnsemblGenomes-Tr; EBT00001732316.
DR   EnsemblGenomes-Tr; EBT00001732317.
DR   EnsemblGenomes-Tr; EBT00001732318.
DR   EnsemblGenomes-Tr; EBT00001732319.
DR   EnsemblGenomes-Tr; EBT00001732320.
DR   EnsemblGenomes-Tr; EBT00001732321.
DR   EnsemblGenomes-Tr; EBT00001732322.
DR   EnsemblGenomes-Tr; EBT00001732323.
DR   EnsemblGenomes-Tr; EBT00001732324.
DR   EnsemblGenomes-Tr; EBT00001732325.
DR   EnsemblGenomes-Tr; EBT00001732326.
DR   EnsemblGenomes-Tr; EBT00001732327.
DR   EnsemblGenomes-Tr; EBT00001732328.
DR   EnsemblGenomes-Tr; EBT00001732329.
DR   EnsemblGenomes-Tr; EBT00001732330.
DR   EnsemblGenomes-Tr; EBT00001732331.
DR   EnsemblGenomes-Tr; EBT00001732332.
DR   EnsemblGenomes-Tr; EBT00001732333.
DR   EnsemblGenomes-Tr; EBT00001732334.
DR   EnsemblGenomes-Tr; EBT00001732335.
DR   EnsemblGenomes-Tr; EBT00001732336.
DR   EnsemblGenomes-Tr; EBT00001732337.
DR   EnsemblGenomes-Tr; lmo4a_rRNA01-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA02-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA03-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA04-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA05-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA06-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA07-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA08-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA09-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA10-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA11-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA12-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA13-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA14-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA15-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA16-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA17-1.
DR   EnsemblGenomes-Tr; lmo4a_rRNA18-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA01-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA02-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA03-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA04-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA05-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA06-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA07-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA08-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA09-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA10-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA11-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA12-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA13-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA14-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA15-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA16-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA17-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA18-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA19-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA20-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA21-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA22-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA23-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA24-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA25-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA26-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA27-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA28-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA29-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA30-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA31-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA32-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA33-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA34-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA35-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA36-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA37-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA38-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA39-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA40-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA41-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA42-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA43-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA44-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA45-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA46-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA47-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA48-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA49-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA50-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA51-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA52-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA53-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA54-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA55-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA56-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA57-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA58-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA59-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA60-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA61-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA62-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA63-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA64-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA65-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA66-1.
DR   EnsemblGenomes-Tr; lmo4a_tRNA67-1.
DR   EuropePMC; PMC3298151; 22247147.
DR   EuropePMC; PMC3464598; 22530965.
DR   EuropePMC; PMC3556495; 23339658.
DR   EuropePMC; PMC4609684; 26311854.
DR   EuropePMC; PMC4725285; 26590286.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01462; rli26.
DR   RFAM; RF01463; rli27.
DR   RFAM; RF01465; rli31.
DR   RFAM; RF01466; rli34.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01469; rli33.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01473; rli41.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01479; rli48.
DR   RFAM; RF01480; rli52.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01484; rli59.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01486; rli62.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01488; rli49.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01493; rli37.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FM211688.
DR   SILVA-SSU; FM211688.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2979198
FT                   /organism="Listeria monocytogenes L99"
FT                   /strain="L99"
FT                   /mol_type="genomic DNA"
FT                   /serovar="4a"
FT                   /db_xref="taxon:563174"
FT   CDS_pept        319..1674
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="lmo4a_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82703"
FT                   /protein_id="CAR82703.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGIE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
FT   CDS_pept        1868..3013
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="lmo4a_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase sliding clamp subunit (PCNA homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82704"
FT                   /protein_id="CAR82704.1"
FT                   /translation="MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLT
FT                   GSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQT
FT                   NISSGQASFTLNGLDPMEYPKLPEVTDGKTIKIPINVLKNIVRQTVFAVSAIEVRPVLT
FT                   GVNWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKILDDASESI
FT                   EMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLL
FT                   ARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALR
FT                   AFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITPVRTY"
FT   CDS_pept        3121..4464
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0003"
FT                   /product="MATE efflux family protein"
FT                   /note="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82705"
FT                   /protein_id="CAR82705.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDYDRLKDVIATATYAVVFSAI
FT                   ILSVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFARQFLL
FT                   LFIDSSETEVINIGVSYLLIVSLFYVVVGILFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYVGLWWATPVAWITATMLGVWRYKSGAWQKKAVIRRK"
FT   CDS_pept        4630..4866
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82706"
FT                   /protein_id="CAR82706.1"
FT                   /translation="MGVKFLAETVKINSEFVTLGQLLQMIDVVSTGGMAKAYLSENTIY
FT                   INGEQDNRRGKKLRNGDVILVPGVGKVKIEQGK"
FT   CDS_pept        4870..5982
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="lmo4a_0005"
FT                   /product="DNA replication and repair protein"
FT                   /note="Recombinational DNA repair ATPase (RecF pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82707"
FT                   /protein_id="CAR82707.1"
FT                   /translation="MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLM
FT                   LALAKSHRTTNDKDFIMWEKEEAKMEGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKL
FT                   SQYVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQMQPIYLHNLSEYQRILQQRNQY
FT                   LKMLQMKRKVDPILLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQISRGLETLK
FT                   IEYKASVTLNGDDPEVWKADLLQKMESIKQREIDRGVTLIGPHRDDSLFYINGQNVQDF
FT                   GSQGQQRTTALSIKLAEIDLIHEETGEYPVLLLDDVLSELDDYRQSHLLGAIEGKVQTF
FT                   VTTTSTSGIDHGTLKQATTFYVEKGTVKKS"
FT   CDS_pept        6031..7971
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="lmo4a_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82708"
FT                   /protein_id="CAR82708.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQVEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWNTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
FT   CDS_pept        8066..10594
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="lmo4a_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82709"
FT                   /protein_id="CAR82709.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHNPEITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYHYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIETVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
FT   CDS_pept        10729..12243
FT                   /transl_table=11
FT                   /gene="cls-1"
FT                   /locus_tag="lmo4a_0008"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82710"
FT                   /protein_id="CAR82710.1"
FT                   /translation="MRKLIQFLFIAVVLFLVEYFLINQAAILFLVTSGLIQLCGLIIVI
FT                   RLLLFDQRNTSSKVAWIAVIFILPVLGTISYLVFGRNPATRKFSTAQVMEKAKLIHAIH
FT                   AIPNNTNEKLPRLSKRIAHLTSIEPIKGNKIEILTNGEETFPVLLDALRKAENHIHIQY
FT                   YIFKTDEISTEIRDILVEKAKAGVEVRFMFDGLGSSKLHKAFLAPLKEAGVSIHAFDPI
FT                   TSPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHIKITGQAVI
FT                   ELQESFLNDWVYMENRAGAADKFISESGLKQYFSPVDMGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNA
FT                   YVKTMIEAGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDES
FT                   EAMHHLKRDFEKDFEDSRLFTMKDMENKPLLTRIKEVLSSLLSPIL"
FT   CDS_pept        12259..12777
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="lmo4a_0009"
FT                   /product="spermidine N1-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82711"
FT                   /protein_id="CAR82711.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNLHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYREMDI"
FT   CDS_pept        12946..13887
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="lmo4a_0010"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="Homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82712"
FT                   /protein_id="CAR82712.1"
FT                   /translation="MILCGEHAVVYGEPAISVPFTQAVVTTNVENSTKTKFSSAFFSGD
FT                   LDDMPDFLAGIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY
FT                   FNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIMHFPKKITFV
FT                   VADTGVPSETRDAVKDVQVLYKKNQAKIGKIIHQLGDISREIKTHLEGDADTVKIGAAM
FT                   NKAQSYLETLTVSDSSLEKLIEVARSSGADGAKLTGGGRGGCIIAVAKNQEIAEQITKK
FT                   LHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
FT   CDS_pept        13844..14815
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="lmo4a_0011"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="Mevalonate pyrophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82713"
FT                   /protein_id="CAR82713.1"
FT                   /translation="MKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTV
FT                   EWDENLAQDTFILNNEQKTDAKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSAS
FT                   AFAALALAGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVP
FT                   FTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILD
FT                   EDFIKVGEITERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAG
FT                   PNVKVICERENENIVADKLSGLAKNVLICHAGKEASVVSDEK"
FT   CDS_pept        14793..15875
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0012"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="Mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82714"
FT                   /protein_id="CAR82714.1"
FT                   /translation="MLYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTL
FT                   EDSERNELWIPHYENPVSWPIGGELKPDGEHWTFTAEAINIATTFLKSEGIELSPVKMV
FT                   IETELIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSC
FT                   GDIASCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWT
FT                   GTPVSTGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSSIKENRR
FT                   ILQELGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNE
FT                   WEKLGIKHLPFHTGRVQITE"
FT   CDS_pept        16221..17327
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="lmo4a_0013"
FT                   /product="quinol oxidase AA3, subunit II"
FT                   /EC_number="1.9.3.-"
FT                   /note="Heme/copper-type cytochrome/quinol oxidases, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82715"
FT                   /protein_id="CAR82715.1"
FT                   /translation="MSKVLKSLLLTALLGVTGLISGCGDLTVLNPKGPVAKGQSDLIIY
FT                   SIIFMLVIVLTIFVLFTIMLVKYRERKDISNYEPDMHGSKKLEIFWTLIPVAIVIALAI
FT                   PTVKTIYAGEEAPKVTSHKDPIVIYATSADWKWIFSYPDESIETVNYVNIPTDRPVLFK
FT                   LTSADTMTSFWVPQLGGQKYAMSGMTMNLYLQADEVGTYKGRNANFNGEGFADQRFDVV
FT                   AQSEKDFKKWAKETKASSPVITQDIYDRLLIPGSSKKKTYSGTHLAFVDVAADPEYVFY
FT                   AYKRFGFEMTNPHNPNTKSTISDEPMLPVRPVTVTNPQFERHDMKPQIIKNGEGYHEDK
FT                   HREDEMKKMEEDIQTNEFNKKESDDAGK"
FT   CDS_pept        17346..19325
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="lmo4a_0014"
FT                   /product="quinol oxidase AA3, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="Heme/copper-type cytochrome/quinol oxidases, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82716"
FT                   /protein_id="CAR82716.1"
FT                   /translation="MKWNEFIVTGDPMILGAQISIVLVSIGVVALLTYTKKWKWLMKEW
FT                   ISSVDHKKIGIMYLLAAVLMFFRGGVDALMMRTQLALPDMKFLDAQHYNEVFSTHGTIM
FT                   ILFMAMPFIIGLMNIAVPLQIGARDVAFPFLNNLSFWTFFMGAMLFNLSFVIGGSPDAG
FT                   WTNYAPLATDFSAGYGINFYLLGVQIAGIGTLMTGINFFVTILRMRTKGMTLMKMPMFT
FT                   WSSLITSLIIIFAFPVLTVALALMSFDRLFGTAFFTLTNGGLPMMWANLFWVWGHPEVY
FT                   IVILPAFGIFSEIISTFSRKKLFGYPAMVAAMAVISLLSFLVWVHHFFTMGSGALVNSF
FT                   FSITTMMIAIPTGIKIFNWLFTMYKGRITFTTPMLWSLAFIPNFVVGGVTGVMLAMAAA
FT                   DYQYHNTYFLVSHFHYVLIAGTVFSCFAGLTYWYPKMVGYRLNEKIGKWFFWIFVVGFN
FT                   VCFFPQYFLGLDGMPRRIYTYVQGDGWTTLNFISTVGGFLMGVAFLVLCYNIYYSYKNS
FT                   KREVTGDPWDARTLEWATSSAVPPKYNFAVLPEWNDLDDFWNRKQKGDPYVNDKNYKPI
FT                   HMPSNTMVGFVMSVFFFIAGFGLVFYWYWMGIIGLVGILGCMIYRSFQNNDGYHVEVDE
FT                   IKATEEHNARELATGVKEGNPWNL"
FT   CDS_pept        19313..19924
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="lmo4a_0015"
FT                   /product="quinol oxidase AA3, subunit III"
FT                   /EC_number="1.9.3.-"
FT                   /note="Heme/copper-type cytochrome/quinol oxidase, subunit
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82717"
FT                   /protein_id="CAR82717.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
FT   CDS_pept        19926..20258
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="lmo4a_0016"
FT                   /product="quinol oxidase AA3, subunit IV"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82718"
FT                   /protein_id="CAR82718.1"
FT                   /translation="MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYSTLTT
FT                   NVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIG
FT                   HMNHLL"
FT   CDS_pept        20426..21859
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0017"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82719"
FT                   /protein_id="CAR82719.1"
FT                   /translation="MTESKFPKGFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGR
FT                   WEALFNPSKALATDYGFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGD
FT                   ETTPNEKGLAFYDAVFDECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFC
FT                   EAIFTRYKDKVKYWMTFNEINMILHLPYIGGGLDVTKEANPEEVKYQAAHHQLVASALA
FT                   TKLGHEINPENQIGCMLAAGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTK
FT                   RFFKEHNINIKMEDGDLDALRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNP
FT                   YLKASEWGWQIDPLGLRITMNTIYDRYQKPLFIVENGLGAVDTVAEDGSITDDYRIDYM
FT                   REHVREMGEAIEDGVELLGYTPWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSK
FT                   KKSFDWYKKVIETNGKDID"
FT   CDS_pept        complement(21905..22726)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82720"
FT                   /protein_id="CAR82720.1"
FT                   /translation="MGTFFSKWGKWILVIALVFSVFSVSTAGQAAAKETVINKQMVTTA
FT                   SLNVRSTNATSGKVIGWLKTNTKFKAIAKTSNNWYRFSFKGKNGYVSGKYIKAATTAPA
FT                   PKPSTPKIVQMNVPLIVQRPQLPTGCEITNIAMMLRYAGKNVDKVKLAKEMKRHKSNPN
FT                   YGFVGNPFSKSGWTIYPPALVNQVKKYTGTAKNMTGTNLGGIKNQLNKKRPVVAWVSNF
FT                   HGFSVHAITITGYDKNNFYYNDSWSGQKNARISQSYFNTCWSKQAKRAISY"
FT   CDS_pept        22968..23708
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0019"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82721"
FT                   /protein_id="CAR82721.1"
FT                   /translation="MAEPKYAIIINDIKRLISDGTFKPGEKIYSEDELKKKYNVSNTTV
FT                   VRALHELVRAGILARYQGKGTYVSKSIINEEVIFNEYTTVPNGKFNRKTKIANEHTRVV
FT                   AINEIQDARIAKNLQIPPENMIVHFQRIRLIDDVPWTVQNNYMAKSNLINVDLTNLERF
FT                   NSLSEVIKELYGINILHEAMKERIQVEFPVKDKNNFKLLEIDTELPLYHIERITYVPEG
FT                   QPYEYIESYLRHNFYSIEIEKKKQ"
FT   CDS_pept        23724..24125
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0020"
FT                   /product="PTS system, fructose-specific, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system, mannose/fructose-specific
FT                   component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82722"
FT                   /protein_id="CAR82722.1"
FT                   /translation="MNFIIAAHGRYAQEVKNSCQMITGQTTNISAITFTEEMGVTDVLD
FT                   AYTAVYSPDNETVIIVDIVGGTPCNAAQMFSAKHPEVKVISGLSLGLIIPLSLGESLEG
FT                   AMLGAKENTQFVELKASHTIVSDDGEEED"
FT   CDS_pept        24125..24613
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0021"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82723"
FT                   /protein_id="CAR82723.1"
FT                   /translation="MGSNGIKHVRVDERLIHGQVATMWTNTIKATRIMIVDDAVVKNDM
FT                   EKVALKTAVPAGVKLSILTVKGAANNINNDKYAGQQVFLIVKSPHALRGLVDADVELPQ
FT                   INVGNMSTKAGSRQIKKSVSVTDENLEDFDYLLQKGIKITAQMVPSEDAVEFASLLKK"
FT   CDS_pept        24636..25439
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0022"
FT                   /product="PTS system, mannose-specific, IIC component,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82724"
FT                   /protein_id="CAR82724.1"
FT                   /translation="MDLAVWQIILLVILAACTILDALTLVIGLNFPVITGTLAGIIMGD
FT                   MVLGLAIGATLQLMVLGVGTYGGASIPDFTTGAIVGTVFAVLSGQDAEFAIGLAIPVGL
FT                   LMVQLDILARFTNTFFLHRIDSNIASGNISAVKRNIWYGALPWALSRAVPVFIMLTFGQ
FT                   SVVDFILNEIPEWLMGGLRVAGGILPVVGIAILLRYLPTNKFVAYLIIGFVAAAYLKVP
FT                   MLGVALIGVALAIIYFKQNFKNPVAAGANGAALVGEENEDGEYED"
FT   CDS_pept        25420..26241
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0023"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82725"
FT                   /protein_id="CAR82725.1"
FT                   /translation="MANTKTEQDFEKVLKRRDLIAANFRWLFASQICWNYERMMSTGYL
FT                   YSILPTLRKLYKTDDDLKDMMNMHNQFFNTNPMVGGLILGMDMAIEEREKKASKEVVTG
FT                   LKTGLMGPFAGVGDTIFGVILPTIFGSIAAYMGLQGNVTGVVIWVLVNILVVGARFTLL
FT                   PLGYKQGAKLVTEFADRLNALTDAAILLGVTVVGALIPTVIKATVPFVYKSGKVELKMQ
FT                   DMLDQIMPSLVPVLLVALIYALLGHKKMTSTKAILLVMVIAIILFNLKILG"
FT   CDS_pept        26269..26973
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82726"
FT                   /protein_id="CAR82726.1"
FT                   /translation="MGLTFFDKARELTEELEKSQAENIHQAAKLVAESIMNDGIIQAFG
FT                   SGHSYAAAIEVCGRAGGLIPSKVIMDPAGGYYESIEGVGSLLTHRLQAKPNDIFFLISN
FT                   SGRNPMGIELAEWIKAQGCKLIVVTALDASQTAASRHSSGKLLYEFADVILDNRSVQGD
FT                   AALELEGLEGKVCGTSSFSAVLLLQQTIYEAVELMLEKGYTPPVYRSANIDGGYEYNFA
FT                   IEDKFADRIFHL"
FT   CDS_pept        27029..27670
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0025"
FT                   /product="CutC family protein"
FT                   /note="Uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82727"
FT                   /protein_id="CAR82727.1"
FT                   /translation="MVLKEACIENITNLVNVIEAGANRVELCDNLAEGGTSVSYGVAKH
FT                   VVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMVDDILMYKKIAVDGVVFGCITDSGLL
FT                   DKPAIIELLKAAAGLEVTFHMAFDELVGTEKLPAIDWLAEHGVTRILTHGGDGAKLPEE
FT                   TFVHWRKYIDYAAGRIIILPGGGIKSHNMEWIIKETGAAEMHGTDLFGER"
FT   CDS_pept        27875..29776
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0026"
FT                   /product="PTS system, beta-glucoside-specific, IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82728"
FT                   /protein_id="CAR82728.1"
FT                   /translation="MKYEQLAKDILKNVGGKENINSVFHCITRLRFKLKDENSANTKEI
FT                   EKLDGVISVIKSGGQYQVVIGNHVPDVFKAVLEVGGISAEGDDSNAPASGNIFNRFIDM
FT                   ISGVFTPVLGVLAATGMIKGFTAMFAAFGWITVTSGTYQLLYAIGDCLFYFFPIFLGYT
FT                   AMKKFGGNIFIGMAIGASLVYPTLAGISAGDPIYTLFQGTIFESPIHVTFLGIPVILMS
FT                   YASSVIPIILATYFGSKVEKGFKKIIPDVIKTFVVPFCTLLVVVPLTFLVIGPIATWAG
FT                   QLLGAGTIWIYNLSPVVAGLILGGFWQVFVIFGLHWGLIPVAINNLTTLGADPVLAMMF
FT                   GASFAQIGAVLAVFFKTKNTKLKSLSIPAFISGIFGVTEPAIYGVTLPLKKPFIMSCIA
FT                   GAIGGGIIGFASAKVYIMGGLGIFGLPNFFQPGSGITSAFWWVVIAIVISFILGFILTY
FT                   VAGFKDPAEAVVEPSNTVEGETLIERETIPAPVVGEIVTLADVKDEAFSSGALGKGVAI
FT                   IPTVGRVVAPAAGTVTTIFPTGHAIGITTKDGAEVLIHIGMDTVQLEGKFFTAHVKQGD
FT                   VIEKGQLLTEFDIEGIKAAGYDVTTPVVVTNSNQYLDVMITDAKEAKLEERLITLVI"
FT   CDS_pept        29860..30735
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized proteins, homologs of microcin C7
FT                   resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82729"
FT                   /protein_id="CAR82729.1"
FT                   /translation="MLVKGDTVGIICCSDGRKKEAENRIALLERVLKTEFSLQVVFAET
FT                   IFQKDESPFSGTPQDRAIELMKLYQRSDVQMIFDISGGDAANQVLPYLDFDIIRNAQKP
FT                   FVGYSDLTVILNAIYTKTEQRGYNYQLLHLVGKDSELQQSHFRKTFFENRVLISGEQLN
FT                   EFVWHDGEVIGGNIRCFLKLAGTNFMPDLTNKIILLESLGGKEAKIASYVAQLEQLGAF
FT                   SKCLGVIVGQHSEAEENGEYERIGRLYQQIGRNYKLPIFRTSEIGHSVDAKPCLIGAKV
FT                   NVSRETLTNF"
FT   CDS_pept        30970..31308
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82730"
FT                   /protein_id="CAR82730.1"
FT                   /translation="MKVEGLLGFLGAALGIGFSLMVLVIPDISQALEEESFFFYMLTIG
FT                   SLVLSGVGLAGSFVVSHKPRLGGAMMVAAAIGCTMSISIMFLLPIVLLAVGGLIALINY
FT                   EEAASVEE"
FT   CDS_pept        complement(31345..32154)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0029"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82731"
FT                   /protein_id="CAR82731.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFANLVHPKADVIASNGGVVAVSGEIIQQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVYYTKNPPYYFTDEEDKGRVNATKLVAIKTRETFLEHADQFINGIVIEEEDFDK
FT                   LAVLRSELEKLSDVSILSSHANNIEILPKDMDKKYAVKDLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTNANDADGIYHFLKKHLNR"
FT   CDS_pept        complement(32171..33226)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0030"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82732"
FT                   /protein_id="CAR82732.1"
FT                   /translation="MKKITIQEIAKLSGVSVSTVSRVLNNSPSVSAAKRQKIQAIIDEH
FT                   NYTPSVFARGMVNKQTKNIGVILPDISNPYFISLITQIQKFALDYMFSTILFNTMLAEP
FT                   NNKNNQHPLTEEDYLKIILEKQVDGLLILGGEIDKEIVSKEYITALNQLNKAIPVVVIG
FT                   SKIPELNCLFIERNLKKGVTTLVSHLTALGHKNIGFIGGEAGVKITTYRLESFKEAMAS
FT                   YQHPINDDWVVLSDYYTADGYAAMTQLLENSATFPSALVAINDNVAIGAIRAINDANLS
FT                   CPEDIAIVSCDQFMNGDYQTPRLTSMDQHNEYLGKMAILQLISAINGQVEPMIINHNPE
FT                   LIIRESCGSKL"
FT   CDS_pept        33428..34393
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0031"
FT                   /product="ROK family protein"
FT                   /note="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82733"
FT                   /protein_id="CAR82733.1"
FT                   /translation="MNIQESVIGIDLGGTKILIGEVTKDGEVLNSKSYPSNTENQTKAT
FT                   EVLLGALDDYTQNIGFIAEKQTSIGVGLVGRVDHKSGVWLEIEPGKTNPTPLADILEAK
FT                   TGLPVSLGNDVVCATMAEQQFGWGRETNDFIYLNIGTGLAAGFVVDGRVTQGGHFNAGE
FT                   IGHAVVDIHSDVRCGCGRCGCVERLASGLGIKEEALRHLKNYPTSVLAENQAELTGKLV
FT                   LHAAEQKDVLAEKIIDNATLQLANLIMNLVRTTDPECVILGGGVTQNEHFFQKILANLQ
FT                   SNTIRFVTKGVVRSKLEKDKVGLIGAAVIGMKLGNEGGKE"
FT   CDS_pept        34390..36792
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0032"
FT                   /product="glycosyl hydrolase, family 9"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82734"
FT                   /protein_id="CAR82734.1"
FT                   /translation="MKPSMERQIAQTGIIHRPLPIETEHALETLAKKKQVLSSRTLFSS
FT                   KQQVSLDFTHQGAGEFAISEQGEIKLASPVDMPHWPAGAPDDGDYTNFGNVTISTSLEN
FT                   EDWSGFNRVRIQVFPYFPGVTNPYLMISFKNDGTVKVPDIYGREGVHGVNLINHEWNDV
FT                   IFEIEGLPRDRMTEMSFSYYLNGPERLTAGTMELFINEIKLEQISEPEISKGWIPQNNT
FT                   LIYSHNGYSKDMPKVAFCANNHAASTFTIHEKETDKVVFTGKSYQNTTETGNFIILDFS
FT                   DLQTVGKYYLKFADMQSETFQIGTSEVIWESSIWKSLNFIFCERCGCPVFGKHTTCHAD
FT                   IIAEHDGKQLSFNGGWHDAGDVSQQLIQTAEVTMALYEMAASLPDKEEALRMRLLEEGE
FT                   WGLDFILKTRFGDGFRATSAGMTRWTDGLVGGMDDAIARVHNQAYENFYCAGIEAYIGS
FT                   QITDNATMQNHLLRIAEEDLLFAIEELEKHGTSQKPIFWEHTYQTSESLYYATASWAAS
FT                   MVYQLTDKEIYAEKAAEWLDLMLEAQETAGVKDSETSELYKGFFYRDKTHKVIQHFNHQ
FT                   AREHLYLLALEAALETQPAHSEKQTWKQSVEMYGDYLKKVTRFTKPYPLIPAGLYKKDE
FT                   YLDEASFHLQHLLIDERAIEEYQLQFEQGIKINDEIALRKFPIWFSFRGNNAILLSAGK
FT                   AASIAGKILQDKALLDIAEGQLQWVIGMNPFGQSMMHGEGYRYAQQYSVLNGEITGEIP
FT                   VGMETFRNEDEPYWPEFNNATYKEVWVGNAGKWMSIVAGLNKITGKS"
FT   CDS_pept        36805..38163
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0033"
FT                   /product="PTS system, beta-glucoside-specific, IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82735"
FT                   /protein_id="CAR82735.1"
FT                   /translation="MSSERSLSSRFIEGLSIFAQKISSQKHIMAIRDGFAAMIPITIIA
FT                   AFFLLVNNVLLQPENGLLKFIPNVENYLGVGIQVYNATLGIMAILAAFLIGNFLAKSYG
FT                   MEGRTEGVIAVAAYVVLIPASSHLMSVDGKAFEAGGVLTQEMTSSTGMFLAIIAALVSV
FT                   TMLAKFSKSKKLKISMPESVPPAIAKSFNILIPSFLVLSILAIIEVLVVSFVSMSIPEI
FT                   IVKVLQIPLVGGFQTLPGILLYVFLAGFLWVFGIHGAFVLGAISGPVLLTSLQQNIDAV
FT                   NASTALPNIVTQPFLDAFVYMGGGGTIICLVIAIFIASKRPDHRMVTKFGLIPSIFNVS
FT                   EPLMFGLPVVFNPIYGIPLVIAPLASTAMAYFATSWGWISQTYILIPWVTPPVLSGYLA
FT                   TGGDIRASILQIAIIIVGTLIYLPFVLVANRAYVLEQKAAGKVEAETVTNGEV"
FT   CDS_pept        38165..39250
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0034"
FT                   /product="SIS domain protein"
FT                   /note="Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82736"
FT                   /protein_id="CAR82736.1"
FT                   /translation="MKPTMMTYINEEEEMCRAILADFQTNAEKLESLVKNGAKEWLILA
FT                   TGSSLNAAQSAKYYIENLADVRITIEEPFNHLYYEKLSSHLDLVIGISQSGQSTSTISA
FT                   LERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLAGL
FT                   HFAYKTAQIDETRFNDEINAFSRATDAIPETIAKTEAFYEKWQEEFAAAPKFTAIGYGP
FT                   TVGTCKEFETKFSETVRVPSQGLDLEAFMHGPYLEVNPQHRIFFLETKSEVTERLVLLR
FT                   DYESKYTPFTYTVKFGTTENERTLGIPADLDEFQAPFLMILPFQILAHHIAELKGNKLT
FT                   ERIYTDFGVAMKSKTKPGDYA"
FT   CDS_pept        39439..40098
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0035"
FT                   /product="DedA family protein"
FT                   /note="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82737"
FT                   /protein_id="CAR82737.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
FT   CDS_pept        40182..41408
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="lmo4a_0036"
FT                   /EC_number="3.5.3.6"
FT                   /note="Arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82738"
FT                   /protein_id="CAR82738.1"
FT                   /translation="MEKALNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIPYL
FT                   KMMQKEHDFFVKTMQGSNIEVLYLEKLAAEALRAANNKESFLTKIIKESNQMDESALYV
FT                   RDYLMSFDEEEMISKLMSGLKKSEIPERKKKHLNEMMDEQYPFFLDPLPNLYFTRDPAA
FT                   VIGNGVTINKMFQPARRRESMFIELILKHHPRFSNQEIPVWSGREEPFSLEGGDELVLT
FT                   EETILVGVSERTDARAVERLAESLFSRSPKIKRVLAVEIPETRSFMHLDTVFTMVNYAQ
FT                   FTIHPAIQNQQGELNIYILEKSENGLDITPRRDFKRVIAEVLGEPEVDFIPCGGEDVIV
FT                   SAREQWNDGANTLAIAPGEVITYDRNQVSNDLLRSAGIKVHEVISSELSRGRGGPRCMT
FT                   MPLSRENLK"
FT   CDS_pept        41687..41980
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="lmo4a_0037"
FT                   /note="Ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82739"
FT                   /protein_id="CAR82739.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
FT   CDS_pept        42036..42572
FT                   /transl_table=11
FT                   /gene="ssb-1"
FT                   /locus_tag="lmo4a_0038"
FT                   /product="single-strand binding protein"
FT                   /note="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82740"
FT                   /protein_id="CAR82740.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
FT   CDS_pept        42616..42855
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="lmo4a_0039"
FT                   /note="Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82741"
FT                   /protein_id="CAR82741.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
FT   CDS_pept        43008..43619
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0040"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82742"
FT                   /protein_id="CAR82742.1"
FT                   /translation="MYKKLATVGVAVLLVGALSACSFNDDKDTSSNNSKNETTSSKSSN
FT                   NESSSDSLQNKSFDMSYEDAINAFKDKHSDAEISSVELEKSLGKYVYKVDGISNDNEYE
FT                   MKFDAETKEQLSDETDRLDREDAGGVEKENEKIDLNGIKTPKEAMDKAVSEQSGDVTSW
FT                   KIERELDTTYYEVTVKQDNNKYEIKLNAKTLDVLQTEQDD"
FT   CDS_pept        43877..44491
FT                   /transl_table=11
FT                   /gene="agrB"
FT                   /locus_tag="lmo4a_0041"
FT                   /product="accessory gene regulator protein B"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82743"
FT                   /protein_id="CAR82743.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLMMFVLAPFVF
FT                   QNVPSNNWIVLGTFAFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMIGSLFQVISINPLTYKLLRRRYRNYEKYE"
FT   CDS_pept        44475..44636
FT                   /transl_table=11
FT                   /gene="agrD"
FT                   /locus_tag="lmo4a_0042"
FT                   /product="accessory gene regulator protein D"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82744"
FT                   /protein_id="CAR82744.1"
FT                   /translation="MKNMNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVK
FT                   MQEKNENK"
FT   CDS_pept        44732..46027
FT                   /transl_table=11
FT                   /gene="agrC"
FT                   /locus_tag="lmo4a_0043"
FT                   /product="accessory gene regulator protein C"
FT                   /EC_number="2.7.3.-"
FT                   /note="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82745"
FT                   /protein_id="CAR82745.1"
FT                   /translation="MFSILMAIIQITGIFIAIQILTNRVFSIKEGLVTIAIAMLAFPLF
FT                   TLVQYWSMIFVLLVFVSALYWKNKNLIVSGSITLVVIILLTISDSIVGFILVPGLNFKY
FT                   DDIFNELLPTLVYCAGMLTNLLVLSFLLRKLTEKIDITRFIEHRKYAYIIFSIVALTVL
FT                   AFYMNIYAGSIAGFDGSVLKINTLIFTGYTILLIVIVTVVINTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDMPGLKYYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKISMDSIDLCKVVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSIIIVFANSLPVNMPPIYKIFEEGFSTKGEGRGLG
FT                   LASLREIMKKYSHVALDTKVTDREVIQELEIM"
FT   CDS_pept        46046..46690
FT                   /transl_table=11
FT                   /gene="agrA"
FT                   /locus_tag="lmo4a_0044"
FT                   /product="accessory gene regulator protein A"
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82746"
FT                   /protein_id="CAR82746.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDMLHDRVLSCMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKIFTN"
FT   CDS_pept        46940..48913
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0045"
FT                   /product="DHH subfamily 1 protein"
FT                   /note="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82747"
FT                   /protein_id="CAR82747.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATIILSVITFFFSWWLSALVVVGGII
FT                   LTVAMFYFEYRLNEDVQLYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDEKGIMSIAWRDHRFDTIVKRKERILYLYDRT
FT                   EYYDLNKKFQANKSVFAVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEDDLIQLAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDSATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
FT   CDS_pept        48916..49362
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="lmo4a_0046"
FT                   /note="Ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82748"
FT                   /protein_id="CAR82748.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQALEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
FT   CDS_pept        49387..50739
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="lmo4a_0047"
FT                   /EC_number="3.6.1.-"
FT                   /note="Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82749"
FT                   /protein_id="CAR82749.1"
FT                   /translation="MDNNFQDRTPPQNIEAEQAVLGAIFLEPNALITASEILMPDDFYR
FT                   TGHQIIFETMLDLNDHGKAVDVLTVYEALAAKGNLEDAGGLPYLTELSGAVPTAANLEY
FT                   YAHIIEDKALLRRLIRTATQIATDGYSREDELDMLMDEAEKSILEVSQRKNVGAFKNIK
FT                   DVLVKTYDDIEILHNRKGDITGIPTGFNELDKMTAGFQRNDLIIVAARPSVGKTAFALN
FT                   IAQNVATKTDENVAIFSLEMGAEQLVMRMLCAEGNINAQNLRTGALTSDDWQKLTIAMG
FT                   TLSNSGIYIDDTPGVRVNEIRSKCRRLKQETGLGMIVIDYLQLIAGSGRGGENRQQEVS
FT                   EISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRE
FT                   DYYDREGENDGTIEIIIAKQRNGPVGDVKLAFVKEYNKFVNLEVRYDDAMA"
FT   CDS_pept        50795..50944
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82750"
FT                   /protein_id="CAR82750.1"
FT                   /translation="MQKGNVLLLMDFEIPVKGLKKRTIKLPYKSMFVNPLTILVANGTM
FT                   YSGK"
FT   CDS_pept        50998..52290
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="lmo4a_0049"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82751"
FT                   /protein_id="CAR82751.1"
FT                   /translation="MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKF
FT                   DGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHI
FT                   ILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHN
FT                   LGEKNRLLERFYELEGFKLEDILEEYYDYGQQFKEYVCDTSVVLNDALDDGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTEL
FT                   FDSIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETL
FT                   KICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMER
FT                   IAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA"
FT   CDS_pept        52595..52888
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82752"
FT                   /protein_id="CAR82752.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQDQLRSEWE
FT                   GQAFVRFDEQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
FT   CDS_pept        53039..56254
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0051"
FT                   /product="membrane protein, putative"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82753"
FT                   /protein_id="CAR82753.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKAHKM
FT                   TIALVNEDQGDTFQGKKVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSNYTKQFKTVQDYTGASKESFQGFQ
FT                   EIMKEFEESLNVSKQENAEHMKNMDGFTKTQEENAPFGVKFTENLSNFDGTLSAEDIRT
FT                   QTAALEQANAKMTSEFQIIEDSNSLLSQTQALQNYIAETNARIEAVDAEIMGTLENDFR
FT                   TAVYNDLLRILRENEYSDKLNEIGLKDLTGEDLNAGFNKMLVKEIQALPTYNADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRSAFGDDFSFTNDPKTLPIDTLKSDTINRLKSEGVALE
FT                   SSSYTVAGSDYMTEIILTLDENFTFSDVDCMVNGNSNTGLVQQTAYGENGIKLHIPALG
FT                   STAIDIKITGRAKLREGANVPLVGAVNWSATLQQYEKKEYSQMPTVPSGLDPDPVQPVS
FT                   SLVVRKEPVPIKVTAPSYLNETNSSVKAITNTVKDYYKLQALFDLYYGIDASDSAQIPD
FT                   FSDYQVTLENSAKPSSYYYIFNKEDIIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKSA
FT                   MAEANYRSEDVTNRLTETTQEAINLNTNLALTLQNLESWREASKGLIEENGVALEKSGE
FT                   EATMALQLSSEFAGILAKSESLAGTSEGNLKSAEVVYQTFEAIDKEAKNIQQSGETLVK
FT                   EASTLSDDLSEKLEDDETFQKNFAKVMKNSRVGDRQNENLYSFLSSPVDKMNAGTIVAG
FT                   DKSMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLTICVGII
FT                   EGLVIGAVSGFIFEVGEIGMFLWIGVCVLIMMALVTAFSYLLRQLNMIGMSLILLVLSL
FT                   YLFLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGATVLFT
FT                   GLNLFVWHRSKEEEVEEDNSDEI"
FT   CDS_pept        56244..56759
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0052"
FT                   /product="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82754"
FT                   /protein_id="CAR82754.1"
FT                   /translation="MKFKIAAFVLLLCFAFAPGVLAADSDSYLENNGKMDIKTDRLQKT
FT                   EEEKTKELEQMEETELDKNGIPLFTDEMDEKIAKQKAAEKAEYDRIKDSLFEEESTSGE
FT                   TVEKTKAKLFTGKYEATAVTTETPTNVETTIEDEMKKTKQKTVGGAIAGTLVALAGGIY
FT                   VAARNVFE"
FT   CDS_pept        56777..57028
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0053"
FT                   /product="EsaB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82755"
FT                   /protein_id="CAR82755.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKIE
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
FT   CDS_pept        57049..58245
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0054"
FT                   /product="EssB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82756"
FT                   /protein_id="CAR82756.1"
FT                   /translation="MNKTTEMDGTAYEFTYEDLVWSITFPKSKTHAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAPRTYGFEQVRKMGREDKLRALRNIADLSELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTIQDIAAILEEAYVKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVNGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTKLSGDEKVEKLKTLEESLKEYDEKVNEKTTTEDETTNTEAK"
FT   CDS_pept        58196..62749
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0055"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82757"
FT                   /protein_id="CAR82757.1"
FT                   /translation="MKKRQLKTKQQIQKQNKGEWTMNREALLIVSNGQQCHKHHLSPER
FT                   VVTIGNTIEHEITYPELAESIEVKYDEGSWNAETTALQANQAVNVENLAFYLCQDLYTQ
FT                   VYDVVTNISVTFGVGIENDVTLDDTKSDFILLRDTKEGLFKLQVLNGEIYHNFSLVTED
FT                   CTVEPGDQLYTDGVTITIGKEDISVLAVKNRVTSKLAPLFAADNSFGEDYPDYHRSPRI
FT                   IYRAPEEKISMAKPSSKPSKPTDGLIKIILPPLIMVAITVMISIFQPRGLYIIMTIAMS
FT                   AVTITMAILNYIKSRKKYKIDSKQRVESYDLYLKRKTKELHETSEKQRHALTYHYPDVT
FT                   ELEKMALRVDSRIYEKTMFHHDFLTFRVGRGDEASSFSVEFQQEEFSQEKDELVEEAVK
FT                   IKGQYLSINEVPVATDLMHGPVGYIGPRRLVLEQLQMLVMQTSLFHSYYDLQFITIFPE
FT                   EEKADWDWMRWLPHANMRDVNVRGFVYHERSRDQVLNSLYQILKERKQALTEQASKQEK
FT                   LYFTPHYVVLITDEKLVLDHTVMEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRD
FT                   AKSGNIILEQGDLVNRAFVPDHLPADFDKEVISRALAPLNHLQNLKNSIPESVTFLEMY
FT                   GVERVEELNIAGRWAKNETYKSLAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGK
FT                   SEIIQSYIISLGVNFHPYEVAFLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALA
FT                   SIKAELQKRQRLFGEHDVNHINQYQKLYKQGKATEPMPHLFLISDEFAELKSEQPEFMK
FT                   ELVSTARIGRSLGIHLILATQKPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAA
FT                   EITLPGRSYLQVGNNEIYELFQSAWSGADYVPDKESTDYIDTTIYAINDLGQYDILTED
FT                   LSGLDKKDDLTKLPSELDAVIDHIHEYTEASGIEALPRPWLPPLEERISLESISTVDFE
FT                   ANWQKDEKDLELTLGVLDQPQLQAQNVLHWNLEKNGHMAVFSSPGFGKSTFMQTAIFDL
FT                   ARKNTPEFFHAYLLDFGTNGLLSLKGLPHVADTFSIDETEKTLKLVRLLSREIKERKQL
FT                   LSKFSVASLKMYEEISGDKKPIILLAIDNYDAIREVDEFVANLEPTIVQIAREGASLGI
FT                   HLMITANNQNAMRLQLLSNIKTQIALHLNEKNEVSSIVGRSDYTIEELPGRGLIKIEEP
FT                   TLFQMALPNNGAEAIEIIKNNQDEAEKMTEIWTGQKPQCIPMVPETLGFTHFTDHMETK
FT                   KMLELKSILPIGLEYEYASPVGVSLEQHNLAIIMPTVELVQQIITNSSHLLVKKELREL
FT                   VVFDTPSMELMKLKELPLTYITNSERIEGKIDILYGAFKTAEQAYLEELQSNNTITKEE
FT                   YFKNVPPIVVVTYSTVQLYNQLSSNAQKQLLEMLKSDGKMGVQFIIGNDLGSMAKEYSP
FT                   IGDAIRNSKQVLLGARFADQAIYSPTIRIVQEKPLAPQELYLLLEGNAEKLKIPKG"
FT   CDS_pept        62775..63644
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0056"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82758"
FT                   /protein_id="CAR82758.1"
FT                   /translation="MKKKIIGLLASLLLLGGCFNMNEKTEQEKAQEGTTPVEDYVDQGY
FT                   SFVDGNKSAERVKKHEEEIKQVAIDYMKTKYKTDVKVNNVVPARNAAVVIVECEEPIQF
FT                   TTSVVVGLILNKDEVGSAHEEEGEVEQAIVGGLYAKAFEKEFRHLDDLTEKLAMKNDLV
FT                   GYNQEALDKTSPNGYQGKYYFVSLGFKEYLSVYNAYLNKQEISANELQALFRKDDPTGE
FT                   KMTIALRFFMKEDKLPIQDFVDNIAEELLQESNLPKATYLITIYKNSIVNRVGLPDGEN
FT                   TSTEIFIK"
FT   CDS_pept        63662..65650
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82759"
FT                   /protein_id="CAR82759.1"
FT                   /translation="MTTKMGTSDTDLIELSGKWVYRHPLRGNSLYVNGTLYEVKEGEYN
FT                   KSSGLDYMIVENTTTGEISMVFEGTQGTQDFLTDGTLPGSIPNTQLREADAAYKKESQK
FT                   YNIKNVAGNSLGGGLSNYVASKNDGIRSVTYNPAILPNGIYDKDNPRITNYLSEYDPLT
FT                   LGERGAGYGDRLPGESHILQNNVPWLQTILSNHTGYDDAGVTVNGKNIPIDADAYLPVG
FT                   IWSGKILTGGRKGQKIDMNPDNIRILANSLRTRMTEQISRGQFYLDTAVDLVNNEGSHL
FT                   DDRTVSLQKSFENLLGEGEFGGIITSLANYAEFRDGMEEANPVCFAALDVMQRVRTLPI
FT                   LGELLDVVSGTFLSVGGFLSDIPVLVGDLALKIEDTMDQVSKVKMQAVPELFKGIDNQY
FT                   LSDAMVAELKEHYKILDDNKDLVVKQVLTFSSQVTYVSNELEKADKLLSATQKVQSVGA
FT                   PPATQAYVLKESKALKDGMGKKQRLLDRNYKAFTNKTTSLLIPALSGVYSIVNQLKQAI
FT                   RSAIQHLKNLQSGFSMVKIPFTDADNQVREQISEYIRKLQEILLTVKGVGSAVKDLQSN
FT                   LPNVLAAYRPYIDTALFDGTKFRDVILLNKAAANIFRSAEMIFGDIKHQLSGNDSAAIS
FT                   ALDKLAVKTSKNMKILLEQIKRGSINV"
FT   CDS_pept        66052..66921
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0058"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82760"
FT                   /protein_id="CAR82760.1"
FT                   /translation="MKKIILSLFAAVFLLSGCFNMNEKTEQEKAQEGTTPVQDYVGQGF
FT                   SFVDGEKSAERVKEYEEEIKRKAIEYVQTKYKTKVKVNNVVPARNAAVVMIECEGPIQF
FT                   HTSVIVGESINKKGEWSARSNEGEVEQAIVSGLYKKAYETEFRNLDTFTEKLAKENDLL
FT                   GLRDEAIEKTSSSGYTSNHYFIAASSLSFPSVYQAYIENQRIASDELKLLFAKDDPEGN
FT                   ILSIPMEFYSKEDKLPDQKVADNLAERLKQEEGLPKGNYMVTVYKNFIVNRVGLPDGQN
FT                   IDVTDIIK"
FT   CDS_pept        66937..67263
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82761"
FT                   /protein_id="CAR82761.1"
FT                   /translation="MTAKVKTPDTDLIELSGKWVYKKPLKKERLNVNGTIYKVKEAECN
FT                   KSSGLDYMIVENTTTSEISMVFEGMQGTQDFLTDGTLPGSIPNTQLREADAAYKKESQK
FT                   YTIK"
FT   CDS_pept        67601..68374
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82762"
FT                   /protein_id="CAR82762.1"
FT                   /translation="MTKNFKKLKSLHELPTPLILYNCWDVASARAIQQGGAPVIATSSY
FT                   AIAESLGAVDGEHLTFDEMFLVISRIAENVSLPLTVDIETGYARNLEELAQNVERLLAI
FT                   GACGVNLEDQLIGDTNPGLCSSEEQCDKIKTIKETAAKMSTEIFINARTDVFFQGRDET
FT                   ADLVEEAISRANAYKEAGADAIFIPGLLSPKLIRAFVEKSPLPVNVMRIDGMLSNEELQ
FT                   KIGVKRISYGPFSFFQANLAIQQEVERIFEGGKAL"
FT   CDS_pept        68371..69423
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="lmo4a_0061"
FT                   /product="Ada regulatory protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="Adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82763"
FT                   /protein_id="CAR82763.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESGNGF
FT                   RDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDESLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTVIIQQIEAELARYFNGELIDFKTPIRYIGSDFQQSVWNELRRIPI
FT                   GETISYKGLAEKLGRPTASRAVARANGANQLSLIIPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPK"
FT   CDS_pept        complement(69445..70083)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0062"
FT                   /product="pentapeptide repeats domain protein"
FT                   /note="Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82764"
FT                   /protein_id="CAR82764.1"
FT                   /translation="MKKITAPRIPDGDLTVYPNDTYFIEDIGEVSEQIFRKTTLTGEIF
FT                   EHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGVN
FT                   FSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKA
FT                   QFLNCALNGVDLSSCIFESITAMPQDLKGVSIDFSHAPALMPLFGIRVK"
FT   CDS_pept        70214..71170
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0063"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="Lactate dehydrogenase and related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82765"
FT                   /protein_id="CAR82765.1"
FT                   /translation="MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELIKNVTEV
FT                   DAIICPLSSPISAKVLESAKNLTIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATA
FT                   ELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVA
FT                   KRAAAFGMNIIYSGHHPKEVAKEWNAEFVSQEDLLKRSDVVTIHAAYSPALKHLLNETT
FT                   LKTMKSSAFLINAARGPVVEEAALIKALEAGVIAGAALDVFEFEPKIGEDLAKLDNVVL
FT                   TPHIGNATVETRAAMGKIAIANVEAVLAGKAPLHSVY"
FT   tRNA            71258..71330
FT                   /locus_tag="lmo4a_tRNA01"
FT   CDS_pept        complement(71438..72616)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0064"
FT                   /product="integrase"
FT                   /note="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82766"
FT                   /protein_id="CAR82766.1"
FT                   /translation="MAKKKRYFGTIEKLKTGWRMRVTVGYNEKGTPIRVPRFTTTKNAA
FT                   QREKELAAFIDELEKTGYTAPSNLTFREFVETEWLVKHVPANLSYDTGHDYYEQIKRRI
FT                   YPVLGGVALSKITTLQIVNLIDDLQKSGKRLEDSDNKRGVKDKPLSAHSIRNIYYALSS
FT                   VLEVARKWRVISINPAKGVDLPSRKKRAHTIYQGESLEQMYEALKTEPLQFQVMIYIAV
FT                   VTGCREAELVALERKHIDELSNKILFEQTIIDVVGEGVRVVSDTKNSVFGKVDIPQWLT
FT                   DLIIQYLQDVEPGTGAWTGHHFLFADETGKPKRPDSVYQRWRRFMERHHLPRIRFHDLR
FT                   HTSATLLISQGEHIKVVQERLRHKSMITTADTYAHVLQETHKKAAESFKKPF"
FT   CDS_pept        complement(72699..73247)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0065"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82767"
FT                   /protein_id="CAR82767.1"
FT                   /translation="MKRMLTLAVLCIALVLTGCGTDSVKEDAKDTAGNKKNKVTAASTL
FT                   DSFVNADIPMYKNVVFTEETDPNELLGRPNSYIAKIDFNDKSAIDRIATKNIEDLGLEE
FT                   SDKGDQIQQLISDRTGGTIEEFKTEKDLQNRLEYLQDLPVKSNVDNEYRYSSGKVLLRI
FT                   DSALTPSEAERYEKAFLNQ"
FT   CDS_pept        complement(73267..73779)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82768"
FT                   /protein_id="CAR82768.1"
FT                   /translation="MYYMKHYKPTMTELRMSESMKKHGITKPTQLDTEKIQIAYNVLVM
FT                   EMDFPSAAFGAFGIVLSRGLRGEDYKNAFFHEFAHWLEHAGNQLQMTRQQKLMQEQQAE
FT                   QMSMYLRIPFHMLNTIDFSSEDCIIEISETFNVPLELAGRRLKKIKDNVLCHSNSEAYL
FT                   LRENKII"
FT   CDS_pept        complement(73803..74138)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0067"
FT                   /product="phage transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82769"
FT                   /protein_id="CAR82769.1"
FT                   /translation="MSTFDRIKKLAEEQKIPISELERKLGMGQNSLYKWKNQKPTIEKL
FT                   QKVADFFHVSVDYLLGRTNIKNQLDALDDAQFLDVDGLTAEDIAKVESVIAKLREAQRT
FT                   IDELENK"
FT   CDS_pept        74410..74613
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82770"
FT                   /protein_id="CAR82770.1"
FT                   /translation="MMPVHKLKELVKIALIRRGISQAELAKTIGISPTYLSDILNENRS
FT                   GKKVEDIKNQITKLLEIDKEVI"
FT   CDS_pept        75066..75332
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82771"
FT                   /protein_id="CAR82771.1"
FT                   /translation="MTGEELIKLDVLSEKLNNAKHELQAFRYASQTKNRKVLTKELAVL
FT                   FATKYGTWLITNTELAIQQSSRILELELLIEELKAELEVWKGE"
FT   CDS_pept        75338..75595
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82772"
FT                   /protein_id="CAR82772.1"
FT                   /translation="MAQTIANEYEEYITEKIRLSDNGIKLTAYSFKNSYQARVIEKLDS
FT                   NFVSLVLVKCDDGKKSIKDILLELTNEQLIEKLEEIKNYD"
FT   CDS_pept        75613..75951
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82773"
FT                   /protein_id="CAR82773.1"
FT                   /translation="MKNELDNVNPAHYRQGAMQTIDVMRAKLTTEEFRGYLKGCILKYV
FT                   TREKLKNGIEDLEKAQWYLDYLIAFDTNQPFKSHAEIQELLTQQDVLEAGLQDMQNRLT
FT                   REAGSENE"
FT   CDS_pept        75944..76174
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82774"
FT                   /protein_id="CAR82774.1"
FT                   /translation="MSESDAIQALVTISFALILLAIFCYWVGYSDAVKKLKGGGQIESM
FT                   KKARNEAATSKTSIQKLISKHSLTRLGAKSK"
FT   CDS_pept        76383..77135
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82775"
FT                   /protein_id="CAR82775.1"
FT                   /translation="MKLTFDIESVEDALELQRVLKVLMSGTEEGPTKLLAEPEAPVKVE
FT                   GLSEEEQEEQEEQEEQEEQEQEEQEEQEEQEEQEEQEQEEEEEEEEEEEEEEEEEEEQL
FT                   KLADVKRAVSRFEGGTKNVQVKFVMVTGFKVAALNKLKPADYKGFIEMLDEREKEFGLS
FT                   QVSKKEEVSENKPSKKTKPKKDESGEEEVTLDSLRVLVRPFVQAKKNKPVKRLLRNMFG
FT                   VEALAALEEEDYPAFAAEVKELKEELGL"
FT   CDS_pept        77137..78318
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0074"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82776"
FT                   /protein_id="CAR82776.1"
FT                   /translation="MPEIHAKLSASGSSRWLNCTPSIALEAKFPEQKNGGVFAQEGTLA
FT                   HSFAELLLQKFNDEVTKAGYARKLNRLKKNSLYDASMIDHVEVYTTIVIEKFQEAHAAD
FT                   KNAVLSIEQQLDYSDYARGGFGTGDAVIVGNGVVEIIDLKYGKGVPVSAEENSQLMLYG
FT                   LGAYNAFELDYDLHTVRMTIVQPRLDDVTEFEMEVSDLLDWAENVVKPAALLADAGKGE
FT                   LNPGPWCKFCRARSICKARAEANLALTSYDFKDPRLLQPDEIAKVLGQVAELKSWVEDV
FT                   KSFALKEAESRGIEFPGWKLVEGRSNRRYADAEMVQAMMELEGYSEEELLSKKLISLTD
FT                   MEKLIGKKQVSAILGDLIEKPAGKPALVVETDRRQALKLKSDAADDFADDLED"
FT   CDS_pept        78321..78983
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0075"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82777"
FT                   /protein_id="CAR82777.1"
FT                   /translation="MGDIADWQVEKMLNNDRPIYFRGVDRKMVKVKTGKVRFSYVHVFE
FT                   PWAGEEGQEKRFSVCLIIDKTDKKTLKAIKNAIAEIKESKEAINIWGGKNGKAPKSLKT
FT                   PLRDGDEEREDMEEFEGTYFVNANSKRQPGVINKKRKELTSEEFYSGCYGRASIDLFPY
FT                   NSNGSKGIAVGLNNLLFLEDGEPLGFAVVSAEDDFDDDLDDYDDDFDDDDDEDEDDL"
FT   CDS_pept        78980..80914
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0076"
FT                   /product="phage-related DNA polymerase family protein"
FT                   /note="DNA polymerase I - 3'-5' exonuclease and polymerase
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82778"
FT                   /protein_id="CAR82778.1"
FT                   /translation="MSQKVLRIDIETYSGRDIKNCGAYAYTESEDFEILLFAYAYDDEP
FT                   VKVIDLTIDEIPDTVLEDLNNRRVLKTAHNANFERTCLAKYYNRKMPPEQWQCTMVHGT
FT                   LLGLPASLDMMSKALRLAQEKDNEGKALIRYFCMPCKPTKANGGRTRNYPEHASEKWAK
FT                   FIEYCRQDVVVERSIAKKIAKFPFPEDEQRNWELDQRIADKGVRIDVDLVKHAIACQER
FT                   YQASLSKKAKGLTGLENPNSVQQLKDWLADMGYPVSSLNKDSVSELLADEDLDEDVREM
FT                   LLLRQEMSKTSIKKYEKMQHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQNLPRNYIK
FT                   DIAEVRKDLKAGDYEAFEMMYSNVPDVLSQLIRTAFIAEDGYTFDITDFSAIEARVIAW
FT                   LAGEQWRLDVFNSHGKIYEASASQMFHIPIEEVDKNLRQKGKVSELALGYNGGVNALIA
FT                   MGALEMGLKENELQGIVDAWRKASPAITSLWRGVEKHAKLAISTRKSQKYKGLTFYYEA
FT                   GILFIKLPSGRNLAYFRAKLVPGKYGPQICYEGVTDKGWRKQYTYGGKLVENIVQAIAR
FT                   DCLAISLRRIEDTGIDTVMHVHDEAITEVQESESSVDKLNAILAEPISWAPGLPLQGDG
FT                   FSSDFYMKD"
FT   CDS_pept        80921..81151
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82779"
FT                   /protein_id="CAR82779.1"
FT                   /translation="MTLVGERQKLINTIYQQLAPVKVHSSGYANTISEKILNASIAELN
FT                   AILADVIAYQLDYDLKMQKHAPRRSGGQDYR"
FT   CDS_pept        81425..81601
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82780"
FT                   /protein_id="CAR82780.1"
FT                   /translation="MECYIQITNEEAARMILEGSFDELWIMDTKDIVKCSTCLIRLEEL
FT                   PELVFFTKGKIEI"
FT   CDS_pept        81598..81984
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82781"
FT                   /protein_id="CAR82781.1"
FT                   /translation="MRGIEYRVWDKEVEEMDNNPSVIEMWQTKPINEQFRLEAEEKLVW
FT                   MQYIGLKDKNGKKIFEGDIVINSKGQIGYIAYLIQEAGFVVVLETSDYRLGHRNTNESY
FT                   AVASRHEVIGNMQDNPELFPGWWK"
FT   CDS_pept        82622..82990
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82782"
FT                   /protein_id="CAR82782.1"
FT                   /translation="MRFREGDKVEFIQQGELTQGVVTEIEDTGHSIFYQIDYARNTEII
FT                   WITEDKLLPPAPVLKVPQRGDRMRHKIVQVGFLADKGEELIKLLDDGWKILTATYVGDN
FT                   IEQIGGLVQYVLRKEVAE"
FT   CDS_pept        82987..83421
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82783"
FT                   /protein_id="CAR82783.1"
FT                   /translation="MKQVSVQHRIEMKKLADLIIKNPDLPVITMTDNDDTISGITGGVS
FT                   YIAGCLPEVSIDYIYSRTSKDLLLGNGEYRPYVKSFDEHVGLEILRERVSYRDNTLDAE
FT                   YLKKEATKIWNNLAWRKVILVYSGQLENADDVYKERGVVR"
FT   CDS_pept        83854..86292
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82784"
FT                   /protein_id="CAR82784.1"
FT                   /translation="MNAKDIAISADGKLTLAVGKSRKEKAWKNKETSWQKVLEKISQTT
FT                   RTKETIDEYLQMSKAEQSVIKDVGGFVGGTLLKGRRKAENVKWRQLITLDADFAAPGLW
FT                   EEIELFYNFACAVYSTHKHTDAKPRLRVVIPLTRAVTPDEYQAVSRRIAADLDIDVFDD
FT                   TTYQPHRLMYWPSTAKDGTFEFHYQDGAWLDPDKVLDRYDDWTDPSFWPESSRRENARK
FT                   KLADRQGNPLEKPGIVGAFCKTYMIQDAIEAFLPDRYEPTGDGRYTYADGSTAGGLVLY
FT                   ENGLFAYSHHGTDPISEKLVNAFDLVRIHKFGAQDDDAQEGTPVNRLPSFMAMADFARN
FT                   DDSVKEHLVESSLTSALEDFADMLDEVDEESEEVDKSWMKKLTLNRNGKVESTAPNILR
FT                   ILENDPNLRGKFGYNEFNYRMSILGNVPWRKTTKKVDEKNDLDDSALRNYLESVYQISG
FT                   KDKIKDALREVMHRQRFHPVRKYLSGLEWDGKERLDTLLVDYLGAADSEYTRIVTRKTF
FT                   AAAVARVLVPGIKFDQVLTLTGTQGIGKSTLLDKLGKEWYSDSLEDLHGKSAYELLQGY
FT                   WIMELGELSALNKTEVEKAKAFISAREDRFRVAYGENVQGFPRQCIFIATTNDNTFLRD
FT                   GTGNRRFWPVEVHGFGEKSVFTDLKEDEVDQIWAEAFVRYKEGEALYLQGEMENQARMQ
FT                   QAKFTESNVLEGLIREYLETPVPADWSSWNAPARRAFLRGEDFEEVERDDLVLRDKICA
FT                   MEIWCELMDGDAKQLTKQKAREINDALRNIENWKDNQGVLRFGKLYGRQRAYTRITLAK
FT                   "
FT   CDS_pept        86598..86876
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0083"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82785"
FT                   /protein_id="CAR82785.1"
FT                   /translation="MLESKVEKYLREQVNKRGGLCWKFTSPGTRGVPDRIVMLDRRIVF
FT                   VETKAPKKELRKLQEKRKAQIEAQGLLHYAVDTKEQVDNLMSHFGAD"
FT   CDS_pept        86876..88267
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0084"
FT                   /product="SNF2/RAD54 helicase family protein"
FT                   /note="Superfamily II DNA/RNA helicases, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82786"
FT                   /protein_id="CAR82786.1"
FT                   /translation="MNETIQFVAHDYQEYAINKITASPKCGLFLDMGMGKTVTTLTAIA
FT                   GLMYNLLEVNKVLVIAPLRVAEDTWSRETEKWSHTAFLQVSKILGPAECRKEALNQRAD
FT                   IYVINRENLAWLVDHLGKNWDFDMVVVDEFSSFKNSKSQRFKALRKVLPKIKRLVGLTG
FT                   TPAPNTLLDLWPQIYLLDRGERLGKTKRAYLDKYFTPGARNGHVIFEWRLKNGAEDRIH
FT                   QHISDICVSMKAEDWLEMPERIDNTISIKLPSKARAQYSELEKEFLLEFEHSDVVADSA
FT                   AVLSNKLLQLANGAIYDENQEYQEIHNKKLEALADIIEESVGQPVLVFYSYKHDEKRIL
FT                   NHLKQYKPEKIKDSRSIRKWNAGKTRVLLAHPASAGHGLNLQDGGHIVVWFGLTWSLEL
FT                   YQQANARLFRQGQKKSVIVHHIVAKDTLDEKVIEALSSKKVGQDALLEAVKARLEKVKR
FT                   DERWR"
FT   CDS_pept        88251..88616
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0085"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82787"
FT                   /protein_id="CAR82787.1"
FT                   /translation="MKGGDSVNNEMTLNEYQRKSMRTNIAHGEGDTMGLLNYALGAAGE
FT                   AGEVADIIKKHAFHGHELNRQDLISELGDVMWYVSQLAVILGISLEEIAKNNVTKLEAR
FT                   YPNGFSEKDSINRKEDA"
FT   CDS_pept        88616..89158
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82788"
FT                   /protein_id="CAR82788.1"
FT                   /translation="MSKQAFGLSKKQLEIVTAMATKTATEEYSRLQKEQQKKDHSWRLR
FT                   NVKLLLKNYRNLKLYCDEVVKDLTILEPFLNLMGGKALDIKSLSDTEIKTELMMKYVDN
FT                   VLLTYEIACNNGTIEDSRRFKIVRDMYLNTKKLTAEKVSEKYNIDRRTVYKEINKASEV
FT                   LGVLMFGLDGVSDIFKR"
FT   CDS_pept        90060..90413
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82789"
FT                   /protein_id="CAR82789.1"
FT                   /translation="MAENKSWEILAKSQSYKQRRGKIRNSLLKHLEVKDAKREPFLDIV
FT                   EQYMSLWDTACQLELDISERGVVVVGMHGMKKNDSVPEQQKVNKQMLSILAYLDMNPEA
FT                   AADVTGGDIDDTV"
FT   CDS_pept        90400..92046
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0088"
FT                   /product="phage terminase family protein"
FT                   /note="Transcription-repair coupling factor (superfamily II
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82790"
FT                   /protein_id="CAR82790.1"
FT                   /translation="MIPYKYHPAISEWMYMVDSGEVPSSQEMKDLMPFLRAKLDAPNAF
FT                   VDNKRIDNALANAERFFELKQYPFQKFLLTFITYVFVRNEQGELELMFNEYFIYAGRGF
FT                   GKNTILSESSFELTTSNHNVKNYNVDIVATSEEQAMTSFKDIRDMLENNKEFMKSRYSW
FT                   SKTEIRNRKNGSTIKARTSNPKTKDGGRPGAVGFDEAHAYDSYKSFNVHTTGLGKVPFA
FT                   RRFYLTTDGYIRGSVLDDIKERAKMVLRGELPNSKLFPFMCKLDDPEEVHDPRNWEKAN
FT                   PMLRYNSDLRAQVEQEYETAKVTPSLMVEFMTKRMNCPTENLATAVATWDNILATNQNL
FT                   PELVGQNCIGAVDYARVRDFCAVGLLFKVADKRYWIHHTFIPASALVVQKFNFDIEAAV
FT                   KQGLCTIVQGETIEPDIVADWFEVQARKYRIQRVCMDDYKYQYMKPELSSRGFEPWIVR
FT                   NGKTTHTKVLPLVDMLFAKHKLVFGNDMMMRWYTNNTYLDIDTKGNVSFEKIDPEKRKN
FT                   DGFMALIHALTQDGELKEVRRIRRKPRSYSY"
FT   CDS_pept        92058..93266
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0089"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82791"
FT                   /protein_id="CAR82791.1"
FT                   /translation="MGLLDAFLSLGTGSKKNSYEARKERMDYLIEEVTANIYFKQLAVQ
FT                   TSVNLIAKTLARCEFKTFKNGKVHKGETYYSLNIEPNINQSKTAFLNDLVSQLIYSDEG
FT                   ALVVQTDDMQLLVADSYQRNKYAVKSNDYQFVESNNYVFQRTFYEKDVLFLELNNKQIR
FT                   ATIDGLYDSYGKLISGSIKNYNRKNARKLVLNISALFDQEFDKYENEGDEESEADKRID
FT                   DLMNNRFKNFFAEGDSVVTLEEGLKLDDFSSSDTKNQASSRDIRAAVDDVIDLVAMAFH
FT                   IPRGLLKGDVADIEQMTNNFLTFCINPIIEQIENELNRKLFTKEEYLAGNCVKISTDRI
FT                   KAFDLKDIAGSMEVLVRIGAFSVNDVLEFIGKERIDEAWADEHIITKNYAEIDKYLKGG
FT                   DEE"
FT   CDS_pept        93263..94093
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0090"
FT                   /product="phage protein, Clp family"
FT                   /note="Protease subunit of ATP-dependent Clp proteases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82792"
FT                   /protein_id="CAR82792.1"
FT                   /translation="MTKRKFSCFNFKKDTESNTAEIDIYGDIVADGYQWYESDITSFDF
FT                   KKDLDALGDVSKIYVNINSNGGFVYEGQAIYNQLVRHPAQIHVRIDGMAASIASVIAMA
FT                   GDIIEMPANAQMMIHEPAGGAFGNKSDLESAIRALDASKQSIIAAYRTHTTLEVSEIES
FT                   MMAEEKWMSGQEAYELGFATLVTNPLQQVALAKSPVTNTFRNVPESLAREEQTKYEPAK
FT                   QSLDLDALVMAVAAKIQDSNVLRSLEPSNKATNKATNKSTKASPLFDAFKALSE"
FT   CDS_pept        94127..95272
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0091"
FT                   /product="major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82793"
FT                   /protein_id="CAR82793.1"
FT                   /translation="MKNPDKVKMGKEQLQAVLDKAMTSEDPKVQAAAISEWSEGFQAQL
FT                   VAEAEKAARAGLTDDQVMAQRGLTVLNTQERDFYNTIIENKGLDNLDVVIPVTVYDRIF
FT                   ENLEEQHPLLAAIDFVNTTGITRWLYRKADAEGALWSDVTDAITKELSNGFQKIEIGQT
FT                   KLTAFIPLYNSTLELGPVWIDKFIVTLLSESLAIGLEKAIVTGTGKDMPIGMDRDLDGA
FT                   VVGGEYPVKEAKVLNDLLPQTLGEEIMAPLTLDGKRAVSDIIFVLNPLTYWSKFFGAIT
FT                   TMTSAAQYVQTLPINAQNIQSRYVAQNKLIVGVPTDYFMGIGTTGKIESSKEYRFLEDQ
FT                   IVFAARQLANGRPKDNVSFLVFDIENLKPLLTLIKELDTPS"
FT   CDS_pept        95307..95417
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0092"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82794"
FT                   /protein_id="CAR82794.1"
FT                   /translation="MTNNELKAILDNLGITYNAKATKAELLSLIEGADIE"
FT   CDS_pept        95410..95706
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82795"
FT                   /protein_id="CAR82795.1"
FT                   /translation="MSEFDLKEYVKRGCAITWNDPALDEQIEEAKEDLRDIAGGSIDFS
FT                   KPGSATRLLKNRVRYERNGVGSLFESDYRSELLRFQLKQGLKGGAVNDYSSEN"
FT   CDS_pept        95684..96022
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0094"
FT                   /product="phage head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82796"
FT                   /protein_id="CAR82796.1"
FT                   /translation="MTTQARTDVFNDGLLAYGSVETKRIKGKAVGKVFSEAGRLYFAFM
FT                   EARSSDYALAEGDNISIDLKVKTPYEPGFSKQKPGQVVLEGEQYDVVSLDWDAGKTKLF
FT                   WYLQKGGE"
FT   CDS_pept        96412..96837
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82797"
FT                   /protein_id="CAR82797.1"
FT                   /translation="MVRFELDASDLEQLLKKIADSPGDVEKAINQSLEKEGAPLAIEGI
FT                   IRRMPVSQGGAKKVREKSHAKFSNPLIKRMENLGFEIVAKGGASSKKGSFGYLAFPDEG
FT                   RGSSNLIAQHFFNEGMTDRTPRILEALNEALDRAIEF"
FT   CDS_pept        96853..97440
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0096"
FT                   /product="phage major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82798"
FT                   /protein_id="CAR82798.1"
FT                   /translation="MVVKKEYFAYDFSNVHWLKVDKEGKLGKGVLFGEFSKFEGEASIK
FT                   TVARKAEGVPVEEVSKPEMMEGTLTGHILLSVARELYGLTTQGLQEGIWAYGSNSKTAN
FT                   FALTAEERDMYGEPHLLAFPNVSVTGGIKWSLENGSEEVAEIEIPIKAMRDSSGNLRYD
FT                   ALASEVTDEKVKEKWHTDFSPDMVKEDYTFPS"
FT   CDS_pept        97451..97702
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0097"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82799"
FT                   /protein_id="CAR82799.1"
FT                   /translation="MRVSAFTDDSITWAWDSVEGASFYRVYLGGALTQEETTDTTFVST
FT                   NLSPETVYSAKVSAVSKYNKESEVTEEVSQKTAVIAAE"
FT   CDS_pept        97765..98136
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0098"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82800"
FT                   /protein_id="CAR82800.1"
FT                   /translation="MAQIELKNHGMVDIDTQLTAATFMDLQDEGIVDKDFLDKIVNATA
FT                   EADLPLRLKLNTLYAAYREANKVEYLSYEEFIRSYQIDYIQLTYCIGAVITKQDVETFS
FT                   GFADSLMKKIPKSAGSAGK"
FT   CDS_pept        98316..102710
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0099"
FT                   /product="phage tail tape measure protein"
FT                   /note="Phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82801"
FT                   /protein_id="CAR82801.1"
FT                   /translation="MARDNEKKIKFKVDNQQYNAAMKQMNADTAKLNKEFRLEQEQLKE
FT                   TGSASDKLESQMSKLAKEQELTGKKIETTGQHLDEAKKIFGDNSKEAQNLEKKLLDLQI
FT                   AEQRLANQSIDTARKIELLAKSENEANSSSAKRRQELSKLESEQDRLSRSNERLDQELE
FT                   LQIATMGDGAKETDKLKASQMVLGKQMGNTANQVKNLEQQLELAKREYGKNSQEVEALE
FT                   KELLSAKTAYANFGNELDKTNKDLGVFGVKTKAAGENISKAGAGMSAGITVPVLAIGAA
FT                   SIQAAENVADSQSKITGALGATEAQTAELSATARTIYSNGYGESLEEVTDALTRVKLKM
FT                   RDLDGKELEQATVTAMNLAATFDADVNEVVRGGDGLMKNFKISSEEAFQKLAWGAQNGL
FT                   NFSDELFDNISEYAPLFSQAGFSIDEMFAILDAGTQEGAYNLDYVNDLVKEFGIRIQDG
FT                   SKSTTEAMAEMSGSTKKMFKEYQKGKVSAAEMFKAIGKDLKGMDDQQKATQLGTALFGT
FT                   KFEDLGNKAVYAMTDAQTGLMDTKGALDKLNTSAESNHQLEVAMRALQDAIADIGTALA
FT                   PVMTEIAGAAKEFASWFKGLDDETKKLIIGLAATAAAIGPVTAGIGLLMMTLNPISATI
FT                   AGVGLGILAVGGALVAVTSARKKHDEEVTKSIDNAVLYGEGVSKGTQKAGESFVKMKDT
FT                   AHTNMALMKTATVENAKQMSNEVVEAYSGMASKAITALETYRSRLTTEIDTITKGTGEV
FT                   GKKSAEKATKEVNDSIDKNINKIKGAMDTVSALKDKYSGNLAQMTAADQKRYSEATLIL
FT                   DEQLKVFSKSVEDQEKIAKAASANQDTISKSSYDKQLETAKKARDASTKEAEKYYKKTN
FT                   TDLKKALADGNISQESYNQLTASNSKLLAENSYKAQKVFAGTNKSLAESVKNTGDVILE
FT                   SGTKLSQLQVQQADGTIKYWSQEKKTYIDKAAMQEEIKAKNEAYIESLTDNNKEAEGSL
FT                   KEFKDNLVKFYMEAGMSAEQAKKQVELDTQGMVDSVDASGNKIATHATTLSEKFIKGLN
FT                   EKNADIPATAKKWGLDLESNTKIDLGKNGNKTAKEFFKAIQAGGEEALPMLQYFFSSKL
FT                   ESITAKDLSDVGKKDMDTLREGLSAGAITLDQLKEKFGASMLNIYSDDLSKVGQDNITT
FT                   LRNGLDTGSITLNELEGKYKAQLDKIYDKDLTKIGKDDIATLKAGMDLGLPGVNNYLTG
FT                   LKSKIKTDTKVDIAGVGKTNIDGLVNGFQNGKVNVNQFLAGLRELQKKGSKQDLSKEGK
FT                   DNAESFVDGANSKKPAAKNAGKGVANSAKSGAGSVSVKQEGKNFADGFASGINSVAGEA
FT                   AKAAANMVSNAISAVKKAQKSASPAKKLVPKGGDFVDGYALGIDKNADSAAAAAASMAE
FT                   GAIDAVNGSPAMSYQQKMQELATSFNATQNYIQFQLNGLTIREEADINKLVDAIDERLG
FT                   DKY"
FT   CDS_pept        102707..103615
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82802"
FT                   /protein_id="CAR82802.1"
FT                   /translation="MTTAYRTISYRNSAGEIADFSMPYQQFLYNIEGMGFAYDNTVEES
FT                   NYSDHVYVANTRLATADFTGELSLLSIFGDNRNIYENQRELTRILNYDQLMRQQGADAY
FT                   GTLIYKNASGIEMFSRALIKSFNFGEIEEDGDELKVKVSFDRISKMWVSAKAKKVTINL
FT                   EGSDEAHKHPYSHPWTHGQTYKAGSGTITNIGGNHFAKLIIRIHGEVSAFTLTIKDTTS
FT                   RFQKRIKYDGNVNQGETLIIDNFDMFVRKNGVNSIANFDLFAADPPFFDLMPGVPYAIS
FT                   VDSQNLRGSVEVDIYETWVSA"
FT   CDS_pept        103615..104640
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82803"
FT                   /protein_id="CAR82803.1"
FT                   /translation="MLTCLVFDKLLNQKDIISITGGSFTVHVWDWQSFEIKTRSSNVQT
FT                   DDFITVLDGKEPIFSGVVKQSQESSGVFTYSGFDLRLILDRVQMNYLLKRSLVSSAVYT
FT                   GGSFAILKNTIQLAFPAANIIAQVDEDRTTFSLSPRMQTAFGFHRSNCVSNDITYQLFI
FT                   VSNRRLLLKGKYLRDKRREVVLLTDITHTQGEVIRNTKEAYNQILGLGSGEDNNRDYHF
FT                   IDNKASTDYASCFVYDIRENITHAELVQRTVAKQKELQFEYTVKFYTLKNNVAQLGQEY
FT                   DIGDYVSFRMQDGALVDDLVSAYTINIDKGILSPRYELETGIKKGSLTAKLKDLKEGGY
FT                   K"
FT   CDS_pept        104643..105413
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82804"
FT                   /protein_id="CAR82804.1"
FT                   /translation="MAIKTFNYTNDAYIEAADTRAELGAFVGTSRNGFFGSITQVGTTN
FT                   SYTVKADSVIFVGGLCVRVLSDEVFDLTTAKYIVVETSYQTITDAYTCMIKAVTLLEET
FT                   TMVGAVNKHVPIFQKGIGVLNEGRGLADVVKKMNRADCFWSGGSYLDEGHKFSYPNLKT
FT                   NDYQMLYLVFSHYTPGTGADDWGWLVYPVPVPFIAAHQSAGHSIPIMVEDTTKVMYKYA
FT                   YISLTQVQGSSNNVRVLDGVNFRTKCLREIWGVG"
FT   CDS_pept        105413..105712
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82805"
FT                   /protein_id="CAR82805.1"
FT                   /translation="MKQYYVLLNADGFITVWSSEKQEGFLKIEASEDDFNKLDFVRVEN
FT                   GKAKVDEQRRQQIIKEYEASTLTEIDKLKMQNIELRDSILDLAIIVDGLGGELE"
FT   CDS_pept        105709..105870
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82806"
FT                   /protein_id="CAR82806.1"
FT                   /translation="MSALVNLFVDAILDENSDRTINDVPNSIRAKVQARLDEYYTAQAE
FT                   QQEVESAE"
FT   CDS_pept        105900..106121
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82807"
FT                   /protein_id="CAR82807.1"
FT                   /translation="MPKDMLEPIQRWEFEALKKEVKQLSEDKASLSAELDSFVKEREKD
FT                   RKMSLNVITGALASLLVGILTFLITRGF"
FT   CDS_pept        106123..106533
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82808"
FT                   /protein_id="CAR82808.1"
FT                   /translation="MPFKQTVEFKGIAVIESGVTVFGAYEVVALLYNPSLFDNQVSESY
FT                   ELLAHFIPENVWAFIFLAMTLLVGVGTLLQAHYRIRLGLVMRMLGLILAALITVFFAVV
FT                   FLFDFPNILPGVLVGFATIVALGLVQNFIKRL"
FT   CDS_pept        106543..106797
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0107"
FT                   /product="phage holin"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82809"
FT                   /protein_id="CAR82809.1"
FT                   /translation="MKINWKVRVKSKVFWVSVIPLVLVLAQQLLGWFGVTIPADTINKQ
FT                   ALDFVNSVFLLLGVLGVVNDPTTPGASDSELVQNRKDEE"
FT   CDS_pept        106797..107030
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82810"
FT                   /protein_id="CAR82810.1"
FT                   /translation="MKFSKGQKVKMVDTNSVKNDKQLDETAKNIIDKSNYKGIITKTVR
FT                   GEGDKDLFFVSFYIDSERITQGFRENEIEGVE"
FT   CDS_pept        107033..107959
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0109"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="Negative regulator of beta-lactamase expression"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82811"
FT                   /protein_id="CAR82811.1"
FT                   /translation="MATVNGVLFRQNLVSSSKYGIKAPNRMDAKKITVHNTYNDATAQN
FT                   ETDYCKNNNNEVSFHVAVDDKEAIQVVPFDRNAWHCGDGGNGYGNRNTIGVEICYSKSG
FT                   GSKYTKSEQNAIKYIAGLCVQQGIAATKDTIKKHQDWSGKYCPHRVLAEKRWPALQQAI
FT                   IDEYKRITSKNPNRHSGAVVDSVPMLSKTDFKSSPVRMYKAGTAILVYEHNKYWYKAYV
FT                   NDKLCYIYKSFCVSNGKKDAKGRIPVKIKSAKDLRIPVWDNTRLNSGKIKWYAPYTKLS
FT                   WYDNRKGYLELWYTKDGWYYTANYFLK"
FT   CDS_pept        107984..108403
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82812"
FT                   /protein_id="CAR82812.1"
FT                   /translation="MAQKNIVVESGVKIYTDKTYKKVVTELPRNAIFKYESGGYCLFKT
FT                   IKGYTNRAHWTCPAISGSYVIALAKVTQKLAESVGGKGVIKITRGEIVRIDPSSLKAGY
FT                   VNCAVFNDTWEWGFKIKLADVKRCETLTYNSIAKL"
FT   CDS_pept        complement(108452..108934)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0111"
FT                   /product="phage protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82813"
FT                   /protein_id="CAR82813.1"
FT                   /translation="MAGYLKRYAEDRGWTLYRLAKESHLSDSTLRTADLTTLNKLSVIN
FT                   IKKISEAVGETPGEVLDDLIKFEERVEKMNISELIREIKNKDYAVRLEGTDDNSITKLI
FT                   IDVDNDGNEYVISESKNESIAEKFASTFKNGWNKEYEDEEEFYNDMQSIILKSELN"
FT   CDS_pept        complement(108940..109128)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82814"
FT                   /protein_id="CAR82814.1"
FT                   /translation="MKNDYMFKEIAEKEQEIKKQLERWKNRGIRSAGFESRNIAELFTE
FT                   LANLERLSDLKIMESEA"
FT   CDS_pept        complement(109160..109363)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82815"
FT                   /protein_id="CAR82815.1"
FT                   /translation="MTNIKAIFEKWGHGHLTEVIEDLKEGYEVVINVVDRDTFNLMNDL
FT                   NATGEFTVYEDAINDTITIEHC"
FT   CDS_pept        109768..109947
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82816"
FT                   /protein_id="CAR82816.1"
FT                   /translation="MVFCRFYGEIVNNFNNKLIYFWFFIKMASESLQPIFENELNVFMK
FT                   SQTEKPTFTQQELT"
FT   CDS_pept        complement(110306..110809)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82817"
FT                   /protein_id="CAR82817.1"
FT                   /translation="MAKVIKIESDSAIVLKDNGETIDVLLDCFTFSPDTGDEVEVYKHG
FT                   EELIVNKKVEKTSENPNINIVNNTSQNQEQAQEQKQEQTQTVITEIRFSGQNEGKLVNK
FT                   WVYVALALLLGTFGAHKFLAGKNGQGVLYIVFCWTGIPSIVSFIEGIVAIFKKANDANE
FT                   ILIQ"
FT   CDS_pept        complement(110987..111355)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0116"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82818"
FT                   /protein_id="CAR82818.1"
FT                   /translation="MSFSIGEFSELVDIPSSTLRFYEKEGLITPERDKNNLRTYSEEDA
FT                   NWLKFLLHLKGAGLSIKELKQYTIWRAAGDSTISERLNMLKEKKIVLVQEIENLQKNLD
FT                   TVVRKIGIYEEKVAKLDV"
FT   CDS_pept        complement(111411..112394)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0117"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="Predicted oxidoreductases (related to aryl-alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82819"
FT                   /protein_id="CAR82819.1"
FT                   /translation="MDKRRLGTTGLVTSELGFGCMGLNYHRGPAKNRNEMIEVVRAAMD
FT                   SGITMFDTAEVYGPYTNEELVGEALSSKRNHVQIATKGGFKIDGLNNEVDSRPESLKAA
FT                   VEGSLKRLKTDYIDLYYIHRIDPSIPIEEVAGTIKQLKQEGKILHWGLSEASAKTIRRA
FT                   HKVERLATVESEYSIWWREAEQEIFPALEELGIGLVAYSPLGRGYLSGKLDINTNFTEN
FT                   DNRGGLPRFQKEAMKANQVLLDFMKEIADEQNVTTAQLAIAWILDQKPWIVPIPGTTRQ
FT                   SRIKENIAATKIHFDDAARQKIATALSQIEIVGDRYSAAENKRIGK"
FT   CDS_pept        112852..113511
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82820"
FT                   /protein_id="CAR82820.1"
FT                   /translation="MKYIEYHDYIKRDAIIYAYLLDNFSYVCKQIKAWESITIDREHVL
FT                   LVKSGTLIEESDGKKKGIVRCFFEKNLIFPTRNPVVLKALETSEICLISAEGVFGKLEE
FT                   DQILSNFFLQIAEKNEQDLKRQALLGTENSKNKVVSTLNFLLENNLSNTTLPVFPEWLQ
FT                   INILAKLANCSISTISSTVNELHNKGMLDIKSSPWKLKGREMRLEYFERDVQKVAD"
FT   CDS_pept        113624..119464
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82821"
FT                   /protein_id="CAR82821.1"
FT                   /translation="MKKNILVVIIVSVLAISAIVSAFFLMRDDAYAIETEGFTYSPKGK
FT                   LVTFSPDAKYNDAWLNNEKTISDGKEVKPINLARTLFLKDGRIQFLGKSVAIKSASDLI
FT                   EMPSKTFVTESKGTYKANISKDKTIAQLPKGTVVKLAEGRYIILDNSYLKNKKGLNKKL
FT                   PKNVIVSIDENKKVLLMGEKTLEELAGDDAYIEMENNHYQFDLKKEMLVSQTKNEENID
FT                   VRSIKVEIDDKAEKRNLKTTKETTEKTTTDETKKQEDKNNEQTKTETETNQASNGNAAN
FT                   TEATTGDASGGDTGTTDKNVANESETTKNNQNTTDVSKANEIIKKLNDAESLSTFQVPI
FT                   VDVELTVKGQKASAKLQLTDSSKRLESLEAILYDSENKVVKKVALNSSKVDQNFAFDSL
FT                   KYGETYQVVVQGKYKSANDKIQETIFFRQTVEAKPVVLTPKVVERSQDSVTAEITATEL
FT                   YGNVDELVLRIKENNSNSTTSKTVKVDAKALTKNGKAEVKFDSLNSSKEYIIEMEKLVV
FT                   DGKDVTDENWYFIASTLKAKPTMAGIDLSYSTEKGEFTAVPINLIDKDSSITSIRYVAY
FT                   LEEDYKANGENAKEYAYSVVDASQKKTSVKVGRTVDMSDGNYVFVAYISGNNNQSDFTF
FT                   ATPASNAVVVGMKSIPTVEFSLKEAEQDKLTINYEVFDADNTILYDNLTHPTLKLYKSN
FT                   AQGLYSGNPVATVDLRNKSDITNLLEYDGLESETYYVVVMTASYDLDDGSGIMVDKLIG
FT                   QSSVFQTTEIAKVDATFTMESVTTTQAEINIKLSESATKLSAANLKIYDKKNNTLLKTI
FT                   PLDSDFEKLMSADGKTYLFDDLAINKEYLLKVEDGSDSGMNQVPVEGELVFKTKREAPI
FT                   TDKVLLDYQPTKMKVGGLAGIEATEKPMLDDYNAVSSITYKIYKVDDLNTPLVEQEVTT
FT                   AAEFEKHSYFDLNSTELGRGFEYMIKAEVIWNDNYEDHRIEISSETIQIKKEKPSVGYE
FT                   ILKRTASEVKLNVYVKDIEGAIIPGKLEITSSTGGSAQLKNGKNTVTLPLSSEGATTLK
FT                   TVGDYVITSGEPAESTVFMTKDLVAMNTTAPQASAQFALDETGRSMILTPEPNDIAKSN
FT                   VMKTTYSIQAENSSSPDYSVAKIGDEQFDEQTIDLPFGNVWFNNSYQLALDMKMNYMEN
FT                   RINNEKLFENYYVSLNNNSAFVTSSNGGLSTTKNANRADVYRVTKGPTDSEGNISGVKF
FT                   KNIWTGTYIAYRGGVLISNSETADPFNFRRQDDGSYVAELNGRYVDFSSGLVSTESAGS
FT                   KIDLYSAQEETGKVSQSITTKALVEPDITAEALSIYDKRVKLDVIGEDKDNTIVKKDGD
FT                   NELFVNAYKEDGTTLVKSVRIDGLPTRDISLTDLSPDKTYVIKVEGKYDLLDGEGAKDK
FT                   VYYSETITTEKSLPSMASTSYSWNAAYGFRTIKGNNNFIDESNVLTNIEYRLYDASTIS
FT                   SNLSDLVALEQELGTKTPAATFDNLSKTPEFNLYNNLGIQNYDSGKTYVIAAFMKTSLA
FT                   KAPIFLSDAKSIFITPPKTVSAPIKLESVSTRKATLKFSYNDPDGYFVGGTNKQFQYVL
FT                   KETTTGKIVKNGSFVGGNTASWLNTFDNLEPATGYTLTINTNYDNLNGDGNKPWNTSLN
FT                   FTTDDEYVSSNSLTIQLDAATKKIKFQAKELIPGSTTIEKVQIEFYELIDYGGNNERTS
FT                   LVERKTVALPTSYPATVSESFSVAGKKQDQSFLGKMVVTYRTPLNEVKTYERSSNFVTL
FT                   QEDIAANLKSFRSVRATDTNVAVELDTTKVDTEAKETYTFELKDENGKVIDTEEVKAKD
FT                   LAEPVNLSMKPTSNYAITVFDQKDKPVALYQGNNEENNLKANITDDSFTLMANDTADAK
FT                   TKLTVTIEPKELSAWEEVQSWFGKDFTETKTIEKQELNEGVEFDANYHDSKVTVKEAES
FT                   GKTFGIIELEASK"
FT   CDS_pept        119461..121740
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82822"
FT                   /protein_id="CAR82822.1"
FT                   /translation="MKPTWKIGVIVAAVPLIIISVILWGSFKEARYDLVSLPSNGVVLN
FT                   DEQETLQFQKGHTLYRSWNDDQLIAKNDEDDTRNKIMQSTILYLDKDALMFTKSVPVID
FT                   VNGVSTKLKGRQTYEPKGASYQYKNSEIAEKSIVKLANRQYFLNAEATLYLGGKEIKKV
FT                   SKPLLLIDKTGSVTIYENKKKSRYLGHMTLKVNDETVLDASNETYTIGERKIDLASFGG
FT                   TDNEKIVVKKDEKDVEDKKAAEEEKKAASEKTATNDKQSSGETSNKNESASNGLNATKK
FT                   YGNEIKAGSGSADTGTTGSKSGSSGATQKDLEKIDNYEAVLKKIEELNKKLERNIPVLR
FT                   IGYIAPGVTSAKVSYNYSDPNNTLIGVTKISVVDEKTGKTINTHYASATDTEATLTGLS
FT                   PNGKYHLEFTYQYDLGTDKGIQEVKMKSDSFTTQSVSAIYQMQSVTSTSIKVNVALDAQ
FT                   IEGIKRARIKVKKVNGDSFYMNVGTNFINGNGELLNVTDLAPSTAYQFQTIIEMKNGET
FT                   IELNSSEKYYTMQATLLRSLRANLSVDKVVQVEYDWTSTDYTLNQATVELKDEDKSEVD
FT                   YKIVNQEKGSIRLVPITDEETVDLEAKLVLKTTNNDTKESKTFEYPIKQDVQYDKDAKL
FT                   TISLTPFQTEENSTEKTEDAEQETARNTGITTKIEEVLAPQNATYDMMFSMQRKAGETY
FT                   RVAFERRAVGTNDGWTSFANKELTADETGLVSHMETISRIAKESFDYRIAVYDTKGTLQ
FT                   LYVYQE"
FT   CDS_pept        121796..122038
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0121"
FT                   /product="ATP synthase F0, C subunit family protein"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82823"
FT                   /protein_id="CAR82823.1"
FT                   /translation="MDLVVACSVIGAALAIGLATLGAAIGQGIAVSRATEIIGKNPNAK
FT                   KEVMGGLFLGLLMIVALMLFALAIAVILLWVNPFI"
FT   CDS_pept        122035..123081
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0122"
FT                   /product="ATP synthase F1, delta subunit, putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82824"
FT                   /protein_id="CAR82824.1"
FT                   /translation="MIGESMEKLIQTIVLYGIFAVGFLYLLYFTLQKLENILTSFFYEI
FT                   SQDKSLEKESLLRRLKRQKVATNQEEQKNRQLAIEAEQKETIFLEEIDQLVARNRQYEQ
FT                   ELQLWKNETPTQIVEVPSVETTPHAPFKSLSSCVNEIVQKVFITSEEEEAQLFTEAIRE
FT                   FDALVRVEKIRLALPYKVLLRLFEMHKPEELHAFTKSFEEFNERASKLSVKQIYQSSYL
FT                   SPEQKLKVMREDGTLDGLNHQFVEFLFYMLTHFSYRQTRGLYRNYLEVYNVHFYTGLIR
FT                   VDVANEESATHFDKLWRPTHTSYKIEYQVQKELIGGVIINYGTKSIDMSYQELIKRTTE
FT                   KMESEVRL"
FT   CDS_pept        123078..124574
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0123"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82825"
FT                   /protein_id="CAR82825.1"
FT                   /translation="MKTIHFDMNKYETPVDLEYLKEHGRVEKISDGVIFSSGLENAALH
FT                   QAVIIDDKHRGVILELNEEFVGIGLIDKTNNILEGMTVSVTDHFIEVNLFEDMAGRIID
FT                   TTGKMLYDVSDEQPTASSPLFCVTPAIMTIDSVTRPLNTGLAVIDSITPIGRGQRQLIL
FT                   GNRQSGKTQIAVDTIINQHDQNVHCIYVAIGLKAAYIAEVIETLRKYGAMKYSTVVATA
FT                   ASDSLTAQYLTPYAGMAVAEALRDQGKDVLIIFDDLTKHADAYRAITLLFNRPPGREAY
FT                   PGDSFYIHSSLLERAVQMNPEHGGGSITAIPMIETLSDDVTAYIPTNVISITDGQLFLK
FT                   SDLFNRGQKPAVDVGVSVSRIGGDAQHPIIRKLSKNLTLILSQFEELKELLDFGNALDE
FT                   GSMKMVTDGRMLTELFKQNILSPLSVPELIAILYAFQNGFLNKMAPTNVQSFKGLLLEK
FT                   AHAHPDFASFSNQIEEISDLDEAHVKLLEEIIQEAGRPFR"
FT   CDS_pept        124571..125443
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0124"
FT                   /product="ATP synthase F1, gamma subunit, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="F0F1-type ATP synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82826"
FT                   /protein_id="CAR82826.1"
FT                   /translation="MSSIDQARKKIKALNSTYKIVHVTELATLGKLSGLREKAEAAVSY
FT                   YETILKSLRWVRKTMYAGNNIQVSEEKNITALAITSERGLCGAYNSEVFVEIDKLIESL
FT                   GDQVNINWIVVGEQGHRYLTNLGQNISTYLQFSLENIDLETTTEVTADFIDQINNQEMD
FT                   ALYVIFTKYFNAVQSEAMCEKIYPDIPEESDAESIEVDYVLDFETDDEQVEQLLLENYL
FT                   CGLLYSMFRYSVASEYCMRRIAMKQAKDNIHKQHEEAVFDARKKALQQKTGELLDIISG
FT                   AQTIRKEEE"
FT   CDS_pept        125444..126814
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0125"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="F0F1-type ATP synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82827"
FT                   /protein_id="CAR82827.1"
FT                   /translation="MKKHTGTIISISGFVLKIEFNECELPEISHALEYETHQGTYLAEV
FT                   VQHTGINTVSAIAIGEVSGLARGAEVVNLGHPIEVPVGETVQGRMLNVYGKAIDGLPEP
FT                   EAKVKWPIFREQPLLRELDTNKEILYTGIKVIDLICPILKGGKTGLFGGAGVGKSVLMQ
FT                   ELINNISMMGGNSVFTGVGERVREGIGLYKELESSGVLPQTTVVLGQMNESPGVRMRVA
FT                   LTGLTIAEYLRDEEKKDVLLFIDNVFRFIQAGSEVSSLQGKIPITGGYQSTLSKEVGDF
FT                   QDRIASTKNGSITSIQCVFLPADDIDDPSAVATFSHLDSTIVLERSIAALGIFPAVNPL
FT                   QSFSRALNPTFVGERHYQLAVQVKFILQRYMELQEIINVLGMAELSDEDKKLVHRARKI
FT                   RNFLSQPFYVSEKFTGTEGIFVEIEDLLVSVERILSGEYDERSEREFLFIGSYKDLK"
FT   CDS_pept        126827..127144
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0126"
FT                   /product="ATP synthase F1, epsilon subunit, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="F0F1-type ATP synthase, epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82828"
FT                   /protein_id="CAR82828.1"
FT                   /translation="MKLKIVSPMGQFFEGDVEGFVINTKEGQQTVLEDHIDCLSFFDYS
FT                   EITILDSAATEPIFVALGYLHLVQNEANIMAQFASADAKQAERIFERLSKRKQTEGRGI
FT                   L"
FT   CDS_pept        127141..127701
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82829"
FT                   /protein_id="CAR82829.1"
FT                   /translation="MISGFFETLLQIIGLFAAFFLIILLLLAAIRHYFSKDEKPLERIQ
FT                   RYQLWYTRYQFDGEITAFLVVISATLLVCFAVVQIVAIPFQFTLLMFWSSWAFHLVAYW
FT                   KKMRTPQKLNKEIKQLIGLVAITALYFAGYFALKSMYLLLVHVSEASWVIQFGVRSYLA
FT                   ICSLLVAGGALVLWQRIYARLLK"
FT   CDS_pept        127824..133799
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0128"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82830"
FT                   /protein_id="CAR82830.1"
FT                   /translation="MMKIKSLRRSLLLVMAALLILGQLNLSSFRVSAEEKGNESLSYEV
FT                   QKELSSDSKKANLTIKTTPKSTDVKILTIETPDGKKVDGQEAAYTATKNGSIDFVITYQ
FT                   DKDKTEKTYKASYEVSEITEETKETTNQTVTETPTNKGLLKAGAPSVSLNIPDYNKTSW
FT                   DNGDIKDVSVTVEFNNNNSSGKKINFTLPDGMRFVSLPVPSNFQATGNVDSNVLSYFGA
FT                   GNPVGDSITSVTVPNKETGYNKATFGTVSYNLAPATEKLTLNFSVQVDAAKYYGGTDLK
FT                   SPIQVDAYMGDSGTPVASAEQKVRADGKNVVGYAAQKHVQTMFRNWYTSSFLPEVMPST
FT                   DTEESFNYTKPYSVVNGINAMDARGSKIFVPKNVKTTLYYPEGMEYVGVVNEGRSLLTN
FT                   NANRTITHYPSENKVVIDFNQESYYGIVETIFAVKYKVPEGTDEGTYTAPKVPHAVITT
FT                   YDDQVFETDALTNDSNDTTTLAAKDICKVVGRSTNKMVMLPRNYYINPDNETWAGLVQI
FT                   NNKQTAGVKTNQIYQIKFDDNWEAYTVNLPFDGTYPGNKVKDIQYKTNLNPEYRTYDGT
FT                   PPKTNGNKMLTLEATTVGLQEGEYFTEVKANVGDFSVGFTNIDTSAPFKAANSASYGIV
FT                   KPGITSVQFEANIWDADNEASTKVSGSSTYTVSNSVTTAANGTASFYNSEGTQVKTARA
FT                   GETVTTKAALIMHEYPYGTRSVLNNPEIYLRQLEGTTVKPGSIKLTDQDGKEVDFTVET
FT                   KNAKNGEKVYVIKTTDVTVGEFVGYPAKKRYLNISYNTTFDMTLSKSIHTDIQELLAWG
FT                   GSNVTSALGANVFLDNGLDVNQNGRDAERLLSTNTSTLSVPKQDTVTVETFLNVAGEGI
FT                   KAAYVEDDDSTVSYFTPGTDADYMVKITNTSSGSAKSLDIYIPIPKTGQDFGSKFQSEP
FT                   FKWDMKLSDALAMTAEQKAQFDISYTTEATSNNYTADSIYSNSLTDYGKANMVRIKVKT
FT                   EIASGESQTIKVPLKVDETFDSAAAGNKIGERDVYNPYYAVTTNTYSGSIAGTRVGAEL
FT                   VIVEVAGKLFKDKNANGLYESTQNDTALANEVVELYKWNETNSAYEPFTKDGQNVTTTT
FT                   DANGDYKFDYNLGIGYGKYAVKFPEKEGHKLTLQNVGKDKAINSAAPNLGTDTGWVKEI
FT                   DPAQPDAQHINAGYISYVPESDLKVNLNEKLVQEGKSLKITLPKVALTNGEAAEDTIEP
FT                   DIFQKILATTDGYKWTTADPTIATAKTLTDGSGAIVGVSTKGKTIAATDLTITIKDIFG
FT                   TEKKSTAPVYVTTANGEFAQKDQLRIGATDFTLEYKDAIALTEAQAVSKAKTAAFEEVK
FT                   NGVNSNAEDRTNVVKVDETQLNALKNGSNRGGTYPLTFTLEKDGKEVEVVVEVKVEKDL
FT                   TEVNAHDSTIYVGDNWRAADNFDSALNKEGETLTFADIEVTGSVDTTTAGTYPVTYKYN
FT                   DTTKTVNILVKEDATEVNAHDSTIYTNDTWTAKDNFDSAADKDGNVVDFAKVSVTNTVN
FT                   TAQAGTYPITYTYGGVEKTITVTVKENKKGINAHNATIYVGDSWTAEDNFDNAVDKDGD
FT                   PVAFSDVTVKETPTVNTNKAGTYQLKYSYDGASKTVTLTVKNILTAVNAHDSTVYVDES
FT                   WEAKDNFDSAKNKDGETVAFSDVEVEGNVDMTQAGTYSITYKYDGFSKTIKVTVKNPQT
FT                   AINAHDSVVYTGDSWSAKDNFDNAIDKAGKSVAYKDITVEEDPKVDLTTPGTYSVKYSY
FT                   EKVSKVVQITVKPRQTKVESHDSTIYAGKTWNAKDNFDLAVDKKGDDVKLSDVTVVGLV
FT                   DTKTPGTYEITYRYDGVTSVSHVTVLQNQAKIIVADSKLKANAKWDPKDNFVRAMSRDG
FT                   SDIPLSNVKVEGKVNTKKPGTYKITYTIDPNEGTADAGKEELSVVAMIQVEGEKVTVKP
FT                   SDDDSKIDVKAGQQRTATYKQAIPKTGDQMNLWVILAGACLVGFALFLWLFRLRRRHG"
FT   CDS_pept        133956..134591
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82831"
FT                   /protein_id="CAR82831.1"
FT                   /translation="MTFLEFHQLVSQDSLIYSWIRTNFSLTHQELEVGKELKLQHGQLI
FT                   VMEKGLMVQESFEKKPTIQRVFADQRIIFTTDGGLSLAALEHTTYIVISTDEILERLDE
FT                   DKLLPNFFLQIAEDFERSIEWQRQLMSAYPEERVEMVLQKVIERYKLDPEQNPVFPRWL
FT                   KIYVLAKLAKCSVSTTSVIINNLAEQGKINVKMTPWELAQPSKASCAS"
FT   CDS_pept        134892..135857
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="lmo4a_0130"
FT                   /product="PTS system, mannose-specific, IIAB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system, mannose/fructose-specific
FT                   component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82832"
FT                   /protein_id="CAR82832.1"
FT                   /translation="MVGIILATHGEFAEGILQSGTMIFGEQENVKAITLMPSEGPEDIK
FT                   AKMEAAIASFDSQDEVLFLVDLWGGTPFNQANGLYELHKDKWAIVAGLNLPMLIEAFSS
FT                   RFTMESAHEIAANILAPAQEGIRVKPEELQPQVTATEQPQAEIAAVGDGKIEFVLTRVD
FT                   SRLLHGQVATAWTKATHPTRIIVVSDAVAKDDLRKKLIEQAAPPGVKANVIPVQKMIEI
FT                   SKDPRFGNTKALLLFENPQDVLRAIEGGVEIEQVNVGSMAHSVGKVVVSKVLSMGKDDV
FT                   ATFEKLKEKGVKFDVRKVPNDSSANMDEIIKKAKNELKTQ"
FT   CDS_pept        135881..136687
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="lmo4a_0131"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82833"
FT                   /protein_id="CAR82833.1"
FT                   /translation="MSVISIILVVLIAFLAGIEGILDEFQFHQPLIACTLIGLVTGNLT
FT                   ACIILGGTLQMIALGWANIGAAVAPDAALASVASAIILVLGGQGVAGIPSAIAIAIPLA
FT                   VAGLFLTMIVRTLAVPIVHLMDRAAEKGNIRSVEWLHISAICMQGIRIAIPAAALLFIP
FT                   ADSVQSFLEAMPAWLTDGMAIGGGMVVAVGYALVINMMATKEVWPFFVIGFVVAAISQL
FT                   TLIAIGALGVALALIYLNLSKMGGGNSNGGGGGNSRDPLGDILNDY"
FT   CDS_pept        136709..137620
FT                   /transl_table=11
FT                   /gene="manN"
FT                   /locus_tag="lmo4a_0132"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82834"
FT                   /protein_id="CAR82834.1"
FT                   /translation="MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKTKEDRSSALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
FT   CDS_pept        137747..138136
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82835"
FT                   /protein_id="CAR82835.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKKPKEVLRKIRVYVDPANMV
FT                   SSLSFFDVMKRSFRSIFSKKKNKNK"
FT   CDS_pept        138270..138620
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82836"
FT                   /protein_id="CAR82836.1"
FT                   /translation="MKKPRIYTMSFASVYPLYIQKAEKKDRTKEEVDEIIFWLTGYDQD
FT                   SLQQAIDQAIDFETFFAEAPKMNPNASLITGVICGYRVEEIEDKLMQQIRYLDKLVDEL
FT                   AKGKKMEKILRK"
FT   CDS_pept        complement(138661..140205)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82837"
FT                   /protein_id="CAR82837.1"
FT                   /translation="MKRILIRSGMRPTNVYTPEDIYLKDRTGFNNGNLAYQYSIYRALW
FT                   NDDVEIHADGLSSNPNLAEKINENYDLYVMPLADAFRDDFRPVLRNYTQLIRKLKIPVI
FT                   VTGVGLRANYEPQLDEGFSFDEDVTNFVKAVLEKSAQIGVRGQITADYLKKLGFNAELD
FT                   FRVIGCPSLYTFGREIKIRDFHLTDQSTIAINASPTSSEIAINFLNNMITTYKDYHFIP
FT                   QHLDEFHLMYAGGPDISSDINGYPTNIQHKYYQEGRVKYFTSMPSWFDFVKKVDFSIGS
FT                   RLHGNVIPTIVGTPNISFVQDARMRELASYHALPHVTIDELEKTNNLQELLTKVDLKSA
FT                   EKVQARNFDNYIDFLDTNGLNHIYKHDKNRKSAPMDELINSITFPTSPDPISILNPQEM
FT                   LNRVKISTNLLKERHDFSTRYRVNLVNNQLTQLKKTTSEQNKKYQQKITETQEKNQQLE
FT                   KQLTDTKQKLQLTINKNHELTNKIRHYQGTLNRKSVKTTLKVANSLANLKKKVSRS"
FT   CDS_pept        complement(140293..140586)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0136"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82838"
FT                   /protein_id="CAR82838.1"
FT                   /translation="MKKLKELSKSDLLLIFQALSDPIRLDIFLCLLKSKEKRFSGTTYN
FT                   ISKSTMSHHIKLLKEAKLINLRKEGTTHIYSVNEALVEEIGYFFDACKHNHK"
FT   CDS_pept        140701..140988
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82839"
FT                   /protein_id="CAR82839.1"
FT                   /translation="MHIEAQITVKKEQTEAFLQAAKEVIAASRAEAGNHGYELVQSTEN
FT                   ETVFYMLEKWADMAAIQQHNDSEHFKKFQKLAADFVANELEISVLTPLAR"
FT   CDS_pept        141002..141634
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0138"
FT                   /product="nitroreductase family protein"
FT                   /EC_number="1.-.-.-"
FT                   /note="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82840"
FT                   /protein_id="CAR82840.1"
FT                   /translation="MTYVNNDFEDLMKNRRSIREYDETVKISQEEMKAILEDAVTAPSS
FT                   VNMQPWRFVVVESDAGKEKLSSLVRFNTRQNESSSAMILVFGDLENFENGEKIYGESVE
FT                   RGLMPAEVKEQQMAKLSQYFASIPRSEAERVVLIDGGIVAMQLMLVARAHGYDTNPIGG
FT                   FERTEVAEAFNMDPERYVPVMIVSIGKAKNSGYQSYRLPITDVTTFA"
FT   CDS_pept        141730..142101
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82841"
FT                   /protein_id="CAR82841.1"
FT                   /translation="MTIKITRKTGIGSGITPVKIRIENEEIVKLDNHQSHFFMPKMEKT
FT                   KVCVTDWFYGSQEAVLENSNDVIVRINRKALILNYSMFPFLFFGLLATSWVSTVIALIL
FT                   CLASFFYSRKDWFEFVKIK"
FT   CDS_pept        142382..144664
FT                   /transl_table=11
FT                   /gene="chiA"
FT                   /locus_tag="lmo4a_0140"
FT                   /product="chitinase B"
FT                   /EC_number="3.2.1.14"
FT                   /note="Predicted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82842"
FT                   /protein_id="CAR82842.1"
FT                   /translation="MNKKMKKLFSITSVVLLVLSLVVVSIGAQPKRAKAAENVPQYRNV
FT                   MYYGDWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGV
FT                   QWGGANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFV
FT                   KYTNMDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGV
FT                   DINKKYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGN
FT                   PKDPNYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAE
FT                   KTNKDADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPY
FT                   LYSKETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKTG
FT                   LFGTSAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFET
FT                   VKLPKFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSS
FT                   ASSVDVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALTSSNVTD
FT                   KSATLSWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYTYTVKAYDAAGN
FT                   FSAASSTLTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQW
FT                   GPWLLIN"
FT   CDS_pept        144767..145669
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0141"
FT                   /product="ROK family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82843"
FT                   /protein_id="CAR82843.1"
FT                   /translation="MYFVYDIGGTFVKFALMENNGTVKMKDKFPTTAKSAEELVAQMVE
FT                   KWRPYRTEVKGIAVSCPGVVDTEKGVIYQGGSLLFMHEKNLAEMLARECHVPVVLQNDA
FT                   KSAALAELWLGVAKNVHSAAILTLGSGVGGGIIMDGKLQSGYHLMAGEVSFMETSFDTK
FT                   KLRGTFFGRTGSAVELIKRIASKKNLPNKKDGEHVFELINQGDEEANAIFDAYIYELAS
FT                   QILNIQYLIDPEIIAIGGGISAQPVVVERLNEAVAEIKAANPYHAAQPKIVTCHFQNDA
FT                   NLYGALYNFFLQMDAQNKR"
FT   CDS_pept        complement(145694..147475)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0142"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82844"
FT                   /protein_id="CAR82844.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPNKNITQLFWIAIIFIVSVVVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDVPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLKSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
FT   CDS_pept        complement(147468..149210)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0143"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82845"
FT                   /protein_id="CAR82845.1"
FT                   /translation="MESMKWIWQYVRKYRLLMIGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYQNKTNLLIPLLLIMIISTIIRTICRYTYQIMCERIGQNSLFRIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENVFLFSFAIIIMATIDWKLTLALV
FT                   ILTPLIAILTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKKRNLDSADVSRTYLPVLDSLAGMLVVITLIFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFIASSFKIQDMMATDAKIPIHAEKPAPSLQGHVEFKNVS
FT                   FHFEDDPNTDVLKNISLKASPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILIDGVD
FT                   ARKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRRMARIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKK
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHTSLLAEKGYYFDIYNKQLGTEA
FT                   NVNG"
FT   CDS_pept        149353..150186
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0144"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82846"
FT                   /protein_id="CAR82846.1"
FT                   /translation="MLKINTTTFNPQILYIANCYTNEVRVGENHHHDFLEISIICEGNV
FT                   IYDIEGERVKLGKGDMLIFNPGVNHYDITEPGMTNAQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKKEEESAILSISKQIIEEKDAGKPGYDLILKAFVMQLIIHVLREATPEQLENNGV
FT                   KLSTDEQQKQILVNEIIHYMEKHHTEDVSLSTLSQTMYISPAYISKVFKEETGESPINY
FT                   LIKIRLTRAEELLKNKDVTVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
FT   CDS_pept        150221..151336
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0145"
FT                   /product="lipase family protein"
FT                   /note="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82847"
FT                   /protein_id="CAR82847.1"
FT                   /translation="MEYKKALAFIKSNSILEQEEGTEVIFKRAQETARGNLDPFLLKDL
FT                   KQHLGGTNDAIKEAPQEIQMPDFSNLEIATAAALQMRATMGSPNIDLSNGVTTEYRVVE
FT                   GDYGDIPVRIYRHEEATKPVPAFIFYHGGGFVGGTPAVVENFCKGIAEKLPAVVINVDY
FT                   HLAPEFPAPAAPKDCYRVLEWVVEQSDELGIDASKIGVSGDSAGGTLAAAVSYMDYEAE
FT                   TNYVGFQALLYPALTLVDEDNDKYKWDISKFGASEETLPLVAPGIIGMNGSGELLRTAY
FT                   VRDENPASPIYSPLSAVDKSIYPPTLIASAEFDALRAFADIFAKELRASGVQTKAIVYQ
FT                   GMCHAFIDKYGIFPQAEDVADEIVQMMKEIF"
FT   CDS_pept        151452..152150
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0146"
FT                   /product="EAL domain protein"
FT                   /note="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82848"
FT                   /protein_id="CAR82848.1"
FT                   /translation="MKFQLFIQPKLDVLQGNIVEYEILLRDDSAVPRFPLSELEAVLAD
FT                   EELYLAFSEWFSEAFLDVLKKYPNDRFAINIAPQQLFYIETLHWLDKLKSESHRITVEM
FT                   TEDIFDVPGHKRHLNANDKDAFILNKIKVIHGLGYHIAIDDVSCGLNSLERVMSYLPYI
FT                   IEIKFSLIHFKNIPLEDLLLFIKAWANFAQKNKLDFVVEGIETKETMTLLESHGVSIFQ
FT                   GYLVNKPFPV"
FT   CDS_pept        complement(152120..152815)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82849"
FT                   /protein_id="CAR82849.1"
FT                   /translation="MLHNIDFSAIFSSDYSNKVSFKKGEIIHSYREYEEKPAQIGAILE
FT                   GTAVLEGPTNEGRWMINALISQHSLFGMESLLETKRAPELTEYRVRALENGTALFIDRE
FT                   FLLNYLYANPHFFHLILDEVIVRYLFTAKNYKNINQAPIIKVTRILVEIIELLHLHQTE
FT                   GPIELPVFVTQTFLADYCRSSRARITESLEELRENGLLLAKKPIIISSHEKLLDQVDSF
FT                   QTGNGLLTK"
FT   CDS_pept        complement(153032..153484)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82850"
FT                   /protein_id="CAR82850.1"
FT                   /translation="MYEKLVNKYQDEVTIREEKMPYKLPGLYLNGTIFISKDQSSIEKG
FT                   CVLVEELMHYKYTVGNITKQETLMDKKQEIFARRKGYEELIPLDDIIACFYLGLREYFE
FT                   VAEFLEVTEEFLRHTVSHYAEKYGPMYDYGGYLINFGNSIDVYKKF"
FT   CDS_pept        complement(153490..153825)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0149"
FT                   /product="repressor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82851"
FT                   /protein_id="CAR82851.1"
FT                   /translation="MELNKFVGNKIKQYREERGLNQEALAEKLHTTRQTISRYENGDRK
FT                   ANQDVLFELAKIFNKRLDDFFPERNLPPVDERLVTIAAHIDDDVTEEEMRDILAYIEMK
FT                   KKLHRGM"
FT   CDS_pept        154042..154470
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /locus_tag="lmo4a_0150"
FT                   /product="antigen D"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82852"
FT                   /protein_id="CAR82852.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEQEENRFIRKRLIEELEFFEALGDREKG
FT                   LLTAEQKLLILTPSEYREYKRTKSDVQISRLIGVSRSSLAEWKRKKGLNRKKSQPVQQE
FT                   MIDVLAFHLDKTKDEIGALPASAIECQYEAFVINEAHN"
FT   CDS_pept        154482..154898
FT                   /transl_table=11
FT                   /gene="lmaC"
FT                   /locus_tag="lmo4a_0151"
FT                   /product="antigen C"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82853"
FT                   /protein_id="CAR82853.1"
FT                   /translation="MQVLVLPENKDINYIKTVQEVKRFFADFERFRVITGLSKKPHLLR
FT                   NGFLEEPQFAPVAFSARHNKEVILEARWLVEKYTEMLNQMDDLYRTILMECYVERKQDV
FT                   AVMMDLPYEIAQFKRIKKRAVLEIATLMGILVRK"
FT   CDS_pept        155214..155636
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0152"
FT                   /product="phage holin"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82854"
FT                   /protein_id="CAR82854.1"
FT                   /translation="MEVILKIGILGFGAVFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDAKSGDEEEKHDKDMD"
FT   CDS_pept        155617..156153
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0153"
FT                   /EC_number="3.5.1.28"
FT                   /note="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82855"
FT                   /protein_id="CAR82855.1"
FT                   /translation="MTKIWIDAGHGGKDPGASGNGLVEKNWVLATAKQLQTELVKAGFE
FT                   VGMTRTNDTFLELRERAKKANSFKADLFISLHFNAGGGRGYEDFIYTSVPTKTTEMQKV
FT                   LHKNILAKVAKYGMVDRGMKRANFAVLRETSMDAILLEAGFCDSKDATVLNSNAYQRDF
FT                   CLGILAGVKQIFQNR"
FT   CDS_pept        156181..157452
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82856"
FT                   /protein_id="CAR82856.1"
FT                   /translation="MSEIVKEFDIKKAQDNLATLVNCWEPFQFIMISDSYVYGVSQTAR
FT                   VEPNDATIYQIDNNGEVMGKMLLVGGTHNSAYGVKTINGKDYIYAPIHTSTGDKVVYKF
FT                   EFEKDTTITEKSPKAKKLGDFKQKKSLNISISNDDVFVFTLLADNTATVMKFTLAEFEQ
FT                   GATDSAIKFDVGNKTYGYLQGFAGFGDKVYIAIGPGGTALDPVSKCYLYTHSLIDGSLY
FT                   DKQWISWGSDDELGEPFNKYREPEGMDFFVSKTGEPVLVQTVFTGGNSGDGKTVRRRNK
FT                   LYTITNLNNSDDFTNKFSRKRPASATLFKGELKGNDASTVYLPRDIANFEYIVVSWMHG
FT                   DGVRRQESFHVKTLEGYPRVDLSNIVLQGDGFATIYYFIVEFSTSKMRVVNSRARRMKP
FT                   TGWDALVDPYANSIILSVEGYNLR"
FT   CDS_pept        complement(157505..159853)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0155"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="5'-nucleotidase/2',3'-cyclic phosphodiesterase and
FT                   related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82857"
FT                   /protein_id="CAR82857.1"
FT                   /translation="MNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILGIN
FT                   DFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVGAS
FT                   PAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAYPR
FT                   VKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIKDY
FT                   DFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMMTKANE
FT                   LDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVTPPDAK
FT                   ITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKESEL
FT                   GNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGNIL
FT                   QVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTPLK
FT                   ADQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQKEG
FT                   RKVYKSQAEIDKETEDAAIKAIKDATKINKLAEKDKTLTGTTLPGATVSVQKATANARM
FT                   ALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPPDN
FT                   GNGGTDNGNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTPNTSTTGTSSNTSL
FT                   PTTGDTAGFATVFGIILTTTALYVLRKRS"
FT   CDS_pept        160047..160796
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0156"
FT                   /product="EAL domain protein"
FT                   /note="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82858"
FT                   /protein_id="CAR82858.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLIRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEDIKEKYSIV"
FT   CDS_pept        complement(160866..162374)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0157"
FT                   /product="inosine-5-monophosphate dehydrogenase, putative"
FT                   /EC_number="1.1.1.205"
FT                   /note="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82859"
FT                   /protein_id="CAR82859.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILDLKEKTGHSTVAVTEDGTAHGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
FT   CDS_pept        162541..162774
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82860"
FT                   /protein_id="CAR82860.1"
FT                   /translation="MDEETLLERGYRKYRGAEVDIYFNTNICEHSGNCVKGNAELFNLD
FT                   RKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK"
FT   CDS_pept        162786..163064
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0159"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82861"
FT                   /protein_id="CAR82861.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKTEGKKIVPLCPFAKAEFAKKPEYQEVQAAK"
FT   CDS_pept        163391..164965
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0160"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82862"
FT                   /protein_id="CAR82862.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSLIIG
FT                   VTGDPEVINPNYASDRVTLTIQQAVYAPLFWEVDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVNSILDTKQNSPNRGNFVFDDKPVKVEAVDDTTVKFTLPTVA
FT                   PAFDNTIKTFFPIPKHIFEGVENIEKSDKNKNPIGSGPYKFVEYKTGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YATFNENQPALKSKELRQALSYALDREEIIDAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKKLVKESGFDTSQKLTVYYLNNSKSQESIALYLQQQYKEIGVTLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLYLSDAPYNYSNYHNKDLDALWEKG
FT                   AVTADDKERQEIYEKIQNTIADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
FT   CDS_pept        165067..166017
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0161"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82863"
FT                   /protein_id="CAR82863.1"
FT                   /translation="MLKTIIKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYVQYFIWLGNLLQGNLGYSIVNSQPVLQQILERIPATLGLVGT
FT                   SLVLTLLLSIPFGLVAANYENTWIDKVLNGISYIGISIPIFWFGMILIDVFSIQLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQIMGHHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIVDPRIREMG"
FT   CDS_pept        166025..166921
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0162"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82864"
FT                   /protein_id="CAR82864.1"
FT                   /translation="MMRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSV
FT                   LILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLV
FT                   GVFAMMIAVVVGTLAGTVSGYFGGFIDNMVMRFLDIFMSIPSFFLLMILNAYLKPGISN
FT                   IIIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVA
FT                   ASLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTIL
FT                   SFNVLGDVLRKGLSRRY"
FT   CDS_pept        167122..167406
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82865"
FT                   /protein_id="CAR82865.1"
FT                   /translation="MSEIKVKEATLKKHATKLESKGKSTEYLPMKGGNMAYSQANSINH
FT                   FRTALFDLVDAVDNFQGVVGTDAKRLQELGASFTRKDQELERGMGLGDK"
FT   CDS_pept        167407..167775
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82866"
FT                   /protein_id="CAR82866.1"
FT                   /translation="MDAKSQQMETQLQLLKKEQSAAEDFLQDLQRQQNEQEWLAEDFAR
FT                   VHQEERESLELLREVWQGAESRSFGYYLADLQEEEKQKWHKKIQANQEEHQQKITACQK
FT                   NIYQLENQQQDLQKELLQ"
FT   CDS_pept        167772..169076
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82867"
FT                   /protein_id="CAR82867.1"
FT                   /translation="MSRIDIGEIQTFAHQLHTANETARKSIKDIKNAVENYTEDSSLKG
FT                   KAIDASKNYYQMTYFPLCDAIIEAMNESEERLAQYIADFHAQVDGSADAKIDADGLYEL
FT                   GKMIDRIEAKKEALAQRMNTGTEGQMQSYRSQLSIAYKQENILEKYLAFEQSHSGFFDN
FT                   LTDLVQGIQQTIRELQSNIQFNSKTGTYDMSKLNFTTVTRMQNALGKALKNNEKTFNFD
FT                   EYQKTYRGQMWVLMKNGIVDVEATNAYNAAVLNGELPHESNEAQEEAELLQAVIQSVKE
FT                   GIDPVTGQEISKAQGFGIISGLVFRYTAGGYKGKKFKVSKDWLHRRKKNNGVEVGTDFG
FT                   KIGKLVNHPNIKINWSEHSEHGMSRLKQRGLSKSQVDDFVERGKALSQNGGEKFAFITE
FT                   NGVAIVSKDGKLVTAWGKKDFDEGMEKIIEKLYGK"
FT   CDS_pept        169086..169328
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82868"
FT                   /protein_id="CAR82868.1"
FT                   /translation="MYEKVEKIINDWDPIELFPLAPKDEYSQEINKIISIVQENHNIDM
FT                   NVLAKGIRKIFIDSFGENLIFKNNEDEIAEKILAL"
FT   CDS_pept        169349..169792
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82869"
FT                   /protein_id="CAR82869.1"
FT                   /translation="MEEQEIIEKVEILPNNFSENDSIYISQENIKNLVLFSKENQTVLG
FT                   LLITPFLICENSGLKYELHYYEISTEISKNDTEIIGFPFGNKLPKEITDNISPKIFVRR
FT                   EDYSAFENFLSQYFNAMKSMEFADDKQAIGMIEHGATLFYEVL"
FT   CDS_pept        170024..170260
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82870"
FT                   /protein_id="CAR82870.1"
FT                   /translation="MPDWDFNNPESIKAWDLASGSYAEQVSGEVRAVVGSDLRKGNIWE
FT                   NVELPRLKNNPNVTKITTIDPKTGLEKIIFERK"
FT   CDS_pept        170266..170499
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82871"
FT                   /protein_id="CAR82871.1"
FT                   /translation="MKITGNSSQVKFDLENGYVVKADGEMLVGGEFVVFKDSMKNWEPP
FT                   YENKKISESEVQEIIHQVKQSTNENTVQISFE"
FT   CDS_pept        170587..170778
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82872"
FT                   /protein_id="CAR82872.1"
FT                   /translation="MDNFYKGFEGYPEIDFYTYINGEKTGIEMWEGYFDSIMNELSPVD
FT                   GRWVSLAYYYHHLYEGLV"
FT   CDS_pept        170762..170938
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82873"
FT                   /protein_id="CAR82873.1"
FT                   /translation="MKGWYDESSWVIPDNKKTLEQFETIDIKVLDNVTQEIMMKLIKLL
FT                   KDNLDSEIFIEYS"
FT   CDS_pept        complement(171263..172918)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0172"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="ABC-type oligopeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82874"
FT                   /protein_id="CAR82874.1"
FT                   /translation="MHFLKKTLPIFAILTVLLLTACGNDNEKSTTKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPEISADQTKYTIKLKKN
FT                   AKWSDGSQVTADDFVYAWRRAVDPKTAPGYSALFKDSIKNATEINEGKLPVTDLGVVAT
FT                   DPTTLEITLKKPVPYFISLLSFETFFPQKESFVKKQGDKYGTDSAHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDQYWDKDNVKVNEIDVQVAKDINAGVNLYNTNEADRVPLSGDFAKQY
FT                   KDKKDFQTEKDALISYLRMNQKRDGKATPLANNSLRHALNLAVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGDHLVYNKEEALKYWKQAQKELGTDKVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTSDGNYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYFNNHMSYNSPAYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIRVEK"
FT   CDS_pept        173140..174081
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0173"
FT                   /product="zinc ABC transporter, zinc-binding protein"
FT                   /note="ABC-type metal ion transport system, periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82875"
FT                   /protein_id="CAR82875.1"
FT                   /translation="MKKWSFLVVTVLAFVLVLAGCGASNDKVSGDKDKLKIVTTFYPMY
FT                   DFTKNVAGDNASIEMLNDAGTEPHDYEPSAKDIAKIEAADVFVYNSEDMETWVPSVLKS
FT                   LDSKKLTVIDASKGIELVEGTEEEDHDHEHEEGHHHEHDPHVWLSPVLAEQEVTNIQNG
FT                   LTKADKTNADTYKKNAETYKEKLKTLDNKFKTAFEGAKQRDFVTQHAAFQYLAKEYDLH
FT                   QVAIAGLSPDQEPSPARLAELQKYVKENNISTIYFEEVASPKVAETLANETGAKLEVLS
FT                   PIEGITDKEQKKGMDYIAYMEQNLQALQKTIK"
FT   CDS_pept        174094..174798
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0174"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /note="ABC-type sugar transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82876"
FT                   /protein_id="CAR82876.1"
FT                   /translation="MKYIDIANIGFKYESEPVLENISFQVSAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVTFAKKNADGGRLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTTKDHAHVEKALKSVEMWDYRHKRIGELSGGQKQRICLARMFATDPDILILDE
FT                   PQTAMDKQSKIRFYDLLRHEAQVHGKAILMVTHDSEEMEDFVDKHIRLIRKEDVSWKCF
FT                   SMDLCKEPSKHQ"
FT   CDS_pept        174747..175553
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0175"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /note="ABC-type Mn2+/Zn2+ transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82877"
FT                   /protein_id="CAR82877.1"
FT                   /translation="MEMFLYGFMQRAFQASMIIAIIAPLLGVFLIIRRQSLMADTLSHV
FT                   SLAGVAFGLVLNVNPSVTTLIVVVIAALGIEYLRGVYATYSELSIAILMAGGLAVALVL
FT                   MSLDQGGITTSVQQYLFGSIVTISKAQVQLLVILGVAIVVLFLVFKRFMFVLTFSEDVA
FT                   VAEGVPVRLISLLFSVVTGIAIAVIMPIAGALLVSALIILPAAIGMRISKGFLMCVISA
FT                   ILIGLVGMFSGLVSSYQLGTPPGATITLMFIILFIISTVVLKLARK"
FT   CDS_pept        complement(175557..176237)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82878"
FT                   /protein_id="CAR82878.1"
FT                   /translation="MSKTLYNYQEFIRLSHEGRITYEQIDVPKNASLLTEKADIDNHIY
FT                   LVVDGYIALILNDGKEHSKIYSIQGKGTFLNYFTLLDQSDNRFNFKTLSGCSLYKYSKI
FT                   DMEYFLSMFPENFGFQFFIMKNQTTHLYFKSLMASSPASEKLKTTFSNMALLHGVLSDD
FT                   DTVILPQAIKTSHLLSYSNLSKSCFYKDLQHLKTTNQIEKKEKSWIIHDQELYAMIQNG
FT                   QTSF"
FT   CDS_pept        176516..178855
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0177"
FT                   /product="DNA repair helicase family protein"
FT                   /note="Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82879"
FT                   /protein_id="CAR82879.1"
FT                   /translation="MRKVQISVRRLVEFVLRSGSIDNRMTSSDRALEGTKIHQLLQKEA
FT                   GEEYVAEVSLKLERIVDGIAFSLEGRADGIINDQMIDEIKTTETPMKEITEDFRPLHWA
FT                   QLICYGFMLAEKSDLAEVTLQLTYYQVSDKEVKQFQRVMSREDMGAFVDDLLSKYAIWA
FT                   KASAAWEMKRNKTIQELTFPYDNYRSGQRELAIAVYRTVASEESLFCEAPTGIGKTMST
FT                   LFPSVKAMGEGKTDKLFYFTAKTITRQVAEDALDEMRRKGLAARSVTITAKDKICFLDE
FT                   RKCEPDHCQFARGYYDRLNEALFDMLQTEEAITRPIVESYARKYTLCPFELSLDVALFC
FT                   DVIVCDYNYLFDPVVYLKRFFAEGPGKYTFLVDEVHNLVDRARSMYSATLKKSLVMQVK
FT                   RGLDSKKNKRLLNAINAMNKEMIALNKKLKDLEKTIYVQKDELGDWNASVLKFTFVAKE
FT                   WLPQNAQSESQADVLELYFESLRYVAIAEFYDDRYVTQVTRSHGDLEIKQLCLDPAFLL
FT                   SEKLKLGSSSVLFSATMRPIDYYTNVLGGQEDTSRMIFSSPFKQKNMHLLVADYISTKY
FT                   QMRENSMEAVVDALYALASGKKGNYLFFFPSFLYLQKVYDLFKEKYPNIRSQKQETAMD
FT                   EEQREHFLENFQAGNEESLVGFCVLGGVFSEGVDLRGERLVGAAVVGVGLAQLNHESDL
FT                   IKDYYNETIGRGFDYAYQIPGMNKVLQAVGRVIRGESDCGVVLLIEERFSADRYRALFP
FT                   AHWNHAKTVKSTDDISREVAGFWQNR"
FT   CDS_pept        178901..179713
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0178"
FT                   /product="Cof-like hydrolase"
FT                   /note="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82880"
FT                   /protein_id="CAR82880.1"
FT                   /translation="MYKIIAIDIDGTLLNDAHEITPAVRDSIKAAKEKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDVGDYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPASIHVSKVMLLDSPEKIT
FT                   DVIKKLPESIKQKFYVVRSVPYNLEFLQKGVNKGSALASLAEKLGVSQSEVMSIGDQEN
FT                   DISMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLVLDR"
FT   CDS_pept        179998..182061
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0179"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82881"
FT                   /protein_id="CAR82881.1"
FT                   /translation="MSKNGNFLKKVGLAFLSILIVASTIFQTTVVKAATSYGSQFLNTV
FT                   ELLDKDGVPQTNFGYYDNMDVHYTWSIPNSTNVKAGDTMDFTLPSQLALATDLAFDVKD
FT                   SKGQVVGTATVKRATNQVTLVFSDYVEKHSDIKGELDFWTTFNQKVITGNETVDLEFPL
FT                   QNGTTGIDVEVGEKTPVSPTETLFKYGWVDASNPSLIHWVIRVNYAKVNIPNAVFTDII
FT                   GSKQTLNFDSIKAFHGTYSADRIFTAGAAISSTNFSATSDGFSVALGDLTDSVQISYTT
FT                   TATDGGKSTQYDNTAKLAGTDFVPKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKAT
FT                   LEGAEFKLVDSKGTVLQENITTNASGQLSIADLKFDTYQLIETKAPTGYKLDTTPVEFT
FT                   IGENNKAITVTKENTLNTGSVELTKLDAATKATLAGATFELQDKEGNTLQTDLKTDENG
FT                   VLKVTDLVPGSYQFVETSAPTGYKLDNSPVSFEIIATETDQIVKVTKENVLEVGSVELT
FT                   KLDSLTKATLAGATFELQNKEGNTLQTGLTTDENGVLKVTDLVPGTYQFVETNAPIGYE
FT                   LDTTPVVFEIIAGETDQPVKVTKENTPTPPTPPAPVPPNPAPPVPSKPTVPPVKPEISV
FT                   IPQKSENSEDSPKKSNLSITSSLPKTGDANDFAGLGVLFIALSLSGFLMKRK"
FT   CDS_pept        182251..183975
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0180"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82882"
FT                   /protein_id="CAR82882.1"
FT                   /translation="MKKRTTMTSNLKKFGLAFLSVILLVNVLFQTNFVKAATNYGSDFL
FT                   KTVELLDADGNPQTDFGYYDSIKVHYTWEIPNSTNVKEGDTMEFVLPPELKIVTDLDFS
FT                   LKDHDGNTVGHVIAKKSTGQVVITFTDFVEKNSNISGYLDFWTNWDKSLVEGNENVPVE
FT                   FPVNGTTETIDVGVGGKNQIDPDESLYKYGWANAEHPELIQWVVRVNYSKQNIQNAVYE
FT                   DFIGPKQVVDFNSIKAFHGEFDPDDNFTPGAEVPSSAITQTTEGFKVDLGNLTDSVKIS
FT                   YYTTSTDNGASPNYTNKGQLTGDNFIKQEIEVATPTSGGGGGGEGTTGSVELTKTDDSS
FT                   QKNPLEGAEFKLVNGAGTTVQTGLKTNIDGKLTISNLKYDTYQLIETKAPQGYVLDASP
FT                   VEFTIDDAHQSLFLSKENSAIKGSVSLEKIDHDTQNLLADAEFELQDKDGNTLQTNLKT
FT                   DKMGKLTVTDLLPGEYQFVETKAPTGYILDATPVKFKISTESLNITVTKENTKKPETPK
FT                   VPEPPKTPEQPGKPDKIISADSKQTTLPKTGDTPLVNGWGILLVAISASGLIALRRK"
FT   CDS_pept        complement(184536..185372)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0181"
FT                   /product="STAS domain protein"
FT                   /note="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82883"
FT                   /protein_id="CAR82883.1"
FT                   /translation="MNESNGSMELYLREHTEEIINNWLSKIYENENTYTSFVYSPRYKD
FT                   ELRADSEQTADLIISYFAGKKAFFEKLDKWLDNMYARRMENEVPLPEVITTLDKLRREF
FT                   VSAVGDFCIHNDEVSKCDFSSSLSMVNHGFDRINEAFSAMYYNDIVKHLEQQHRLIEEI
FT                   STPVISITDKLAILPLMGRVDRERAEKLSEITANKCVHLGVEQLCIDLSGITYFDDALG
FT                   EMLTNLVTMLKLLGVEAFISGIQPKMAQQINRVELNLSIPAYHSLKAVLQDQTRTI"
FT   CDS_pept        185589..186581
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="lmo4a_0182"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82884"
FT                   /protein_id="CAR82884.1"
FT                   /translation="MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLLEGSSGTGKKRTA
FT                   LWLAQSLFCLESTETELACGKCANCMRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEQAKAFEEEEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
FT   CDS_pept        186587..187420
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82885"
FT                   /protein_id="CAR82885.1"
FT                   /translation="MLKIVGVRFKDVGKIYYFSPGELEITENQGVIVENAQGIEFGKTV
FT                   IEPRYVDEEDVVLPLKKVLRIATEADYKCVAENGDSCQKAFLLCDEKIRERELEMSLVD
FT                   VDYTFDRNKIIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYEQAKREMPDV
FT                   GVKVKTPEGAEARVSGINLLSRILQVSLPEEETVIEYELDELRPYNEFLKQPAKS"
FT   CDS_pept        187431..187820
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82886"
FT                   /protein_id="CAR82886.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAETEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
FT   CDS_pept        187879..188631
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82887"
FT                   /protein_id="CAR82887.1"
FT                   /translation="MEKTKLIGDERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFSYLP
FT                   IRKGKIIDLCSGNGIIPLLLSTRTKAKIVGVEIQERLADMAKRSILYNQLEEQIEMIEY
FT                   DLKNITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDTIRVAASL
FT                   LKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLVEGIKDGKPGV
FT                   KYVPPVIVYDELGEYTPVIKEILYGESK"
FT   CDS_pept        188615..188887
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0186"
FT                   /product="endonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82888"
FT                   /protein_id="CAR82888.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVIRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLLQREEEAK"
FT   CDS_pept        188884..189765
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0187"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /EC_number="2.1.1.107"
FT                   /note="Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82889"
FT                   /protein_id="CAR82889.1"
FT                   /translation="MIKSQKSFSGAIQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPG
FT                   YELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAV
FT                   REETWILYESPHRLKETLKALAKITGNDRKMVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTVMEQENISSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
FT   CDS_pept        complement(189810..190094)
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="lmo4a_0188"
FT                   /product="transition state regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82890"
FT                   /protein_id="CAR82890.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIIL
FT                   KKYSAGLVCDVTGEFSVENKKFVDGKLTLSKEGAAELMEEIKRRFGDTL"
FT   CDS_pept        190208..191065
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0189"
FT                   /product="glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82891"
FT                   /protein_id="CAR82891.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTATIIIASFVSGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDESSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
FT   CDS_pept        191133..192395
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82892"
FT                   /protein_id="CAR82892.1"
FT                   /translation="MNAKLEVNGELVKESYVYLLSRYLVLRQENFDTKEDKIPYNTLKH
FT                   NSISPADANFVNPNFDVVYSEAWIAVDDENAVILEVPEIKNRYYTVQLLDGWGEVVTNI
FT                   NERNFPEHPHGKFAFVKKGTNPSVPSDAVKIELPSEKVKVLLRVEQKDDPEGAVKLQKA
FT                   FKFDAPDNIKIKEPLEIPHFTNADFLLEEIYSNLEELLATYPDKMPKAAEFQDKARKVA
FT                   AYIELGDEQKAEVRDLIVKEAIPYFTNGAKGFGTQKGGWSVTYVAGAFENDILARAIIN
FT                   YGGIWANSIQEALYFIGQKGTDNELLTGDKVYKIHFPADELPSELADAFWSVTLYSVPD
FT                   YHVIPNKLNKFCINNYTGPKLSEDGSLTLYIAAEKPADVDPGNWLPSKAGKEFSLNFRL
FT                   YVPKKEVLEGKVFLPPLEVIK"
FT   CDS_pept        complement(192543..193799)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0191"
FT                   /product="cell wall surface anchor family (LPXTG motif)"
FT                   /note="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82893"
FT                   /protein_id="CAR82893.1"
FT                   /translation="MFTKKKTIASLLILSSLAGQIALTPISALADTQDTNNIALLQNTN
FT                   ENVPYKYTSTLTFPVLTNQTQEDYKLEIKLALPAGMNYTDLQVSVGGEDITNQVGTTSF
FT                   DSSTNTVTFKFDKVTSWDSLSKAKVKFDWKTSYSGEGGEAKIDSLVATATATSEDKAGN
FT                   KSTSTGSLKPKDISAPVVKADKTEVTYNLGSNVTEEQFLTDINASVTDNYDSTISLTSN
FT                   FTSIVNLAVSGDYSVNVQATDKAGNVSNTVNVTVHVATPAPVAGANITVNYLDSDGNKL
FT                   AESDTLTGTIDSNYQSTSKKISGYTLETTPKNATGTFTDTPQTVDYIYKKDTVAPTPVV
FT                   DPVNPVDPVNPVNPVDPVVNKPVIVTPNADQVTTSNSVEKTTYNSLPKTGDTDQSTSAT
FT                   IFGALLLLISAPLLLFKKK"
FT   CDS_pept        194054..194914
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0192"
FT                   /product="glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82894"
FT                   /protein_id="CAR82894.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAIGMVLSALIMTHSGGTEKRFNKRTLLLTIPGIIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIVLLKEKKTQKEMFFVIVGVVLVVLGGILIG
FT                   VAKGA"
FT   CDS_pept        194983..196980
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="lmo4a_0193"
FT                   /EC_number="6.1.1.10"
FT                   /note="Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82895"
FT                   /protein_id="CAR82895.1"
FT                   /translation="MLPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGY
FT                   DVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRH
FT                   KTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGN
FT                   EVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLR
FT                   EVPFGSDGLFTPEDFVDRVNYDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQT
FT                   LVDFKNNVVKEYEASMEHMQFSVALNQLWSLVSRTNKYIDETAPWALAKEEEKRAELAS
FT                   VMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKK
FT                   GTPIFPRLDAEVEVTYIQDEMKGSAPAPAEEVAEVEALETPQIGIEDFDKIDLRVAEVK
FT                   QVDKVKKADKLLCFQLDLGEGKLRQVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLM
FT                   SEGMILSGEKDGKLSVIEASSALPNGAKVK"
FT   CDS_pept        197144..198358
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0194"
FT                   /product="xylose repressor protein"
FT                   /note="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82896"
FT                   /protein_id="CAR82896.1"
FT                   /translation="MDILRKGNKDLIKDINRYTVLNLIREKGEITRTEIAKKCDFGMST
FT                   STYILDDLQQEGIILEGAETSSTGGRRAKLVRFNKDYGFVVSVKVEEEQLLFALTDLNA
FT                   DIIENTSIPFSSEKKPEEAIDLIAKNVKKMCENRDMNHLLGVGIAISGLVNRKKGTVIR
FT                   STMLGWENVALEAMLHTHFPDIPVYVDKNINCYTLAELWLGEGKQSNNFATVSVGAGLG
FT                   LSVVINRQIYYGAQGGAGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKEA
FT                   YPTSELNDFHFDKVAKSARAGDEMATELMGKMGEYLGYGIRNIINTFNPEKVIIVGEGL
FT                   HHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQGAALLVIHQLFQVPIYEEE
FT                   QTLLR"
FT   CDS_pept        198394..199272
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0195"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82897"
FT                   /protein_id="CAR82897.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFENYKRLFNDPEFWKSFRNTITFIIGYLPSVMILGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPSYGLINYFLSLIGIAGPNWLTDPQTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
FT   CDS_pept        199272..200120
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0196"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="ABC-type sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82898"
FT                   /protein_id="CAR82898.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVVVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
FT   CDS_pept        200148..201404
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0197"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82899"
FT                   /protein_id="CAR82899.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTKTTIN
FT                   SPENVAALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
FT   CDS_pept        201487..204789
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0198"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /note="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82900"
FT                   /protein_id="CAR82900.1"
FT                   /translation="MSKFTKLMQGYLHLIEGKNEKIKPILLETKPNFTTDSVLETASWL
FT                   WLSSKINHYDREEVEPVIAFLVENWNRPEKSIWGSAENDIYLATISSVYSALLDVKNTF
FT                   PKPELQQTITIIRDYCFDNLLKGDSILTGFNTRKVSTDQLLSVLPFGLFSPEDLVMVAA
FT                   VGKMEQQLVQDDGVLPYSGAPRVNSFATALMALYFLEKSDQDKALHYLNMAMKMEDNDE
FT                   LGAIFIEINQAFRAMESEVTAHISHDPFGHENRYEQQLTERTPHYPETEMHFSAACEVI
FT                   SEVEPIQVELVLKEKDWTILCEKKEKNDVQIWEALVPPLEEVGEYTYYFQATMKDQTTL
FT                   TSDDYKVEPIWKHWSEEAAICETEQGLMVLFKENPSSIIPVEFTVKSDELVIGLKPSFE
FT                   ASNVKTKSSGQLKKDDLEIIVSNNPVRLEVHFKGKLILESHKIYPALQWYTDKTGTINK
FT                   VKLHLDAPKEEEYYGFGERYNALGQRGNVLDCFVYNQYRDQGTRTYIPMPFYHTNRDYS
FT                   VFVDTARYTSFDLGNQLADKHTITVEINGCDTDICLLMGDIRSAVANYMKKTGKPAMVP
FT                   VWALGPWMSSNNWDRESVVRNEVETTQELQIPSTVVVLEQWSDEATYYMFNDAEYDEKA
FT                   PSEAYSYDEIRFPSWGRWPDPKGMVDYIHDNKMKLILWQIPIQKYLNRQQHPLKDREEA
FT                   YMIEKGYVVKNPDGSPYRIPENWFTESLIMDFSNEEGKKWWFDKRQYLIDIGVDGFKTD
FT                   GGEFVFGEGLQFADGRRGDEMRNLYPNDYVEAYYQFAQQNDGMTFSRAGYTGAQNFPAH
FT                   WAGDERSTFDAFRRSLIAGLSAGFSGIPFWSFDFAGFNGDIPTAELFIRSAEMATFCPI
FT                   MQYHAESKAEFNQDRTPWNIASRTGDDSVIPIYRHFANVRMNILPYIYNESLKCVETGL
FT                   PMMRALLLDYKEDPRVSDMYDQYLFGEAMLIAPVIEDGVRSREVYLPEGTWYDFWNGTK
FT                   VSGPTLRKCKADKEEIPVFIRGGKAVLCNVDATLKLGSWVGNTVEEYDTPLLKIYVDGD
FT                   FTEEMTDHLSEKWLVKVTENADEVVVSIQTNTPAYEVEVIGTTKKVQIKKGR"
FT   CDS_pept        204792..207083
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0199"
FT                   /product="alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82901"
FT                   /protein_id="CAR82901.1"
FT                   /translation="MDASTSFAILPSNVKQKTAFPRKVNQVKTASWANNCLTGTLDIGQ
FT                   FSCYFVNEKIARVTVNPFGEVDLTPSIAAIHDTEKQAAKFTETTDGYELHFADKEIIVC
FT                   KNPFRISMKQAGKRIFQTEGLAINRDKEHQISIQSDPGTAIFGLGEKTGALNKAGSIIS
FT                   MWNTDVYSPHNKDTVELYQSIPFMIADTAETTYGLFYDNSHRTEFDFQSFEEMYTILAE
FT                   GGQANLYVIFGEDTKEVVANYTDLTGKTPLPPKWSLGYHQSRYSYTSEEEVERIANTFK
FT                   EKEIPLDCVFMDIHYMDDFRVFTFNPDTFPNGPELIARLREQNIDVVPIVDPGIKKDVD
FT                   YSVYQEGIKHNYFCSKLEGSIYYGDVWPGVSAFPDFLSTTVQRWWGDLHKFYTDIGIRG
FT                   IWNDMNEPSVFNESKTMDLDVVHNLDGKNVTHKEAHNLYGLYMSKATFEGLKRLVPNER
FT                   PFSLTRAGYAGVQRYSAVWTGDNRSHWEHLEMSLPMIMNLGLSGVAFTGADVGGFSSDC
FT                   TKEMLIRWTQAGAFLPYFRNHCVQDSIYQEPWAFGADAERIVKQYIELRYAFLPYIYTE
FT                   FQKTAESGLPLVRPLYMEFKDERDLIQVNDQFMLGENILVAPIVREGQVKRLVRLPKGL
FT                   WFNYWTKEQLVGGDYIIADAPIDTMPIYIKAGTILPVGSSVQNTKETQELALEVYLDGD
FT                   AASGYVYNDDGKSYQYESGAVSKTTLTATFKNGEVQINANHQGEEKLQQKVTTIQVFGE
FT                   KIDKITRAGI"
FT   CDS_pept        207087..208748
FT                   /transl_table=11
FT                   /gene="malL-1"
FT                   /locus_tag="lmo4a_0200"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number="3.2.1.10"
FT                   /note="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82902"
FT                   /protein_id="CAR82902.1"
FT                   /translation="MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELG
FT                   VDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDQLLQGLHDRDMKLVMDLVVNH
FT                   TSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSK
FT                   KQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDA
FT                   GNDFCNGPRIHEFLQEMNQEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFE
FT                   HMNLDSDGDNKWDLKPIYLPDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDN
FT                   RFRVRSAKMLATCLHMMKGTPYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGH
FT                   SHESIMQSIYTKGRDNARTPYQWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSI
FT                   FYYYQNLIKLRKTTEIITTGNYRLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISD
FT                   ETILNEIQKGSVLVNNVPNIIEGTLRPYEAIVYQIK"
FT   CDS_pept        208846..209619
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0201"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /EC_number="3.1.21.-"
FT                   /note="Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82903"
FT                   /protein_id="CAR82903.1"
FT                   /translation="MLFDTHVHLNDEAFDDDIEEVIKRAQENDVTRMAVVGFNKETIDR
FT                   ALELAEKYDFISLIVGWHPTDAITFTDADLEWLRDLALTHPKVVALGEMGLDYHWDTSP
FT                   KETQFEVFRKQIRLAKEVNLPIVIHNREATEDVVRILQEEHAEEVGGIMHCFGETVEVM
FT                   EACLAMNFYISFGGTVTFKNAKLPKIAAQAIPIDRLLIETDAPYLAPTPNRGKRNEPGY
FT                   VKLVAEKIAELKEMKYSEIATHSTENAKRLFKIKD"
FT   CDS_pept        209911..211125
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82904"
FT                   /protein_id="CAR82904.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKTNVADLLKDENITTRPQDVLNVALDTKLKDGLKVNIDRAIQLSLQNGT
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGEKVVEYKVTFENGKEKKRDVIKENVTSNKTDKV
FT                   VVRGTKEKVVATQVSTSSSSASSSSSSAPSSGGKTYRMESTAYSGGGITAYGINLSANP
FT                   GLKVIAVDPRVIPLGSKVWVEGYGEAIAGDTGGVIKGNIVDVYFPNESQCYSWGRRMVT
FT                   VKVLN"
FT   CDS_pept        211227..211802
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="lmo4a_0203"
FT                   /product="primase-related protein"
FT                   /EC_number="3.1.26.8"
FT                   /note="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82905"
FT                   /protein_id="CAR82905.1"
FT                   /translation="MSGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGTPAEKQFISKDILIHLGLLGGAGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEEQLVAACQKIMQEEENE"
FT   CDS_pept        211795..212682
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="lmo4a_0204"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Dimethyladenosine transferase (rRNA methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82906"
FT                   /protein_id="CAR82906.1"
FT                   /translation="MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDSNILTRITDTAE
FT                   ITKETNVIEIGPGIGALTEQLAKTANEVVAFEIDQRLLPILDDTLSAYSNVQVVHGDVL
FT                   KADVEEVVAEQFAKPELPLKIVANLPYYVTTPIILKLLHDNIPADSMTFMLQKEVADRI
FT                   SAVPSTKSYGSLTIAIQFYMEAELAFIVPKTVFMPQPNVDSAVIHLKRRKEPLAEVNDE
FT                   EFFFEVTRASFAQRRKTLWNNLASKFPALKPRKDELVEGLNAIGIDLIRRGETLDIPEF
FT                   AKLSNFLGDFLKEK"
FT   CDS_pept        212802..213059
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82907"
FT                   /protein_id="CAR82907.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
FT   CDS_pept        213198..214073
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="lmo4a_0206"
FT                   /product="4-(cytidine 5-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="Homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82908"
FT                   /protein_id="CAR82908.1"
FT                   /translation="MKISITAPAKINLSLDALYKRDDGYHEVEMVMTTIDLADRLYLER
FT                   LDEDKIVLDVKAHFIPEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNIIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNMPG
FT                   CWIVLAKPSISVSTPTIYKELQVESVEHPDTKKMIESIKNGDLDGIFASTGNVLESVTL
FT                   EKNPQVKRIKDRMLAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSEGENDTNK"
FT   CDS_pept        214099..214836
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82909"
FT                   /protein_id="CAR82909.1"
FT                   /translation="MKIIFNADDFGISPGAVYGILESYKRGVVKSTTLLANSPAFDLAV
FT                   EVAKENPGLDIGAHLTLTFGSPVLQGLETLTDDDGRFRRNYTALENGLADVDMNEVERE
FT                   LTAQIEKILDAGITISHFDTHHSIEPLIYPVQHKLAEKYGVSIRRHSDVSDFGAIKTPD
FT                   LFATEFYADGVSFETIKKLVQEHIGTNDVVEVMTHPAYIDETLREISSYVEPRIKEVSI
FT                   LTSRELQAYLGQQEVEIISFRDL"
FT   CDS_pept        215000..215818
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="lmo4a_0208"
FT                   /product="Pur operon transcriptional repressor"
FT                   /EC_number="2.4.2.-"
FT                   /note="Adenine/guanine phosphoribosyltransferases and
FT                   related PRPP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82910"
FT                   /protein_id="CAR82910.1"
FT                   /translation="MKIRRSERLIDMTQFLLSHPRKLVPLTMFAERYGSAKSSISEDLV
FT                   IIKKTFEDRGIGTLETVPGAAGGVQYISIAGNDDVLDFVHTLCNRIAEPNRLLPGGYLY
FT                   LSDLLGEPVTLKAIGKILATKFNNQKIDAIMTVATKGIPIAQAVAEHLSVPFVIVRRDS
FT                   KVTEGSTVSINYVSGSSKRIEKMELSKRSLAEGSNVVIVDDFMKAGGTINGMKNLLEEF
FT                   NAHLVGIGVLVESEYAEERLVDDYVSLVKIKNVNMKEKQIEVVDGNYFNS"
FT   CDS_pept        215991..216668
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0209"
FT                   /product="secretion protein, HlyD family"
FT                   /note="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82911"
FT                   /protein_id="CAR82911.1"
FT                   /translation="MKKWVKWLIVIVIIAVVAVGAVFLLSKNSGSVTQEKLVTAKVKQG
FT                   EMKINATGTGAISPQNTQVPDYDELQLVAQMDELDIPNIKKDQEVKITVTALPDKTYTG
FT                   KVKEIAEQGQVQNGVSSFSVIISLDKTDDLKAGMTADASILVNEKKDALYVPIEAVQKD
FT                   SDDKYYVLVPEEKDNGQTKKVKKFVETGLHNEDNIEITKGVKKDEKVILPTQETATVPG
FT                   APS"
FT   CDS_pept        216717..217409
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0210"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ABC-type sugar transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82912"
FT                   /protein_id="CAR82912.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVEQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDEGSYHLDNVDVFKLSDNKLSEIRNKKIGFIFQQFNLLPKLSA
FT                   FENVELPLIYAGLSVSAREKAAIECLEKVGLLEKRRNLPTQLSGGQQQRVAIARALAGK
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEEATQA"
FT   CDS_pept        217406..218614
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0211"
FT                   /product="ABC transporter, permease protein"
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82913"
FT                   /protein_id="CAR82913.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKSSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGV
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
FT   CDS_pept        219301..219609
FT                   /transl_table=11
FT                   /gene="spoVG-1"
FT                   /locus_tag="lmo4a_0212"
FT                   /product="stage V sporulation protein G"
FT                   /note="Uncharacterized protein, involved in the regulation
FT                   of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82914"
FT                   /protein_id="CAR82914.1"
FT                   /translation="MEITDVRLRRVETDGRMKAISSITIDGEFVIHDIRVIDGNEGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRAKIQEAVLAAYEVADEPAVNEESSADESVVEEN"
FT   CDS_pept        219728..220036
FT                   /transl_table=11
FT                   /gene="spoVG-2"
FT                   /locus_tag="lmo4a_0213"
FT                   /product="stage V sporulation protein G"
FT                   /note="Uncharacterized protein, involved in the regulation
FT                   of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82915"
FT                   /protein_id="CAR82915.1"
FT                   /translation="MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFV
FT                   AMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYERVGEEEATAVTEEESESVSAE"
FT   CDS_pept        220424..221797
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="lmo4a_0214"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="N-acetylglucosamine-1-phosphate uridyltransferase
FT                   (contains nucleotidyltransferase and I-patch
FT                   acetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82916"
FT                   /protein_id="CAR82916.1"
FT                   /translation="MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLN
FT                   VDKVVTIVGHGAEKVQEHLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDGVTLVVCGDT
FT                   PLIEASTMEALLKYHHEKRAKATILTTVIEDPTGYGRIIRDDLGIVEKIVEHKDATEKE
FT                   QRISEINTGTYCFDNKALFEALENVSNDNVQGEYYLPDVIKILKDSDEVVAAYRMESFE
FT                   ESLGVNDRIALAEASKLMQRRINENHMRNGVTLVNPESTYIDIDVKIGQDTVIEPGVML
FT                   RGKTVIGDDCVVTSGSEIVNSVIGERVHVRTSSIFESKVGDDVQIGPYAHLRPESDIHD
FT                   NVKIGNYVETKKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKNKAKTIIGD
FT                   NVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPDDALGIARAKQDNKLGYAKHLNHGK"
FT   CDS_pept        221848..222804
FT                   /transl_table=11
FT                   /gene="prs-1"
FT                   /locus_tag="lmo4a_0215"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82917"
FT                   /protein_id="CAR82917.1"
FT                   /translation="MSNEYFDPKLKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSDGE
FT                   IQINIEESIRGCHVYVIQSTSNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQD
FT                   RKARSREPITAKLVANLIETAGATRMITLDMHAPQIQGFFDIPIDHLNAVRLLSDYFSE
FT                   RHLGDDLVVVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVAEVMNIVGNVEGKVCI
FT                   IIDDIIDTAGTITLAAKALREAGATKVYACCSHPVLSGPAMKRIEESPIEKLVVTNSIA
FT                   LPEEKWIDKMEQLSVAALLGEAIVRVHENASVSSLFE"
FT   CDS_pept        complement(222848..223561)
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="lmo4a_0216"
FT                   /product="positive regulatory factor A"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82918"
FT                   /protein_id="CAR82918.1"
FT                   /translation="MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGI
FT                   TKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKE
FT                   LLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIK
FT                   IALDNLTMQELGYSSGIAHSSAVSRIISKLKQENVIVYKNSCFYVQNLDYLKRYAPKLD
FT                   EWFYLACPATWGKLN"
FT   CDS_pept        complement(223833..224786)
FT                   /transl_table=11
FT                   /gene="plcA"
FT                   /locus_tag="lmo4a_0217"
FT                   /product="phosphatidylinositol-specific phospholipase C"
FT                   /EC_number="4.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82919"
FT                   /protein_id="CAR82919.1"
FT                   /translation="MYKNYLQRTLVLLLCFVLYFFTFPLGGKAYSLNNWNKPIKNSVTT
FT                   KQWMSALPDTTSLAAISIPGTHDTMSYNGDITWTLTKPLAQTQTMSLYQQLEAGIRYID
FT                   IRAKDNLNIYHGPIFLNASLSGVLETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQP
FT                   LINIYKDYFYTTPRNDTSNKIPTLKDIRGKILLLSENHTKKPLVINSHKFGMQFGASNQ
FT                   VIQDDYNGPSVKKKFKEIVQTAYQASKADNKLFLNHISATSLTFTPRQYAAALNNKVEQ
FT                   FVLNLTSEKVRGLGILIMDFPEKQTIKNIIKNNKFN"
FT   CDS_pept        225029..226618
FT                   /transl_table=11
FT                   /gene="hly"
FT                   /locus_tag="lmo4a_0218"
FT                   /product="listeriolysin O"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82920"
FT                   /protein_id="CAR82920.1"
FT                   /translation="MKKIMLVFITLILISLPIAQQTEAKDASAFNKENSISSMAPPASP
FT                   PASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKK
FT                   KKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTN
FT                   QDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFG
FT                   TAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQA
FT                   LGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKN
FT                   SSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAV
FT                   IKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEINYDPEGNEIVQHKNWSENNK
FT                   SKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLY
FT                   PKYSNSVDNPIE"
FT   CDS_pept        226940..228472
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="lmo4a_0219"
FT                   /product="zinc metalloproteinase"
FT                   /EC_number="3.4.24.29"
FT                   /note="Zinc metalloprotease (elastase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82921"
FT                   /protein_id="CAR82921.1"
FT                   /translation="MKSKLICIIMVIAFQAHFTMTVKADSVGEERLQNNIQAKKTHADL
FT                   KALPDSCEAKDFYKNFKILDMTKDKLGVTHYTLALSSGGYLTDNDEIKVHVTPDNKITF
FT                   INGDLQQGQLKITNQIKMTEKNAIEKAFEAIGQSEAHVKSYIGNPVKEKEIIINSRTKR
FT                   LVYNIKLIFAEPEVASWIIQVDAETGAILKKQNMLSEVEPADTHKDFQALGKGANRLLQ
FT                   RPLHVMKINDLFYLVDRTHKGLIRTFDLNHKTDASFGKVVSNKTNMFTDPEFSSAVDAH
FT                   FYASEVYEYYKNVHQLESLDGKGGEIDSFVHYGLNCNNAFWDGREILYGDGDKKNFKPF
FT                   SCAKTIVGHELTHAVIQYSAGLEYEGQSGALNESFADVFGYFIAPNHWLIGEDVCVRGS
FT                   RDGRIRSIKDPDKYNQAAHMKDYASLPITEEGDWGGVHFNSGIPNKAAYNTITKLGKEK
FT                   TEQLYFRALKYYLTKKAQFTDAKKALQQAAKDLYGEDASKKVAEAWEAVGVN"
FT   CDS_pept        228689..230485
FT                   /transl_table=11
FT                   /gene="actA"
FT                   /locus_tag="lmo4a_0220"
FT                   /product="actin-assembly inducing protein"
FT                   /note="Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82922"
FT                   /protein_id="CAR82922.1"
FT                   /translation="MRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEEQ
FT                   PSEVNTGPRYETAREVSSRDIEELEKSNKVKNTNKADLIAMLKAKAEKGPNINNNNSEQ
FT                   TENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLTYLDKPT
FT                   KANKKKVAKASVTDTSESDLDSSMQSADESTPQPLKANQQPFFPKVFKKIKDAGKWVRD
FT                   KIDENPEVKKAIVDKGAGLIDQLLTKKKNEEVNASDFPAPPTDEELRLALPETPMLLGF
FT                   NAPATSEPSSFEFPPPPTEDELEIMRETAPSLDSSFTSGDLASLRSAINRHSENFSDFP
FT                   PIPTEEELNGRGGRPTSEEFSSLNSGDFTDDENSETTEEEIDRLADLRDRGTGKHSRNA
FT                   GFLPLNPFTSSPVPSLSPKVSKISAPALISDITKKAPFENPPQPLNVFNKKTTTKTASK
FT                   KITPVNTSPKLAALPITKAQETALGENKAPFIEKQAEPNNQPIDMPSLPVIQKEVTERN
FT                   KEEMKPQTEEKMVGESEPANNVNGKKRSAGIEEGKLIAKSAEDEKAKEESANHTTLILA
FT                   MLAMGVFSLGAFIKIIQLRKNS"
FT   CDS_pept        230522..231391
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="lmo4a_0221"
FT                   /product="phosphatidylcholine-specific phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82923"
FT                   /protein_id="CAR82923.1"
FT                   /translation="MKFKKVVLGMCLTASVLVFPVTIKASACCDEYLKPPAAPHDIDSK
FT                   LPHKLSWSADNPTNTDVNTHYWLFKQAEKILAKDVDHMRANLMNELKNFDKQIAQGIYD
FT                   ADHKNPYYDTSTFLSHFYNPDKDNTYLPGFANAKITGAKYFNQSVADYREGKFDTAFYK
FT                   LGLAIHYYTDISQPMHANNFTAISYPPGYHCAYENYVDTIKHNYQATEDMVVKRFCSDD
FT                   VKDWLYENAKRAKADYPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFLE
FT                   FWSKKTNE"
FT   CDS_pept        231463..231786
FT                   /transl_table=11
FT                   /gene="vclXY"
FT                   /locus_tag="lmo4a_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82924"
FT                   /protein_id="CAR82924.1"
FT                   /translation="MYIKGRLIFFFVMFVIALCSVLILLIIKMSVWKEEPFNLSDAKEI
FT                   ECLGSCKIKNTNQKIHFFSIKKNLFEERGNIAGISNEHEPKVADKSIFIVILDDEKGVA
FT                   NEE"
FT   CDS_pept        231922..232377
FT                   /transl_table=11
FT                   /gene="vclZ"
FT                   /locus_tag="lmo4a_0223"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82925"
FT                   /protein_id="CAR82925.1"
FT                   /translation="MKMLKKGTAVLFVMVMAMMLVACGGKEETRTFTLSQNGVESKLVY
FT                   TYKGDKVTKQTAENTMSYTALSVSSKEDAEKLLKETSDKFQNIDGLKEKIEYKDDKAIE
FT                   TIEVDYTKIASEDMNKIPGMASGDASKGISMKESAKLLESQGYKENK"
FT   CDS_pept        complement(232428..232760)
FT                   /transl_table=11
FT                   /gene="vclB"
FT                   /locus_tag="lmo4a_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82926"
FT                   /protein_id="CAR82926.1"
FT                   /translation="MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
FT                   RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGADNGMLMVTASGTAVV
FT                   IEAQDY"
FT   CDS_pept        complement(232826..233500)
FT                   /transl_table=11
FT                   /gene="vclA"
FT                   /locus_tag="lmo4a_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82927"
FT                   /protein_id="CAR82927.1"
FT                   /translation="MITFDELNAELQALENPNTIKIFRNHGCPETLELYGLKIGDLKKI
FT                   IRREKLKKNHELAIELIESNNSDLIYLGLLAIDPNKITIEQIEKWNVAFRETWSQLTFG
FT                   LASVVSKRDDALLFAKKWIESDYDLTKSMGWQIYSEHINDLPEAETLLQRAKDTLQTET
FT                   NRTRYSMNGFIITCGIYKDDLHEKAMEAAKSVGKVHVNLGNTACKVPDAISYIEKARNR
FT                   TK"
FT   CDS_pept        complement(233577..234518)
FT                   /transl_table=11
FT                   /gene="ldh-1"
FT                   /locus_tag="lmo4a_0226"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82928"
FT                   /protein_id="CAR82928.1"
FT                   /translation="MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGD
FT                   AMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIV
FT                   DEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKV
FT                   DARNVHGYILGEHGDTEFPAWSHTTVGDLPITEWITEDEQGAMDTIFVSVRDAAYEIIN
FT                   KKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHI
FT                   VEMNLNEKEKEQMKNSADTLKKVLDDAMKQVD"
FT   CDS_pept        234812..235435
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="lmo4a_0227"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="Ribosomal protein L25 (general stress protein Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82929"
FT                   /protein_id="CAR82929.1"
FT                   /translation="MATTLEVQKRETTQHSEVTRLRSEGKVPGIIYGYKSENVPVSVDS
FT                   LELIKAVRDNGRNAVFSVTVDGKKLNVLLHEYQVDPLKDVLVHVDLLAVDMNEEVETDV
FT                   RVVLVGDAPGVKAGGVLQQIIHDVKVSATPEKLPETIELDISSLEIGDVLTTNDLPENK
FT                   DYVVQAEEEETVVTVSAPRAEEEPTTTEAPEPEAVHGKDEEPVE"
FT   CDS_pept        235525..236109
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0228"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82930"
FT                   /protein_id="CAR82930.1"
FT                   /translation="MLDKSVPHISAIMVNHDATNYPEFHLPEGYSFCFYKDGLEEDWCR
FT                   LQLETGQVPSMDSIRARFETEFGNEKEKLAKRCVFVEAPNGEIIGTAMLWDGNTFGEME
FT                   SRIHWVAVLDSHGGKGIAKALLSKILGLNKNDFVYLTTQTGSYQAIYLYQKFGFEKYVG
FT                   KTPKNWRTVNFQEEKEAAWQIIENKIAEHQA"
FT   CDS_pept        236216..236776
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="lmo4a_0229"
FT                   /EC_number="3.1.1.29"
FT                   /note="Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82931"
FT                   /protein_id="CAR82931.1"
FT                   /translation="MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGM
FT                   TSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQ
FT                   KGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVIHYVLGDFPKAEQPDIIAAIQK
FT                   SADAIEDYAQTPFIEVMNKYNQK"
FT   CDS_pept        236891..240430
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="lmo4a_0230"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="Transcription-repair coupling factor (superfamily II
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82932"
FT                   /protein_id="CAR82932.1"
FT                   /translation="MKGLQQLIYEQKDIRAVLNALDEKEKAQLVTGLTGSSRALFASVV
FT                   EGASKRPVVFVTHNLYHAQKLYDDLLSLMDVDRLFLYPADELISSELSISSPELRGQRV
FT                   EALDFLLSGKPGIVIVPVAGLRKMLPPVSLWKHFNISIVEGEEIDPDVLRQKLVTMGYT
FT                   MSGMVNTPGEFSVRGGIIDIYPITEEFPIRIELFDTEVDSLRFFDVETQRSTTRVEEFR
FT                   LLPATEIILDQSYYPDIVKRLEKKMTHTLNELKENEDKQALVENLEEDLEMLRSGVKPD
FT                   MFFKYIGLAYPDPASLFDYLPKNTAILLDEFGRILETEESLEREEAEWQTETLSRMETV
FT                   RDVQVSHSFKKLLEANHSPKIYLSLFQKQMASMRVSKTTNIVYKQMQQFHGQMNVLKTE
FT                   LESWHKNNYAVVILAPNVERAEKMQQTLADYDMESTILKKESDVPKYGMVQFVIGTFQN
FT                   GFELPLAKVAIISETELFNKKIKKVKKRQKLSNAERIQSYSELKVGDYVVHVNHGIARY
FT                   VGMETLDINGVHKDYLLLVYQGEDKLFIPVDQLDLVQKYVGAEGKSPRLNKLGGAEWKR
FT                   VKKKVQASVQDIADDLIKLYAEREAEKGYAFSADDEMQREFEEAFPYQETEDQLRSISE
FT                   IKKDMERPRPMDRLLVGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHFETMK
FT                   ERFQGFPIEIGLLSRFRTKKQQTETLKGMKNGTVDVVVGTHRLLSKDVEYQDLGLLIVD
FT                   EEQRFGVTHKEKIKQMRSKIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQT
FT                   YVAEQNNVLVREAIERELARDGQVYYLYNRVESITQKADEISAMVPDARVATAHGQMGE
FT                   SELEAVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDADRMGLSQLYQLRGRVGRW
FT                   NRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNILGAQQHG
FT                   FIDSVGFDLYSQMLKEAIEAKKPKEEQKQIVPVEIDIQADAYIPEYYITDGRQKIEMYK
FT                   RFRNIETLSELEDLQSDMIDRFGEYPEEVEYLFTMTELKVHALEVGIESVKQEQNKITM
FT                   LFSESGTAGIRGDIVMQIIGEFGRMVGVGMEGTQLKITINVQNKPLKEWLYQVKSLAEK
FT                   LRGAMKEKASTEN"
FT   CDS_pept        240462..242051
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0231"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="Membrane protein involved in the export of O-antigen
FT                   and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82933"
FT                   /protein_id="CAR82933.1"
FT                   /translation="MSERSMKRLMKGAAWLTAASLISKILSAVYRVPFQNMVGDVGFYI
FT                   FQQVYPIYGIAMTLALGGFPVVISKMLAEAEGDVRRQQIIMRAVSRMLRIVSIAIFVFL
FT                   FLFANVIAMMMGDPALSELIRVISFVFLLMPQLAFMRGFFQGEGDMVPTAISQTVEQII
FT                   RVAIILIGAGLALHFSLDLYDAGSMAMSGAFFGGVAGIFILRHFYNKKVSLGEGIQPAV
FT                   FASKEEKIGIGRAFLRQSVAICVVSSMLILFQLVDSFQVYRLMSESGIPDFIAKTLKGI
FT                   YDRGQPILQLGLVISTGLALALVPMITAARVQGQQKELKRSVLLAIKITLILAGAETVG
FT                   LIVIMRPLNQMLFQTPDGTFVLQLFMPAVFLSSLIIMLSSILQGFGKIAVPAVGVGIGL
FT                   IVKWITGGILIPKFATVGASVSTCIGLLVILIICYVSLKQTIRVPFVEKAMLLRLLAAL
FT                   ALMAVFPCLFEWLAPLDTRLGSAFQAIVSAVIGGGIFLVFALRYKLLGPKDFVFLPFGS
FT                   KLLALSKLVARK"
FT   CDS_pept        242075..242353
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0232"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82934"
FT                   /protein_id="CAR82934.1"
FT                   /translation="MATTMRLDKYLKVSRLIKRRTVAKEVAEKGRIAVNGVTAKPGTNV
FT                   KSGDELVIRFGPKIVTAKIERLEENAKKEQATEMYTIIKEERTDESR"
FT   CDS_pept        242582..242968
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="lmo4a_0233"
FT                   /product="cell division protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82935"
FT                   /protein_id="CAR82935.1"
FT                   /translation="MKKAESKVARIENRYIKDTATMKKTRSRRRIALFRRLAFMAIIFV
FT                   VVGGLLTITYTKQALTLKEKKAKQVQVDKKMVAMKDEEEALNEQIKKLHNDDYIAKLAR
FT                   SEYYLSKDGEIIFNIPEENSKQKE"
FT   CDS_pept        243119..243547
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0234"
FT                   /product="S1 RNA-binding domain protein"
FT                   /note="Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82936"
FT                   /protein_id="CAR82936.1"
FT                   /translation="MSIEVGNKLQGKVTGITNFGAFVELEGGKTGLVHISEVADNYVKD
FT                   INDILTVGDEVTVKVMNIGDDGKIGLSIRKAVDRPDRPEKSYDRKPKYNKKPAGNYVKP
FT                   AESFEDIMSKFLKDSDERLTTIKRQTESKRGGRGAKRG"
FT   CDS_pept        243654..245600
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0235"
FT                   /product="bifunctional protein TilS/HprT"
FT                   /note="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82937"
FT                   /protein_id="CAR82937.1"
FT                   /translation="MDDTEKRVHKYIEKHDLIRSDDKLLVAVSGGPDSLALLHFLWNSD
FT                   LVPKEAISVAHLNHHLRENAANEQNVVETFCERHGIPFYIEEVDIKSRAESLQKGIEET
FT                   ARIVRYDFFEKVMAEKNINKLALAHHADDQIETILMRLVRGSASIGWSGIQPKREVKGG
FT                   YAIRPFLPITKAEIIAYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPSVYAH
FT                   FERFSEETSEDFQFLEALASDLLKKNLIKNGKQTTLLLTSFKNEANPLQRRAIHLLLRY
FT                   LYNEDTSFITVNHIYQIIQMIQSDNPSSSIDLPNKLIANRAYNKLHFQFGEREAPSEFY
FT                   HQLELNDRIELDSKSSIRLKLKSSVVQTNGLNGMLLDAEEITLPLIVRNRVNGDRMTMK
FT                   GQAGSKKLKDIFIDAKIPRQERDQLPVITDYTGKILWVPGVKKSAYDREFSRSKKQYII
FT                   RYTRNIGGNESMHNDIQKVLISEDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFM
FT                   TDLLKRVDTYLEMDFMDVSSYGNGTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTL
FT                   SYLVDLIKYRKAKSVKLVTLLDKPAGRNVEIEADYVGFVVPNEFVVGYGLDYAERYRNL
FT                   PYIGILKPEIYSE"
FT   CDS_pept        245947..248019
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="lmo4a_0236"
FT                   /product="ATP-dependent metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /note="ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82938"
FT                   /protein_id="CAR82938.1"
FT                   /translation="MNRFFRNAIFYVIIFLVIIGIVASFNSNKEAAKDISYSEFVSKLE
FT                   DGKVKSVSIQPDRSVYTIEGEFKSSDKSSDDKKTGLGQSKTSSTAFTTYALNSDTSLGD
FT                   LQKTLDKEDVKTTIVPAKQNSGWVTFLTSIVPFVIIFILFFFLMSQSQGGGGGKVMSFG
FT                   KSKAKLYNDDKKKVRFTDVAGADEEKQELVEVVEFLKDPRKFADLGARIPKGVLLVGPP
FT                   GTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEI
FT                   DAVGRQRGAGMGGGHDEREQTLNQLLVEMDGFGGNEGIIIIAATNRADVLDPALLRPGR
FT                   FDRQIMVDRPDVKGREAVLRVHARNKPLAKSVDLKAIAQRTPGFSGADLENLLNEAALV
FT                   AARSDKKEIDMSDLDEASDRVIAGPAKKNRVISEKERRTVAYHEGGHVIVGMVLDEAEV
FT                   VHKVTIVPRGQAGGYAVMLPKEDRFLMTKAELMDRITGLLGGRVAEEVTFGEVTTGASN
FT                   DFERATELARRMVTEWGMSDKIGPLQFTSGNGQVFMGRDFGSDKGYSDKIAYEIDTEVQ
FT                   SLIRYCYDRAKTIITEHQEQHKLIAETLLKVETLDARQIRSLFDDGVMPPDIDTIDVEA
FT                   EYPSEKDEEPVGKSFEEEKEDLKEEKVEETKEEPKEVTSEDAPNIEQTPNDKKDE"
FT   CDS_pept        248135..248914
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0237"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="Putative transcriptional regulator, homolog of Bvg
FT                   accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82939"
FT                   /protein_id="CAR82939.1"
FT                   /translation="MILVIDVGNTNCTVGVYEKQKLLKHWRMTTDRHRTSDELGMTVLN
FT                   FFSYANLTPSDIQGIIISSVVPPIMHAMETMCVRYFNIRPLIVGPGIKTGLNLKVDNPR
FT                   EIGSDRIVNAVAASEEYGTPVIVVDFGTATTFCYIDESGVYQGGAIAPGIMISTEALYN
FT                   RAAKLPRVDIAESNQIIGKSTVASMQAGIFYGFVGQCEGIIAEIKKQSNASPVVVATGG
FT                   LARMITEKSSAVDILDPFLTLKGLELLYRRNKPTTEK"
FT   CDS_pept        248930..249814
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0238"
FT                   /product="chaperonin Hsp33 family"
FT                   /note="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82940"
FT                   /protein_id="CAR82940.1"
FT                   /translation="MSDYLVKALAYDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGR
FT                   TMTGTLFLGAMQKEDQKITVKIEGDGPIGPIVADSNAQGQIRGYVTNPHVHFSELNEAG
FT                   KLDVRRGVGTSGMLSVVKDLGFGENFTGQTPIVSGEIGEDFTYYLATSEQINSSVGVGV
FT                   LVNPDDTIEAAGGFMLQLLPGATDEIIDEIEKNLTALPTVSRMIEAGETPESILAKLAG
FT                   GEDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNTYDF
FT                   SEEELEKLYEEAK"
FT   CDS_pept        249930..250856
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="lmo4a_0239"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82941"
FT                   /protein_id="CAR82941.1"
FT                   /translation="MTIANSITDLIGKTPIVKLNRLPEAGSADVYVKLEFQNPGGSVKD
FT                   RIANAMIESAEKSGALKPGDTIIEPTSGNTGIGLAMVAAAKGYQAIFVMPETMSLERRK
FT                   LLQAYGAKLVLTPGSDGMKGAIAKAEELAKENNYFVPQQFHNPANPAVHEETTGPEIVE
FT                   AFGKDGLDAFIAGVGTGGTVTGVGHVLKKNYPDVKIYALEPEESPVLSGGSPSPHKIQG
FT                   IGAGFVPDTLDTKVYDGILKVSSEDALETAREVAKKEGILVGISSGATVKAALDLAKEL
FT                   GAGKKVLAIVASNGERYLSTPLYNFED"
FT   CDS_pept        251838..252773
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="lmo4a_0240"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="Dihydropteroate synthase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82942"
FT                   /protein_id="CAR82942.1"
FT                   /translation="MKIPNSLFDRCGLLPFPHRFFCALKSLNSAIINLGKRCLGLKKWK
FT                   RDHLGMVMGILNVTPDSFSDGGKYMQVEEAVNRALQMAEDGAAIIDVGGISTRPGFSEV
FT                   TPEEELTRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIA
FT                   EVAAKYNVPICLMHNRENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVK
FT                   TPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGC
FT                   TITRVHDVLPIARMVRMTDAITGKLDITKL"
FT   CDS_pept        252787..253161
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="lmo4a_0241"
FT                   /EC_number="4.1.2.25"
FT                   /note="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82943"
FT                   /protein_id="CAR82943.1"
FT                   /translation="MDKIYLNELVFYGYHGVLAEETKLGQTFRVSLILGLSTKKAGISD
FT                   SVDDTVSYAEVYETVKEIVEGTPFKLIEALAEKIATEVLTDYPLLEEVTVKLIKPNPPI
FT                   PGHYDSVAVEIERKRSDLNG"
FT   CDS_pept        253154..253633
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="lmo4a_0242"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokin
FT                   ase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82944"
FT                   /protein_id="CAR82944.1"
FT                   /translation="MAKAFLSIGTNIGERLENLNDALSGLAASDKIKITNVSSVYETDA
FT                   VGYEDQAAFLNITVEIETDFPPVDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDV
FT                   KIDTEKLKIPHPYMKERAFVLIPLIEISPEKSNLVDNPAILEEQGVRKIKNQVNW"
FT   CDS_pept        253709..254704
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0243"
FT                   /product="dihydrouridine synthase"
FT                   /note="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82945"
FT                   /protein_id="CAR82945.1"
FT                   /translation="MFKIGNVEIKNQVVVAPMAGISNSAFRLTVKEFGAGLVCCEMISD
FT                   KGIAYRNAKTLDMLYIDEKEKPLSLQIFGGEKETLVEAAKFVAENTTADIIDINMGCPV
FT                   NKIIKCEAGAKWLLDPNKVYDMVAAVVDAVDKPVTVKMRIGWDEEHVFAIENALAAERA
FT                   GAAAVAMHGRTRVQMYEGSANWDVLRDVKRELKIPFMANGDVRTPEDAKRILEHTGADG
FT                   VMIGRAALGNPWMIYRTVKFLETGELLPEPEPREKMQTAMLHLNRLVELKGENIAVREF
FT                   RQHAAYYLKGARGSTRAKVAANQATKQAEMEAILNEFVLQYEEKALAKQD"
FT   CDS_pept        254819..256315
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="lmo4a_0244"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82946"
FT                   /protein_id="CAR82946.1"
FT                   /translation="MSNENHEELNDQLIVRREKVDILREEGIDPFGEKFIRSISPEEIE
FT                   TKFADKSKEELEEDAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAY
FT                   AVFKLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITNEESQNRFVMRSKILKYTRDYMDSQGFLEVETPVLHTIAGGAAAKPFITHHN
FT                   ALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDY
FT                   EDVMNLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRIHMADAVKEYVGVDFWNVTS
FT                   DEEARELAKKHDVPVTEHMTYGHILNEFFETHVEEKLIQPTFVYGHPVEISPLAKKNKE
FT                   DERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEAL
FT                   EYGLPPTGGLGIGVDRLVMLLTNAPSIRDILLFPTMKHRD"
FT   rRNA            256770..258307
FT                   /locus_tag="lmo4a_rRNA01"
FT   rRNA            258561..261489
FT                   /locus_tag="lmo4a_rRNA02"
FT   rRNA            261569..261683
FT                   /locus_tag="lmo4a_rRNA03"
FT   tRNA            261692..261764
FT                   /locus_tag="lmo4a_tRNA02"
FT   tRNA            261773..261845
FT                   /locus_tag="lmo4a_tRNA03"
FT   tRNA            261886..261958
FT                   /locus_tag="lmo4a_tRNA04"
FT   tRNA            261965..262046
FT                   /locus_tag="lmo4a_tRNA05"
FT   tRNA            262063..262134
FT                   /locus_tag="lmo4a_tRNA06"
FT   tRNA            262156..262241
FT                   /locus_tag="lmo4a_tRNA07"
FT   tRNA            262254..262327
FT                   /locus_tag="lmo4a_tRNA08"
FT   tRNA            262338..262411
FT                   /locus_tag="lmo4a_tRNA09"
FT   tRNA            262431..262503
FT                   /locus_tag="lmo4a_tRNA10"
FT   rRNA            262788..264325
FT                   /locus_tag="lmo4a_rRNA04"
FT   rRNA            264579..267508
FT                   /locus_tag="lmo4a_rRNA05"
FT   rRNA            267588..267702
FT                   /locus_tag="lmo4a_rRNA06"
FT   CDS_pept        267848..268306
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="lmo4a_0245"
FT                   /note="Transcriptional repressor of class III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82947"
FT                   /protein_id="CAR82947.1"
FT                   /translation="MKNISDIIEAYLKQVLESSEAVEIKRSEIADKFECVPSQINYVIN
FT                   TRFTMERGYIVESKRGGGGYIRIIKVKMNDKLQLLEAIISMVHDKKVSQSFSEDVILRL
FT                   LEEEVITKKEARLMVAALDREVLILPLPDRDILRSRILEAMLVALKYD"
FT   CDS_pept        268319..268837
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="lmo4a_0246"
FT                   /product="modulator of CtsR repression"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82948"
FT                   /protein_id="CAR82948.1"
FT                   /translation="MICQRCGENKAVIALQQLNEAGKVESLYLCEDCATEKALSSEKDL
FT                   VKAMDTFSEVALDFLTLLQKEENAQKEVVCGNCQLSFEEFLQTNRVGCSECYEAFEEQL
FT                   VPIIGRVQNGYKNHVGKVPAEVERAEGVQNEISRLQEKLAQLVKNEEFEEAAVVRDEIK
FT                   ALRAGGEVK"
FT   CDS_pept        268834..269856
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="lmo4a_0247"
FT                   /product="modulator of CtsR repression"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82949"
FT                   /protein_id="CAR82949.1"
FT                   /translation="MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYEQKE
FT                   EIVDKIAGAFDDNFTLIKMNQISHLEKALLVEKHLISPYMMNKSEYGAVLLNEEENVSI
FT                   MLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKQFGYLTSCVTNIGTGM
FT                   RASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSLPASSIFQVSNQVTLGKTET
FT                   EIVEDLTQVMEQIIMQERIARTTLKQKFHIALEDRVFRSYGLLTNCRIISMREASDAIS
FT                   DVRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK
FT                   "
FT   CDS_pept        269885..272347
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="lmo4a_0248"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /note="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82950"
FT                   /protein_id="CAR82950.1"
FT                   /translation="MMFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGI
FT                   AAKALYELGISSEKVQQEVEGLIGHGEKAVTTIQYTPRAKKVIELSMDEARKLGHTYVG
FT                   TEHILLGLIREGEGVAARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNTQATPTLD
FT                   SLARDLTVIAREDNLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQ
FT                   QIVRNEVPETLRGKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELH
FT                   TLIGAGGAEGAIDASNILKPPLARGELQCIGATTLDEYRKYIEKDAALERRFQPIKVDE
FT                   PTVEESIQILHGLRDRYEAHHRVAITDEALEAAVRLSDRYISDRFLPDKAIDVIDESGS
FT                   KVRLKSFTTPKNVKEMENNLSELKKEKDAAVQGQEFEKAASLRDKEQKLKKSLEETKAN
FT                   WQEKQGLDHSEVTEDIVAEVVASWTGIPVAKLAETETNKLLNMEKLLHERVIGQDAAVK
FT                   AVSLAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDSMIRIDMSEY
FT                   MEKFSTARLVGAPPGYVGYEEGGQLTEKVRQKPYSVVLLDEIEKAHPDVFNMLLQVLDD
FT                   GRLTDSKGRVVDFRNTVIIMTSNIGAQEMKQDKSMGFNVIDPLKDHKAMEHRVLQDLKQ
FT                   AFRPEFINRIDETIVFHSLQEKELKQIVTLLTAQLTKRLAERDIHVKLTEGAKAKIAKD
FT                   GYDPEYGARPLKRAIQKEVEDMLSEELLRGNIKVGDYVEIGVKDGKLEVRKKDAPKKKT
FT                   TAKKVKAK"
FT   CDS_pept        272494..273867
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="lmo4a_0249"
FT                   /product="DNA repair protein"
FT                   /note="Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82951"
FT                   /protein_id="CAR82951.1"
FT                   /translation="MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEPSKATPITQIESETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTAALMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGTWKIPKDVQVVGVETIGEALKKALPD"
FT   CDS_pept        274001..275074
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0250"
FT                   /product="PIN/TRAM domain protein"
FT                   /note="ATPase (PilT family)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82952"
FT                   /protein_id="CAR82952.1"
FT                   /translation="MLTWVIRVCFLILGGTTGVFSLPALWVKLGIGHILLINNPYTDAL
FT                   IGALIFYLITFWAVKYVEAALNWLEEKLAKIAIATLVYGGLGLFVGLVIAFFASNALSQ
FT                   TNIPLLNSVVPVILTLVLGYLGFRIGISRRNEFGNFVNNRNAKKKTPEEEKTEEKSKKT
FT                   YKILDTSVIIDGRIADILTTGFLDGTVVIPLFVLAELQHIADSSDTLKRTRGRRGLDIL
FT                   NRIQKEDAIQVEMYEGDFEDTPEVDSKLVKLAKVMGGIVVTNDYNLNKVCEFQNVPVLN
FT                   INDLANAVKPVVLPGEKMTVLMVKDGKEHNQGVAYLDDGTMIVVEDGRKFINETIQVEV
FT                   TSVLQTSAGRMIFAKPS"
FT   CDS_pept        275094..275792
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="lmo4a_0251"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /note="4-diphosphocytidyl-2-methyl-D-erithritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82953"
FT                   /protein_id="CAR82953.1"
FT                   /translation="MNYELVFLAAGQGKRMNAQKNKMWLELVGEPIFIHALRPFLADNR
FT                   CSKVIVVCQEEERKHVKELMSQLNVAESRIEIVKGGSERQYSVAAGLERCGTERVVLVH
FT                   DGARPFITVDIIDRLLIGVKQSKAAICAVKVKDTVKRVVNGVVQETVDRENLWQVQTPQ
FT                   AFELPILRKAHQLARKEQFLGTDEASLVERLPCPVAIVQGSYYNIKLTTPEDMPLAKAI
FT                   LGELGGIAND"
FT   CDS_pept        275785..276258
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="lmo4a_0252"
FT                   /EC_number="4.6.1.12"
FT                   /note="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82954"
FT                   /protein_id="CAR82954.1"
FT                   /translation="MIRIGQGYDVHKLAYDRELIVGGIKIPYEKGLLGHSDADVLLHAI
FT                   TDAIIGAIGAGDIGHFFPDTDMAFKDADSAELLAEIWQKVEADGFRLGNLDATIIAEKP
FT                   KMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK"
FT   CDS_pept        276277..277752
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="lmo4a_0253"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82955"
FT                   /protein_id="CAR82955.1"
FT                   /translation="MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRI
FT                   EDTDAKRNIADGEESQMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDE
FT                   GLAYKCYCTEEELDAEREKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPA
FT                   NETITFNDMVKDDVSFESNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHIS
FT                   NTPKQILIYNAFGWEPPIFGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFN
FT                   FIAMLGWSPEGEEEIFSKEEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVV
FT                   ELSLPHLQKAGVVSAELNQAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFD
FT                   EEETAVLAEETVPTVISAFKKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIV
FT                   TTGEMHGPELPLAIEVLGREKVLNRLDTWLKNN"
FT   CDS_pept        278152..278766
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="lmo4a_0254"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82956"
FT                   /protein_id="CAR82956.1"
FT                   /translation="MPTRLKEDIATIIKNDPATKSFFDAFLTNPGLHALWWHRVANFFY
FT                   RHKMVLFGKVLSQTARFWTNIEIHPGATIGRRLFIDHGAGIVIGETAEIGDDVTIFHGV
FT                   TLGGTGKDCGKRHPTVGDGALVSAGAKVLGPVEIGAGARIGAGAVVLKDVPPGATVVGI
FT                   PAKVVRLNGRTVGHAVPKMDELTLRIAELENIVEKLLKEKE"
FT   CDS_pept        278773..280188
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="lmo4a_0255"
FT                   /EC_number="6.1.1.16"
FT                   /note="Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82957"
FT                   /protein_id="CAR82957.1"
FT                   /translation="MSIQIFNTLKREKEPFKPLKDGEVKMYVCGPTVYNYIHIGNARPI
FT                   IVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQL
FT                   NVAKATVNPRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSEL
FT                   QHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTID
FT                   IHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVL
FT                   KDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEE
FT                   AHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLAKETVSINVLREFL
FT                   SMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII
FT                   LEDTAQGTRFRRG"
FT   CDS_pept        280192..280602
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82958"
FT                   /protein_id="CAR82958.1"
FT                   /translation="MAEVKEYKQLNGLALAYMGDAVYEKFIREYLLAAGKTKPNQLHKT
FT                   ATKFVSAKGQAVALKAMIAEGFLTEEEDRIAKRGRNAKSYTVPKNTDPGTYSMSTSFEA
FT                   VLGYLYLAGEVERLQEWMEKALEIVEKGVENN"
FT   CDS_pept        280602..281357
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0257"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /EC_number="2.1.1.-"
FT                   /note="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82959"
FT                   /protein_id="CAR82959.1"
FT                   /translation="MEQENEQEWIGGRNPVLEVLRSDRDIHKIYVQEGSQKGVLKQVLT
FT                   LAKDRKIQVQFVPKQKIEKVVSGAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIIL
FT                   DELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVR
FT                   TMEELQKRGLWIFGTDAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPM
FT                   RGKVTSLNASVAASLLLYEVYRKRFPLEK"
FT   CDS_pept        281360..281872
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82960"
FT                   /protein_id="CAR82960.1"
FT                   /translation="MEQILLVDGYNVIGAWPELSFLKDRDLEAARDKLVEWMAEYQSYT
FT                   GYRVVVVFDAQFVRGVKRKSKKYQVEVVFTHEDETADEYIEQKAIEWKNVRTQIMVATS
FT                   DYTEQWAIFGQGALRISSRELLFEIQEMSKQIGQKIKRIQEEMPKSNLNLDSDVISQLE
FT                   KWRRGEE"
FT   CDS_pept        281953..282558
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="lmo4a_0259"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82961"
FT                   /protein_id="CAR82961.1"
FT                   /translation="MDNSVNQEELAMLELARSGDTEALEYFFSKYQSVIYWKSTQYFLQ
FT                   GAERDDLIQEAMIGLFKAIRDYDKTKEASFRSFAEMCINRQLLSAVKRASRQKNIPLNN
FT                   SVSLDTPMAEDDVDWTLLDVISEKAAETPEDFLIKNEDLIHVARQLEQVTSEFEKEVLK
FT                   QYLEGKSYQEMALYFNKKEKAIDNALQRVKKKMMKQLE"
FT   CDS_pept        282662..282811
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0260"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82962"
FT                   /protein_id="CAR82962.1"
FT                   /translation="MKKKTSLACSECGSRNYTVNVSGTQKETRLEVKKFCRHCNKHTLH
FT                   RETK"
FT   CDS_pept        282831..283010
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="lmo4a_0261"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82963"
FT                   /protein_id="CAR82963.1"
FT                   /translation="MSAIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFM
FT                   LIDFGIEQIIKLIV"
FT   CDS_pept        283139..283672
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="lmo4a_0262"
FT                   /product="transcription antitermination factor"
FT                   /note="Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82964"
FT                   /protein_id="CAR82964.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMSDKIFRVIVPEEEE
FT                   TEVKNGKTKTIKRKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPE
FT                   EADRILKSMGMVEKRAEADFEIGETVMVKEGPFADFSGKVDEMDNDKGKAKVMVNMFGR
FT                   ETPVEVDFNQIEKL"
FT   CDS_pept        283727..284197
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82965"
FT                   /protein_id="CAR82965.1"
FT                   /translation="MDKAKQIYLEFKREADFLELDFPLFLGDGPGFGELCMDYSEQDGY
FT                   MLYGYERGIRNSEFKTTDLEEFKYEVFLHICWYMGMEFELRHRKEDMRHDDNILEADTR
FT                   KVAFEKTLQLLKMVNPAWIDKAAQGYTAYLNLWRENKNVYFDKEAMKFKVNL"
FT   CDS_pept        284323..284748
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="lmo4a_0264"
FT                   /note="Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82966"
FT                   /protein_id="CAR82966.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
FT   CDS_pept        284788..285477
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="lmo4a_0265"
FT                   /note="Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82967"
FT                   /protein_id="CAR82967.1"
FT                   /translation="MAKKGKKYQDALKQIDANKVYTAEEAVELAKKIDFAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKI
FT                   NQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEY
FT                   RVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGI
FT                   KVDPASL"
FT   CDS_pept        285725..286225
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="lmo4a_0266"
FT                   /note="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82968"
FT                   /protein_id="CAR82968.1"
FT                   /translation="MSKVLEAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITELRKQL
FT                   RDAGIEFKVYKNSLTRRAVEANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHE
FT                   ALEIKAGVIEGKVASLEEIKALATLPSREGLLSMLCNVLQAPVRGLAIATKAVADQKEG
FT                   QEA"
FT   CDS_pept        286304..286666
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="lmo4a_0267"
FT                   /note="Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82969"
FT                   /protein_id="CAR82969.1"
FT                   /translation="MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GGAAEQTEFTVELASAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKDEAE
FT                   EIKAKLEEVGANVEVK"
FT   CDS_pept        286841..287227
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0268"
FT                   /product="transcriptional regulator"
FT                   /note="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82970"
FT                   /protein_id="CAR82970.1"
FT                   /translation="MAIKSISKSELEVMKIIWDFGRAVQYADVAGKLEEKNYSWKKNTV
FT                   LTFLTRLVEKNLLSVKKVGRKNEYYALVSENEYLERQTETFVEDIYEGDVKGLITNLVQ
FT                   NDLISPDELEDLQQFWKRMKSPNE"
FT   CDS_pept        287220..288260
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0269"
FT                   /product="peptidase M56, BlaR1 family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82971"
FT                   /protein_id="CAR82971.1"
FT                   /translation="MNELLKIFLSMALTSVILIPLVWILQRIFNRYLSKGKIYYSWMIV
FT                   FFFLTIPFAYFFFRFAKDSAFMWRNKTEFDGVTSIVVDQSGVVLQHDFKTVFWMTVLDY
FT                   LWVAWLVIFLLTFIYRIASYRNFKKYVFSGARRVDDLEQLDLLAETMEELNVKRPVELM
FT                   INPLISSPIFLGLKKNVIVIPNETFLNDELHYIFKHELVHCKRKDMYYVWMVQFFTCVY
FT                   WFNPLMYLMNKRIQMDRELACDEAVLATLPKSKYIGYGDTLLSSLAKSGNYKESYVAVS
FT                   LHENAKALKERLTCIANYETPSKKHNILFLIFIIVLCSVGVLFSAFQADMFTLEKKKGI
FT                   TIERKN"
FT   CDS_pept        288376..289038
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82972"
FT                   /protein_id="CAR82972.1"
FT                   /translation="MFGRKKVSIPEEYLQFNQFSADKERLLCIGAFTTENKHKVETKLD
FT                   GSNNMLKLYYPKNRAAKVMKYWLPMFGINDGYSAVEVITNWIQANDYSGMIAANTTNKV
FT                   IRIVTKASQKEGLDETSLVAAANKVKTYGAFDLDRLGYIVRVCYSLDLINEEQAWGFLE
FT                   ELWDAATMHYDDWDEYCVSYLNGEEGLDTNWYSDGVKAYVALRKDAASLLNKYQLKN"
FT   CDS_pept        289063..289566
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0271"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82973"
FT                   /protein_id="CAR82973.1"
FT                   /translation="MKKFLSILSILVLALLVTACGSESSEKKSEKKEEKMETVTYVADI
FT                   SGAKLEATFSHVGDNLRKVDQKMVYPYAALGIDSESLANLDDAMKKQLEEQVASQYSAY
FT                   KDSKGASLETKFTDEALELTMSVDLYKADKDSVASLLGGTTDPKNVSLKETVKQFEAQG
FT                   FKKK"
FT   CDS_pept        289687..290292
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0272"
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /EC_number="2.1.1.52"
FT                   /note="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82974"
FT                   /protein_id="CAR82974.1"
FT                   /translation="MTNNHYYTNDETIKHNRKTWQVMLKGFNMSFTSDNGVFSKNTVDF
FT                   GSKLLIESFGLETKTGKILDVGCGYGPMGLTVAKAFPDSQIEMVDVNLRALELAKENAE
FT                   INKITNTHIYESSVYDNVTANDYQAIISNPPIRAGKKIVHAILEGAYDHLQETGELWIV
FT                   IQKKQGGPSAEKKMEEVFGNVETVAKDKGYFIFKSVKN"
FT   CDS_pept        290492..291001
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82975"
FT                   /protein_id="CAR82975.1"
FT                   /translation="MREKKVRGIKRKSNNMIERIEAKTLEFPTEFYNGYWHLHLPVAQD
FT                   FISSNKTPKKIKQLCIQTLLDRAEHLIGLKPDDKEKYRVVVAVDLADLWGSQIIVFKGD
FT                   SHFKDFFNRNDEYQKWLNLPDNRNIQTEWGLSIPNDMKKSGFKEVITDEDGYHYEGEIW
FT                   FIGELK"
FT   CDS_pept        291152..291895
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82976"
FT                   /protein_id="CAR82976.1"
FT                   /translation="MNQGSDGIYLVIHSGSRVLGKEIAEYHQEVAYKRLGTLRKELKLD
FT                   ATAAKKRGNLEMANNLNSEREQVKLDYDLSYVTGSDLNNYLNDMEIAQKFAARNRYIMA
FT                   ETILKAMKWNKAVVSAFDCVHNYIDIDNRMLRKGATSAQLGEQIIVPLNMRDGSILATG
FT                   KGNADWNYSAPHGSGRMLSRSKAKAQISLESYQAAMKDVWTTSVSKKTIDEAPKAYKSA
FT                   KQLLADVEDTMEIQEIIKPLYNFKA"
FT   CDS_pept        291948..292445
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82977"
FT                   /protein_id="CAR82977.1"
FT                   /translation="MENNVDRDNKYVNIEDFDLSWYFNVEGIKMSDEEMKYIKPLAKAY
FT                   SSKMWEKYISHRHLHFEQLDSEDKLPPLARMDYNWLDDLDNGLYENFSNYLLRNINYHQ
FT                   QDTVLAFWLKDYAVETEWRFFIKHWSEFLFDQGVVLINVSSEQFLMFCSNGTLFKGVNS
FT                   LN"
FT   CDS_pept        292622..293617
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0276"
FT                   /product="transcriptional regulator"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82978"
FT                   /protein_id="CAR82978.1"
FT                   /translation="MNKVTKIGDVAEKTGYSITTISRAINGNPNVSDKTKKKIFAAMKE
FT                   LNYYPNNIAQQFRGQGTKMIGVVISFITNPFFAYLVDAIERYLSHRGYQVVMLQTLENP
FT                   AKELQFIEMLQKKQLDGLIMANLENDTEEIKSLVESGKIVLCNRYLGNENLTIINIDET
FT                   KAAYQATNYLIKCGYKRIAYCTGGIKNKNDYRFKGFMQAVTENGLSFDESLYFEKLLTI
FT                   KDGEELLVNILEEKSTMPDAIFSNGDTVAAGILYAAKKYGIAVPEELGIIGFDNQPIAE
FT                   VLNPALTTIEQPIKELGEYSAQVLLANLQGTSVPVAPDLETKLIIRETTK"
FT   CDS_pept        293755..294981
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0277"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="Maltose-binding periplasmic proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82979"
FT                   /protein_id="CAR82979.1"
FT                   /translation="MKKLLLSISIIVGLSLLASCGVEKEYKPDIKVNEKNVSLKVWVDL
FT                   NQGDFYRKVVDDFKKEHPDKNYDITVIESESGRAQEYVQKDPEAAADVFITPNDRLGQL
FT                   VESGAVYQLTKYTDDIKKNNTPTSIQAATYQDKMYGFPVTAEAMFMYYDKRVFSEDDIK
FT                   TFSGITSKGKLGINLAEAGADYRETPWFIANGTYLYGENGEDPYGTTFNTPEGVQVLNW
FT                   IGELKNNPNVVAVNADEISALRSGKINAVFSGVWNKDAIREVLGENMGVAVYPKTDFGS
FT                   GQVDMMAFQGSGIYCVNAFTKSPLDAMELADYITNADVQEKAFKELGKIPSNLEARTSS
FT                   TVEKDDVAKAVIDMTSGKHSVLMPKIPEMNVFWQHMNPLLVDTYKGKIKKEDYPEALDK
FT                   LVKDITPAK"
FT   CDS_pept        294999..296336
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0278"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82980"
FT                   /protein_id="CAR82980.1"
FT                   /translation="MMVKKNYFNIFKNGSVSTRLSYVIMGAGNLAHKQIAKGLLFLFSE
FT                   LVFLFFLVFYGITLIQGMATLGTVNQSWNFDKSLGIMVRTPGDNSMLMLIYGIMTVVIC
FT                   VLFIFLYLANIRSASQVEDFQRENKKIPTFKEDLKSLLDNKFHVTLLTIPMIGVVVFTI
FT                   MPLVYMISLAFTNYDHEHLPPRNLFGWVGFVNFKNVLNGDISSTFFPVLGWTLIWALLA
FT                   TATCFFFGVLLALLINHKGVKFKKFWRTIFVITMAVPPFVSLLVMQNLLHAAGPLNTML
FT                   LNWGIIAEPIPFLTDALLAKVSVIFVNMWIGIPVTMLIATGILMNLPKDQLEAARMDGG
FT                   NSFHLFRYITFPQILTVMLPSLIQQFIGNINNFNVIYLLTGGGPSNSNFYGAGDTDLLV
FT                   TWLYKLTVEAADYNLASVIGIVTFILSAAFSLFAYTRTNSYKEGSN"
FT   CDS_pept        296338..297168
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0279"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="ABC-type sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82981"
FT                   /protein_id="CAR82981.1"
FT                   /translation="MKRSTVWPNLLLIVLGCIWIFPIIWIVLTAFRAESGQFVSYIFPK
FT                   EYTLDHFAYLFENHENFPFMLWVKNTMIVAVCSCLLSTFITVSMAYVLSRLRFRFKKTM
FT                   LKTALVLNMFPAFMSMIAVYYILKAFGLTQSLTALVLIYSSTAALTFYIAKGFFDTIPK
FT                   SLDESAMMDGATKLSIFTKITLPMSKPIIVYTALMAFMLPWMDFIFAKVIMGDNVPKYT
FT                   VSIGLYSMLNQTTANTMYTTFAAGCILIAVPITILFIYLQKYYVEGITSGAVKG"
FT   CDS_pept        297183..298880
FT                   /transl_table=11
FT                   /gene="malL-2"
FT                   /locus_tag="lmo4a_0280"
FT                   /product="oligo-1,6-glucosidase"
FT                   /EC_number="3.2.1.10"
FT                   /note="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82982"
FT                   /protein_id="CAR82982.1"
FT                   /translation="MKITETKEWWKESVVYQIYPRSFQDSNGDGIGDIRGIIERLPYLK
FT                   DLGINVIWLCPVYKSPMDDGGYDISDYYEIDPMFGTMSDMDELIEKAEKLGIKILMDLV
FT                   VNHTSDEHEWFEKAIADPKSKYRDYYIFREGVNGNPPNNWRSYFGGSAWEAVPGEENMF
FT                   YLHAFSKKQPDLNWENIVVRNECIQMINWWLEKGLGGFRIDAILNLKKRIEYGTFPADG
FT                   EDGLVFIGHWILNQPGIEEWLKEIDERTFKKHNAFTVAEADVPEERLSEFIGENGHFRM
FT                   VFDFSYTDIDTPETGEWFKNSEWTVKELKEKIITNELVTQRNGWGAKYLENHDQPRSIN
FT                   KYLPQEYQDDRSKKMLGTLFMMLHGTPFIYQGQEIGMSNTRMESIDDYNDIATHDQYHR
FT                   AILSGMSPEEALEGMYRRSRDNSRTPMQWNDQKNAGFSDSDEIWLKTNPNYLDINVEQE
FT                   QIDDNSVLNFYKKLIHLRSDSSKYKEVAVYGELLPVESSDEVIAYKRKTDDAELLIIVN
FT                   FSDSENQLCIEGAYEQVLANVALPEMVENVLEIPAYTGAVFSRVLEVD"
FT   CDS_pept        298881..300323
FT                   /transl_table=11
FT                   /gene="gtfA"
FT                   /locus_tag="lmo4a_0281"
FT                   /product="sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /note="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82983"
FT                   /protein_id="CAR82983.1"
FT                   /translation="MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAIGGIHLLPFFP
FT                   STGDRGFAPSDYTTVDSDLGSWEMIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLN
FT                   SKYKDMFIRINDFFPPGRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQID
FT                   LDVTAEVTKEFIRQTIKNMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKA
FT                   EAAKYDMELLPEIHEHYSIQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSP
FT                   MKQFTTLDTHDGIGVVDARDLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQIN
FT                   STYYSALGDDDKSYLLARVIQCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYY
FT                   TIDEIKNEVKRPVVKALCNLLRFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITA
FT                   TLKANLSTKTFQISENERNILI"
FT   CDS_pept        300880..304434
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="lmo4a_0282"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-directed RNA polymerase, beta subunit/140 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82984"
FT                   /protein_id="CAR82984.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPTDGV
FT                   MEDSVLVQSIKIYAPNDDEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPETNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEQGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
FT   CDS_pept        304605..308210
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="lmo4a_0283"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-directed RNA polymerase, beta' subunit/160 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82985"
FT                   /protein_id="CAR82985.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMAPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRKQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIGVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEA
FT                   IATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAI
FT                   LSGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
FT   CDS_pept        308286..308831
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82986"
FT                   /protein_id="CAR82986.1"
FT                   /translation="MITHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKV
FT                   KQLGFKQAILSNTATSDTEVIKRVLTNFDIIDYFDFIYASNSELQPGKMEKPDKTIFDF
FT                   TLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPV
FT                   WDLADVPEALLLLKKISS"
FT   CDS_pept        308897..310357
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0285"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82987"
FT                   /protein_id="CAR82987.1"
FT                   /translation="MTEVKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVKFIPK
FT                   EERTKDLELDVSKAEIEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSL
FT                   NWARIFPNGDDKEPNEKGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADR
FT                   RVIGFFTNYAETVFKRYKNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAG
FT                   HHQFVASALATKLAHEIIPGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVH
FT                   ARGEYPSYMNRFFQENDIHIVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAG
FT                   NLMGGVKNEYLESSDWGWQIDPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKI
FT                   HDDYRIDYLRKHIEQMKEAIADGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDW
FT                   GKGTLERSRKDSFFWYKKVIETNGEDLD"
FT   CDS_pept        310520..311659
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="lmo4a_0286"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82988"
FT                   /protein_id="CAR82988.1"
FT                   /translation="MERERKIQILKDIVNIDSTNGHEEQVANYLQKLFAEYGIESEKVQ
FT                   YDVDRASLVSEIGSNDGKVLAFSGHMDVVDAGDVSKWKFPPFEAAEHEGKIYGRGATDM
FT                   KSGLAAMVIAMIELHEEKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGE
FT                   PSGHRIVYAHKGSINYTVKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNE
FT                   ILGDFIHNVTVIDGGNQVNSIPEKALLQGNIRSISEMDNETVKQVLVKIINKLNKQENV
FT                   NLELIFDYDKQPVFSDKNSDLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFP
FT                   VIIFGPGNETPHQVNENVSIENYLEMVDVYKRIATEFLS"
FT   CDS_pept        311806..312222
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0287"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82989"
FT                   /protein_id="CAR82989.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAVGISTAQFDCIA
FT                   QIGLDKEITQQQLAEKLVVTKGNVTQLLAKLEQLGYITRTKTGREKHIALTEKGQACYR
FT                   ENVPKQEAFQQAQFDKLTRDEQKELLKLLKKLGE"
FT   CDS_pept        312229..313188
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0288"
FT                   /product="glyoxalase family protein"
FT                   /EC_number="1.13.11.-"
FT                   /note="Predicted ring-cleavage extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82990"
FT                   /protein_id="CAR82990.1"
FT                   /translation="MKLTGIHHVSIFTANARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNHPSRNAISSLSLRVPSDEALHYWDKRLDEHRIFH
FT                   SKPIDQFGRKIIRLKDTDGLPVNLISDETSTQVTEVSPWEDSPVPAEYAICGLGPVRFS
FT                   VFKKEKTDRLLTKILGFERIGAYEDDDKLVTVFKTGDVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDGDLIGWTEMIQDLGYKNSGYVDRFYFHSLYFRESNGILIELATDEP
FT                   GFQTDFTKEHGTYVDLPPHLEERREDILTHLKPLDTDK"
FT   CDS_pept        313259..313894
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0289"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82991"
FT                   /protein_id="CAR82991.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIDGAKAVGE
FT                   VLKDTPIDAVYTSTSKRTQDTAAYILGDREIEIQPLEELKEMSFGTWEGIRVTEIDEQH
FT                   PEERAKILHSPETYKAEVNGGETYYELAERLLEGIEKIIAENPSGNILVVSHGMSLTLL
FT                   LYLLQGGTIEDHRKEAPRILNTSISIVEYQNGEFSLKKLNEVGHLDLK"
FT   CDS_pept        313978..315864
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0290"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82992"
FT                   /protein_id="CAR82992.1"
FT                   /translation="MKRIVKIFLHYLLGILGIILISCVPAIFSKVTSWSSSTYWEALKS
FT                   IFTAIFHPTQWEISYQGSAEVFHVSLADFITGPYFYSMKIIVASLLISALIAYLLVIAT
FT                   FRGPKWLRRGLSGFLSILQAFPDFSFIFLIQMAVVYIYQQTGVFTLNFYSLNGEQIYAA
FT                   PIVCLSIIPTVLFYKMMMLLMENEWQADYIQLARGKGLTDRAILLRHATPNMMQSLFYQ
FT                   SKTIVWFILSAYLVVEFLFGIEGVLYYLLAGFSPLNIFLVLALVFTPFYFFYALIDLWI
FT                   SRGKNTESANVTRIPLHWNSFQKTFTEKVNLKSKWRNFVVTTGQLLKRPSFSIPLVTLS
FT                   ILLIASLIYGLMGDKINSLKFISDATGRVTDMAPFKPNAQVWLGTDQAGNSILDQLLVG
FT                   IKYTLLIAVIIATLRVVIGYILAVPLAFFSKPRTRNFVQATADGMHYLPLSLLVFIIMV
FT                   NEFISYSGVFETSLFTRITFQILIMVVIVLPITTNRISSEISQVLKKEFVLSALVFGGN
FT                   ARWILTKHINPQIWSKLILIWIEQLIQTLQMFVHLAIFGIFIGGAIMGADDGMLNPVIP
FT                   ELSGLIANAKFVFANHQFWIILPPLVVFMILILCFQMMANSLLKREEESKKA"
FT   CDS_pept        complement(315893..316978)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0291"
FT                   /product="leucine rich repeat domain protein"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82993"
FT                   /protein_id="CAR82993.1"
FT                   /translation="MKKFILASLACTTLISFSPLVGQVEVNAATTNIATAPEKNLQEAP
FT                   PATVDQIFPDDALAFKVAQELGVSEDTVVTQEQLDTIETMVYVDFGVEDLTGMEYLHNL
FT                   KFVDLSQNKISNLESLANLTELETVSLNYNQITDITPLMNSPKLYNLELGVNQISTLPS
FT                   FENLTNLKILNLSSNQLQDISALKDTPQLTNLSISANNISDISVLSECDNLQAFYAESN
FT                   QLTSIEALRNKTKLEYFDANFNQIKDVTPLSTIPTIRSIKMEENQISDFSSLAGHRLEL
FT                   FDATGQNIYLPDIALGDSTNIVMKDNLGVTLHDWVWYTPGTYQNDTLTWENAGDNSAYF
FT                   LNNQYPTFPSVTVTVYQTVTP"
FT   CDS_pept        complement(317113..317739)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82994"
FT                   /protein_id="CAR82994.1"
FT                   /translation="MMANLQDRLARIQAKITALKEKDPDLNLFGSESHTYKLNQPLSNQ
FT                   TLTEFENAHQITLPQDYRAFLEQIGNGGMGPYYGLETLVDGLCASLDYKDEKYGVQTLS
FT                   EPFPHTDDWTAPGYKEGMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPS
FT                   YGEIWVDDRNNDNGVYPDFYFGNEERLGFLEWYELWLDKSIEEFE"
FT   CDS_pept        complement(317740..319176)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0293"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82995"
FT                   /protein_id="CAR82995.1"
FT                   /translation="MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIP
FT                   GTTFKGTNGDVAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFY
FT                   DNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVK
FT                   YWVSLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIG
FT                   PSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIE
FT                   DGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKK
FT                   VVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRI
FT                   DYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTR
FT                   IPKKSYYWYKQVIETNGADL"
FT   CDS_pept        complement(319296..320108)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0294"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82996"
FT                   /protein_id="CAR82996.1"
FT                   /translation="MYKLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRP
FT                   LVGVENYLTELELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNL
FT                   HMHFFDDKALYTPNREIGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELE
FT                   VGIAKIPESFREKYHLVRSTPFYLEILNRDASKGNAVKELSEKIGIKQSEVMCIGDQEN
FT                   DVTMLEFAGLGIAMGNAPERIKQLADYTTASNNDSGVAKAIQKFVLDK"
FT   CDS_pept        320244..320747
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0295"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82997"
FT                   /protein_id="CAR82997.1"
FT                   /translation="MKRNYHVKFLNEKDVELAEAVCAASEDYYLIEQNKPASKSDALKI
FT                   ITEIPDGKTRFDKFVLAVLDENEKPIGLVDIVSDYPRKGRWFIGLLLLTPDARHNGLGK
FT                   VLHQTIKEWASDGGADSLALGVLAENEKGRGFFEYLGYTKEETKQANYGGKEQEVSIFT
FT                   LAIK"
FT   CDS_pept        complement(320784..321446)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82998"
FT                   /protein_id="CAR82998.1"
FT                   /translation="MAYPFNHKEFIAMMEQYNLKSNIITIPEHTILNDLVTENQDCVYL
FT                   LKSGILAGYIDFDNDKIYSIFTANFFMGYYTIFENTPLVLTYQTLTECEVIIYKKKDIE
FT                   YSLSLFPENFGFQYTIMRTIAKHGYYKSLLQYRDKKDQLAFVFEMLVKILDIPVEDGVA
FT                   VLPKSISTTVIKNYCTLSKAFFYSQLKELKEAGIISKVKLQWRINMEALLEKNNTIV"
FT   CDS_pept        complement(321696..322538)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0297"
FT                   /product="competence protein ComEC/Rec2-related protein"
FT                   /note="Predicted hydrolase (metallo-beta-lactamase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR82999"
FT                   /protein_id="CAR82999.1"
FT                   /translation="MKKGILNVLLAFALIMGLSVPSSMQAQAAAPTIKVHFIDVGQGDA
FT                   IYIKAPSGEDILIDAGNKGKGKIVVNYLKKLKVKDIEIMIASHSDADNVGGLPEVMNNI
FT                   KVKSLYAPNSTNTTAAYKDFVNTAKKKKLAIKTAKAGVKLPVKGVNAQFVGPVKTYGKT
FT                   DRNNWSAVLHVAYKKNTFLFTGDAQTKAESDMIKAKKTLRADVLKVSTQGSKTATSQAF
FT                   VNVVKPKYAIISVGKNGYGHPTSQTVNRLTKAKAKVYRTDRNKTIVVTGNGSSYSIGK"
FT   CDS_pept        complement(322555..323376)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0298"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83000"
FT                   /protein_id="CAR83000.1"
FT                   /translation="MTKKYLICSDIDGTLLHQDQTVSEKTRDLIQTLENDGHIFSISTG
FT                   RMYHSAREVGLKVSNSGHVIASNGSYAAIRDEQLLKTTLEEKAIRETYDIMHDFDLPLF
FT                   FFSTNTLFYTKEPPAFFRELADKSRLDTGDDCFSLVSINDKAVFDENMNQFLNAIVVAE
FT                   DDIARLADVRIALDKANGIRVLSSHHNNLEILPANSDKKTAVEALGSYYDIPRERIITF
FT                   GDGENDIGMLQYAGTGVAMANASDNVKAAANHLTDTNEADGVYKFLKEFIS"
FT   CDS_pept        323492..324463
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0299"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83001"
FT                   /protein_id="CAR83001.1"
FT                   /translation="MGNLNWAILGPGLIAHEFAEGMRGLNREIYAVGARSLEKGQAFAS
FT                   QYGIKNVYDDFDKMLADPAIDVVYIATPHSNHYEFIMKSLHNGKHVLAEKAITVSSKEL
FT                   NEINALAKEKGLIVKEAMTIFHMPLYKKLREIVDSGAIGKLKIIQVAFGSAKEKDPKNR
FT                   FYNMDLAGGALLDIGTYALSFARYFLSETPDEVLTTMKKFETGVDEQSGILLKNKEEEL
FT                   AVVSLSFRAKMPKRGVIACEEGFITVDEYPRASRATVTHTTTGKVEEIEAGETSKALEY
FT                   EILAMEESVATGENTTYQLTNDVIAIMSDVRTQWGIKFPFEK"
FT   CDS_pept        complement(324501..325601)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0300"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="ABC-type sugar transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83002"
FT                   /protein_id="CAR83002.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDEIKKRVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLEGSNFIGDDFTIEVPEGKLKLLKDRGFDGKEIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
FT   CDS_pept        325892..328042
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="lmo4a_0301"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83003"
FT                   /protein_id="CAR83003.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKANFDLIKIRNAVEASMKAINLEDETFL
FT                   EEILLEVVSELPNKADMTIDEIQHCVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLKKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHKKDAMEWVVPEKQEGYAAEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWEN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGENVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDAE
FT                   AKNFTLDILKELKGYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKEYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECDFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
FT   CDS_pept        328035..328586
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="lmo4a_0302"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="Pyruvate-formate lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83004"
FT                   /protein_id="CAR83004.1"
FT                   /translation="MNNPKPCEWKSNELSRGYIADYKAFNFVDGEGVRCSLYVSGCPFH
FT                   CEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESVQGLTLLGGEPFLNTATCLSVVKRI
FT                   RATYGETKDIWSWTGYTWDEMMQETADKLELLSLIDVLVDGRFEQKLFDPNLAFRGSSN
FT                   QRIIDVQKSLASGEVVLYEL"
FT   CDS_pept        328684..329655
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0303"
FT                   /product="acyltransferase family protein"
FT                   /note="Fucose 4-O-acetylase and related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83005"
FT                   /protein_id="CAR83005.1"
FT                   /translation="MKAKEHDIQLSNIKGILIFLVIFGHYLLVMGPKEVATIDIIYSFH
FT                   MPAFIFINGIFSQKATIKKIGRLIGLFIIFQPLFLLLGFLTGYYKFIDMKMLITPAFHL
FT                   WYLLALAAWMLFAIYANKRGKYALDVLFLALVLCIIAIVNRYFYGTQFLTITRILSFAP
FT                   YFIAGFYLGENGFSKMRTFLKKYKYICWLTVIILVMVLYHLFSKQPNEYLNLFYGFLNK
FT                   TTFSATTLGYLMNVFSSFILAFLWIVLLIAIVPTKRTVFDIVGKDTLLPYILHPIIFYL
FT                   MMTKQRFFVDQTVAFQLLFTLLITIAVYGIFTMVLNKKKNVY"
FT   CDS_pept        330376..330696
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83006"
FT                   /protein_id="CAR83006.1"
FT                   /translation="MNIKGFFITPAVGFILNLYAGIVVGMMLNDLWGSVLHEGLRGGAL
FT                   IGVFVASMALPNIFIGALPVVICNLYAWITGKDINLEERYKNADNIDPSKNYPPNFGLK
FT                   KK"
FT   CDS_pept        complement(330762..330989)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83007"
FT                   /protein_id="CAR83007.1"
FT                   /translation="MYKLGNTEVTVEKYRAEFAKKHYLPFMKELMNMSGCTLLEARDFI
FT                   DKVIAEEQIEVNSMSKEIQDYCLAELQEDE"
FT   CDS_pept        complement(331062..331733)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0306"
FT                   /product="hypothetical protein"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83008"
FT                   /protein_id="CAR83008.1"
FT                   /translation="MDALFNYKEFVRLSHEGNIKYEKLKVPKHTDLVDTASQRNNHVYL
FT                   IVEGFVSISMNPQSNSIYTVLGKGSFVNYYSLFQGNVDDFLFTTISPCTIYKYTFKDLE
FT                   YFLSMFPENFGFQFFIMRDLARHAFFKSLFAETSSSDKLELSFSNIGKLHGALYEKDSV
FT                   ILPKEMRTSTIAAYSNLSKSSFYKQLALLKEQGKIWKNGREWVVRNKELYDYVKARQFV
FT                   D"
FT   CDS_pept        complement(331897..332676)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83009"
FT                   /protein_id="CAR83009.1"
FT                   /translation="MWKLALCQTDVVFKYPDANYARIEKAIVEAAKNGADIAVLPEMWN
FT                   TGYALNELAGVADLNGERTKEFLATLSEKHQIAIIGGSVSISEGNKFSNTMYAFDKYGG
FT                   LLSSYKKVHLFQLMNEHLYLEAGNDKNLFRLDGVSCAGFICYDIRFPEWIRKHTSEGSE
FT                   VIFVSAQWPAERVTQWEQLLIARAIENQAFVVAVNRVGDDPNNHFNGHSLVIDPLGNIV
FT                   AHGGEDEGNIYAEIDLNLVAETRGIIPVFTDRRPELY"
FT   CDS_pept        complement(332766..333428)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0308"
FT                   /product="ABC transporter, permease protein"
FT                   /note="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83010"
FT                   /protein_id="CAR83010.1"
FT                   /translation="MSLFFEEWGPILWQGFLETLTMTGITLVISLAIGLPLGVFLTLTR
FT                   KGGQSENLVAYSILNWVINILRSLPFIILLFLMIPVTRFVVGTTIGIQGVIMPLVVFTA
FT                   PYIARLMESALLEVDRGVVEAYQAMGISTPKIIWSVVIREARSGIVLGLTIATIGLIGA
FT                   TAMAGLVGAGGLGTIAYQYGFQRFEPTVMYTTIIILIIMVQALQSFGNFLSRRLKKD"
FT   CDS_pept        complement(333425..334441)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0309"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83011"
FT                   /protein_id="CAR83011.1"
FT                   /translation="MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKS
FT                   TLVRCINLLERPDAGQVVIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDNIA
FT                   KPLKLEGVPKDEIETRVNKYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILL
FT                   SDEATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQ
FT                   GTVLDIFTKAKHATTKRFVGSEASFDIPQDLLEKYIATGKLVSLHFIGDEADEPALALV
FT                   SRKFDVLPSILAGGIDHLKNGTLGKLLVHLKGDEVEYSKAISYLKESGVVVEEVELL"
FT   CDS_pept        complement(334456..335277)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0310"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83012"
FT                   /protein_id="CAR83012.1"
FT                   /translation="MRKLTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   KLDVAFKTVAFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEYRGLKLFEDAGIIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTKDNPYPNVFVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPAF"
FT   CDS_pept        335658..336839
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0311"
FT                   /product="aminotransferase, class I"
FT                   /EC_number="2.6.1.-"
FT                   /note="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83013"
FT                   /protein_id="CAR83013.1"
FT                   /translation="MKISKRLQNLPDQFFSSLVEKVGKKVAEGHDVINLGQGNPDQPTP
FT                   KHIVEAMKTAAEKPLNHKYSLFRGKHELKQAAADFYAREYNVTIDPNTEVAILFGTKTG
FT                   LVELPMCLMDPGDTMLLPDPGYPDYLSGVVLGEVQFEKMPLIAENDFLPDFTKIPVEVA
FT                   EKAELMYLNYPNNPTGAVATSDFFEDTVAFAKEHNVVIAHDFAYGGIGFDGKKPISFLE
FT                   TNGAKEVGIELYTLSKTYNMAGWRVGFAVGNSEVIEAINLIQDHMYVSLFPGIQDAAIE
FT                   ALTGDQTCVRELTARYESRRDAFISACKKIGWEAVAPAGSFFAWMPVPEDFTSSEFADY
FT                   LLEEVSVAVADGSGFGEFGEGYVRVGLLMDEDRLEEAVTRISKLHLFDKVTQK"
FT   CDS_pept        337045..337758
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0312"
FT                   /product="DNA-binding response regulator"
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83014"
FT                   /protein_id="CAR83014.1"
FT                   /translation="MAEKKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEE
FT                   VQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKP
FT                   FSNRELIARVKANLRRHSQVSSSAAEEEENSELEIGSLIIHPDAYVASKRGETIELTHR
FT                   EFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLV
FT                   TRRGVGYYLRNPEQE"
FT   CDS_pept        337943..339775
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0313"
FT                   /product="sensory box histidine kinase"
FT                   /note="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83015"
FT                   /protein_id="CAR83015.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEIIKNSDNSVKLQNDIRELLVDFSRASSNLIEVRIVDDKGKI
FT                   LGTSNLNNQGIVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGKV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIVEMKRQVYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTEGERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDTYQFEDLMEVDGSLTMDRSTF
FT                   DKPYVLRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPREPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKFEDEIEVSIADEGLGVPDEDLANVFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKTKGTIIKFTLPYSDLPEDDWE"
FT   CDS_pept        339772..341094
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0314"
FT                   /product="two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83016"
FT                   /protein_id="CAR83016.1"
FT                   /translation="MMKKTGFRSFVLTILVVLSIVLSYFIWKGQPDYEAINVKEVEKTT
FT                   IDKTMTTSQVFKPYKLAVNANESNYQSLDDDLLNELMAQGKAFSFSEVVLANKKSSEDY
FT                   EKLIHKNGTIEIIFPNNIPFSIFAQIFQIEGEGLESAFFNRIVFDVNNTDTGLHSVYFA
FT                   NDDQENIYQSSLQNKDIDKIEKIVKKNESKLTQNDKLISNKRNLFLSSEKTKLDRKKYI
FT                   IDSLEINLFTSALFQDSGTVKSEGNTYTDGSSVIEMDTDNKVLEYVNPSQERTNPEDLS
FT                   SVKRAGLIQDSFNFVNDHAGWTGDGAYYFTGYAGESATTNFSLFIDNLQVYNENGMADI
FT                   SVTEGLEAVYKYMRPFFRLDTDVPGEKKEVTLPSSYSVYNALAQNPNVKAEEIEDIVPG
FT                   YHMTRSESSGMNRLVTLEPTWLYKYHDKWFIFQPDAEKAGE"
FT   CDS_pept        341097..341936
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83017"
FT                   /protein_id="CAR83017.1"
FT                   /translation="MDWRKTQMIFIVTLLILNVFLAVIFFNKQLSDDPDTLGNETLEER
FT                   LKADNISHPDLSTKPTSGSIFTTERAAFTTKDVSNFTGQAITLKDNNKQIYSVLQNPVK
FT                   AGKKGTNPEFQKFMESSVYRGESYQFWNYDKDARTLTFNQLINNNMVLFDEAGQITFYL
FT                   DQDDRVISYEQTWMSKQDDLKDKTNLMSATDALEAVYQHGELKQDSDVVSATFGYYTTV
FT                   QLPSGNVYFPVWCFEVKHSGETNYVLVNAKDEQVINQSENKSTTEPGTELSSRQKAK"
FT   CDS_pept        342056..342886
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0316"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83018"
FT                   /protein_id="CAR83018.1"
FT                   /translation="MFANKILTEKDTDQIRFSILASGSSGNATLVETGDQKILIDCGLS
FT                   GKKMEGLFAQVGRDMNDLDAILITHEHSDHIKGLGVLARKYKLPIYANAKTWKAMDNMI
FT                   GEVSSDQKFQFDMETVKSFGSMQVESFGVSHDAIEPMFYIFHKGNKKFVMITDTGYVSD
FT                   RMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRRILGDEGHVSNEDAAIAMSEVITDQ
FT                   TKRIYLGHLSKDNNMKELARMSVTQTLMAEGIDVGGKLEIFDTDPDNATSIFTI"
FT   CDS_pept        342984..344486
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="lmo4a_0317"
FT                   /product="serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83019"
FT                   /protein_id="CAR83019.1"
FT                   /translation="MDEKEKNLNENSEKESTPKREVEETLHTNESSQPVQETPIVEGVT
FT                   PEGEKFAGATEDAAEASSTNAFFEEASNKESEPARPAPGPRRAGTTGGGAVPPNRVSNG
FT                   GSGNGNGEPPKRGKHFIGYFLTALIGVIIGGLIIFFVAWDNGDNADTTSNSNNKATKVE
FT                   KVSVDTTSDVTKAVDKVQDAVVSVLNYQSSSSLDGTTTSEQEASSGSGVIYKKANGKAY
FT                   IVTNNHVVADANKLEVTFTNGKKSEAKLLGTDEWNDLAVLEIDDKNVSTVAAFGDSDSL
FT                   KLGEPAIAIGSPLGTEFSGSVTQGIISGLNRAVPVDTNGDGTEDWEADVIQTDAAINPG
FT                   NSGGALINIEGQVIGINSMKISMENVEGISFAIPSNTVEPIIEQLETKGEVERPSLGVS
FT                   LRDVDTIPETQQKNILKLPDSVDYGAMVQQVVSGSAADKAGLKQYDVIVELNGQKVTNS
FT                   MTLRKILYGNDVKIGDKVKVKYYRDGKEKSTDIKLEAAKTTT"
FT   CDS_pept        345174..345653
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83020"
FT                   /protein_id="CAR83020.1"
FT                   /translation="MNIQIVTVGKLKEKYLVQGIAEYLKRLGAYAKVTIVEVPDEKAPE
FT                   VLSDAEMKQVKDKEGARILAKIPDDAHVIALAIDGKMKSSEEFAADLDKLATYGKSKVT
FT                   FVIGGSLGLSEAVLKRSNERISFGRLTLPHQLMRLVLVEQVYRAFRIVRGEPYHK"
FT   CDS_pept        345718..346356
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83021"
FT                   /protein_id="CAR83021.1"
FT                   /translation="MVFLKKYGFYFLLLGVLSDFLTPYILGIFYPELNQMTRVMSVFGD
FT                   VASPVRGAFLVWSVVSGVFFVLALPAIYQSVVKTSRTLAILLASAIGLYGIGDCIFTGL
FT                   FSIDTEQASWTFSTWVHNIGSGLGYAGFLIFPLFLVILYRKTGDKTRSNIYLVLLIVSL
FT                   LSAGVYGLARIPAVNDLPVLDEIGFCQRISFFFNYLPIVVFGIDRIRKP"
FT   CDS_pept        complement(346362..348233)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0320"
FT                   /note="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83022"
FT                   /protein_id="CAR83022.1"
FT                   /translation="MTISERQRSLLEKLNDSQKTVTAKALSEMLGVSSKTVRNDIMQIN
FT                   QSFSSTIIASKAGKGYFLTPNEQLSQINLTKNNENLHFELLRHIIEQDHTNFYDLADQF
FT                   FISESTLSRIIKELNAVIAEKDESLCIIRKNNELITEGGEEEKRRIFNLFLNQEIENHQ
FT                   LSLDKYADYFDYCNLKQLSELIIAYHKKNEFFMNDFSTISFILHIAVLIERISMGSYIE
FT                   RTALLEQDKTSLEMAEHLTETLEEELQIDIPTQELSYIARLYSGKLATTSTIDAKVFGS
FT                   VVTRLLEAVDQNFHIDFSADEKIATYLVAHISALYKRANHKQYLTNPLTEELKNKFPFI
FT                   YNVSVYASAFIQKELAITFPDDEIAYIALHFLSASETINHGKKRKILLVTPYGAGSQRL
FT                   IHNQLKKIPDFSIDLLVSQSIFDIKQFTLDKEIHLILTAEPLNLTTDIPVYHYDLLLAE
FT                   SDLQKIKHILETKQKTESISRKFFKKELFFPKQNFKSKEETITFLCEQLTAFDYCDPDY
FT                   VAKVFEREQLSSTCYGNYYAIPHAIQRSAKKNAVAVCSLDKPIDWGGNRVKLVLLLTMK
FT                   EERDNSFEELFGQLVTILNERSFVKKLAKQEDFQQFIELCEQKTLDS"
FT   CDS_pept        complement(348332..349645)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0321"
FT                   /product="PTS system, IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83023"
FT                   /protein_id="CAR83023.1"
FT                   /translation="MRFNTISEKMDQYISPLANKLSQQRHLKATRDAFMSMLPITLFGS
FT                   IPIILKAAPVTDDTKNGFLLAWANFAEKYDLILNWISGITLGAMSLYICVGITYYLCKH
FT                   YHEDFLRPLMFSIAGFFMLVLNPIKMGWDGKEVDISFLDGRGILLSIFVAIVTVEGYHW
FT                   MRKKNVGRITMPDSVPASLSETFAALVPGIILMTFFSIIFIIFNLLDTTAIQFLYEKMA
FT                   PSFKAADSLPFTILSIFLVHLFWFFGVHDAALAGILGPIRDGNLSINAAEKMAGQDLTN
FT                   IFTTPFWTYFVIIGGSGSVLALAFLMMRSKSKQLSTVGKVGFLPSIFGISEPLIFGTPL
FT                   MLNPIFFFPFIFTSVFNGVITYLCMYFGIVGKTFAVFSWQMPAPIGAFLSTMDWRAIVL
FT                   VFILIFLNGLMYYPFLKVYEKNLVALEKEAEEENIAAN"
FT   CDS_pept        complement(349650..349940)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0322"
FT                   /product="PTS system, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83024"
FT                   /protein_id="CAR83024.1"
FT                   /translation="MKNIMLVCNAGMSTGMLAKKIEAASGNTLNVTAYSESEYTDYLDG
FT                   VDLVLIGPQIRFLMPQIKQAVSVPVHAISPVKYGIMDGKGVYEDIQKLIGG"
FT   CDS_pept        complement(349956..351347)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0323"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83025"
FT                   /protein_id="CAR83025.1"
FT                   /translation="MNNNFLWGGATASYQCEGAWDVDGKAESMWDYYLHEAGLENGDVA
FT                   SDHYHRYEEDIRMMKEGGQNSYRFSLSWPRIIKNRQGDINLKGIEFYQNLLDTCKKYDI
FT                   EPFVTLYHWDLPQYWEETGGWLDHDVCAAFEHYAKVCYDHFGDKITNWTTFNEPKWFVA
FT                   NGYKIGNYPPGYQDTQKTMIAAYNVMYASALGVKAFKEGGYPGQIGIVHSYTPVNGVDE
FT                   SIETKIAMRYADNYCNNWILDTAALGEFPVDLIAELAKSHDISFMKTDELQTIKQNTVD
FT                   FIGLNYYSRTLVKPYTGGETQLQFNHSGKKGESKVLIKNWFEQVKDPANETTEWDTEIY
FT                   PKGLQDGLIEAYERYQLPLYVTENGIGVREDVSVSQVDDAYRIAFMNDHINAIFNAIDA
FT                   GCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFENNQIRKPKASYYWFKEMIESQGKLI
FT                   KRREF"
FT   CDS_pept        complement(351340..351681)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0324"
FT                   /product="PTS system, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system cellobiose-specific
FT                   component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83026"
FT                   /protein_id="CAR83026.1"
FT                   /translation="MTDSNELTTELDSMAIILHAGNAKSCAFEALKEVKQQNIEAFTQK
FT                   ITEAKDEIKLAHRAHAELLRKLSSENRMREVDLLLVHAEGHLSSTDIAVEMIRELGEIY
FT                   QWKWSLSNE"
FT   CDS_pept        351881..352462
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0325"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83027"
FT                   /protein_id="CAR83027.1"
FT                   /translation="MSKKWIGIILVSALFLLIGCGKVPVENKKVVDDKEVINSKFTGKW
FT                   KLETVSIGKIDRTGYREVNHDYSREFEIDRNGIIKEVIVDDDGARTFTFKIKSKGGDEY
FT                   QNDGSLTSEEVFKYETEAQKEYVKKVLELKRKIDFVKIIKSEQKGNEYYIETEQMQDLT
FT                   FFMYLSDKKLIKEAVYEKENYSSKDIYIKK"
FT   CDS_pept        352562..353113
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0326"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83028"
FT                   /protein_id="CAR83028.1"
FT                   /translation="MSKKLVSIIFLGMLLLLAGCGKAVVDSKYTGKWKLESVSIGASDG
FT                   TDMKDTDESNMMSHDLEMNAAGNVKELYIYDEFVLTNSYKIKQKNGNEYQYDGPVTSKK
FT                   VYGYETESEKENVQKALKALEAQDVIKIMKSEQKGNEYHLDTKAEREYEFSMELENENL
FT                   ILKKVDKKENAMVKETYKKN"
FT   CDS_pept        353296..354378
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0327"
FT                   /product="threonine aldolase family protein"
FT                   /EC_number="4.1.2.5"
FT                   /note="Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83029"
FT                   /protein_id="CAR83029.1"
FT                   /translation="MTTTLKTSYQKTAYKLGGNGPRNIGVLTEALQNIDDNLESDIYGN
FT                   GAVIGNFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRCVAYHPLSHLEIHEQ
FT                   DGLKELQQITPILLGTANRLVTIDDIKSLREPVSSVLIELPQREIGGQLPSFEELEEIS
FT                   DYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDD
FT                   FVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKT
FT                   VPEVPVSNMFHVYFEKSADEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFA
FT                   EIPVEILESAFECLEKELKL"
FT   CDS_pept        complement(354436..354822)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83030"
FT                   /protein_id="CAR83030.1"
FT                   /translation="MQHQEQEKKDQAFFNDQKEKITIYLKYNIPDFNTVTFTNEEFNPI
FT                   GTSIDGYINNDKNLSFTAGKDVKIFSCSEELDKMFKEPRKGYDEIIEKEETSIEIPREK
FT                   TKTIDEILSELKSYEDQVITRNKI"
FT   CDS_pept        354927..356081
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83031"
FT                   /protein_id="CAR83031.1"
FT                   /translation="MIDLTTKKAFTDEEYFKLSEAVYQDGTLNSKKINIELSDRTKSNW
FT                   KVVSKLNDKATDTQAFAVVPEEKGKDGRISYNYNNMVFVYRGTKESKDFGSDIINVFAG
FT                   TNTRTSLDRKSKNPFQVSEKWTKEVLKEFNPKNPTSTGHSLGGALSHYNSILHDFNATT
FT                   YAAPNIYQLLPEDKQKKVREGFYNKSITDFTHDDDMIGTFDQFGSPIIGSQYIAERNKV
FT                   EVGVKGVFGAIPGHYNETFEGCFSSDGTMKLKVDVDTIIRYAQDIDRIIHSLQTSNDDL
FT                   ANIEKDLQLGSKKIQNQLEDEIGIGGAYSELSTWDIDDVLTELCTKYKNGVYCFYNPDE
FT                   FERYYEMNHHTCKLLKNFQIELIDAAQSFREADTYLGEWISNNN"
FT   CDS_pept        356097..356525
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83032"
FT                   /protein_id="CAR83032.1"
FT                   /translation="MYGNTYQREYARAMGETAYDTSYQLKIIERELKKKDLTEGERSNL
FT                   LAAESILKKQVQLKVLNQDAKKLVEKLTQQTRDEMNMIQIENEKIGDELKFIQDKLADA
FT                   FESRTAKAVQSWMRNIREEELEEQKEVLVICKESIRMD"
FT   CDS_pept        356787..358448
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83033"
FT                   /protein_id="CAR83033.1"
FT                   /translation="MSIINSNFRSLGSYIMENVYKIPDYQREYSWEETELEDLWMDLSQ
FT                   IINGETESHFFGQIVIHIDKKVDEKLIIDGQQRTSTTVILLAAMRDLFIKIHDYGWEDA
FT                   RFDAEDITTKFIGRYTQTRDERKLILGENDKEYFSNRIQFMTPETKKKQKLTNSQKRID
FT                   FAYDYFYKKLEKSMDSAETLENKYTVLKEFFSTFTEKCSVMFVETDDINEAFIIFETLN
FT                   ARGRDLETADLLKNHLFRVANKKIDVVKEEWKQMLEFLGKIDTTKYIRHFWNSQNSFIR
FT                   EKDLYKVIRKKITTPLEANNFMKDLLKLSEVYSGMVNPAEDNFFDANIQKVLADINILG
FT                   AKSFYPIILAMVKKGYDFKEIYEVLSCIEVLVVRNFVVSGLVANKYEIEFSKIAFRIYQ
FT                   EDIEDFTEIMSLLRKNIVADNDFLHNFSSFEIKNKPSIRYILKKINDSYSKELTVLDDN
FT                   NKVHIEHIMPVKATDWDIIKEDHGEYLWKLGNLTLLGGEYNKKSTNKIFNEKKEVYEYS
FT                   QVQLTKELLDYEEWTVETIQERQKILAEVAVNIWKV"
FT   CDS_pept        complement(358698..359573)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0332"
FT                   /product="type II restriction enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83034"
FT                   /protein_id="CAR83034.1"
FT                   /translation="MSEYSNVLIALSNILERNSCRLTPIFRGNGAANAAGDSLEFFVKD
FT                   MFCTGASAYSHQIEKEKHYDKYLSWKGNSSNFPDFIIKEGVGVEPKKMNGKGVGNLALN
FT                   SSFPKAYIYPDTQNLPIKELIMESQWEKKEIVYVVGNLNEKDDKLYRLWLAYGNTFIAR
FT                   ESIYLDLKESIKEAVVDLPDAIFVDTKEFGRIKKVDPLGNSNLRLRGMWELSHPEVVFQ
FT                   KYLQMNEIPEDATKINLIITENEYENLSDKPDLSRYFNENRLQVQKILIPNPNNLEEEI
FT                   SAYLFEAFTD"
FT   CDS_pept        359701..360936
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0333"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83035"
FT                   /protein_id="CAR83035.1"
FT                   /translation="MKNMITESKFTSSSTLSTQEIKKVLFSKIEDENKKIKNLSVPEID
FT                   YSNINYDNKKVNVVSLFSGAGGLDLGLELAGVYAKKEQKEQPLELLNNYPRYKEIRKES
FT                   LFNIIYSNDMFKEANETYLANFQSNILKQELDIRKIPNFPKCELMIGGFPCPGFSAAGP
FT                   RLIDDERNFLYIHFIRALMQSQPDFFVAENVKGLMTLAKGEVFNQVVQDFSSAGYKVKA
FT                   FLVNSRDYGVPQLRERVFLIGTHETKQPNFEYILPPPTNGTKKGLLPFVTLRDSIFDLL
FT                   DKPGDFYEGSFSSMYLSRNRKKTWEEQSFTIQASGRQAPLHPSGKPMEKLDKDIWKLVG
FT                   NTNRRLSVKEIARIQTFPDWFEFSTGGNIKASKNHRLNQQYKQIGNAVPVKLAFEMLLP
FT                   IAKYMNEQKNRC"
FT   CDS_pept        361376..362161
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83036"
FT                   /protein_id="CAR83036.1"
FT                   /translation="MPKLIIDADDFGLSKAINHGIIESYKTGITTSTLLMPNLETAEHA
FT                   IALAKDHPDLFIGQHTNFLLGKPCANPAEIPSLVDENGEFHRSKYYRANTELKFQYEDV
FT                   RTETIAQMERFKALTGHYPEHIDCHSIGDETVDQAFFDIAHEFGIHTTLKYSGDKKWPD
FT                   QEGYLPIIKLLESGALPYTNGGVSVENFLNDDFGLLKLAPNEIAEMHFDVGFLDQFVLD
FT                   NSSYTLMRCRELATICDARVRDWLLENGFELITFGDLQR"
FT   CDS_pept        362384..363058
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0335"
FT                   /product="TENA/THI-4 family protein"
FT                   /note="Putative transcription activator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83037"
FT                   /protein_id="CAR83037.1"
FT                   /translation="MFVHSFQEEVGDLWQETLQHPFVRSLADGTLEKEAFYYYLLQDDY
FT                   YLSHFEKVIEKSVEQAGTAELAAEMREVQRRLRQSELLMREQFYPRVGLTERDFSERKP
FT                   APTAYHYTSHLYRMADFGSFGVTIASLLPCYALYADMGKMYEGARSSEPFYQELLDSYV
FT                   DENYQKVVLQQKRLVEQAASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVN
FT                   YV"
FT   CDS_pept        363051..363860
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="lmo4a_0336"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="Hydroxyethylthiazole kinase, sugar kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83038"
FT                   /protein_id="CAR83038.1"
FT                   /translation="MFDFMTLEKVREKGPLVHNITNIVVANDSANGLLAIGASPIMASA
FT                   KEEMDELAKMADVLVINIGTLDGELVEAMKIAGRAANVAGTPVVLDPVGVGATSYRRKV
FT                   VQELLAEIQFTAIRGNAGELAAIAGEAWEAKGVDAGVGSADVLSIAEKVANEWSTVVII
FT                   SGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQDDAFRASVEACASYA
FT                   VASEYAELELERKLPGSFRPLFLDALASWSVEKTHAKAKIQESGEHK"
FT   CDS_pept        363857..364660
FT                   /transl_table=11
FT                   /gene="thiD-1"
FT                   /locus_tag="lmo4a_0337"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.1.49"
FT                   /note="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83039"
FT                   /protein_id="CAR83039.1"
FT                   /translation="MIFPQVLTIAGSDSGGGAGIQADIKTFQERKTFGMSVITAITAQN
FT                   TLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVARNIHLHNFQNIVI
FT                   DPVMIAKGGTALLENEATQVLKDKLLPLGTIITPNIPEAEEILGEKITTKAEIEQAAKK
FT                   IFDLGVKAVVIKGGHSEMSEAADFYYDGETTKWLTSERFDTPHTHGTGCTFSACIAAEL
FT                   AKGNSLLDSVMVAKEFITSAIKYPLGIGHGHGPTNHFAYRLEDGK"
FT   CDS_pept        364657..365301
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="lmo4a_0338"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83040"
FT                   /protein_id="CAR83040.1"
FT                   /translation="MRAELAVYFIAGTQDIVRGTLPGVLEEALKAGITCFQYREKGVGS
FT                   LQTASERKEMALECQQLCAKYQVPFIINDDVALALEIGADGIHVGQNDEGIRQVIASCA
FT                   GKMKIGLSVHSVSEAAEAERLGAVDYIGVGPIFPTISKADAEPVSGTAILEEIRRAGIK
FT                   LPIVGIGGINEKNSAEVLTAGADGVSVISAITRSDDCYSVIKQLKNPGSPS"
FT   CDS_pept        complement(365328..366743)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0339"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83041"
FT                   /protein_id="CAR83041.1"
FT                   /translation="MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFG
FT                   HITDGPTPDNLKLEGIDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAG
FT                   LQFYDDLFDELLAHNIEPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYK
FT                   GKVKYWLTFNEINSILHAPFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIM
FT                   PEAQIGCMVLAMPTYPLTSNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNI
FT                   ELDVTEEDLEILKNTVDFISFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGW
FT                   QIDPQGLRVVLNEFWDRYQKPLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLS
FT                   QVKEAIKDGVDLMGYTSWGCIDLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFD
FT                   WYKNVIATNGEDL"
FT   CDS_pept        367019..367678
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83042"
FT                   /protein_id="CAR83042.1"
FT                   /translation="MGSAFSAILSPAVGILISPFPIVGLILILLSNKARINSIFYTVGW
FT                   IVGNIAIFFIGLFLMSSAVSSSGDQSTLVKVVLIVLGVLLILLGAHDFTKRPKNGEKAA
FT                   TPKWFEKMSNIKPGGAMIFAFVLSAVNPKNMLLSLTAGVSVGALNLSGGQETTATIIFG
FT                   IIACCSIYIPTIAFLLAGSRLNNALDSTRKWLIQNNSVIMAVLFLFIGLSVISKAF"
FT   CDS_pept        367862..368254
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83043"
FT                   /protein_id="CAR83043.1"
FT                   /translation="MFDKLMGKAAIVTESSYGIERFLDEDEQIIQIFKFIRDEVIITSK
FT                   GIFNIDAQGITGKKVEYKFFPKKALKYVSIETAGTLDRDFDLKIGVEGNTVVTQNTSFS
FT                   APIALKVHKNDTEMGFALYKMIKGML"
FT   CDS_pept        complement(368300..369070)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0342"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83044"
FT                   /protein_id="CAR83044.1"
FT                   /translation="MFSVTTFNIRFDDTSERKKSWELRKTLTKSLLDKYQWDFMGVEEP
FT                   LLPQMLDMKAMLDWDYFGVGRDDGLEKGEFTAVFYNSTRFTLLQEGHFWLSDTPDVPSI
FT                   HSTAMFPRICVWGKFADSDGKQFYLFNTHLDHISEEARLFASQLLLKKAAIIAENSPVI
FT                   VLGDFNTQPNTPTYNYITEKYQDAQLISQKPAKGPTGCFHDFHPLRPENELEKIDYIFV
FT                   SNEFQVNTYETIVDEVDGFSASDHFPVTANLDWK"
FT   CDS_pept        369224..369706
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0343"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83045"
FT                   /protein_id="CAR83045.1"
FT                   /translation="MLRKGRWLLILLLLIVLVALSACEDSGNGDVSGVPAKKEKQHFPP
FT                   NDTKKGWIELLATDGISSQGNLPCVYEEAESVEKLEIHMKELSTASLTYIYIDGYIVQM
FT                   EQGGNELSFQIQLSKTELRKGIHELAVVQYQENNPETKKVEFLKRAKYEVKQIKND"
FT   CDS_pept        369967..370869
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0344"
FT                   /product="transcriptional activator, Rgg family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83046"
FT                   /protein_id="CAR83046.1"
FT                   /translation="MGSYGELIREIRLSKGLTQKEVYTGIISRSYAIGFEKGKHEITLS
FT                   LFEEILKRIMVPLDEFFFIYRDFSSTEDDSFWIDFVELSGKNDVVGMQALLDKITLERT
FT                   EQSEVRKAILHTRIQTINHYLRTNVFDESNISDEYKKIIHDYLWKMQTWTLEEVRIFSN
FT                   GISFFEEEVQIHFYQIMLKSYEKYRYYDRGRLLFCHLFANLTDELIIQNKINYANLVLE
FT                   KLKEASETSGSFNSAFYRIVANYYQGAIWMKEGEVEKGYHQAKRAIQTWKELHYEAIAD
FT                   LYSVVLKQFLEKENIQVED"
FT   CDS_pept        371032..371904
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0345"
FT                   /product="transcriptional activator, Rgg family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83047"
FT                   /protein_id="CAR83047.1"
FT                   /translation="MISYGELIRQIRQSKKISQKEVYTGVISKSYAIEFEKGTHAISSL
FT                   LLEKIVAKLMVSMEEFFLMYHQEELPEKEDFWETYARTCKTDEASAWESLYQKISLEKG
FT                   KVNQVKSAAIKLELDHIKGKQVADKKAVQILENYLIEAVFWTLQDIFLFTRMMHYLPLK
FT                   SRVPFYYKLLNTLDRYRHFERGRSILQSALASIMDDFIERNEIEHMELMIKSLEKISED
FT                   CDGTYFKILCMYYRGIVRWGEGEEREGGEEIDQAVAILRALGYENKAAEYETMYRQFAR
FT                   ENNDIKTME"
FT   CDS_pept        372211..376152
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0346"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83048"
FT                   /protein_id="CAR83048.1"
FT                   /translation="MNSNEPFIKEIEKETGKTRANITQTDLEAITALRVTGASDIPTNI
FT                   DMLTHLTTLEVKNGTLSSVSNSVGNLKELKILVLNDNNLSTFPMIAFQLPKLEELQVSG
FT                   GTIEEIPATITNMASHLKFLGILNNHLVKVPDAIFTTNWTNATGGDLDLMAAGNQIVTN
FT                   IPANYISQFNNGDNLLEFYDNNYQKQDQLTTTPGYTIDVPVGTDFNQLTPDKTKLALTS
FT                   GRTLLAQHEFEYYDDGSSSLIHNGVAAAPGQATIFIKSKFSTQSNKFARTQVTVNITAL
FT                   NGGPITVKHEDTKGQELAPPVILNGKDGDPYTTTQKTFPGYTLVATPANQNGTFTMNPA
FT                   TVNYVYSANDYKLTSTFKDAQGQELKAPVVDTKDYHIQDNYTTTAATIPGYSLVSTPAN
FT                   QNGTFGAGNVTVNYVYKKDDYTLTSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFP
FT                   GYTLVATPTNATGTFGSSNITVNYVYQANGYQLTSTFKDQQGKTIAPDDVDTKTYHVND
FT                   PYTTTAKTIPGYTLVTTPANDQGNFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKQPV
FT                   VDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLTSTYKD
FT                   AQGTELKPPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAV
FT                   AYKLTSTYKDQQGNDLALPKVDSKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASD
FT                   VTVNYVYKANDYTLTSTYKDAQGKELKTPVIDSQKYHINDTYTTTGATIPGYTLVAAPA
FT                   NQSGTFGAANVTVNYVYKADDYTLTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATI
FT                   PGYTLVAAPANQTGTFNTSNVTVNYVYKANEYTLTSTFKNVQGTELKPAVVKKGFIIKD
FT                   GYATSGVTIPGYTLVATPSNKKGTFGASNVTVNYVYKANGYALITTYKDTQGKDLKPLA
FT                   IDTKTYNINDPYTATALNIPGYTLTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKD
FT                   ANGKELQAPKVDAKTYHIQDTYKTTAAVIPGYTLVATPKNDQGTFGANNVTVNYVYQTN
FT                   DYTLTSTFKDAQGNELKAAEIDAQKYHIHDTYTTKAAVIPGYTLEKTPTNETGTFNASD
FT                   IQVNYVYKANDYQLTSTFKDQQGNEIALPTVDAKTYHIHDAYTTKARLIPGYSLVAAPT
FT                   NQIGAFGTSDVTVNYVYKKDAIIKPITPAKPTILTIKTPASKVIKTKVVKQTLPKTGDD
FT                   DAGLLNLLRLIGLVLILGVFLAVGSKKLR"
FT   CDS_pept        376290..376970
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83049"
FT                   /protein_id="CAR83049.1"
FT                   /translation="MLEKKYQIHLQNHYDATSRQVQKKEIKVLKKRKNLLIGEVFPYQI
FT                   CLESTMEYSRFMLWFEKEVQKIVKELWNQHFIIKLTLSQLHFRETILFLEHLKDFSKRI
FT                   TIEFIGEDTPEIKKHFSVQEQEAFFIGKLRMLKKWKFIISKHIEGCSVEQTLAFTPCLH
FT                   EIKYTMSQQARMEENIIDLHMFIDFWEYWATHKKLKFVVEVKEADFITKSLMHKKVHVQ
FT                   FENA"
FT   CDS_pept        complement(377155..379056)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0348"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83050"
FT                   /protein_id="CAR83050.1"
FT                   /translation="MKLSKFFTIIALSATVTSSLPIPMVKAESTTANEMKTENQLLKTE
FT                   LKETPKEKTPNNNLKNQLVQAGTKTYNDYFPDDNLAKEVAETMNKNADESVTVEELAKI
FT                   TKLDARSQDIEDSTGIEYLTGLEILYLEDNQLKSIDVSKNLNLKDLACSNNPLANLDVS
FT                   KNLALEELTCENNELTQLDVSQNTALEYLYCPRNQLTKLDVSKNSALRYLACDVNQLTN
FT                   LDVSKNPALTNLGCTKNQLTDLDISQNPNLSTLICSDNQLTNLDVSQNQSLAYLTCDNN
FT                   KLKKIDIDQNLALIELSCENNQLTNLDTTQNLALEFLYCDDNQLTDLDVSKNVNLLILF
FT                   CNNNQLTSLAVGDTIGKVRCNNNQLKDISFLPDYFTDDYDDYQAMDQTLVSPTQTTQNN
FT                   TLVYAVPTDLLDKDGNIVSIIKPDNGGIYDAATRTITWENLPDNGEVSYTFENEDYGRF
FT                   SGRVTVPYTGKETISISSDDEISYKEGTTKTEAAFLADIHASVTPATETITSNFADAVD
FT                   FQTPGKYVVTLSVAGSDVTKDVIVYVTAEPSTDNPVAPTPPKDKDDTDVNNEQSPGNDK
FT                   DGTDVNSGKSTDKQPVKVVEKQLPKTGDITSLSLSLAGIVCLSFGILFFIKRKKKTV"
FT   CDS_pept        379623..383852
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0349"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83051"
FT                   /protein_id="CAR83051.1"
FT                   /translation="MKSKTKQIIIIGVVLFQSLFAYPLITMAEENESKSVNTETTLEPK
FT                   VALEEKTPQKPSLTNNLKQEKTVLQAGETYETVFPDAALATVIAKAATGSEDITQEVSQ
FT                   TDLNKITSLTGTSKGIVDLTGIDLLSKLTSLSISGNQITDISALNGLVNLSNLNVSNNK
FT                   ITSFNLNANSNLPMLSTVNIRSNNLKNINVQDQPKLRTIECDTGSSSELTEVTLKNLPI
FT                   LIAVGTGSSAYQNDIVFSSTPGLSKVILENLPSTSSEVKLDHCAIEELVINNLPKVSVV
FT                   IISYNKITTLEGLENLSAVNTLYVSENLVTEIESMHAFPKLQKLELGWNALTNVVMDQV
FT                   TAEKFPLLRTMNVSGNNLIKVNIQDQPKLWTFECDTGSSSELTEVTLKNLPTLIAAGNG
FT                   SSAYQDDIVFSSTPGLSKVILENLPSTSSEVKLDHCAIEELVINNLPKVSVVIISYNKI
FT                   TTLEGLENLSAVNTLYVSENLVTEIESMHAFPKLQKLELGWNALTNVVMDQVTAEKFPL
FT                   LRTMNVSGNNLIKVNIQDQPKLWTFECDTGSSSELTEVTLKNLPTLIAAGNGSSAYQDD
FT                   IVFSSTPGLSKVILENLPSTSSEVKLDHCAIEELVINNLPKVSVVIISYNKITTLEGLE
FT                   NLSAVNTLYVSENLVTEIESMHAFPKLQKLELGWNALTNVVMDQVTAEKFPLLRTMNVR
FT                   GNNLIKINIQDQPKLWTFECDTGNSSELTEVTLKNLPTLIAASSGSNDIAFSRTPGLSK
FT                   VILENLPSTNSEVNLDHCAIEELVINNLPKVSMVDISYNKITTLEGLENLSAVNTLYVS
FT                   ENLVTEIESMHAFPKLQKLTVDNNHISVLPTSLKTENPVLTTLSAKNQTITLKQKVIVS
FT                   DLVLDNEVKNFGQITNAKSISNKGTYQNDQIKWLFEDIKSVNAVDYQFSESVQEATIQG
FT                   TFSGKVTQPIKASKVPVITADAEMNYPKNEAVSEAAFFKDISASVTDDATLTSDFESVV
FT                   DLAKAGTYEVTLNAMNEDGVEAASVTVLVHIAKSPAPVITTDKEITYTKNAEVSITEFL
FT                   AAIHAKTNDGSPIESDFATAVNWSTAGDYTVTLKSTNEDGVEAIPVEVTVHIAKSPAPV
FT                   ITADKEITYAKNAEVSITEFLAAIHAKTSDGSSIEADLDTAVTWGTVGDYTVTLRSTNE
FT                   DGVEAIPVEVTVHIAKSPAPVITADKKITYTKNAEVSITEFLAAIHAKTSDGSPIESDF
FT                   ATAVTWSAAGDYTVTLRSTNEDGVEAIPVEVKVHIVEPLAPTISNVTFDVDDVQTTESL
FT                   EAGELISEPLSPTKEGYTFIGWYDEKTGGNKWDFTTDKMPAYNIILYAQFSKDTNKAEA
FT                   AGGDKPSTPSSIKVSPTGQSESGNLENRFNVKLPATGDDNATVLLVGLGLLMLGLFIRL
FT                   TQKKRAK"
FT   CDS_pept        384240..384878
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83052"
FT                   /protein_id="CAR83052.1"
FT                   /translation="MGCDIHLMVEVRDKKLDQWKEYDIADELLKNIGRNYNLFSILANV
FT                   RNGVGFANSDTGNAFIPIDNPRGVPNDASEKYIAYVENWGLDGHSHSFLDLAELKKYDW
FT                   RGQKNKHRGFMNQKDYAEYKRTGKITRYATNVSGESVKKIANEAMDVVISGKVIPDKEA
FT                   DYYTLVEWEESYYESAVNFVDKVLPALEKIANDCNCENEDVRLLFFFDD"
FT   CDS_pept        385231..385515
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83053"
FT                   /protein_id="CAR83053.1"
FT                   /translation="MREIKVDERTFQQHATKLASESTRSYLPLKNGNMAYSRANSIDQL
FT                   RSALIELVDVVEDFQHVTNQDASRLKKMGIAYAKQDQLMGQKINQLEVR"
FT   CDS_pept        385516..385884
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83054"
FT                   /protein_id="CAR83054.1"
FT                   /translation="MDSAHSQLEQQLQQIKKAKITAETDVDQTRRKQNEQDWLEEDSDQ
FT                   LTQEKLVLLDLLRSGWQGEEASGFHRYLEERQHEESQAWRRDLQDKRTDLDKELQENKN
FT                   KLHTLETKHATLQKEWSK"
FT   CDS_pept        385881..387410
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83055"
FT                   /protein_id="CAR83055.1"
FT                   /translation="MSRIDIAELNDFLHGLRSSNAEAKAMIRQIKEAAMDYSQDDRLKG
FT                   EAVTTSKRYFSSTYTSICQSIIEALDESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MTKVSQLQRKEEDLHRQLTAPNTKPDMQQVYAVKSRSVHTQLLKAIEQENILEKYLAFE
FT                   QSHGQFFSALAELIQATGCAVQELLHHVTFNDKTGTYSVPKSAANSLLLMKRALDNART
FT                   ENDKDPFPKAFEDYTVLAYTYVNDQGETVTMWLLEKDGKRVENKELQDFLEKHGQELDP
FT                   LLYTNLSGEELERKVNDSWKEGINYLNGQKVSGFSGATLRSSAYVASMKDWTDDAGLTD
FT                   MALSLGFGIAAARNKAIMTKKVNEPEAGEIAKRTSEIEKRIRENIEASKKTRKASGMKE
FT                   YLKREKEVLERIKKANSKKTVTSSLGNEIDVTPRDNHTIVDKNPGPFGNPDSSVDILDS
FT                   KGNLTTRRYYDRDGRAIRDVDMTDHGNAKKHPEYPHEHFWTYDSKGNPSRN"
FT   CDS_pept        387427..387654
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83056"
FT                   /protein_id="CAR83056.1"
FT                   /translation="MEYEQMADSLAYGEEYNFYYKNEEYWLSKNQEGHYLTKVSDGETQ
FT                   EFRTSEDLLGTARINGKLIIEIWEDIQSQF"
FT   CDS_pept        387823..388203
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83057"
FT                   /protein_id="CAR83057.1"
FT                   /translation="MKKLTTEQSFEYYLSSLCMLGMHTINLSDEEIEYEIFEELAIDYP
FT                   AALSPYTRELLVDNDIIDRELSLLSKQLQTKLFELDGGILWNVKALRTTPEWKEVLRLS
FT                   DEIKGLIHQQWTDEELDYLLGK"
FT   CDS_pept        388328..389155
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83058"
FT                   /protein_id="CAR83058.1"
FT                   /translation="MVKTGYFKVNGKYSFVEYYEEVLLEEIFKYMQQSRLALHRLKEIK
FT                   RIAELLSWHDNDKSQKYLRETKKLETRMKELEKFWGIEDEISEKSFDDGTTIEVLDVIE
FT                   EMVESIYKYLVLKQDAEKLTIEWLDELISSTMGILSSLQKKIGRTAEIGKHALKINEIQ
FT                   RTFKILQPAVSPKIFYHIKTNDAQMKKALSSLSKKKCQYLYFGLIDFSDVVDQMYNRLE
FT                   GYEKLIYTASDDLLKYESFDEEKKRNRIIFGLTIVATIATILQVWDFVLGILT"
FT   CDS_pept        389283..389651
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0357"
FT                   /product="inorganic pyrophosphatase family protein"
FT                   /note="Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83059"
FT                   /protein_id="CAR83059.1"
FT                   /translation="MTSKQSIQKTQLSKTKKHTLKVTIDRPIGYTDKFGNVYPLNYGFV
FT                   EGVIGGDGEEQDVYVLSRKISEPIDTFQGDLIAVITRNDDVEDKWVVAAPNENFTIEEI
FT                   REKVHFIEQYFDSEIKLI"
FT   CDS_pept        389694..389882
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83060"
FT                   /protein_id="CAR83060.1"
FT                   /translation="MEERFEKIYTQGKLNIMEIWVDKETGVQYVYHLSGYAGGMSPLLD
FT                   VDGKPLLADLSKLNGAE"
FT   CDS_pept        complement(390002..391999)
FT                   /transl_table=11
FT                   /gene="tkt-1"
FT                   /locus_tag="lmo4a_0359"
FT                   /EC_number="2.2.1.1"
FT                   /note="Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83061"
FT                   /protein_id="CAR83061.1"
FT                   /translation="MSRIDEQMVNSIRVLSMDMIEKANSGHPGLPMGAAPMAFSLWKNH
FT                   LKFNPEHPTWFNRDRFVLSAGHGSAMLYSLLHLFGYDLPMSELKNFRQTGSKTPGHPEF
FT                   GHTVGVDATTGPLGQGFAMGVGMAMAEAHLGAKFNQPEFPVVDHNTYVLCGDGCLMEGI
FT                   SYEAASLAGHLKLGKLVVLYDSNDISLDGDLNESFSEDIELRFRAAGWQTLRVDDGNDL
FT                   DALDAAIHLAKTEKSRPTLIEVKTVIGYGSPGKAGKSAAHGSPLGEKELKLAKEAYDWQ
FT                   MPPFELPKTVENQKEFYHSKGRASESSWLRTFNAYKQKYPALAESLQQLMDDNLDTDWD
FT                   AELPVFDENADKPVATREVSGIVLQELEKKLPNLFGGAADLASSNKTHLKASERFAPSN
FT                   YAAKNISFGVREFAMGAAVNGMTLHGGVQAFGATFFVFSDYLRSAIRSAALMGIPSTFI
FT                   MTHDSIAVGEDGPTHEPIEHLASFRAMPGLHVIRPADGNETVEAYRYAFTQKEQPTMLV
FT                   LSRQNLPILPNSAAKAKTGLAKGAYILADSPLDKLDIILLASGSEVHLMTAVRDNLAKK
FT                   GFGARVVSMPSFDLFDKQSPEYKESILPKAVKKRFAAEMGASYGWHKYLGDTGEILAID
FT                   SFGMSGPGDELAERFGFTVENLTELALKQL"
FT   CDS_pept        complement(392001..392657)
FT                   /transl_table=11
FT                   /gene="talC-1"
FT                   /locus_tag="lmo4a_0360"
FT                   /EC_number="2.2.1.2"
FT                   /note="Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83062"
FT                   /protein_id="CAR83062.1"
FT                   /translation="MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKE
FT                   ICSIVDGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKT
FT                   NVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISA
FT                   SIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN"
FT   CDS_pept        complement(392704..393468)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0361"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.1.1.-"
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83063"
FT                   /protein_id="CAR83063.1"
FT                   /translation="MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD
FT                   IKEDVKDVAAKINPSRTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKA
FT                   EDLPEEYWDKTMELNLKGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCAS
FT                   KAAIVSMTQVLAMEWAPYNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYP
FT                   EEVAACALFLVSDAASLITGENLIIDGGYTIK"
FT   CDS_pept        complement(393493..393939)
FT                   /transl_table=11
FT                   /gene="rpiB-1"
FT                   /locus_tag="lmo4a_0362"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="Ribose 5-phosphate isomerase RpiB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83064"
FT                   /protein_id="CAR83064.1"
FT                   /translation="MKIAIGCDEMGYELKQTLIARLKEKNIEFTDFGSFEDEKVLYPSI
FT                   AEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIM
FT                   TMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQKNR"
FT   CDS_pept        complement(393946..394710)
FT                   /transl_table=11
FT                   /gene="tpiA-1"
FT                   /locus_tag="lmo4a_0363"
FT                   /EC_number="5.3.1.1"
FT                   /note="Triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83065"
FT                   /protein_id="CAR83065.1"
FT                   /translation="MRKPLVGINMKNYINTRAQTSEWLEATIPLLENFSDVDTFIFPSM
FT                   GTLETTANLLAGTSFGFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFH
FT                   EKTSEIAKKIKLALDEEITPVVCVGESLRANDTNELKSALHKQIEALFNTIQVAQFKNV
FT                   VLAYEPEWAIGKANSADTSYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIV
FT                   RQKNVDGLFVGRFGHKPQNFADIVSIVSKTKG"
FT   CDS_pept        complement(394714..395364)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0364"
FT                   /EC_number="2.7.1.29"
FT                   /note="Dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83066"
FT                   /protein_id="CAR83066.1"
FT                   /translation="MSELVMDSAFFGHVLQDMGALIEKERDYLTGLDSDIGDGDHGINL
FT                   SIGFREVNKQLDELLTASPDIATLLKKSGMILLGKVGGASGPLYGSFFMKCGADVPGKT
FT                   EVNFDELCGMIINGAAAVQHRGKAELGDKTMMDAFLPGVEVLQNRDANADPIETFSAFV
FT                   DAMHAGAQSTIPLIAKKGRALRLGERAIGHLDPGSESSWMLMNVILENLKKAV"
FT   CDS_pept        complement(395386..396381)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0365"
FT                   /EC_number="2.7.1.29"
FT                   /note="Dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83067"
FT                   /protein_id="CAR83067.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAENVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPG
FT                   IKRTSIEPADKVVDQIMGYLIEEMKLTADEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHNPLVGNYATSMDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD"
FT   CDS_pept        complement(396403..396744)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83068"
FT                   /protein_id="CAR83068.1"
FT                   /translation="MSIGIALATIAGGFLFPFAIRMMWGKMVDEWGAIGGWMAAAFIVG
FT                   TVWTINHGIPKSMIYQSGTVWVDMAVAAGIGVFTASLLTGGKFSKSIVNLAAAVVGGVL
FT                   GGFLLSLFL"
FT   CDS_pept        complement(396760..397191)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83069"
FT                   /protein_id="CAR83069.1"
FT                   /translation="MKFFRGMIGFCIAGMIVMSVWTPLAENYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGGELVSSLPTIGLVAIGAVLAG
FT                   IVAAAIEKDMAKKQEAKQEKTEPGMNMKEEERLNENQLV"
FT   CDS_pept        complement(397276..397653)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0368"
FT                   /product="PTS-dependent dihydroxyacetone kinase,
FT                   phosphotransferase subunit"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83070"
FT                   /protein_id="CAR83070.1"
FT                   /translation="MISIVLVSHSQKITEGLQEMIVEMVGDTVHIISSGGTGDGRLGTN
FT                   AIMIADNIATCTNSEHIYIFCDIGSAILSAETALELLDTDLLEKTTIIDAPLVEGAFTA
FT                   AVQSLVNPSKEAILQELTNVH"
FT   CDS_pept        397836..398600
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0369"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83071"
FT                   /protein_id="CAR83071.1"
FT                   /translation="MFPFERQNKIIHLLDQNNKITVPELSRILDVSISTIRNDLSALEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFSRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGANLIEN
FT                   IHADLCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLIALLDHTKMGVISTASITS
FT                   AENIDLLITDNKINKALYKKFQDAGLPVKIAE"
FT   CDS_pept        398666..399076
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0370"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83072"
FT                   /protein_id="CAR83072.1"
FT                   /translation="MDYIITTDLPNAEEFVKLRVDAGLSFRSIEVSRQALLKSVYFVGL
FT                   RSTGNGALIGMGRLVGDGIMFIVSDIAVLPEFQGNGYGKLIMTHIKKYIDSNLDKTACV
FT                   TLLADVPADDLYKQFGFRESAPASIGMIYQMK"
FT   CDS_pept        399173..400942
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0371"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83073"
FT                   /protein_id="CAR83073.1"
FT                   /translation="MKSKGRLFLYVVLALSIVIGTNVFIKIDAHAAAAPPAAISQIFPD
FT                   NALATEIQTTLGKSSTAEVVTQTDLDTINSLTLTSKGISSLEGMNYLTNLGTLILSGNQ
FT                   VSDISPLKGLTNLTMLQLSGNPISDISALSNLKNLQALDINDAQITDITPLSGLTNLKG
FT                   LGLYDNQLENLSGVNNLHQLRSLNVSKNKLTNLDELQALSNLGVLYANENQIDNLQGIS
FT                   ALNNLFLLDLSANQIVDTTPLAGLTNVQTLYVSNNQISDVTGLSSLINLDWLDISQNKI
FT                   SNIRPLNSLTKLTIIQMTNQLIVNEPISFESTITIPNLIKNIAEQTIDPDTISDNGVYA
FT                   NESVTWNLPTYIPKVSYTFIERDTVGNATGNFSGTVEQPLVQYFKATFNIDGQETTENV
FT                   ETGTLLQEPPTPVKEGYTFNGWYDAETGGTKWDFTADTMPANDITLYAQFSINSYTATF
FT                   DVDGVISTQTVDYQGLLEEPPAPTKEGYTFKGWYDAKSGGTKWDFTNNQMPAKDITLYA
FT                   QFSKDAASGGDDGGTDEGGGNSENSTEGAPNTSDIDTINHIVLPATGDDHVLFPIFIGT
FT                   FLTSLALLTLRRK"
FT   CDS_pept        complement(400983..402509)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0372"
FT                   /product="long-chain acyl-CoA synthetase, putative"
FT                   /EC_number="6.2.1.-"
FT                   /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83074"
FT                   /protein_id="CAR83074.1"
FT                   /translation="MTIKKYEPLNLYTNFKKSAERYPEMPIHFDEELVTFPELGLHTTY
FT                   KKCEEAIIQKAAHLHKFGVRKEEKVIVYKSAKFDSYILAVAISYIGAVPIMVSPHLPAS
FT                   TIDIFVNRLDQPWLLFDSETSEKSHQLNNLPDSRLINAEQLFKAPLDGYTCEQEELPKD
FT                   MIAYMTHTSGTTGVPKLIAHSANSMGWRTKYQRRILNFIKPRGLVAFHISPVHSRFNIG
FT                   VSSLMSLGFPLLPIANPSKANVEKVLREYKPYVLETHPNHFVQWASLAREKPDVFQSIK
FT                   FYHSTFDAINKETMAVFLRTSEYKKPIFLQIYGQSECGPMILRGHTLQSIETLNARDMG
FT                   IGVPGLTEVRIVDQDGNPVPAGVSGNIQMLSKGRALTYYKEEARFEENVYGPWWDSGDY
FT                   GMKDEQGRLFLQDRQVDLVETIDSTLAIEDKLLDTLTFLDEVVIIRGENGSPQPIIAVH
FT                   NDGEMNWDAWWKAVSDLPHMNEPMVMKYDEIPRTATMKVQRLQMERELKK"
FT   CDS_pept        402746..404266
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="lmo4a_0373"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83075"
FT                   /protein_id="CAR83075.1"
FT                   /translation="MKKRLATTFIMLLSLALIIAGCGSNNTSKSDTEKTKEKEKTEVTS
FT                   GASKTSYTDPSELKDKYDIVIVGAGGAGMSAALEAKAKGMNPVILEKMPLAGGNTMKAS
FT                   SGMNASETKFQKEQGINDSNDKFYEETLKGGHGTNDKAMLRFFVDNSASAIDWLDSMDI
FT                   KLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEQKIPVFVNADVKEITQKDGK
FT                   VTGVKVKLNNKDEKTISSNAVVVTTGGYGANKDMIEKERPDLKGYVTTNQEGSTGDGIK
FT                   MIEKLGGTTVDMDQIQVHPTVQQDKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVT
FT                   ASINKLPEKSAYLIFDAGVKDRVKAIAQYEEMGFVEEGKTIDELAGKINVPKEELTKTL
FT                   DTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDG
FT                   KPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKAQ"
FT   CDS_pept        404470..405486
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0374"
FT                   /product="oxidoreductase family protein"
FT                   /note="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83076"
FT                   /protein_id="CAR83076.1"
FT                   /translation="MLKMGFIGNGKSTNRYHLPFILERDNIEVKTIYNRNPKTATWDKI
FT                   EGVHYTTDLDELLKDPEIQLITISTTQSSHFDYAKMVLENGKNVLVEKPFMMTYAEAKE
FT                   IFELAKERGLLVQCYQNRRFDSDFLTAQKVIESGKLGELLEVEMHYDYFRPEIPESVHE
FT                   FKFYDSYLYGHGCHTIDQVLSYFGKPDNIHYDVRQLLGEGRMNDYFDLDLYYGVTKVSV
FT                   KSSYFRIKARPSFVLYGKKGMFTKETKDRQEEHLKLFYMPSNPDFGIDLPEHYGTLTYV
FT                   DDAGVWHEEKVISEVGDYGRVYDGLYDAIVNGKPKQVTDEETLLQMEILEKGVEACK"
FT   CDS_pept        405686..406132
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0375"
FT                   /product="PTS fructose-specific enzyme IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system mannitol/fructose-specific
FT                   IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83077"
FT                   /protein_id="CAR83077.1"
FT                   /translation="MNISNLINEDRIIFDNRIQTKQLLFEKVAEVLGEEGSITNPKKFI
FT                   RDLYKREEETSTGIEDGFGIPHAKSKYVKEPLIVFVHSGIIYDYFGLDNSSIECSFLIG
FT                   VPKKATDVHLQILSELSRKLMNKEFREKLKNSKNKTEIITILSN"
FT   CDS_pept        406146..407540
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0376"
FT                   /product="PTS system fructose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system, fructose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83078"
FT                   /protein_id="CAR83078.1"
FT                   /translation="MKIVGVTACPTGIAHTYMSAEKLTITAEALGYEVKIETQGAKVEN
FT                   VLTKEDIATADYVILAVDKEIDTSRFAGKKIKKVSTSRAIKEADVVIDETVSGKGLISL
FT                   EAKSSDVSSEQPSKASLYNHFMNGVNYMLPFVIAGGILIAISFAFGIDASNPDSDSYNA
FT                   LAAAFSKIGGDTAFGLMVPALAAGIAVSVAGRAGFAPGLVAGTLATVGGSGFLGGMIGG
FT                   ILAGYVAHFFANKVNVTKSLASIYQLIVVPLLGITIVGLAMVFIIDTPIAWVLNALTGW
FT                   LNGLGETSGVVFGLLIGVMMAADMGGPINKSISTFSIGLMSAGVTAPIAACMAAGMVPP
FT                   LGLALATLLFKNKFTKEEKTAGNSCWVLGASYITEGAIPFAVADPLRVIPSLMLGSATA
FT                   AAISMGAGVTSMAPHGGIWVMFIPNVINHLFIYLLAIAAGTVVTAISVGLLKTPLNKRK
FT                   NKEEMI"
FT   CDS_pept        407540..408400
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0377"
FT                   /product="fructose-bisphosphate aldolase, class II family"
FT                   /EC_number="4.1.2.13"
FT                   /note="Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83079"
FT                   /protein_id="CAR83079.1"
FT                   /translation="MLYTMKDLLAVGKAHQFAVPAFNICSFDMLKAIMEEVEANNAPVI
FT                   LEIHPDEIEYLGDNFVATVREYAHRSKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDAS
FT                   RASYEENVALTKQVVELAHKVGVSVEAELGTIGNNGSAEGGADTIIYTDPDQAEDFVQR
FT                   TGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVSESVQ
FT                   YGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKEVVRHKLHILNTTG
FT                   QADKY"
FT   CDS_pept        408457..409227
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0378"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83080"
FT                   /protein_id="CAR83080.1"
FT                   /translation="MLSTAKERQLKIVNRLKVEQFMRIIDLVELVNYSEATVKRDLVEL
FT                   EKEGLVRRTRGGAMIIDNKKIDLPYLMKMNERSNETSKIRIADIAKSLIRDDMVIFLDS
FT                   SSTSLHLIDVLSKFDGLQIITNGVMTASMLSEFTNARVSILGGSILTKRYTVNGAKAYN
FT                   DALTYNADIAFVSCRGIDYDKGATETHEGEALIKQAFRRQSSSLVLLVTEEKVGHKFMH
FT                   QSLACHDIDYLITDFKLDPDVEEQFKTHQITCLY"
FT   CDS_pept        complement(409545..410165)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0379"
FT                   /product="peptidase, S51 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="Predicted glutamine amidotransferase involved in
FT                   pyridoxine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83081"
FT                   /protein_id="CAR83081.1"
FT                   /translation="MMKNLFLTSSFKDVVPLFTEFESNLQGKTVTFIPTASKVEEVVFY
FT                   VEAGKKALEDLGLIVEELDVATETLDEITATLKKNDFIYVTGGNTFFLLQELKRSGADK
FT                   LILEEIAKGKLYIGESAGAVITSPNISYIQSMDSVKKAINLTNYDALNLVDFYTLPHYN
FT                   NTPFKKITQQIIVDYADDLKIFPISNCEAIFVQGNVVTSKGIL"
FT   CDS_pept        410224..411210
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83082"
FT                   /protein_id="CAR83082.1"
FT                   /translation="MIPFNLDKRKEMAMRKAERLNDMMLFLNDKNAFQLSDIMAKYGVS
FT                   RSTAIRDIQSLEEIGMPIYSERGRNGHYRVLRNRLLSPIVFNVDEVFALYFSMLTLKAY
FT                   ETTPFHLSVEKLKTKFERCLSAEKIKMLRKTEEVFSLGYIKHNNQCEFLDVILQFTMEE
FT                   KVCQINYDKNGTEKTYIVQFYNISSAYGQWYVTSYNFETKRMQVFRCDKILALKENDTF
FT                   EAKKMEELKRVADSFNKKADVTTFEVEIASNGVDLFFKENYPSMKLRQQQGENVIHGFY
FT                   HKGEERFIINYLLGYGEKIIAIQPDSLRDMLLNELDTIKKHVQNLSS"
FT   CDS_pept        411260..411769
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0381"
FT                   /product="MutT/nudix family protein"
FT                   /note="NTP pyrophosphohydrolases including oxidative damage
FT                   repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83083"
FT                   /protein_id="CAR83083.1"
FT                   /translation="MEEWDLLNADRELTGKTHIRGEKLAPGELHLVVHVCIFNEKGQLL
FT                   IQKRQKDKEGWPNYWDLSAAGSALKGETSRQAAEREVQEELGIAIDLSNTRAKFSYHFE
FT                   AGFDDYWFITKDVELSDLTLQKEEVADARFVTKEALEVLRSSGEFIPYFFLNQLFDLKN
FT                   ATSIHF"
FT   CDS_pept        411865..412584
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83084"
FT                   /protein_id="CAR83084.1"
FT                   /translation="MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQ
FT                   KLRFVIERAKTYNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVN
FT                   RTASDVRAAYSKNGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDILD
FT                   EDGQAIIYAEPEDFHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFEKLIDAL
FT                   EDLEDVQKVYHNVELED"
FT   CDS_pept        412621..412956
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="lmo4a_0383"
FT                   /product="alkylphosphonate utilization operon protein"
FT                   /note="Uncharacterized Zn-ribbon-containing protein
FT                   involved in phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83085"
FT                   /protein_id="CAR83085.1"
FT                   /translation="MSKLPNCPECNSEYAYEDRGLLICPECGHEWSAVAEEATEEKVFK
FT                   DSNGNVLTDGDSVTVIKDLKVKGASNPIKMGTKVKNIRLVDGDHDIDCKIDGFGPMKLK
FT                   SEFVKKI"
FT   CDS_pept        complement(412996..413709)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0384"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83086"
FT                   /protein_id="CAR83086.1"
FT                   /translation="MSGMAKYMEIYIDIRDKINQNKYEINEKLPDGDSLARVYDCSKLT
FT                   VKKALDMLVQEGMVIRRRGAGTFVKSHSTNGGEFALGPMSGLVNTFGKDNIKSKVILFS
FT                   IEKPSKEVAEKLEMKDDYIYRIIRMREVGHKAYSIEHTYMPLAIIPGLEPRHLEDSIYN
FT                   YIRDDLKLKMQSAHVWVRGDKSNQEDSKLLDLEEPTFMMEIEKLAHLEDGRVFEYSITR
FT                   HTYESFVFETVFVQN"
FT   CDS_pept        413866..415308
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0385"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83087"
FT                   /protein_id="CAR83087.1"
FT                   /translation="MKELLTFPKDFWWGSAWSAEQAEGRGDTGKAKTVWEHWFETEPNR
FT                   FYEGVGSEITTDHFNRYKEDVQWMKKTGQNSFRISISWARMFPNDGVGEVNPKAIAFYR
FT                   DLLTEMNENGIKPFANLYHFDMPVALQDAGGWESREVVDAYVHFADTCFKEFGDLVYHW
FT                   FTFNEPLGPILGGYLEDFHYPNQIDFKRGAQAGFNTILAHALAIKAFKKLNLSSKIGVI
FT                   LNLSPTYPRSQNEYDLEAAEICDAFYTRSFLDPMVKGTFPEKLVEIMREYDQMPEYTEE
FT                   DLTIIKENTAQILGLNYYEPRRVKARLTAINEKSPFLPDWFFEPHNMPGKRMNIYRGWE
FT                   IYERGIYDLCIDIRDNYGNIESFISENGMGVANEERFLNEEGQIQDDYRIQFVKDHLAY
FT                   VHQAIAEGCDIKGYHLWTFIDCWSWINAYKNRYGLVSLDVETGKRTMKKSGEFYKKMSD
FT                   MNGFEYETSKLVGTKREETTNG"
FT   CDS_pept        415301..416635
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0386"
FT                   /product="PTS system, beta-glucoside-specific, IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83088"
FT                   /protein_id="CAR83088.1"
FT                   /translation="MAETKKKSIVNGFINVAQRLGGQIHLRSLRDAFASIMPFMILAGF
FT                   VTLINYVILEPTGFMGKIVNPDTLKTWQEIGISIGNGTLSVITLLVTVAISYHLCLNRG
FT                   YKNVIAPILVALSSFIVVTPIAMTFLPEGASKSIEVPNVIPVSYTGASGMFVGIIVGLI
FT                   ATDLFIKLSKNKRMQINLTGNIPPAVIKSFNVLIPIMITVIIFSVMSFAVNQIFNMDFN
FT                   TLVTTIITKPLSYVTTSLPGFLLITSIANLFFGLGIHQAVISGPLLDPFLLQNMQENMV
FT                   AYANHQEIPHIINMAFKDTFAVMGGSGNTIGLLIAIFIFGKRKDYKDISKLSAAPSLFN
FT                   ISEPIIFGLPIVFNPLLIIPFVLAPIFSLTTAYFATAAGWINHVVVQTPWTTPPIISGF
FT                   LATGGDWRASVLQVIIIVVTVFIYLPFLRMDEKVAFATAQKTEAK"
FT   CDS_pept        416653..416955
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0387"
FT                   /product="PTS system, beta-glucoside-specific, IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83089"
FT                   /protein_id="CAR83089.1"
FT                   /translation="MKNILLVCNAGMSTSFLVEKMKAAGAEQGVEANIWAVSDAELHEN
FT                   WEKADVILLGPQVGYLKGNTEKVVGGKIPVEVINMLDYGRVNGAAVLERAIELIG"
FT   CDS_pept        417042..417236
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83090"
FT                   /protein_id="CAR83090.1"
FT                   /translation="MKYVKSQMKELVKDSVDLQERLQKLMKEMDLEKTFALKALYHSEV
FT                   ADGGPYQTAYQDLDYKYKD"
FT   CDS_pept        complement(417275..418231)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0389"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83091"
FT                   /protein_id="CAR83091.1"
FT                   /translation="MSVIIPKTKEKKMKIERLIGIIMLLLQRELVSASEMATMFEVSKR
FT                   TIFRDIDTLAMANIPIYTIAGTKGGIGIMPTYKVDKKLLTVDDLTAIIASLDGMEQLLS
FT                   SAETKKTLQKMKNMLDHSSEPPKSSISLDFSNLSMKNELNAKVESLYLAIKKHQLVELS
FT                   YIDRTGNQTIRKTEPYHLLFRNRSWYLQGYSLERSDFRTFKMSRIVELKTLEETFEARP
FT                   FSVKPFGAPPDRPMFLMHEVSLIVDKIAREQIIERFDLVEISQQDDAHFLAKVTLPDHE
FT                   AGYRFLLQLGTHVTIQNRDDFYDNFVDYLKEIQGKYI"
FT   CDS_pept        418298..418717
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83092"
FT                   /protein_id="CAR83092.1"
FT                   /translation="MAFEIVELKKETFTGNKVEIPEFDPQKGFGPMSEIKESAYTKFAK
FT                   NEKDYVGINASLDGLQYYIVASAKGENGDTTFDIPEGKYAKFVTSETDRPALDGFIGAA
FT                   YGEVSQSDTVGIAGSFNLEDLREAEFTLYIPVVSK"
FT   CDS_pept        418911..419195
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83093"
FT                   /protein_id="CAR83093.1"
FT                   /translation="MREIKVNEATFQKHASKLDSKSAGSYLPLKGGNMAYSRANSINQL
FT                   RSALIDLVDVVEDFQAVTKQDAGRLKKMGMAYAKQDQAMGQKINQLEVR"
FT   CDS_pept        419196..419564
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83094"
FT                   /protein_id="CAR83094.1"
FT                   /translation="MDSTHSRLELQLQQVKKAQDVLQDNLGQTKRKQVEQEWLEEDSHQ
FT                   LEMEKQGLLDFLRGGWQGEEANGFHRYLEEQQHEEAMAWRKDLSEKRVHLEEEARTTRA
FT                   EMHDIETKQASLRKEWNQ"
FT   CDS_pept        419561..421069
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83095"
FT                   /protein_id="CAR83095.1"
FT                   /translation="MSRIDIAELNDFLQGLRSSNAEAKKMIRGIQQAASKYAQDKSLKG
FT                   QAVSASQSYFASSYPSIAQSVLEALEESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVASLKRKEEDLHRQLTAPNTKPDMQQVYVVQARSAHTQLLQAIEKEDILERYIAFE
FT                   QSHAQFFSALTELIHSTGRAVQELKQNVTFHEKTGTYAVPKSVHASISLMRKAMDKARK
FT                   ENAKDPFPEAFEDYQLFAYTYVNDKGETVTMWLLERNGKRASNKELQAFLEENGAELDP
FT                   ILYTNLSGEELERKVNDAWKDGVNYLNGQKVTGLSGATLRSSAYVASVKDAMDDAGLTE
FT                   MALGLGFGIAAARNKAVIPKKQDDLKVSNFNRDQILKNIEASKKAREASNFSEYLKREK
FT                   ELLKQIKKANGAKVNELKPNEINNMSLNDLRNSIPEGWKFFENNGRVHIKDTSGQMRIR
FT                   IDPPDKITKYQHMHIYDDLGNPLDKLGNIVDRTSLDGHLPWNDK"
FT   CDS_pept        421088..421474
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83096"
FT                   /protein_id="CAR83096.1"
FT                   /translation="MINELQKKIDEINYWDLLVLDIQSKYFGDEVYIYIEKDEEICWKL
FT                   SFTSCYKVSYETDAKWRGDFKVRNTGPKSGYYAQDISLNRYAENEDFIECSFDASIMTM
FT                   NIICKEIIVEEVSVIENSFFWKNY"
FT   CDS_pept        complement(421547..422308)
FT                   /transl_table=11
FT                   /gene="iolR"
FT                   /locus_tag="lmo4a_0395"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83097"
FT                   /protein_id="CAR83097.1"
FT                   /translation="MKVQRIQAIENLIHEKGSISLDDLCEQFNVSKNTVRRDIAKLLQK
FT                   NTIQKVYGGVVSVYNNPEEIRPFENRDTENHTEKQLIGKAAADFIEENDLIFIDSGTTT
FT                   SCLAAALPTDKEITIITNSLDVINFASEMDNVKLIVIGSTFKTSTKSFIGVENWGFFEK
FT                   YNITKAFMAATALSTTHGVMNSDILEYEIKRHMMEKATEKFLLVDHTKVDKSALLTYGE
FT                   LAEFDWLVTSKDMAGGYLGYCEDVGVLVRLV"
FT   CDS_pept        422503..423969
FT                   /transl_table=11
FT                   /gene="iolA"
FT                   /locus_tag="lmo4a_0396"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83098"
FT                   /protein_id="CAR83098.1"
FT                   /translation="MADVRKLKNYIDGEWVESKTDKYEDVINPATGEVLCQVPISTRAE
FT                   LDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEELARLITLENGKNLSEARGE
FT                   VQRGIENVEFAAGAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMF
FT                   PMAIALGNSFILKPSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIK
FT                   AVSFVGSKPVGEYVYKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAG
FT                   ERCMACAVVTVEEDIADEFLEALRTAAKNVKIGNGLDDGVFLGPVIREENQKRTIAYIE
FT                   KGVEEGAKLTVDGRETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEA
FT                   VRVANLSEFANGACIFTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYG
FT                   TLHANGKDSVDFYTHKKVVTARYSLKGYEE"
FT   CDS_pept        423982..424803
FT                   /transl_table=11
FT                   /gene="iolB"
FT                   /locus_tag="lmo4a_0397"
FT                   /product="myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83099"
FT                   /protein_id="CAR83099.1"
FT                   /translation="MGKLLRKPLNERIAPGVTLVQDINQANSPLSYVGFRLIEMEKGAI
FT                   YQEELTELECCIVALTGKITVSEGNDIFPEIGTRANVFEKIPTDSVFISGGRAFQVKAD
FT                   TEKARVALCYSPANQDLPTTLIKASDNSIEQRGKYQNKRLVHNILPDVSEVASSLLVVE
FT                   VYTNGGNFSSYPPHKHDRDNLPAESLLEESYYHEINPEQGFIFQRVYTDERTLDETMAV
FT                   EHQNAVIVPEGYHPVGVPDGYDSYYLNVMAGPNRVWKFHNDPDHEWILERD"
FT   CDS_pept        424820..425797
FT                   /transl_table=11
FT                   /gene="iolC"
FT                   /locus_tag="lmo4a_0398"
FT                   /product="myo-inositol catabolism protein"
FT                   /note="Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83100"
FT                   /protein_id="CAR83100.1"
FT                   /translation="MNLNKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGS
FT                   PANIAIGTAKLGLKVGFIGKISADQHGRFIEKYMRDLSINTDGMVKDTEGRKVGLAFTE
FT                   IKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLISGTALAQSPSREAVLKAVSL
FT                   ARKNDVAIAFELDYRPYTWTNTEETAVYYSLVAEQADVIIGTRDEFDMMENQVGGKNEA
FT                   TKAHLFQHQAEIVVIKHGVEGSFAYTKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGL
FT                   FSGESIETALKYGSAAASIVVSKHSSSDAMPTADEIKALIAQAE"
FT   CDS_pept        425807..427726
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="lmo4a_0399"
FT                   /product="myo-inositol catabolism protein"
FT                   /note="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83101"
FT                   /protein_id="CAR83101.1"
FT                   /translation="MVTEKTIRLTTAQALVKFLNQQYIEVDGEMAPFVDGIFTLFGHGN
FT                   VVGIGQALEETPGHLKVYQGKNEQGMAHAAIAYAKQKNRQRIYACSASAGPGSANLITA
FT                   AGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSTAITTNDGFQAVSRYFDRVQRPE
FT                   QLMSALIRAFEVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKREL
FT                   TEAARLIQASKTPVIIVGGGARYSRAREELIALSEQTNIPLVETHAGKSTVESDFKNNL
FT                   GGTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFDPTTKFININVSRMQTYKLD
FT                   AFQVVGDAKATLAELAPLLKGYQTQFGNKIAAYKTEWLEERARLQNTKFSREAFTPEIK
FT                   DQFDQATLNEYADRLQTEFTQTEALITINDNVSPDSIVVCSAGSLPGDLQRLWNPAVPD
FT                   TYHLEYGYSCMGYEINGALGAKMAAAKNQEVYAIVGDGSFCMSHSELLTSLQYGKKINI
FT                   MLFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRANTKEDL
FT                   ISALEDAKTQTKTTLIEMKVLPKTMSEGYLNWWNVGVSEVSNKESIKQAYEEKQANLKN
FT                   ARLY"
FT   CDS_pept        427858..428229
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83102"
FT                   /protein_id="CAR83102.1"
FT                   /translation="MEVFAEYLAEIENPDHRARTQEVLTWVAETFPDLKPEIKWNTPMF
FT                   TNNGTFIIGFSIAKQHMSVSPEVAGIERFEADIQEAGYSHTKGIFRITWAKPVDYDLLA
FT                   KIIKFNIQDKANYTSFWRV"
FT   CDS_pept        428323..428691
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83103"
FT                   /protein_id="CAR83103.1"
FT                   /translation="MRIFCGIMSIQAGFIGALAEILSPDSKKNNLFMIPEDLAASSGYL
FT                   MSLAMILAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPVVCLISFLM
FT                   GLFIFTDYTRHQDTGEER"
FT   CDS_pept        complement(428715..429830)
FT                   /transl_table=11
FT                   /gene="ltrA"
FT                   /locus_tag="lmo4a_0402"
FT                   /product="low temperature requirement A"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83104"
FT                   /protein_id="CAR83104.1"
FT                   /translation="MAERKVSWLELFFDLIFVTAVASTTHLLLSVDNHPDKTAVYFGEY
FT                   LLMVTPMFWSWVGQTMFFNRFGEKIKSPELYMLPQMFFLILMTASFDLTFSNTYYTFLI
FT                   GYLGIRFITVIQYFVISRQLTGNARKVALLLGSVFLLGVLTTATSVFFEGFARYLVMYL
FT                   GIAVDIILPLFLAKTLRKVPVDFPHLAERFGLFVIITFGESIVAITTILVGHTLDPYTI
FT                   GYTLLGFLIICTLWASYFHSFEKIVDHHKETHGQYLIYGHFFIIISVMLLAANVHLLFE
FT                   GHLERNVLLLMLFGSVAVFFVSKQFVFAAHKKAEVTFSFWKDALLLLLLVGLFFVNLYS
FT                   DLPLFVSFVSIWVCALVDLSLQFRVSRPARV"
FT   CDS_pept        429916..430623
FT                   /transl_table=11
FT                   /gene="ung-1"
FT                   /locus_tag="lmo4a_0403"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="Uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83105"
FT                   /protein_id="CAR83105.1"
FT                   /translation="MEGQNHGTTEMGELKMVKTWEEFLKQEAKQPYFIELMEAVKDARA
FT                   KGNVYPTEEDMFSCFRLCPYDQVKVVILGQDPYHGPGQAHGLSFSVQKGVRIPPSLRNI
FT                   YKELKTDLDIEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEEL
FT                   NNYDKPLVFILWGNHAIKAASGITNPQHLLIKGVHPSPLAASRGFFGSEPFSKTNAFLE
FT                   KNGRTPINWDLNK"
FT   CDS_pept        430793..431092
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83106"
FT                   /protein_id="CAR83106.1"
FT                   /translation="MKHNFTEDDFVYGESWGLVHRGVLEDKEIERMKALRDKVVGKKGV
FT                   AQTTLKPIGSVRIDGEVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK"
FT   CDS_pept        431089..432033
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83107"
FT                   /protein_id="CAR83107.1"
FT                   /translation="MTMIGPIIIAVLIIIFLIVFFTLVPVGLWISALSARVPVGLGTLI
FT                   GMRLRRVVPSRVVKPLIKAVKAGLDLEVNQLESHYLAGGDVDNTVDALIAAHRANIELD
FT                   FSRAAAIDLAGRDVLEAVQTSVTPKVIRTPEFTGVAQNGVEVKVITQITVQSNIERIVG
FT                   GAGEDTVIARVGEAVVSTVGETREHTDVLENPNSISKKVQEQGLGDGTAYTILSIDIAE
FT                   MRIGDNIKAKLDIEKANADMEVAQAAASKRKAEAIALEQENRAAVVAAEAEVPRALSRA
FT                   LEEGNLGVMDYYKMENVQSDTAMRESIAHEDEK"
FT   CDS_pept        432068..432517
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83108"
FT                   /protein_id="CAR83108.1"
FT                   /translation="MDLSDFLNSGWEGVLVVLGIVGVLINFLSKAGKTDEAEAQKAQKQ
FT                   RPKIRTTHQVSRTQTTKKPAKRKVSQGTFAQSKTQDKVIAEQKATQEKMLREIRRESDV
FT                   AKGKKIIKSTSNHSKKARKLRGRLQEAIITKEILDKPVSLRKNHL"
FT   CDS_pept        432661..433344
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0407"
FT                   /product="NLP/P60 domain protein"
FT                   /note="Cell wall-associated hydrolases (invasion-associated
FT                   proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83109"
FT                   /protein_id="CAR83109.1"
FT                   /translation="MKIIATRRKIFFAFIALMISFSVLFLPTTNASAATTYKMTTTADV
FT                   NVRTADNTKGKVIGFYKKGTTVTFTAKTNNNWYKTTYNGKVGYVSGKCLTTYKAPVATT
FT                   QSFAALNNEARKHLGKRYKIGATGPSCFDCSGYTQYVYSKGVKKAIPRTAKQQYASAKK
FT                   IKASELKNGDLIFFNYGKGIAHVGIYVGNGKMLNAQNNGVKYDSITSGYWKKYIAGYGR
FT                   VANLK"
FT   CDS_pept        433401..433826
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0408"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83110"
FT                   /protein_id="CAR83110.1"
FT                   /translation="MEYKIKEISLEELEPRVIEGLLEHKERLGYDIPKSDAVHIGFAAL
FT                   NESGEIVGGVTAKISYGELHVSLLSVDQNTQGSGVGSELMAQIERYGRANNCHHISLTT
FT                   FSYQAPEFYKKCGFTELGRVKDFPIKGEEKFFFIKYL"
FT   CDS_pept        complement(433829..434629)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="lmo4a_0409"
FT                   /EC_number="1.5.1.2"
FT                   /note="Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83111"
FT                   /protein_id="CAR83111.1"
FT                   /translation="MKKIGFIGAGNMGTAMIRGLAQANLDNKEAIIVSGRNLEKLKPLE
FT                   AEFPGLQITTDTGKLAEQADIIILAVKPYTIPEILTTLKEKLTPDKIIISVAAGVTIQD
FT                   LEELTSAKTKIVRVMPNTPALVGEAMSSISPNANVTSEEIKEVTAIFTSFGEAEVVAEN
FT                   LMDAVIGVSGSSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLENDGFRSAVINAVQAAAKKNSSM"
FT   CDS_pept        434757..435239
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83112"
FT                   /protein_id="CAR83112.1"
FT                   /translation="MNEAIERRDDGVTVVSFEVEISAPIQEVFVLLTTNDGLAKWFDEL
FT                   EVGELGADGYLLFIMTPEEKITMPIRAFEPNRKIAFQWDQDEVAFELNEIAAEKTKLTF
FT                   TEQLTTITEHSPRDISGWHICLKKLQASAEGKTYDFDKAAFETLFAKYQKALNSEK"
FT   CDS_pept        435409..435867
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0411"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system mannitol/fructose-specific
FT                   IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83113"
FT                   /protein_id="CAR83113.1"
FT                   /translation="MIVSEEQLFLNQHLSTKEEVLAFIADKAAEIGITTNSAQVERDLW
FT                   AREKEYATAVQQLIAIPHAKTEAISEAKLLFIRLVEPIDWESKEGFKAQAIFAILVPAS
FT                   EASQQHLKILSSVAVNLLEEAFQEQILTIKTEHELMDYLKDNLEGELI"
FT   CDS_pept        435864..436196
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0412"
FT                   /product="PTS system, fructose-specific IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system fructose-specific
FT                   component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83114"
FT                   /protein_id="CAR83114.1"
FT                   /translation="MKVVGVTSCIAGLAHTPMAAKALEKAGVKLGHDVKIEQQGAMGTI
FT                   DEITPAEVSAADVVIIAADKVIDGEDRFKGKPVVRVKIGQCVANGEAVLSKVVAAIEAR
FT                   KQKEAN"
FT   CDS_pept        436200..437312
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0413"
FT                   /product="PTS system, fructose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system, fructose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83115"
FT                   /protein_id="CAR83115.1"
FT                   /translation="MKGKLNEAKDHLMSGISYALPVIIAGSLVVAVAKLIGIIGGVTNL
FT                   DAYADASGFYHYVYLFQNVGWAAIGLLNLVLAGYIAYSIAGKPALAAGFVGGVLATSTN
FT                   AGFLGAVVAGFFAGWLTNWVKKHVRITGPAASSLPLIILPLITVGATGILMSLILGGPL
FT                   GWLNQTLLDWVTEMCKNDTNVIILALILGAMIGFDLGGPVNKAAWMAGNALFMSGIYLP
FT                   SIMINVAICIPPLGYGIATLLRKKNYSTTFKEAGNGALIMGLIGVTEGAIPFTLRSPGK
FT                   LIPLNVIACAIGSAVTMGLGAYVKMPPIGGMYGFFTIGNGWAYLVGGLVGAFIIGICAN
FT                   LFVNFTEEETAAADDAVDDIDISFDEIEIK"
FT   CDS_pept        437328..439961
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0414"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83116"
FT                   /protein_id="CAR83116.1"
FT                   /translation="MKMAKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAK
FT                   DDYHFYLMDAQSSLIEDYLRYCPEDKTRLEKLITEKRLITGPWYTQTDQLVISQESIVR
FT                   NLLYGTRIAREMGHSMAVGYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEF
FT                   IWRGDDGTEMLAEQIPFGYYYGANIPENEAELKTYLNEQIGALEEKASTQNVYFPNGLD
FT                   QAPVRKNLPELVAKFNEIDSTREYQIASPETFFADLEKDVTDLPVIAGELTEGKHSRLH
FT                   KSIFSTRADLKQANNEIENFLSNVLEPVLSISYSLGNRYPHNELAEIWKLMFENAAHDS
FT                   IGGCNSDTTNRDVKHRYKLASDLATNLLDLNMRLISEKIEQKQPFQFTVFNPLPYEKSG
FT                   VIKMTAYIPEDNFTVEDAQGNTLLYTILEKTDLTEYVLNQHIDLNPSKPVYLPEKVFLA
FT                   TMLVNVNSLPALGYDTIYFNLEKETVAQEPTQSTATKIENEFYEIHLADNHSLTIHDKK
FT                   ADRTYTDQMIFVENGDDGDSYNYSPPRKDLVISSKEAVVNSVESSVSSVNQTLTISFTL
FT                   NVPYNLEERANGEKNNEMTIKTVISLRKNEELIRFDVQVANHVLSHRLCVTFATEIASK
FT                   FSTADQLFAPIKRPVRLPEMDVWEAEEWQEAPISIEAMQSFVSLHDESHGVAVMTEGVR
FT                   EYEIIGENYDTISLTLFRTFSHMGKTDLLYRPGRASGESIVATPDAQLLGEINATFALT
FT                   LFESSFDEANIAKKAKEYLSNPPVYQMSDFLNGRLIYVYRDEEKTLDATYSLGLPTIDG
FT                   AIISAVKKAEDSDAFITRFFNPYLQKEITVPEIFQGKERHLDESESNNKQATLKHAKVQ
FT                   TYLFKK"
FT   CDS_pept        439994..441928
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0415"
FT                   /note="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83117"
FT                   /protein_id="CAR83117.1"
FT                   /translation="MGYFAYKRLETLYGMLLDAGSHLSAQKLSQELHISERTIRTDIAK
FT                   LTEFLENHGATITLTRGAGYKIEIQDQAAFQAFQTEKNKPKNADYFDLDNPEERVKYEI
FT                   FLLLSSADYIKLEDLADTIFASRATISNDMKQVRKVIASYGLSLISKPGSGVKIIGDEA
FT                   KMRYALTALIASKNTPESYLETFFEWHKQKDKLQKLMTAVTDYFFATNIRFTDEALQNL
FT                   LLHMMILVERIELGYTLEEFELTDVSEEEIVIADKLATILESLFEIEIADADKNYLLLQ
FT                   IASKRILNVDDKEISEFDDYAYIEGMLNRIESHYFYHLQDDMQLKKDLVAHIHSMLYRV
FT                   KYHMTVKNPMTEHIKRYYPLAYEITLDAVESLKKDYPYDINQNELAYLALHIGASLERN
FT                   YQISYYRHKSALIVCGSGFGTARIVEAKVKSAVSNLDITKVVSIQEYNRFIHIEEDIIL
FT                   STVRIPEKNKPVIKISNIPTTEELKMLGAIIQEQTDPNRGFLSNFFTADFFARSNMTSK
FT                   TAILEEMVNSLEQQNIVGEDFLRSVLEREKLGSTVLGTGIAIPHPLGLMAKETKIVIRI
FT                   LDKPIKWDQKQSVRAVFLLCISKNDYEEAINIYELLVELVREEYGEKLSGLTDFYSFTA
FT                   LANDILKKK"
FT   CDS_pept        442055..442471
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83118"
FT                   /protein_id="CAR83118.1"
FT                   /translation="MNRQTEFTLLIVGASLSILVFLGAVFYSLIFGVNTLMVTDTFGYY
FT                   SSSEEAIVLGIITFFSIIAAFFALLSAVFGFIGAFKIKSNGPKAKQLGVCFIILGGLQV
FT                   FTIHGILFLIAGILTVTKKEYKTISKEDEGTKWE"
FT   CDS_pept        442462..442872
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83119"
FT                   /protein_id="CAR83119.1"
FT                   /translation="MGMITFLPIFIIFAMLLGLAAKVLLAIWVYKDAEQRGMNAILWCL
FT                   LMVFINVIIILVIYLIVRTKGEVMKQNLGLLISGIGIAVLNTLIAIIAFIFLIFFAVND
FT                   GGMHNMMDGYDYDYNYDYDDGYEYDRDNFEEF"
FT   CDS_pept        442981..443988
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0418"
FT                   /product="phosphate transporter family protein"
FT                   /note="Phosphate/sulphate permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83120"
FT                   /protein_id="CAR83120.1"
FT                   /translation="MDTVILITVIIVIMGLAFDFINGFHDIANAVATSISTRALKPRVA
FT                   IGIAAVMNFLGAISFTGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMP
FT                   SSSSHVLIGAIAGASIASASSFSVLNWSGFTTIIIALIVSPIIGFTVGYLIYSLFKHLF
FT                   HDKKLGKMNRRFRFIQIGTAAVQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWV
FT                   QVSCAASMAIGSSVGGYRIIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTT
FT                   QVIDSSIMGVGTANHKKEVNWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL"
FT   CDS_pept        444004..444384
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0419"
FT                   /product="glyoxalase family protein"
FT                   /note="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83121"
FT                   /protein_id="CAR83121.1"
FT                   /translation="MKIEHVALWTTNLEQMKQFYVTYFGATANDLYENKTKGFTSYFLS
FT                   FEDGARLEIMSRTDVTGKTTGENLGWAHIAISTGTKEAVDELTEKLRQDGFAIAGEPRM
FT                   TGDGYYESVVLDPEGNRIEITW"
FT   CDS_pept        444452..444844
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83122"
FT                   /protein_id="CAR83122.1"
FT                   /translation="MDIVTNKIVVEKYNFETIVEENEQFENKIELEVHEVEPVNGNVEL
FT                   MSKGKIFKITIPFLLVLENFRIDGRISRIIQLKDFFGDFSDLEAVDVEGLSNPLIDYIK
FT                   RLTYDVTEIAFDEPGVSLDFNANHNS"
FT   CDS_pept        444857..445279
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83123"
FT                   /protein_id="CAR83123.1"
FT                   /translation="MRQYMKMVRPFDFVIIILLILGSFLPLILFSVAEAKHVGDDVVAV
FT                   ISQDGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWK
FT                   SKAGDTIVCLPHKVFVEIKSTNKKSKDPDTDLIVPN"
FT   CDS_pept        complement(445349..447952)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0422"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83124"
FT                   /protein_id="CAR83124.1"
FT                   /translation="MKPYVLKFQEIQPHSEALVGGKGMNLGACSNIEGVHVPAGFCLTT
FT                   EAYKRTLAENNEFTQLLQRLSSLKTSDMDAIREISETIRTLIQHTQIPSEITSDMDAAL
FT                   LDVGGYEMPFAVRSSATAEDLPHTSFAGQHDTYLNIIGRDALLQHISMCWASLFTERAI
FT                   IYRIQNHFDHRKVQLAVVIQQMISPEASGILFTADPITSNRKSLSIDASFGLGEALVSG
FT                   LVSADSYTVQENTITNKIIAKKKLAIYSLKEGGTETRPLEESQQTTQTLTDQQILQLAK
FT                   LGRKIETHFGKPQDIEWCLAEGVFYIVQSRPITTLYPIPEVSEPGNRVYISVAHQQMMT
FT                   DAMKPLGLSFYLMTTPATMYTAGGRLFVDITQSLSAKVSRDMMINSLGQSDPLIKDALL
FT                   TVINKKGFLPPLPTEENPSQTPVSGKPPVRSIPDSSSVFELVRNSENSIKHLKQSIETK
FT                   SGSDLFDFIVEDLEELKRVLFNPTSIDAIMAGMDASAWLNEHIYQWLGEKNVADKLSES
FT                   APNNITSQMGLELLDVADVIRPYPAVRAYLEQTKNPDFMNELATLEGGAETKKALEDYL
FT                   QKYGMRCAGEIDLTKTRWIENPLTLIPLILSNIKNFEPGASMHKFAQGEKEAFHKEQEI
FT                   LRRLQELPDGEQKAMETKEKIDILRHFIGYREYPKYGMINRYFIYKLALLRAGEQLVKD
FT                   GILQEQEDIYFLYFEELREVVRTGQVDYELINARKRDFATFEKLSPPRILTSDGEMING
FT                   EYKRENLPKDAILGLPVSSGTVEGRARVILNMEKADLEDGDILVTAYTDPSWTPAFVSI
FT                   KGLVTEVGGLMTHGAVIAREYGLPAVVGVENATTVIKDGQQIRINGTEGYIEILD"
FT   CDS_pept        complement(448152..449033)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83125"
FT                   /protein_id="CAR83125.1"
FT                   /translation="MYMTGLGTLLFLVGIGVLIFGLVSFRKRNWPRKKTQIIIISSILA
FT                   IIIGVGIIPTTDEEASTEEPTKQEEKTEKVDNTPVLKAETTFTTDDEGTLVVKGKTNPG
FT                   AEVTLDFVDIPDAVTTADEDGAFSLSVNQLDKAQDAVLSIAIDGQTKEQTLKLALTPAY
FT                   ETKLAEKAEAERVAAEKAEAERVERERVAAEEKRAADAKLAAEKKAEEARVAAEKKAAE
FT                   EKRVAAERSKAAAAAQPDTSNEQGQMVYITATGKKYHYDQNCRGLNNSNGETAVTVAQA
FT                   KARGLTLCKFEQ"
FT   CDS_pept        449375..449566
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83126"
FT                   /protein_id="CAR83126.1"
FT                   /translation="MTKPIEEIGAEFGAKAEKVVRKTGNVAGKAAKISVYGSIWAAKTG
FT                   VNKTRAFAQGFKQGWSGK"
FT   CDS_pept        449592..450401
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0425"
FT                   /product="ZIP zinc transporter family protein"
FT                   /note="Predicted divalent heavy-metal cations transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83127"
FT                   /protein_id="CAR83127.1"
FT                   /translation="MLNYLSSLNPVLLALLAGIFTWACTAAGASLVFFFKNLNKKWGNV
FT                   MLGFAAGVMLAASFWSLLAPAIEMSKDLGKFSFVPALIGFLLGGIFLRVIDRIIPHLHF
FT                   GFPEQAKEGPKTSLRKSILLVLSITIHNIPEGAAVGVAFGAVITGDTETLITAIVLALG
FT                   IGIQNFPEGAAVSIPLRGEGLSRGKSFWYGQLSAVVEPIFAVIGAVLVVFVTPILPFAL
FT                   AFAAGAMIFVIVEELIPESQVEGSADLATAATMAGFAVMMVLDVALG"
FT   CDS_pept        450694..452094
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0426"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /EC_number="3.5.1.-"
FT                   /note="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83128"
FT                   /protein_id="CAR83128.1"
FT                   /translation="MKIRWIRISLVTILIIAVVFVGVIGFQKYQFSKSRNKVIMQMDRL
FT                   MKDQDGDNFRRLDKKEDGVEIISYIPKTATKEDNEIIQKEIEKAKAEEVKKLNRDKDKQ
FT                   GIIFYTYQKEKMAEQVVSYKAVQSEYVKEGKTKFVLKDKKDICQNIVTDAETGALLTLG
FT                   EVLIKNDETKLNLKSAVEQELIKTGDYAVKDVGNLGNIKSLVKWDQTDFELTNSELIVP
FT                   VEIPGSSEPKKVKVQLANIASSVNKRYLPSSVKVPEVPKAKTNKRIALTFDDGPSASVT
FT                   PGVLDTLKRYDVKATFFVLGSSVVQNPGLVKRELDEGHQVGSHSWDHPQLTKLSKQEVY
FT                   NQILQTQKVVFDQTGYFPTTMRPPYGAVNKEVAEEIGLPIIQWSVDTEDWRNKNAGVVT
FT                   QKVLAGATDGAIVLMHDIHKTTAASLDETLKQLKSQGYEFVTIDELYGEKLQIGKQYFD
FT                   KTESRMVK"
FT   CDS_pept        452248..452424
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0427"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83129"
FT                   /protein_id="CAR83129.1"
FT                   /translation="MREERKIGQNELALALEVSRQTIHAIEKGKYNPSLELSLKMARYF
FT                   HLTIEEIFQLEEN"
FT   CDS_pept        452426..452836
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83130"
FT                   /protein_id="CAR83130.1"
FT                   /translation="MKRYIINRGITVVATIIYMFPLLGIIKGEEIFGDIVTPIVMIIAA
FT                   LIGTLTSMFLFENKSKREYEKDKLEKDERYVNNRKTFSYYALIVLALTIPIVLIVLNLY
FT                   GIEQISISSLTIIFLICCFAYMIALEIIRKKV"
FT   CDS_pept        complement(452889..453188)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83131"
FT                   /protein_id="CAR83131.1"
FT                   /translation="MRSLDAVEILRRGETIERYKEGGNSMLPLIKSMQPVRLEPIGTRE
FT                   LKVNDIVFCKVRGSFFTHKISKIRGKQYQISNNHKHVNGWITRNSIYGIVTKIW"
FT   CDS_pept        453291..454103
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0430"
FT                   /product="Cof-like hydrolase"
FT                   /note="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83132"
FT                   /protein_id="CAR83132.1"
FT                   /translation="MIRAISVDMDGTFLDGNGEYDRARFERIYEELVKRDVKFIVASGN
FT                   QYYQLKSFFPGKDEELFYVAENGAVIFHQGELRSVNRFDERLVQKILRTLIQEYQDLQV
FT                   ILCGVKSAYLLKAADPDFKAFAKKYYFELQEVDSFNVLPDDTFIKFALDVEVAKTGQIV
FT                   EDLNQTFAGEIRAVSSGHGSIDIIIPGVTKGNAIQQLLNEWQVAPDDLLAFGDANNDIE
FT                   MLRLTPNSYAMHESSPEVLATAKHVAPSNKEAGVLQVIEEYMKKSQRP"
FT   CDS_pept        complement(454187..455431)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0431"
FT                   /product="FtsW/RodA/SpoVE family protein"
FT                   /note="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83133"
FT                   /protein_id="CAR83133.1"
FT                   /translation="MSSAIFEEYLGKVIAKVKSKQAHSMIKKELNNHLEELSDSFQKRG
FT                   LSLEDADKKAMQEMGDPSAVGKNMNQLHKPRMDWLLIALFILLAGIGFLPLMSDVVSPN
FT                   SFFIKKQIVWLALAILALIGFLFFDYRKLKNLWMYFYAAALILFFISFFVGTRLIGGGI
FT                   WLSFGGIMINGPAISLYLFLIAWAGNFTKVTDFKGWKKLVGLLILFWLPVIFYIMLSQF
FT                   VFSIIYFLCVLVMSIFYYRRNQFAIKVALGNLLVGIIFISTMILKFSSSYLSDNLISVK
FT                   AILSQAGWFGKGLHNNLTIPEAHTDFVFPFLVYSFGWVFGIFLCLLLLVFILRISLNAF
FT                   KTKDLFGRLLTIGGAVLFTVPAFWNILMGLGIVPIMVVPLPFISYGGSMLLVYAALLGL
FT                   ILNVYRRKDIVEPTI"
FT   CDS_pept        complement(455428..455859)
FT                   /transl_table=11
FT                   /gene="lstR"
FT                   /locus_tag="lmo4a_0432"
FT                   /product="lineage-specific thermal regulator"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83134"
FT                   /protein_id="CAR83134.1"
FT                   /translation="MDDPFSNLKDSIKKDFEGFSFSEERKNAVKETIRKKQSHLELQYW
FT                   KEETLRNILDSLHDEAKHGYEISTQLFQKNELSFKNNEGQLYILLHLLENKKILSSKWI
FT                   EDKKYYSLTAKGKKFVATFERRGSKQHGSLKNLIEEASL"
FT   CDS_pept        complement(455862..456410)
FT                   /transl_table=11
FT                   /gene="sigC"
FT                   /locus_tag="lmo4a_0433"
FT                   /product="RNA polymerase sigma C factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83135"
FT                   /protein_id="CAR83135.1"
FT                   /translation="MTELEEIGIHINSIENTEQIISQLMDNYSDDVLHLVFSYVKNRTT
FT                   AEDLTQEIFIKCYEKLDQFNNKSSIKTWLYRIAINHCKDYLGSWHYRKLNFSEKIWDYL
FT                   PSKTKHVEEEIIAKDVANSLMSAVMDLPVKYREVVFLHYYEELSLANISKITGVNSNTL
FT                   KTRLKHARELLKTKMKKEV"
FT   CDS_pept        complement(456601..457458)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0434"
FT                   /product="sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83136"
FT                   /protein_id="CAR83136.1"
FT                   /translation="MSIYLIALLPVLGWGFMPIIANLRKSTPEEQLLGTSISALLFAFI
FT                   LFWILSPEITVLSFIVSFVSGIFWSFGQLLQFKGIAASSVAKAMPISNGTQLVGATLFA
FT                   VLVFREWQTVTAVIIGVVAVILILIGVVMTGFQKRGNHITESVSFHVYGIVILSSFFLT
FT                   LYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKKTAISRKNVTFNLMTGLSWSIANL
FT                   GMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLEWTFILSGILLIMVGVVFL
FT                   SLLK"
FT   CDS_pept        457574..459580
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0435"
FT                   /note="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83137"
FT                   /protein_id="CAR83137.1"
FT                   /translation="MSLCNRISVGKGKLKMKAVTKMIANREKNIIQFLMKTGQTRVGTI
FT                   ANHLGLSEKTVSNSLKEIDVFLKDFDMTVVRKPKIGVYIEGDNKAFAEVSRFLDNQVSQ
FT                   IPSTKEERVIYIFSKLLKADDYITIHQLADELYISRSTIEKNMMEVTKMLEKEGITLYK
FT                   KPSKGMKLLISEREKRALTSKFITNFWGNNWYLKQEGEKVLQAFDTIQADVTGIFPEEG
FT                   LKEIIAIVQEFSERHDFAFTDYAFQSIVIHLAIAVERIREGEYVENVESDPMKDAFESQ
FT                   RNNTEILVGMLEERLAIKIPAFEVGYIQLHLTAAYNQQHDELLVNTRPQEDDVAEFVSE
FT                   CLAEGNYDKGLLEDLTTHMKSAINRLKLGMHFKNPYLSKIKQNFPQAFEEALYFKAKFE
FT                   QKYDVQVNEDETAYIALHFEAYKERSRSFPDQIRVVLVCSTGLGSSRLLAARIKKYFPM
FT                   ITIEKILSVQALMETEVDVDLVISTIYLELEDIPSIVVSPMMSKADLQQVESQIERTRR
FT                   KKKKRSQPFVDLIRPKTIFAKLDVATMEEAIAEIGGKLVEQGIAKPGIVESALKREALS
FT                   FTSFEEMATPHAEPALINESCIAIATLKQPVKWGLVDVDKIFFIALTEKNGINLDAMYE
FT                   QFYKYIDNKKWLEKLTQLKSAAEIYEHLLKDGM"
FT   CDS_pept        459580..460044
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0436"
FT                   /product="PTS system, fructose-specific, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Mannitol/fructose-specific phosphotransferase
FT                   system, IIA domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83138"
FT                   /protein_id="CAR83138.1"
FT                   /translation="MEVKDILTKELVVFDLEAATKEAAIEEMAELLDERGILADKATYV
FT                   RAVLDREAHSTTGIGNNIAIPHGKSESVTKSAIVFARTKEMIEWESLDDEPVNMIFLLA
FT                   ITDSDKTDGHLKILAEIATKLMDDDIVENLKNTRDEEEVIRILNGGVVEI"
FT   CDS_pept        460041..460361
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0437"
FT                   /product="PTS system, fructose-specific, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system fructose-specific
FT                   component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83139"
FT                   /protein_id="CAR83139.1"
FT                   /translation="MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATG
FT                   IENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALID
FT                   EK"
FT   CDS_pept        460374..461480
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0438"
FT                   /product="PTS system, fructose-specific, IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system, fructose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83140"
FT                   /protein_id="CAR83140.1"
FT                   /translation="MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITD
FT                   IWDAKYADSANSLISLLHSLDGFGGLALGMMFPVIAAFIGYSIADKLALAPGLVGGLLA
FT                   RDIGAGFLGALAAGLIAGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVV
FT                   GIPFADLNTALENWLNGMSGSNQILMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIY
FT                   APNTAAQVAIIIPPLGLGLATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESP
FT                   LKVIPATVLGSAVGGALAVGLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMS
FT                   VALRKASAGEEMAGSSYDDEIDEAEWEA"
FT   CDS_pept        461496..464078
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0439"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /note="Alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83141"
FT                   /protein_id="CAR83141.1"
FT                   /translation="MVKAHIVNHTHWDREWYFTSADALVLSEQLFTEVIDELKKHPEAN
FT                   FVLDGQLSILDDYVALYPEKLADIKQLIADEQLFIGPWFTQTDAFFAHGESILRNAMIG
FT                   IFDSKKYGDYMKIGYLPDTFGFNAQMPTLLEHAGFDNVIFWRGIHLGEHVASPYFKWQG
FT                   LGEEASIYAINMPQGYGTGMLLEPTSAYVDGRLDPAIDFIEKYSKTTEVLIPSGNDQLN
FT                   IISNFAEKLVEINKMGRHDYQLSTYQDFIQYVRELPDLEEYRGEFRSPVLARVHKTIGS
FT                   SRMNIKLKSASLEQKLLTRIEPLLVIAKASGISISERLLMHTWKKLLEGQAHDSLAGCV
FT                   SDPVAEDILHRMKEADELCDSIENTIVKKIADDLSLAANEIIVFNTDLHDFDGYKEIQV
FT                   VTEHKKIHFPAFPDATIVQEEFIPSRENVLEETPAGNRFIEEPGYYVLQVRVKVELPGL
FT                   GYRVIAFEENDRELDSMIASTNVTITNNFYKITFENGEIALEKPNGERITSFITLEDDV
FT                   NAGDTYDYSPLAGDIAELFTFSEAKTEKSSEVERLILTGKSDFPLDRLTKEGHGDLQIK
FT                   LILEVKKGSELLDVKVEVDNQIKNHRLRLKVNTGVKTDYNIASLPFGYIERKPVVPANW
FT                   QETYSEMPIDIEPLEQSVTLTNEAESCTIFTRGIKEYQQLDQHLALTLLATTGQLGKPD
FT                   LAYRPGRASGDTTKKGHVLIETEGAQLLGKHDFSLAIYLGDQAFDEHKTAERTKAFNQA
FT                   NVSYQRQPFNHFLHRLDNKIQKTERRLGAKQTLGMLNLPKEYLVSACHPSYYSADKYII
FT                   RLENPTNTPQKLALSDMSFEYVNAIEEVVANDNNRIPAYGAVTLRLEI"
FT   CDS_pept        464214..464729
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83142"
FT                   /protein_id="CAR83142.1"
FT                   /translation="MNRQQLEKLNRDCIYEVYEDREETNEFYMGYIKAIFKKYIIIENY
FT                   HRSGQFDGFAIIANENIFKIQKGTKYLEPYKNVKSPQIQMPELSSKGDTLYNFLQWAKE
FT                   NKKIVELTTVWDELIIGEIDVLDDELLSMNVLLSDDFSPDGQCFIEYESILDVCVDTLK
FT                   LRFMEECC"
FT   CDS_pept        complement(465157..466032)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83143"
FT                   /protein_id="CAR83143.1"
FT                   /translation="MELRVLNYFLTVAREKTISRAAEVLHLSQPTLSKQLKELEEELGV
FT                   TLFIRGNRSITLTEDGIYLANRAKEILSLVELTTSNLLQNETISGKITIGAGETRGFEF
FT                   IGSVIHQLREIHPEITFQLHSGNADDVLEKIEHGLLDFGLVINPVEMHAYEYLQLSLED
FT                   RWGILVNTAHPLAQKEVIIPGDIQENPIMVSNQSFVDNQLASWLGGHFEQLNVIGRYNL
FT                   LYNASLLAKENIASILCIDGIINTDNTNLKFIPFSPPLTAGISIVWKKNPTFSSAAKEF
FT                   LRLIEKEITK"
FT   CDS_pept        466150..466719
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0442"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL famil"
FT                   /EC_number="2.3.1.-"
FT                   /note="Acetyltransferase (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83144"
FT                   /protein_id="CAR83144.1"
FT                   /translation="MIEQDLQKRLVDQEILQGSDLLDEIHEVKQNNEQLIIELNTKYHS
FT                   KKEVTKYLSEITGKPVDPSVDVSLPFYSDFGKHITFGKNIFINLNVTFVDLGGIMIEDN
FT                   VLIGPGARLVTVNHLVSPKKRRGLRVAPICVKKNAWIGANATILSGVTIGENAIVAADA
FT                   TVTRDVPANVIVAGSPAKQIRKIIEE"
FT   CDS_pept        466733..467479
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0443"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83145"
FT                   /protein_id="CAR83145.1"
FT                   /translation="MTIKNKVIIITGASSGIGEATALLLAEKGAKVVLAARRVEKLEKI
FT                   VQTIKASSGEAIFAKTDVTKREDNKKLVELAIETYGKVDAIFLNAGIMPNSPLSALKED
FT                   EWEQMVDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVAGLKAYPGGAVYGATKWAVRD
FT                   LMEVLRMESAQEGTNIRTATIYPAAINTELLETITDKETERGMTSLYKQYGITPDRIAS
FT                   IVAYAIDQPEDVNVNEFTVGPTSQPW"
FT   CDS_pept        467842..474438
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0444"
FT                   /product="wall-associated protein, WapA family"
FT                   /note="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83146"
FT                   /protein_id="CAR83146.1"
FT                   /translation="MKKHAKAKKILVSLIAIMLFLSLIPGYAPMAEETSTGVAEPEKKA
FT                   GEQAPTEVKDERTENEVVFDNHDGSFTKQIFADPINMEVDGEMKRIDANVEKEADSDMI
FT                   VPKQTPLELGFLDKMEDGAYQKLTKAGAEVTFRLKGARTGENEQAVTDQPATYKENEVT
FT                   YENVFPKTDLRHLTFPQSVKEDIVLHEPNQVDTYVYQIETKLGLELAKNGDVLFKNKSG
FT                   ETMYTLPKPVMTDSNVGAETGEAALSENVSFEVKQLTKTVYELQLKVDTAWLNDAAREY
FT                   PVYIDPSVRLDEVYNANINSAKPTETNIGSKLWDSGQNAYTLKLGKWDNSTGNNAAYLK
FT                   MDTSTLNKATISKATLKVYNIWHMSPTVKNDLWYYESNANWSPWQVTWNTAPATTRIGS
FT                   VNVGRGEWANLDVTKTVQAWASGVRPNNGFRLATNIDQNYWKKLVASENNKNYPYLEVN
FT                   YTYAQPEKPTVKTNSNGVGTGTGYMDLSWKAVPGATSYNIVISNGYNYEYINTKSTATT
FT                   WSTKGKKIFPTNDEIANGEFEFHHDGKGTEFALDPRAQYENAFQAGSTFGLRNLTRYLF
FT                   RVQAVFPGGESPNSDLVFAYMPIEKPQPPAAKAYSNLAHKETGYVELNWEKSPMADGYK
FT                   VLVFNGKVYEEYDVGAETKWTTQNKGIWPTKEEIAEGKFALHHDGKGDELAKDPSPVYT
FT                   NSGGNYKERTNYWFRIVAYQKAGNNATSIQSEPATPSLPEVVNKQLGMVDYWTSVPVRG
FT                   GEVNATNGNFLFHETDFNLEGRGPSINVDRTFNSQDDATGIFGKGWTSTLEEKLIEEEN
FT                   GNIVWVESDKKVHRFTKKGDKYEAPPGIYSEITKNADGYLKIEEDKSETRFLADGRLKS
FT                   EKDTKGNELTYEYTDGKLTSMRDASGRTVTLAYEGELVKELVGPENRKISYTYNDKQEL
FT                   ISSSTARGKIYRYGYTDGLLTSIYDPKHTEEKPYETTFAYEEEKLTEITDPVGKKTTLS
FT                   YDMEEQQTTLTNEKKKKTIYSYNDAGNPKKEIVDADGLKLTTTYTYESNNLVKEVNPKG
FT                   QEETYAYDADGNITQATDAYGTESYTYNGNNDVTSATDTEGRKTTVAYDGADAVSETLA
FT                   TESQVSSVTQYDAYGNPIRGSGELSSAGNLLQNSGFEKGAGVSNWTLIQWDAKGSMTFD
FT                   STQSAPGTLGGSGSVKLTSEANSTVKGYSSVTQRVDVEPETTYTFSAWIKTSGMTNADA
FT                   LLIGRLQDANAKDITDAGVWQSNRATSIKKNGGWVKRQLTFKTSKNTRQVLLYLDNEQP
FT                   APHKGKGTIWYDNVQFEKGSVASSYNPVVNSSFEEHNGTLPTGWARSGNTALTQAKVVD
FT                   NEGYSGDSAVYFERKATSEAYTHIAQDVPVNQKEAKALTISALSKSEDAKSNGSVATMS
FT                   NDYSVWGTINYQDGTTSSVQGQFPLGTNDWNRSAVVIKPTKPIKSVKVYTMFRNGLTGK
FT                   AWFDDVRVIEGEVLTKNEYDASGNYVTASYDEEGRKISFTYDIYGNKTSETDEKGNKKT
FT                   LTYDADNALIDTKLANGTSVAYKYDDNGNTTEKNVTASGKTQKNIYEYDVDNKITAFTD
FT                   ALNRTIKYEYDAAGNETKAIMPNGRVTESTYDSADRMDGIKWNDKLAFKFQYDPNGNQT
FT                   KVTDEINSIVTDKTYDDANRITKVAERGGDVSYTYKDKPTKDNKGKTDKVGEVAINHGD
FT                   YTAKTSYTYNDLDRNTRVNDGSKNAYFEFDEFGNINVYTAGNGTAANYTYDSTQKVTNA
FT                   AISSASGTQILDENYTYDAASNRTSIDNKQDGKTTYEYDAVNQLTKETLPDGTVKAYTY
FT                   DGFGNRTQVAISGSETKTIAASYNDGNQLVSWNGEALTYDANGNRTSDGKYTYTWDTGD
FT                   RLSSITKKGESEPFTSYTYDDDNRRLSKTVDGVTTNYHYDGDSIDVLYETDGDGKVVRQ
FT                   YVYSDDNVRLAMKMNGKTLYYHYNAHGDVIALTDEAGKIVAEYAYDAWGNVLKNTASTE
FT                   EAKANPYGYAGYTYDKEIEQYYLMARYYEPEQGVFTAYDPDPGDEDDPQTMNGYNYANN
FT                   NPVMMFDPDGNMPWWAAATIGGAIGGAAKYYITNKIRGKKSTWKGAGKAAFRGGRDALY
FT                   WTTGARVFGLAGKVGTIAKVFKKGTKNRSFKKQVIKNIKTIKYTVKSNYKSLRKNYKKH
FT                   LSTKLNLKSGKSYRKMAKRYYNKIRRKMS"
FT   CDS_pept        475190..475879
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0445"
FT                   /product="HEAT repeat domain protein"
FT                   /note="FOG: HEAT repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83147"
FT                   /protein_id="CAR83147.1"
FT                   /translation="MDAKQLLQTLKNTPNETQMLKIIPKLGKYAKGKAVENALVSLSES
FT                   SSEKIRAAAIDALLTNSHKRIKNLVMAHMSDTKEVKTKCFEYMGYHRMKQAEPILLAHL
FT                   NDVDRWVRYFAVLNLGDLGAYDVIEGVEKHLENETSDVVKSGCYSTSVLLSETEAEKDC
FT                   YEQKLIQLLNSSDEVARYVTINNLADLKNHLKREQIINAFYARLQIESDEENITTLKNA
FT                   IRSLKYW"
FT   CDS_pept        476000..476587
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83148"
FT                   /protein_id="CAR83148.1"
FT                   /translation="MEKMTLKKKTYANFNKEFAKVFNSDNSLPENIFNTKFHNFFVYDM
FT                   DYFYEETGWEWILQISSNNKVKNLFFTSATEKNSDYTIAEIPTSLNPKQILEQMDILEN
FT                   ESEDKKNTFFLTFNEACLFSNVSNWGLYFVNEFNFVILALEEDFPEQNAFSHLESMTKE
FT                   EFTKHFQEWSVWLEKDNLNFLKEFNEVFFAKS"
FT   CDS_pept        476619..477173
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83149"
FT                   /protein_id="CAR83149.1"
FT                   /translation="MSTKFMYERLLKCQEANKLVAIYASREDEYFEAGYIEAVTASDVM
FT                   FRSRRSDGYEEGHVVLPLELVYRIEIDTAHLKTAELLAKHLNQPISSGLFEKAPNKKHS
FT                   LFEIAADYVYQSKEIIFIDIIGDETPAIGMIAENEYEGLEITLVDDEGRLDGTCWIKKE
FT                   DILALRFGGSVEQDLMNKLKK"
FT   CDS_pept        478896..479483
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83150"
FT                   /protein_id="CAR83150.1"
FT                   /translation="MINLEWEELDQLEIEEKVQEVLDYSYNTWISDKKNIRYFVRAFYI
FT                   RWDMLVDMYEVEDDETEGDKLKYMYDFGISELGNITEVDWIMGYCMLINPIYFEENDNY
FT                   LELEEKGQEMLCNVAINNPDDVFLTSFGIPEKDYLKWKIANREQLIQYGEDNFSYDSEF
FT                   SRYFKHIINCRANEEVEKESFLKKIVRRWKQR"
FT   CDS_pept        479518..480204
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0449"
FT                   /product="PBS lyase heat-like repeat domain protein"
FT                   /note="Predicted NTPase (NACHT family)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83151"
FT                   /protein_id="CAR83151.1"
FT                   /translation="MKKILNEIKTIIQQKPFDYEKAEDLISELNLEEAPLELENILLAS
FT                   INNSDENARIFAYEYLYYFDSEAVFQAALIGTTDDDDLVQMCSIEILGNLAKVESLPYL
FT                   KKALGDNNPDVRCFAAESIGFIGTDEAKIMLEKQLHKETDSFAKVGIYSALHFLGDEAM
FT                   LSNIIALLDDSYHLTIIRSLRVLEDCINQANKEMIKSSTKNLLERDIPISVKEAAEIVL
FT                   EKLKRE"
FT   CDS_pept        480250..480639
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83152"
FT                   /protein_id="CAR83152.1"
FT                   /translation="MTYEEFTELAQSFLKKDEDGQPLTHGEKLIVAQYIYEDYVPMDGF
FT                   LLTYFNVNAEMLELLIEAYTKLDDKANLELVQAFATWTKKINRLDDYSAVISKLSDEDW
FT                   EFLDNISDNYPLGEEESYSNILLEE"
FT   CDS_pept        480691..480858
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83153"
FT                   /protein_id="CAR83153.1"
FT                   /translation="MSILCIVMFHWKNKVIFIAKLVKDKIFIRGIKIKLEEINSQFRNK
FT                   KNYQPATHTK"
FT   CDS_pept        480977..481078
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83154"
FT                   /protein_id="CAR83154.1"
FT                   /translation="MGKNSYYYLMGFERGDYIEEVKKREFWREECGA"
FT   CDS_pept        481401..483803
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="lmo4a_0453"
FT                   /product="internalin A"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83155"
FT                   /protein_id="CAR83155.1"
FT                   /translation="MRRKRYVWLKSILVAILVLGSGVWINTSNGTNAQAATITQDTPIN
FT                   QIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQIN
FT                   FSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLSNLTGLTLFNNQITDIDPLKNL
FT                   TNLNRLELSSNTISDISALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI
FT                   SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA
FT                   NNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKN
FT                   LTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLASLTNINWLSAGHNQISDLT
FT                   PLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYAEPDI
FT                   TWNLPSYTNEVSYTFNQSVTIGKGTTTFSGTVTQPLKAIFNAKFHVDGKETTKEVEAGN
FT                   LLTEPAKPVKEGYTFVGWFDAQTGGTKWNFSTDKMPTNDIDLYAQFSINSYTATFDNDG
FT                   VTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSA
FT                   NSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPA
FT                   NDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTSPSANIPGSNTSNTSTGNSASTTST
FT                   MNAYDPYNSKEASLPTTGDSDNALYLLIGLLAVGTAVALTKKARASK"
FT   CDS_pept        483889..485781
FT                   /transl_table=11
FT                   /gene="inlB"
FT                   /locus_tag="lmo4a_0454"
FT                   /product="internalin B"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83156"
FT                   /protein_id="CAR83156.1"
FT                   /translation="MKEKHNPRRKHCLISGLAIIFSLWIIIGNGAKVQAETITVPTPIK
FT                   QIFPDDAFAETIKDNLKKKSVTDLVAQNELNGIDQIIANNSDIKSIQGIQYLPNVTKLF
FT                   LNGNKLTDIKPLANSKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHL
FT                   PQLESLYLGNNKLTDITILSRLTQLDTLSLEDNEISDIVPLSGLTKLQNLYLSKNHISD
FT                   LRALAGLKNLDVLELFSQECLNKSINHQTNLVVPNTVKNIDGSLVTPEIISDDGDYEKP
FT                   NVKWHLPEFINEVSFVFYQPVTVGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEA
FT                   GTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFSTDYMSGNDFTLYAMFKAETTEKAVNL
FT                   TRYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDREARNGSELWYRLKNIGWTK
FT                   AENLSLDRYDKIEYDKGVTAYARVKNAPGNAVWTKPYNTAGATLVNKLSVYQGKNMRIL
FT                   REAKTPITTWYQFSIDGKVIGWVDTRALNTFYKQSMEIPIQLTRYVSANKGNEAYYKVP
FT                   VVDSPIKWGTLTKYKNQTLIVDRTATVEGQLWYRIRTSSTFIGWTKATNLSTQK"
FT   CDS_pept        485943..486077
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83157"
FT                   /protein_id="CAR83157.1"
FT                   /translation="MNVIVSQYIQRNGGDIMKQKGNWKSIVGFVFGLLIIGIIFALIN"
FT   CDS_pept        486143..487024
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83158"
FT                   /protein_id="CAR83158.1"
FT                   /translation="MALVILLIGVMLIFVTFKVNAMPTTPTDMGSYLDVTDSVKQLIVM
FT                   GIGVCAALFFIGGLLLTIRVKSTVYARSFQLHENGIESLFKGKSEGIIPFENIEEIQML
FT                   RVPGLKLVNNLLYRAENSNDWIYIPARVGESGELLENFLTKVTPKLIATNKKALSEKNQ
FT                   LAFNFLAPSDYRAFYQKLDKKLTNTPLNTQKSSLLDQLLAANNKKILVTQEGVSLDGTI
FT                   LNWEDLTVEVHYDKHDTIIKNAQRTHEFDFVCVLTTEKLGQVQLQGSAISNQLVLLDIL
FT                   KEKAASFTSFQQ"
FT   CDS_pept        complement(487080..487547)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0457"
FT                   /product="transcriptional regulator, putative"
FT                   /note="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83159"
FT                   /protein_id="CAR83159.1"
FT                   /translation="MKYSIQFSDAIHILAYIEIFKNTKLLSSEIIAGSVKTNPANIRRI
FT                   MSNLKKSDLITTQTGKANPILARPPEEISLLDVYKSIEGNTNLIHVDPKTNPDCVVGAN
FT                   IQQVLTSKYDLLQQKMELEMEKIKLDSIVRDISVLESKDRPQNMEIVEKYL"
FT   CDS_pept        487665..488510
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="dTDP-D-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83160"
FT                   /protein_id="CAR83160.1"
FT                   /translation="MTYLVTGATGGLGGYALNYLKELVPMSDIYALVRSEEKGADLKAT
FT                   GFNIRIGDYSDAESMKQAFAGIDRVLFVSGAPGNRQVEHENVVNAAKEAGVSYIVYTSF
FT                   AGADKSTSALAEDHFFTEKVIEKSGIAHTFLRNNWYFENEMPMIGGALSAGKFVYAAEK
FT                   GKVGWALKREYAEVAAKAVAGADFPEILELSGPLMTYEELTKALKEATGKDFDVISSDD
FT                   KGFVENLVSVGLPQPVAEMFLSFQHDIKNDQLDVTSDDFEKALGKPLTDRVDALRELLK
FT                   "
FT   CDS_pept        complement(488747..488956)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83161"
FT                   /protein_id="CAR83161.1"
FT                   /translation="MKKDKLTMIKETFKNDKTGELTPGVTIILDGEVAQALDIIMKNKG
FT                   YSDYPEALKDVIFEGIQSFIKQND"
FT   CDS_pept        complement(488960..489430)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83162"
FT                   /protein_id="CAR83162.1"
FT                   /translation="MLIPKYAENIIVGVKYNDSFNWYITDTELWYLDYNQACYSIEEYP
FT                   KERKNISILNENTANSFLINIESYKSSTNSLKQNFFKELNRNKEEVTYDYNPSLLVDFD
FT                   NQILYSNYPESISFEEYIPDNWSGYFQRFFENIPQEYRYWEENSTNYLTRKD"
FT   CDS_pept        complement(489450..489650)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83163"
FT                   /protein_id="CAR83163.1"
FT                   /translation="MDDLIKENAISQNGYKINPLNQGGTAPKIVDKGVFEKFNFEGTAY
FT                   EIPDPITQWLAEYAQNAKILK"
FT   CDS_pept        complement(490050..491318)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein containing a NRPS
FT                   condensation (elongation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83164"
FT                   /protein_id="CAR83164.1"
FT                   /translation="MVKITTYPAEPSDVKHYISGEKMKNDHHLHTVLTFDNHLNIDVLK
FT                   KAVIQSTKKLPLLLCHFKETKKGAFWQESVFSAEDLVFLVKTQAPETEVDRALVTKLST
FT                   ENGPQICFTVVRTDTSDQLVVIMNHMLADGAGFKEYLYLLSELYSNLLENPDYVANLSL
FT                   GSRSLKQVFDQLSRNEIKSIFTEKTKQKAVHNPTFPLKGDPKNPKVIWTKLPKAHFSEI
FT                   IHFAKEHEATVNDVLFAAMARTVQQTTGQQEMSIDCPVDLRKYLPSKTSSGITNLTANI
FT                   TCQISEDDDLTSFESTLQAVKNSLNPQKNSFAPLRIYYLLELIFKKKNYSVAKKASEKM
FT                   YSIPKTSFTNIGIIDEEKLVFEGSTLTDCFICGSLKYAPFFQVAATTFRGSLTLSTNLH
FT                   GTAQDHAWQKEFLEQMISEIPSK"
FT   CDS_pept        491456..491959
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83165"
FT                   /protein_id="CAR83165.1"
FT                   /translation="MTNRTLTTKLLGTLSYTQENGTTMDAVIPLDGKEVKINYSIFEKL
FT                   TSEDYFKDIVTLTDQIPELHVKAKKTILEQFDENDTLTIYFEFHTDELPEEVLEVTECD
FT                   AIENVTKEILIDKLVLSGVWFSENANNELDLTFDFKLLPEVSDELLVVRFDNKGEITGL
FT                   THES"
FT   CDS_pept        complement(492002..494038)
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="lmo4a_0464"
FT                   /product="penicillin-binding family protein"
FT                   /note="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83166"
FT                   /protein_id="CAR83166.1"
FT                   /translation="MANLNGKKGNNKKAIIIGSIVAVVVLAGIAIYFFIQNQHKDEKNA
FT                   LAAAETFTSNIAKEKYDKLGSSVSSESLKKVEFTKKEMEDKYQAVYDGIGAKDIKVKNL
FT                   KSVYDDKENKFNLTYELEMRTSLGKLATQKYKTTISKQDDDWKIDWKPALIFPGMVKTD
FT                   KVRITEDEAERGQIVDRNGNPLATTGQFAEAGVVPSKLGEGDEKVKNIADISKKLEVST
FT                   DYINKQLDQKWVQADSFVPLVTLNKDNLPEATGLTYAQKEMRTYPLNEATSHLIGYVGE
FT                   VSAEDIEKNPKLSVGDVIGKSGLERYYDKQLRGKNGGAIKIINDQTKQEDTLQKIDKKD
FT                   GEEIKLTIDAAVQKKAFDSLGSETGAVTMINPTNGELLALVSTPSYDANQMVLGITSED
FT                   YAKYNDDKRLPFLARYANRYAPGSTFKTITATIGLDTGITKPDKVREISGLQWQKDASW
FT                   GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFDKEYNLPFTM
FT                   KPAQISNDGLNSEILLADTSYGQGELLMSPIQQAIAYSAIANDGKMPYPKLDTKEKAGK
FT                   ETQATEAASANQVKAALVKTVSDPAGTAHALQIQGHNIAAKTGTAELKEKQGEDGLENG
FT                   FVYAFDADNPNYLMVGMIENVKGRGGSGLVIDKLKPVIESMYK"
FT   CDS_pept        494210..494524
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83167"
FT                   /protein_id="CAR83167.1"
FT                   /translation="MEEMEQPEKKVIIRGKGIHNKWKWSTIIVSILSVIIISVLSYQLY
FT                   SVSQNTPENNTNGTMQGPGGSEMPSGTPPSGEPGQAPNSSDDSSDSGTSDSTTSSDGTL
FT                   "
FT   CDS_pept        494661..495590
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0466"
FT                   /product="transcriptional regulator, LytR/CpsA/Psr family"
FT                   /note="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83168"
FT                   /protein_id="CAR83168.1"
FT                   /translation="MARHAQKRKARKGRIFVTILVALLILVGVVAVIGYFQYQSSLKEA
FT                   QNESKLKDYKFNGAKAVGDEINVLLIGSDSRGEDQGRSDSLMIAHYNTKTNTPKLVSIM
FT                   RDTYVDIPGHGKNKINAAYSYGGPELVRQTIKENFGVDVQYYVVANFEGFPKIVDTLAP
FT                   EGIKINAEKDMSKNIDANIKKGEQVMDGKTLLQYARFRKDAEGDFGRIRRQQQVLEALK
FT                   EQAIDVGDVAKIPDVIGKLQGYSSTNIPTGTLMSIGADFLLGKTETMEKFAIPVEGKWH
FT                   NERIDGAGAVLRLDDVAANAKALQDFLK"
FT   CDS_pept        complement(495638..496186)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83169"
FT                   /protein_id="CAR83169.1"
FT                   /translation="MKKVSSLLTQDQFWGIIDNSDKGSKLEELLEKLSEDELFGYDYWW
FT                   NYFHKKSYNQSLWAVAYVVLGGCSDDGFDYFRYWLLTRGKAVFTSAMENADTLCDEFDL
FT                   LTEDEYPESEEVAYLVMDVFENKLGKDFDDAEIEAESRIEFEEVSMPKIDFEWNEDDED
FT                   SIKKVCPNTFAKWWNNDKF"
FT   CDS_pept        496420..497145
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83170"
FT                   /protein_id="CAR83170.1"
FT                   /translation="MKDKTKKRKWNWAQILAIFVLITLVISMVYAIVNLITAPSGNVPE
FT                   GQQTKGDYSLMLMQCVLGVVVLFLPSIISKKMKFVIPNAMYIVFIVFLYCAIYLGEVRS
FT                   FYYLIPNWDTILHTFSGAMLGGLGFSIVSLLNNDERVTLSMSPVFVALFACSFAVFLGV
FT                   FWEFYEFAADSFGMNMQKTMLEDGTMLQGHAAVADTMGDLFVDFLGAFVISVVGYFSIR
FT                   KNKKWMKNFEFKKVEEDAK"
FT   CDS_pept        complement(497189..497854)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83171"
FT                   /protein_id="CAR83171.1"
FT                   /translation="MARSRQISESIGLGLLLALAGGFMDAYSYIERGQVFANAQTGNIL
FT                   LFGINLSEGNWAIAIQYFWPVVSFTVGIAISEVIHRRDIRRLHWRQLSVLIEVVILIGV
FT                   AFIPLDHNLIANSLISFVCGIQVESFRKMHGRGIATTMCIGNLRSATQNLCDYFEYKEK
FT                   QYLRNSLLYFTVILSFIIGAVVGNFFIQLFAQYAILVCAFIQFIAFMMMFIDRESKII"
FT   CDS_pept        complement(497875..498630)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83172"
FT                   /protein_id="CAR83172.1"
FT                   /translation="MTTIFPKEQNVTPLFEQILANPTACRRFKDVFLDNLESYQETRGF
FT                   EKDDTLFAKIILSAYRQSDVSALLLGVCGRTLFELLRQAFLIPKKLTVDNPFFLTDKEG
FT                   NFIAKKDDISNREQEKFQEIYQSDLHHSETAIFLVDDDDIIHSYEPDFSISTKRINKKR
FT                   GILVLYSLPDTLKLGMTESEVYAFIWKTFLHIQEIIPSSRIFYGQETSENADELGVFLP
FT                   IHHFEKKMLQNIEQVNELVDALREQMVNK"
FT   CDS_pept        complement(498747..500906)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83173"
FT                   /protein_id="CAR83173.1"
FT                   /translation="MKRYLTLVMLFILSVLLISEWIYPFAELTELSTANWIILFITLSL
FT                   GSFFLRLKYYWTIPLHVVMIIIVSGIYYAKGGILAGNWLGSFFQITFNGFRDMVQFRSS
FT                   DISMDFILIVFLIALWLLSYITTYSILRKQRVMSVLVLTVAYLAVINTFTDYNSNWAIV
FT                   RTVLEGFLLLHLALASRIAAPNRISADSLKRNGLFYHILVILLLAVFVFSSLMLPKKAP
FT                   IFPDPIPTIKNALGINTTRTVGYSEDDTTLGGALKKDNATVFTARAEKGHYWRVESKTV
FT                   YTGTGWANANSADVISFSSGDKFPIQLTEQTTGVTNTAEISFASSSDYMPYPYGTQTVN
FT                   GAVDSFSANLTIERVGPVDTIKNYTVQLKTPVYNIEKMQNADFSTLSNAFVSQYTQTPK
FT                   DLPDRVAKLANKVTKDADSIYDKTKAIERYLSASGTFTYSTEDAKETPRGADYVDQFLF
FT                   ETQIGYCDNFSTSMVVMLRSLGIPARWAKGYTPGEGEKKENDTKTTYTITNNNAHSWPE
FT                   VFFPGTGWVPFEPTATFSNPENFQEPTTETANKPETPNDSTSTPETPNTPENTPEQNNG
FT                   SSSTGETPKKEEPKTETAASNFEIPSWVWWIPAGLVVALLALAIIFRRRIRSYLLLRSL
FT                   KNSPEFGKTYHRLMKLLASYGYVRESSETLRHFGTRVDAELTTTEFSRLTKMYEAQVYS
FT                   NNLTEKVITAEETQLVQQVIARLTK"
FT   CDS_pept        complement(500903..502051)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein (some members
FT                   contain a von Willebrand factor type A (vWA) domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83174"
FT                   /protein_id="CAR83174.1"
FT                   /translation="MLKKRLLLAFRWIIMLIIYAGLWTYTLFQGDTASWFLTYFFSFIL
FT                   LLLFLSSIYPLKAWKVNRSFVKNTYHDGDLIDMQVSFTRKSRYPVGYLLFQQKIPASFG
FT                   NVSARQQVVYPLFKKHFTVTLAGFVGVRGIHSFPPVDVETSDAFGLLERSRQLSSEKTL
FT                   TIYPTYFPDVLEKISESSPENERNAAYWTLKKNSNLHSLREFSSGDRISLIDWKSSAKS
FT                   DQLMTREFENSATSRLSVIFYGASHPNFELSLRAAYSFIRKISEDNGEIRVTLLGDQTS
FT                   KFAPAKGTSRLQDISTAFAEIAPVDSLTLQESLDSNLHSGEKILLFTPCIDTMLMQKVT
FT                   RLTDNKQLQIITFQSEHSKAMDAPAIFLEPASLLSRWEREAK"
FT   CDS_pept        complement(502056..503003)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0473"
FT                   /note="MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83175"
FT                   /protein_id="CAR83175.1"
FT                   /translation="MSIEPSIKINEIINEVEKVIVGKRHVVKLSLTALLAGGHVLLEDV
FT                   PGVGKTMMVRTLSKTIGVSFKRIQFTPDLLPADVTGVSIFNPETRDFEFRPGPVMGNIV
FT                   LADEINRTAPRTQAALLEGMAENSVTVDGITRKLANPFFVMATQNPIEYEGTYALPEAQ
FT                   LDRFLLKINIGYPTVEEEMQLLTLKQYQDPLDQTQQVVTLSELLDLKNKAKQVFIDDVL
FT                   KNYIIRLVDATRKHPSVALGISPRGSLAFMQAAQAFALIEGRDYVIPDDIQYLAPYIFT
FT                   HRLILKSEAYYNEETAESIIASILKNTSVPVEKR"
FT   CDS_pept        503160..504755
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="Sugar diacid utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83176"
FT                   /protein_id="CAR83176.1"
FT                   /translation="MSVKLADLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLE
FT                   DDLFDNDEFYGSEIVVSAFVNIRDDVEAQCRTIERLHKVGEVALILYYVGIFVPKIDQK
FT                   LIDFANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVTESLEQISSVRPP
FT                   QRNIDTTLKILSDRTHTSLVLTDNSFQVINSITWPRTRHWDFERVIEASKQMGEHELVQ
FT                   LHLDERDFYTARKPIFQDGMQAMHLFMMKEKGALTADVAMQVTEVVQVFMNLWGRNYVE
FT                   ISTAELMKAILNDESVKMRRLGKILNVDVSSIKWMWLVKTEEIRDNEQVLAELKSFVAS
FT                   HFQVSLIDLFEDNIVVLLDNSVAQRDRTHTANEFALMMKEHGIDLKITVCQGMEQTSDV
FT                   QSAYSLVNEYKNAANAIYANKSIYSLQEIDFAAKCVEIVDRGELAIAEQMRPLKSLEDN
FT                   DELIETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPATKIPESYNLYLA
FT                   VAIRRILGGNNNNK"
FT   CDS_pept        504890..506173
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0475"
FT                   /product="cytosine/purines/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /note="Purine-cytosine permease and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83177"
FT                   /protein_id="CAR83177.1"
FT                   /translation="MTEKKSVEQTQSWQSLAFVWTGAMICVPSLLVGGTLISGMPLWEA
FT                   ILIALLGYGVIVLFMIYQGIQSSDLGIPAVSVASQVFGEQGSKKIISILLAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPVSSLIWGVIMLLSAIYGIRILSILNYIAVPVLLFV
FT                   CIYGLVVSLNDGGLAIVENYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGVLMITVGAVLALTAGTADISVVFTNLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAVAGGLGTILAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVSGVNWLGVSSWLVGAVIAGIPVILTFFPELPQLPNQPLIG
FT                   IILSLAVYLIGAKVLSGKTNNVENLEGK"
FT   CDS_pept        506174..507274
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83178"
FT                   /protein_id="CAR83178.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKHGPIK
FT                   LLSPDEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYVGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPMVDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERLARVTTVEMGASSLVSLYPCNGAQIKQSSIKNIVTLSEEIGKVIRETSMD
FT                   EAEKLQKLLDVTHGYHLFEGKITDVVRETRAGFNFGRVKIDGLNKDTDSEVIVHFQNEN
FT                   LVAEKNGEPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMALPADDAWRTDKGIETV
FT                   GPRYFGYDVDFEPLEELVKKEERRHV"
FT   CDS_pept        507267..508817
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0477"
FT                   /product="hydantoinase/oxoprolinase family protein"
FT                   /note="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83179"
FT                   /protein_id="CAR83179.1"
FT                   /translation="MYKIGIDVGGTNTDAVILDENQQLIHSVKMPTSEDIETGITESLH
FT                   RVLSETGIDRSKVTHAMLGTTQCTNAIVERKKLAKVGVLRLGYPATASVLPYTAWPEDM
FT                   VGFLSGKYKLTGGGYEYDGQVLSEINEAEIRETLASWKGEVESVAVVGVFSSLKNDQEL
FT                   AVQKIIEEELGADIPVSISSSVGSVGLIERENATILNAALFKVIAATSDGFEKALEQEG
FT                   IEHAEIYLCQNDGTLMSLNYARQFPILTIACGPTNSIRGASYLAGLKDAMVLDVGGTTS
FT                   DIGVLTDGFPRESSLAVDVGGVRTNFRMPDIISIGLGGGSIVREKDGDITIGPDSVGYR
FT                   ISEEALVFGGKTMTTTDIAVRLGMAEIGNPELVAHIPTDFAEKAYKKIADMTEDAIDKM
FT                   KTSSGSVSLVLVGGGSVIIPDEISGVAQIFRDKNGPVANAIGASISQISGQYEQIYIYS
FT                   QIEREEALQDADQKAREQATLAGAVTDSIEVVEVEEIPLAYHPGNATRLRVKVVGNLV"
FT   CDS_pept        509445..510983
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0478"
FT                   /product="transcriptional regulator"
FT                   /note="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83180"
FT                   /protein_id="CAR83180.1"
FT                   /translation="MREYLDSKSQKKVALLEKIFYAENHTCTQEELLNELNITYPTLIS
FT                   TIKTINFDIERFGYKEFSIVHSAPNLSYTLKISDNCSIQLIINAYIRESPKFQILETLL
FT                   LSSFPNLQALAKKVHVSYSGIKKEIKELNEELSERNLYISTGNQVEITGDEFSLRIFYA
FT                   FLFLVAYSGDRWPFSFVRYDEITDLLESCPKEIYRADSIDKAMMIHYYVAMHLLRDRMN
FT                   CHIDTTRQFKVALYKACTEESKKSESAFIKKVAKQLPNRNYKEMTYTTQIILSTIVAFG
FT                   SYSSIEKMPSFFYMDEQLEEMGFMKLVDFASERVNDNLSIPFSEKEMELLRYSFASINY
FT                   RYFLLDNLINKFNNIVPGYTDLDRNIRKIHKVNHLEPLISQLVNLKEMDPLKPFEERLA
FT                   SDYLIILDKRIDFSIHTLPIKVTILSTISNETAVFDFMRYFSSYYNLEIINQVDPVVDL
FT                   YISDFSVSPEVLTSLRINQPIVYVNTRWLESDYVKINDNLAKIARKKFIANKKD"
FT   CDS_pept        511235..513304
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0479"
FT                   /product="F-box/LRR-repeat domain protein"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83181"
FT                   /protein_id="CAR83181.1"
FT                   /translation="MKKLSMRVILMVTVIFIAFGSANVSIAQELDTANKLPEEELGSLD
FT                   TSDVITEGVPQDKSAEVENLEEIPITDELVQNPDVLEQPIADSDDSDLTVVNSGDFWTI
FT                   YRNTVNGEYSLHMFGNVPSSKPTAWNSYLNRIKHIEIEEATLTGNFSSYFRNNVFTVLE
FT                   SVRIERSNLSRVTSFALAFYGSGIEKVIIRDNNYPTAPSLLTTEGMFKNCSNLMEVDLS
FT                   GLDTSAVTTMWDMFNSCRALEELDVSHFDTSSVTNMSYMFYDNRNLEVLDVSNLDTSSV
FT                   TNMYAMFEDCTSLEELDVSNFDTSSVTDMYRVFNGCEKLKKLDVSNFDTSSATAMVQMF
FT                   RNCSALEKLDVSNFNTSLVTDMRAMFAGCTSLEALDVSNFDTSSVTNMAAMFSDNEKLE
FT                   KLDLSTFDTSSVTNMGTMFKNCTALKSLFLDNFTHAASSTDMFTGTTSLSYLFVSHNVS
FT                   NFNGLENTNWYDEKNWVQFETLSQLQTYHRKQSEPTGYRKGAFLSLTMDAMGGQFEDAE
FT                   EQKVQNKFSGEYWEEVIPVKEGHYFDGWYLDQDCTNKFDFSLPANASITIYAKWIENYT
FT                   VIIPASISLNETSELKVEGINRGDKDLSVGLNRTAMSVSESNKLTLTNTADTTVQCLAP
FT                   LSWDGSETNPEKAILTLAPGSERTEGDAVMNIAIPENIQAGKYTGNLVFSIKYE"
FT   CDS_pept        513370..513843
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83182"
FT                   /protein_id="CAR83182.1"
FT                   /translation="MKKKKVVVISLLLLLVSVIGISSYFLFKDKINLLDVDPSAVEWNG
FT                   KKQKDTSGEENTIAIPGFEKVTLYANETKQAVNFHNPEINDCYFKISLIHPDGSVLWIS
FT                   DLIEPGKGMYSIELEKPLAVGEYENAVLKYECFSLNDQSPLNGSEINLKLVVV"
FT   CDS_pept        513863..514348
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83183"
FT                   /protein_id="CAR83183.1"
FT                   /translation="MNKLVLSTLSVAAMGMVFFSGGTAYAADKEGNTVVEYSVEGDYTL
FT                   VVPEKVNLSNDNATEMSVKTINRNLEPGKEVEVTLSSGLSADGEIELQRVGATSDVITS
FT                   SFKSNNSVVTMANPVIGSFSGYAMDETEVSKIQIGSPQGDKKAGAYQTTLTFTAAFK"
FT   CDS_pept        514376..514681
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0482"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83184"
FT                   /protein_id="CAR83184.1"
FT                   /translation="MKRKLVLAMVLISFCGMFFLSPDRVQASHTVVEVLISEDDLDVSE
FT                   ENVQEIPKKELAASSDKDNKQHTLPKAGDTVTNYTLLGLVLILIWLIMQRKRKKKE"
FT   CDS_pept        514757..515023
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0483"
FT                   /product="transposase OrfA, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83185"
FT                   /protein_id="CAR83185.1"
FT                   /translation="MARIEYGEEIQKSLLVLYSRGSTIDSICKEYGIPRYEFHKWMKLH
FT                   DSDKLETKEVETFLQIRELKQQKNKLEEEILFLNEAINLLESP"
FT   CDS_pept        complement(515103..516065)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0484"
FT                   /product="HD domain protein"
FT                   /note="HD superfamily phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83186"
FT                   /protein_id="CAR83186.1"
FT                   /translation="MKMTDPLYGTFEIEPVLAELIQSPLVSRLAHVHQGGSSYLVNPLW
FT                   DLSRLDHSIGVMLFIRKFGGSLEEQIAGLLHDVSHTAFSHVVDYALDFEEEDYHEQIFE
FT                   DFVKTSTIPAILEKYGYSFEGIFDDISKWKILEQEAPELCADRIDYTLQDLYRHGKISL
FT                   AEVEEFLQALVMVDGRLYLANIALAEWFVAQYYSEVIDYFYDPLNVYSYEILAEAMRIA
FT                   FQQETITNADLRLTDAELLAKLNANSDAWEKIQLLESPHLEENEVDFTYHHKKKMRLIN
FT                   PSVLVDGRLIPADELSGKVREMNDWASEKSKHGSYIKVT"
FT   CDS_pept        516186..516746
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83187"
FT                   /protein_id="CAR83187.1"
FT                   /translation="MAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLTWTYENDFFHCLADGITLENWDKHVLKMLESIKENADFYKNTVSADASIL
FT                   SFCFSKLTNSLFMDLFEKIDTNGAVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPET
FT                   IANQLFRLAKDTEFLANSMYREN"
FT   CDS_pept        516856..518556
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83188"
FT                   /protein_id="CAR83188.1"
FT                   /translation="MKNKKRTLVALTGAAIGTGIAAKKISEQKAAEKERAVDEAIKARY
FT                   YGDKQVYFVGGGIASLAGAVYLIRDANFDGKNIHIIEGMHILGGSNDGAGSVEHGFVCR
FT                   GGRMLNEETYENFWDLFSSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDA
FT                   HSMGFNNNDRMLMTKLLATPEEKLDNLTIRDWFDEHFFETNFWYMWQTTFAFQKWSSLF
FT                   EFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF
FT                   KDAPGITATALHLSDGSTIELGPDDDVIMTNACMTDSATLGDMNTPAPKPEEKPISGEL
FT                   WYKVAQKKPNLGNPEPFFGHEEETNWQSFTVTCHGDKLLKRIERFTGNIPGSGALMTFK
FT                   DSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCH
FT                   LNWQDDFEEIKADIINVIPCYMPYIDAQFEPRAMSDRPAVVPEGSTNFAMISQFVEIPK
FT                   DMVFTEEYSVRAARIAVYTLLDIDKKICPVTPHNRDPKVLAKATQTMFR"
FT   CDS_pept        518707..519810
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted Fe-S-cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83189"
FT                   /protein_id="CAR83189.1"
FT                   /translation="MEKSSIYGLTWTKLTEWLEAHGQKKFRATQVWDWLYRKRVKTFEE
FT                   MSNVPKETIELLTANFVMNTLEEQVVQESTDGTTKYLFKLSDGNLIETVMMKQEYGLSV
FT                   CVTTQVGCNIGCTFCASGLLKKSRDLTAGEIVEQIMNVQHYLDGRNLEERVSHVVVMGI
FT                   GEPFDNYDNVMDFLRVINHDKGLAIGARHITVSTSGLAPRIIDFANEDFQVNLAISLHA
FT                   PNNELRTSIMRINKTYSIEKLMEAIHYYVNKTNRRITFEYIMLKGVNDHKKEALELAAL
FT                   LGEHRHLAYVNLIPYNPVDEHIDYERSTKEDVLAFYDTLKKNGINCVIRREHGTDIDAA
FT                   CGQLRSKQIKRVGVRERMKQKQAAAEE"
FT   CDS_pept        519900..520379
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="DNA gyrase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83190"
FT                   /protein_id="CAR83190.1"
FT                   /translation="MEVEIVERNAFTAVGKKRTFSVENDAQKEKISQFWQEANTNGDAE
FT                   RINELAEFATIDGILGVCQMNGDKMDYYIAIESELTPPEDMEKLTIPASKWAIFKSVGP
FT                   LPNAIQKVWEYIYGEWFQTSNYTHGNAPELEVYTEGDTTAADYYSEVWIPVVEKD"
FT   CDS_pept        520537..520902
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83191"
FT                   /protein_id="CAR83191.1"
FT                   /translation="MIIVTNTIKVEKGAAEHVIRQFTGANGDGHPTKDIAEVEGFLGFE
FT                   LWHSKPEDKDYEEVVVTSKWESEEAQRNWVKSDSFKKAHGRTKDTREQREDRKGIVGNA
FT                   IARFEVVHVQNPVIVEK"
FT   CDS_pept        521032..521400
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83192"
FT                   /protein_id="CAR83192.1"
FT                   /translation="MDSNNEKLKQQLQTLQKQQKDAELSLYMLKHEQNERIWLEEDFER
FT                   ICHEEHESLELMRVVWQGDQARNFGYYLEDLQADEKNKWRQTFQAEEEKRQEKINTYQK
FT                   NIYQLESKQQDIQKELFQ"
FT   CDS_pept        521397..522770
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83193"
FT                   /protein_id="CAR83193.1"
FT                   /translation="MSRIDIEEIRDFAFQLRAANQTGRKIIQGIKTTVTNYIEDGSLKG
FT                   KAVESSKNYYQMTYIPLCDTIIEAMNESEERMKRYIQDFHNQVDPSPNAKIDADGLYEL
FT                   GQMIDRIESKKEALYQRMNSGTEGQMQTYRSQLATAYKQENILEKYLAFEQSHGAFFDH
FT                   LTDLVQGIQQTVRELQSNIQFDSQTGGYDLSKLNFATVNRMRKTLGKASATDTTIYDFA
FT                   AYSKVKQGGMWILSKDGKVDIKATEAYNTASFNGELPKDSNQATEEGELLKATLESLKQ
FT                   NKDPITGQEISKAQGFGILTSLVFGYTTKKYRGKKLSISKCELEKIKNASESALPKSSI
FT                   GIAQSRINIANGPTRFSSSDNAGFNHIVDRHFNPNRNAGQFTISQDKLKNILSSKETVE
FT                   IEVKEIPGNQFERIINIGETAGTIKPSIPENGGKPTNYIRILTDKAGNLITAYPIPKP"
FT   CDS_pept        522781..523248
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83194"
FT                   /protein_id="CAR83194.1"
FT                   /translation="MNEEIIDLYKKFDNNKLPLFFEKLILFINNHDKIFRKYILEDSLN
FT                   SIERFKESEFFLGTTDDNLEGLVLGYSETLIRADEKEICSNVIHMVWDIATFMTDELCP
FT                   SCQDANLKIASSTDRNNIYKTCDNCLITMENGQFIERPKEMIPATKEQINS"
FT   CDS_pept        523275..523880
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83195"
FT                   /protein_id="CAR83195.1"
FT                   /translation="MNVLFQFKNIHKKFLRNPKLNGSVNKKMDITKFKENDIPFSWNEL
FT                   KLGRFGFLDRDFYLQRIWNDEVVMKYILAYLTKNENEENPYLWELGSLFKPYDENEIFR
FT                   LLDLVAGSSENDLKSYYRWRWVLVNDLLNSIMDKGYVDALLEISEFWLDLKFPVDMPFQ
FT                   FQGVENQLTPQEFYTEEYLSKVVLSHKNWLAAEKERVR"
FT   CDS_pept        523959..524327
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83196"
FT                   /protein_id="CAR83196.1"
FT                   /translation="MEISYKVFEKKGFGKVPVIHFSGEQYTGLGDLLNIGFSSITLEDI
FT                   LDKINEIENGESEFEEIGTERSIVEIRKNECMIYDAFDGLLDDDELNPTINLPTLEFKK
FT                   IVRDWKVERDKLLSTIKK"
FT   CDS_pept        524433..525008
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0495"
FT                   /product="nitroreductase family protein"
FT                   /note="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83197"
FT                   /protein_id="CAR83197.1"
FT                   /translation="MIEKTIMERRSIKKANDAPISRETVNTILEQAAFAPFHSKVEPWN
FT                   VYVLHTLAEKERYIEKIIEFNEREQGVSFSEAEIADLKAGYAKKIITPPYLLIVTTNII
FT                   GHGKKDFESIGATSAFIQNIQLLGWEAGIGMIWRSNRFIFDAKFADDLGIPAEQKIVGT
FT                   LHLTSLAEVPEAKPRRPLNEWVKDLADL"
FT   CDS_pept        525073..525243
FT                   /transl_table=11
FT                   /gene="rpmF-1"
FT                   /locus_tag="lmo4a_0496"
FT                   /product="ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83198"
FT                   /protein_id="CAR83198.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHKGLTTPGLSRDSETGEYRMSHRISPD
FT                   GTYKGRTIIEK"
FT   CDS_pept        525335..526063
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0497"
FT                   /product="MutT/nudix family protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83199"
FT                   /protein_id="CAR83199.1"
FT                   /translation="MTEEFVNKEDALKNYNAKEFRTPDGYTSDMILTTVKELNEKPTLH
FT                   ILLIKRSLTNAEGKPNMEGGKWAVPGGFVDENESADQAAERELEEETSLTDIPLIPFGV
FT                   FDKPGRDPRGWIISRAFYAIVPPEALEKRAAGDDAADIGLFPMTEALELPLAFDHLDMI
FT                   KKAYSAITEEFLLTTAIRDFLPETFSAELLYQTLDGCTKPGILPDEVEFMENIEYLPYL
FT                   EKVGELYRFNADAEAGSIYF"
FT   CDS_pept        complement(526099..526992)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0498"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83200"
FT                   /protein_id="CAR83200.1"
FT                   /translation="MNLRQLYYFKKLAEKEHYTIAAAELSITQPSLSHSIAELERELGV
FT                   YLFEKQGRNIRLTKYGRFYLTYVEKSLAELEKGEKLLHELTSPSHGNIDLGFIYTMGAH
FT                   TVPELVQNFTKVESHKDITFSFFQGATKSIIPDLKNEKFDLAICSYVENEPDIEFLPLT
FT                   KQELVVVVAENHPLAKYDSIDLKDTADYSYIFFSDTSGLRPLIDSLFAEINIQPKIGCY
FT                   VEEDTAMVGLVSVDYGISIMPKISSLSHYNVKVLSINEPKHDRFIYLASLKNHYISPAS
FT                   KAFKDFALRYGEKHFL"
FT   CDS_pept        527190..529184
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0499"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /EC_number="1.6.-.-"
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83201"
FT                   /protein_id="CAR83201.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMNY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKKGGTVPRPLTVEEIYEIVNKYGDAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGTPENRARIVKLILEKVREEVGPFFPIVL
FT                   RFSADEFTEGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVATGQEDML
FT                   RKCISCNIGCADHRISKSKPIRCTVNPDIIHEDKYKETKVTRPTNVVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEASEQTGGLARAIANLPDKSRIADFPNYLANRAEKLTNLKVLTGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLHDVIDKEGSKVHSIFGLISNIDDFTEFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNNVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGKEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
FT   CDS_pept        529284..530159
FT                   /transl_table=11
FT                   /gene="aroE-1"
FT                   /locus_tag="lmo4a_0500"
FT                   /EC_number="1.1.1.25"
FT                   /note="Shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83202"
FT                   /protein_id="CAR83202.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGNDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
FT   CDS_pept        530225..530983
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="lmo4a_0501"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83203"
FT                   /protein_id="CAR83203.1"
FT                   /translation="MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVV
FT                   EWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVSDEFYFELNETL
FT                   ARTGKVDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLIRMEA
FT                   LGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
FT   CDS_pept        531080..531673
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0502"
FT                   /product="lipase/acylhydrolase family protein"
FT                   /note="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83204"
FT                   /protein_id="CAR83204.1"
FT                   /translation="MKKLLFLGDSVTDAGRDFENDRELGHGYVKMIAEQLEKEDVTVIN
FT                   RGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVIL
FT                   NRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNA
FT                   LAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK"
FT   CDS_pept        531859..532818
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="Permeases of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83205"
FT                   /protein_id="CAR83205.1"
FT                   /translation="MQKEKAPIGLYFLLIAVMASWGFNVTMTKVLVSYFPTVTMTSFRI
FT                   FTAAITVIIILFITKKLRLPTKREFGLIFLASIFNIVIHHFFLSNGLKLTTGTNAGLIL
FT                   GSAPIVVAIFSVVFLRERIGAWRALGFLAGIFGVSLVVLSNGTGISGISLGDIDIFIAM
FT                   ASQAFSFIIIKKLAGSMDTGLMTGYMLFLGSVMLFGLSRFMEPDGMSELVAVHSWKLWL
FT                   LFVVSAVVATAFGNFVYNYAVGKIGPSRSAIFMNFNPLFSLIGALLFLGEAIKIPQLVG
FT                   FVFIIIGVLLGSGALMDLIYERKKTKVRDPEKLLEKEV"
FT   CDS_pept        532893..533117
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83206"
FT                   /protein_id="CAR83206.1"
FT                   /translation="MKLLLKNINELAAKQKSEGLTAFEKERQAALRQEYLKKIRGTVQD
FT                   NLHHVTIIDPLGDDVTPKKLKEIQAELRG"
FT   CDS_pept        533284..533733
FT                   /transl_table=11
FT                   /gene="rpiB-2"
FT                   /locus_tag="lmo4a_0505"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="Ribose 5-phosphate isomerase RpiB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83207"
FT                   /protein_id="CAR83207.1"
FT                   /translation="MEIAIAADHGGFQLKEKIRAHLIESGYKVKDFGCYSVESVDFPEY
FT                   AAKVGHFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLC
FT                   LGERVLGDSLALLLLDTWLAAEFEGGRHMTRLGKLAELEEREGVE"
FT   CDS_pept        533730..534398
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0506"
FT                   /product="ribulose-phosphate 3-epimerase family protein"
FT                   /EC_number="5.1.3.1"
FT                   /note="Pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83208"
FT                   /protein_id="CAR83208.1"
FT                   /translation="MKMIAASIMCADSLHLADELRALEQANVKMLHCDVMDGVFVENAA
FT                   MGAYVLQDIKNNTDMLLDIHLATVNPDKFVDLYAAIKPAYMSFHVEASPDVDATINHIR
FT                   ALGIKPSIAISPDTEIEQIYPFLEKVDMVLMMTVNPGFAGQKFQHHVLEKIKKLQKELE
FT                   SHTNKPLIEVDGNIFEETVRLLEPIGADVYVVGTAALFNDKAGSYTEKLAPLREIIQER
FT                   "
FT   CDS_pept        534405..535055
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0507"
FT                   /product="transaldolase, putative"
FT                   /EC_number="2.2.1.2"
FT                   /note="Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83209"
FT                   /protein_id="CAR83209.1"
FT                   /translation="MHLDSANLEDVKKIQTSSIFKGITTNPTILVKEKCNRQTAIKRIL
FT                   EHTDKQVFVQTVGFSYEEILADARMLLAMFGKEKIAIKIPAHEAGINVIDTLKKEDKTI
FT                   QILGTAIYSADQAIAAALAGADFVAPYVNRMSAANIDPFKEIAGMRHFFDKKALKTQIM
FT                   AASFKHSGQVMQAYESGADTVTIPYEIYLQMTNKVLAVEAIRVFNKDATLYEK"
FT   CDS_pept        535164..537224
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0508"
FT                   /note="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83210"
FT                   /protein_id="CAR83210.1"
FT                   /translation="MYLDNRSKTLFQEVIKNPNITNKQLEVKYKLSRYQISYSFQKVNE
FT                   WLKWKNYPEVKRSKNGRFILEPELTALFSEKETRDPSVEYLPSENERANLILLMLLTAK
FT                   EELSLAHFTTKIQVSKNTILRDLKVAQKLLPKETTVTYSRASGYQLAGSEWELRKVLTQ
FT                   VVSSVKEMFRGEHYFLSYSGIEKVQLMEIRRTLEEAEAMMQIKFTYEQIELLPYLLSVM
FT                   FLRIRDRRLIDTAFHIDEKSLSDTREYHITDILLEKTGPVPEQERLFITLQLLTTNIFS
FT                   GEILTEKLTEDLEKVVLTCLDLFEKKALVSLKNKHILIEKLLLHLKPAYYRIKYQMNLE
FT                   DTLYEKFNQEFEALNFIVKEAFDPLAKFIGREIPAGEIFFISLFIGSDMIPQNDIYHKQ
FT                   KRAIVLCPSGVTFSKIMENILVKLFPEIHFYPTISVREYTFFKAEVDIVFSSIPLKDGE
FT                   NVFVVQPFMNDIEKTQLRQHVLQNLFGMGNQLTSIDKIMEVVERNADINDSNAIRDGII
FT                   DILSANTATDENKRVKKVYLHDLITEDNIMICEDVKNYQEAIRLASQPLLLQQAITANY
FT                   VKTMIDNHKFHDPYIIIGEDIAIPHAMPNAGVNRLAMSLLVVKNGVYFSETEQVHFVIV
FT                   IAPVDKEQHIEALYQIVHLAENHQILDDLLENVTKEKIMQTINQLVIREDE"
FT   CDS_pept        537228..537830
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0509"
FT                   /product="SIS domain protein"
FT                   /note="Predicted sugar phosphate isomerase involved in
FT                   capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83211"
FT                   /protein_id="CAR83211.1"
FT                   /translation="MDKQAILDNIHQTWQEEANAISRLPEVTSEEALVKTVETIAECTG
FT                   KIVVAGCGTSGVAAKKLVHSFNCIERPAVFLTPSDAVHGTLGVLQKEDILILISKGGNT
FT                   GELLNLIPACKTKGSTLIGATENPDSVIAKEADIFFPVSVSKEPDPFNMLATASTMAVI
FT                   ASFDAVIVCLMTYMNYTKEQFSVIHPGGAVGNKLLNK"
FT   CDS_pept        537858..538325
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0510"
FT                   /product="PTS system, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Mannitol/fructose-specific phosphotransferase
FT                   system, IIA domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83212"
FT                   /protein_id="CAR83212.1"
FT                   /translation="MDVLEYFKEEMVRFSNEQDKEKLLTEMAEQLCEVGAVKPSYKDAV
FT                   IKREKVFPTGLLTAHAGVAIPHTDSEHVIRPVVAVRILKKPVSFIEMASDNEAIDVRIV
FT                   FMMALRSADEQLDMLQTLIQLIQDEEVMTTLLKAQETGDVLSAIEHFSKNN"
FT   CDS_pept        538342..538740
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83213"
FT                   /protein_id="CAR83213.1"
FT                   /translation="MGSFFASFVDWLIGSPGRFVVNLIEDNMLIFMFVVMIYATTILYA
FT                   KWTLAYYLPKKMNQLAEMKTWELDELYAAWQTEKKALPWYILVPSRNEFWVKSARNAPE
FT                   STKLLHFSQQKLKLSDKEKLQKIIEIQS"
FT   CDS_pept        538751..539401
FT                   /transl_table=11
FT                   /gene="rpe-1"
FT                   /locus_tag="lmo4a_0512"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="Pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83214"
FT                   /protein_id="CAR83214.1"
FT                   /translation="MAKIVPSVFGADIGRINEQLEVLEKNGIDLLHVDMMDGSFVPNIA
FT                   FGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIK
FT                   SYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIG
FT                   NRPIQIEVDGGVNAELAKECTLAGADLIVVGSYLFEGDIEANLEKLSKGVLTE"
FT   CDS_pept        539398..540444
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0513"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /EC_number="1.1.1.14"
FT                   /note="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83215"
FT                   /protein_id="CAR83215.1"
FT                   /translation="MKALKLYGKRDLRYEEADMPTIEQPDDVILKVKTVGICGSDISRY
FT                   SKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCR
FT                   KLTVIGARHPGAYAEYIKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDD
FT                   VVVVGSGNIGLLAIQWAKVFGARRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVA
FT                   AHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSEL
FT                   TVWGSWNAISAPFPGKEWQTTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFF
FT                   GKVLFFPE"
FT   CDS_pept        540460..540753
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0514"
FT                   /product="PTS system, galactitol-specific, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83216"
FT                   /protein_id="CAR83216.1"
FT                   /translation="MKKKKIYVCCGTGIATSTVISKKVRAVLDEKRIPYEISQCTVQEV
FT                   ASKVSTSKPDIIVSSTTVTGDVGDVPVVIGRSFLTGLKKQETIDEILAILQD"
FT   CDS_pept        540768..542039
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0515"
FT                   /product="PTS system, galactitol-specific, IIC component"
FT                   /note="Phosphotransferase system, galactitol-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83217"
FT                   /protein_id="CAR83217.1"
FT                   /translation="MDIILDFFKYIIGLGVTVMMPIIITILGVIFRKKISVAFKAGLTV
FT                   GVGFVGLGVITSLMLTTITPVTKALVENYNFKLTATDIGWGVGSSLAWGTEVVPFVFVA
FT                   IIATNILMIAFKWTKTMDVDIWNYWQPLFIASALYLTTGSMIIAILSSIINMAIIFKIA
FT                   DWTQKDVENVLGLEGISLPQIQTTGWALVGYPMNWLLGKIPGVRKINWSTEKVQSRLGI
FT                   FGEPMLMGLIIGGGLAAIAQMPLSQVLQTGVTIAASLVLIPRMVSLLMDGLTVISEAAH
FT                   EFMEKRFPGRELFIGLDSAVGIGHPFVLSLGLLMIPITLILAFILPGNKVLPLADLTAL
FT                   PFYMIFAIVPSKGNLFRGIFTGIVIVIITLYLSGAAAPLMTELAGQIGYNIPKDAVEVT
FT                   SLAVGTQWYTWIVYYGLHWFGGIL"
FT   CDS_pept        542179..543114
FT                   /transl_table=11
FT                   /gene="prs-2"
FT                   /locus_tag="lmo4a_0516"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83218"
FT                   /protein_id="CAR83218.1"
FT                   /translation="MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINI
FT                   EESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARS
FT                   REPITAKLMANLIQRAGADRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLIENYGEK
FT                   DVVVVAPDHSGVVRARRIADRLNAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDII
FT                   DTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQNSNIKEVITSDSIDLPEDKQ
FT                   FDKLTTISIGRILGRAIEGVQENRSLHPLF"
FT   CDS_pept        complement(543846..544487)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0517"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83219"
FT                   /protein_id="CAR83219.1"
FT                   /translation="MKKFVTAMLFLTFLLLVGCSAQNEKAAPPSEKEVKVTKETKISKN
FT                   GSIDADYDIPEDSKELENKSEDIVKVKLVKNKKIGDYDKEKMEYSSTISEVEVLETYKG
FT                   TFKKGDKIDVSEPWYLNEGAYESIENYIALEQEQEYTLFLRGGHDSEKLSSIISMGYGK
FT                   FNEDLKETDATLTDFENLGEVEAYNFISEEQEEVTNYTEIKEDVLKEFND"
FT   CDS_pept        complement(544498..545034)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83220"
FT                   /protein_id="CAR83220.1"
FT                   /translation="MKQSKKSWKVMAAIVIILSITFTTTLTSNAADLRNGSAFSFKLSD
FT                   PKGKFNNGATISAHKKAFDTAYAKINASSSRIKLVRSGSGPTIRTRSTNKRDEWYGQMS
FT                   GNSKGSTITINKYTTTRDKFNQANYNKTALHEMGHAFGMKHQSSSSITVMKQGKYAYND
FT                   YTTLDKNNIKYKYGK"
FT   CDS_pept        545240..545938
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0519"
FT                   /product="glutamine amidotransferase, class I"
FT                   /EC_number="6.3.5.2"
FT                   /note="GMP synthase - Glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83221"
FT                   /protein_id="CAR83221.1"
FT                   /translation="MTGADKLIIDVLQHVPHEGPGLIANWARENQHQLKIHSLFEENAH
FT                   VPNDSDFLIVLGGPMGINDTAEFPWLKDERKLIKRLSEQHKPVFGVCLGAQQIAATFGS
FT                   EITVNKEKEVGWFPVKSTSDKLSFFPESLNVFHWHQDTFALPAGATRLFASEGCLNQAF
FT                   LYGENIIGLQFHFEMEKAGIETILQIDEAFITSGKYVQSVEVMREKDVPEDNKQMLEAI
FT                   LDYLINPKTI"
FT   CDS_pept        complement(545963..546325)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83222"
FT                   /protein_id="CAR83222.1"
FT                   /translation="MMEQILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQGLL
FT                   PDGDLQNMVVNIKLALPCDADKLDEDAIRAIIPYGTVTIEKIAGGMMTTSGIFLEDKED
FT                   KNDLMYIVNASVETGY"
FT   CDS_pept        complement(546329..546787)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0521"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83223"
FT                   /protein_id="CAR83223.1"
FT                   /translation="MNNEQNMNQQIALFYFGYKAFTETADLIIAKHSLKRLHHRILFFT
FT                   ARMPGLTINELLTFLEISKQALHQPLAELKERELLTIEQGRRDKRQRCIFLTTAGKELE
FT                   NELGAAQRKQMAEIFANSSDTDGLHFTEVMEGYAKNRPGAALIKDFKE"
FT   CDS_pept        547168..549009
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0522"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83224"
FT                   /protein_id="CAR83224.1"
FT                   /translation="MKKVLKIFLVTICMFIMIYPSTAAHAEETSDVVNIPDDNLKAYLN
FT                   GQLKQSGVAPITKKQLATITNVTLSGTSYTDLTGLEEADNLVTLSLNNTNIKTLEPIKN
FT                   QTSLTYITVSGDNVKDSLFVDLNGLVNLQSLSISGSEVTHNVFKMFNKLPKLTYLYAQN
FT                   SMKITDISELASLPALTTLFLQFDGIDDFRPLNDFESFKNGNLKALAAFGQNTGRTNPR
FT                   ITLKSGKLDYNEANQTLYLPFSMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSS
FT                   RLSITDDGITVSGVTKEEFDNLNEIEYNARYDFPTGSYPTPPSMNSYTISSGTYDQYFD
FT                   ISHTLDLTADESFDYNQYDATSEEQFLKDIHAETDDGTAVQSDFDQVVKLDVPGEYTVT
FT                   LNAENAAGLKATPVTVKVTVHEKPVITADSQISYKKESTKSVDEFLQEIHSSVTGNAVL
FT                   TSDFDKVVDLNTPGEYTVTLHATNDRGQQADPVTVIVTVTASDGGHVNPIPPTPEVKPT
FT                   PQEETDPTIIPEPQSENSEDQVKENNTKTEEKANKTSLTTKENKVEKADKAEKAEKANQ
FT                   AKTKALPQTGDTNKNGLPIAGVMLSLAALLIIRKSKS"
FT   CDS_pept        549107..549541
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0523"
FT                   /product="universal stress protein family"
FT                   /note="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83225"
FT                   /protein_id="CAR83225.1"
FT                   /translation="MMEKYHRILVAVDGSEPAKLAFEKGLELALKLDGVLGIASIVDLR
FT                   AFSPNVSYDGSLEEKAELELKTSVNEYAEKARTAGVKQVETFVAKGNPKILLSTDIPAE
FT                   FQADLIICGATGMNRVEKLVLGSVSSYIMAHAICDTLIAR"
FT   CDS_pept        complement(549588..551018)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0524"
FT                   /product="CapA domain protein"
FT                   /note="Putative enzyme of poly-gamma-glutamate biosynthesis
FT                   (capsule formation)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83226"
FT                   /protein_id="CAR83226.1"
FT                   /translation="MKKLTYIIITGLVLVFIVGAFWITNSTNKTEQKATPTETPKKAKP
FT                   ANVKTISSQAKKTLNSLASSGADKASISDLNQLIKELKSYQVEKNDSGTYLQNLTACLE
FT                   AVKSYTTGKADEKALGKVYPDFLASEQKLSAIEKTSQYDWFYAAAATNQQGLKEKGVVT
FT                   LTMVGDNSFGTYPETPEHLKFDNVFKKNNGNNTYVFKNCLPWFKSDDYTVINAESAFTN
FT                   ATKAENKMWRIKSDPAHVAFLPASGVDAANLANNHTMDYFQVGYDETLKAFKDNNIPVF
FT                   NADAPLETTIKGMKTVLLGYDCRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEY
FT                   RETPTDYQTQFGHAILDAGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLS
FT                   RMTSMFQLRFTQEDNKIVLKDISIVPTYENSDGSTTENNYQPLPVFGDDAKKIVDELNR
FT                   ISKPIEGGVTEYTYFDPF"
FT   CDS_pept        complement(551139..551954)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0525"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.1"
FT                   /note="Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83227"
FT                   /protein_id="CAR83227.1"
FT                   /translation="MKKNIFKLLMALCAVLLIAGCGNSTSADKKETKETKEDGTVTFYV
FT                   VRHGKTMLNTTDRVQGWSDAVLTPAGEEVVKSAGKGLKDVDFSAAYSSDSGRAIQTANL
FT                   ILKESDKSADKEVQTDQRFREFNFGSYEGDLNENMWTDIAKSQGKTLEEWQKAGISPKG
FT                   FADSVAALDKTRVKEGENWPAEDYATIQARLKEGLTDVAKKESKNGDSNVLLVSHGLSI
FT                   GALLDTIEPGYKLPAEGIKNASVTKITYKDGKFTIGDVNDLSYVEKGSK"
FT   CDS_pept        552307..553029
FT                   /transl_table=11
FT                   /gene="cas6"
FT                   /locus_tag="lmo4a_0526"
FT                   /product="CRISPR-associated protein"
FT                   /note="Uncharacterized protein predicted to be involved in
FT                   DNA repair (RAMP superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83228"
FT                   /protein_id="CAR83228.1"
FT                   /translation="MRLKINCDFDSKIIPKDFQSKVVSLFKAGIMKSSPERYENLFGGN
FT                   KHKQYTFSVYLPKPQNKGAEIQLNEANCIINFSTGDAETGIIFYNALMSLRGSKVLFGA
FT                   GNHITVKNIQIVPEKKIIGKRTVLRTLSPVVSRDHNRETFKNWFYSFEDEEFEPTLKRN
FT                   MLPYLIDAFGEQARYDLEKLKITPISMKKVVVYCHEIHIESSVGIFELEAEAYLQKYLV
FT                   ENGLGTMTGSGFGMIEQL"
FT   CDS_pept        553045..554733
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0527"
FT                   /product="CRISPR-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83229"
FT                   /protein_id="CAR83229.1"
FT                   /translation="MQTEIELRADDWLINAGLVGFLNIVGKENVRINGQSIYFKADLLV
FT                   GFEDKYFNFFIQEYKETLAWFKIVSYKDTMERFRAEDFASFDEKALNDLNKYMKDVVKF
FT                   YLKKSNYIKVFSLIDAKANVTKWLENLNAINLTKKQQWEDVKVDIVEKVKRNYIQLDFI
FT                   IDFCLGEKGLKYLGAKNLIYSVINKGWTGTSFLYTKTKFADPYLDYKTSFLDPVLDYVD
FT                   SDLSKAKYNCFNCNLPIKNLKTGLSFMNDIGFDIEKKTSHVWDFNNDVATCPICRLIYS
FT                   CVPAGFTYVYGEGMFVNDSYGVEELHRVNERMRNSILRFNQDGINSTNTYRALVESITM
FT                   EHENNRRYELADIQLVRYENEHYRFNLLSKKMLHIVNDSKGILKSLIRCGYKEGNLNVN
FT                   LYKEVIQHLMNNENLFTLIHKLIYYKQTSVNGLYYNMGHVSGILDINTKFLKEMEVMTN
FT                   ISQNQLWFVQNCGKEFKEGYVKKKSENKISGITYKLLNSLKVNDKDGFMDTLLNSYSYL
FT                   SMPIPDVFIKMFSNNEAFKSVGYAFMLGVGGEKTKKENGGNTDEK"
FT   CDS_pept        554723..555592
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0528"
FT                   /product="CRISPR-associated negative autoregulator, DevR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83230"
FT                   /protein_id="CAR83230.1"
FT                   /translation="MKNKGLAMTIIFQAESANYGESLGNISSLKKISRNNGDQYTYISR
FT                   QAIRYNLMDQIGEKEAPVKAEGGGDKKVIQFLSEATITDFPELDFFGYLKTEKGSGGQK
FT                   RSAKVRLSNAISLETFKGDLDFLTNKGQADKLNENMNIAQAEIHKSYYRYTITIDLDQI
FT                   GIDGEIALDNKEKARRVKKLMDTVAFLYRDIRGRREDLKPLFVIGGVYDVKNPVFQNIV
FT                   DVADNNIVIKNIKDLLTYEDIKENTRVGIIDGQFANSDEVKAELKAESVPAFFNDIKGK
FT                   IDAYYESN"
FT   CDS_pept        555570..556202
FT                   /transl_table=11
FT                   /gene="cas5"
FT                   /locus_tag="lmo4a_0529"
FT                   /product="CRISPR-associated protein"
FT                   /note="Uncharacterized protein predicted to be involved in
FT                   DNA repair (RAMP superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83231"
FT                   /protein_id="CAR83231.1"
FT                   /translation="MLIMKAIRVKLWQDLVNFKKPTSFQLKETYPLPPYSTVIGMVHTL
FT                   CGFTSYHEMKISIQGKYFSKVNDLATRYEFKNGMTYDASRHQIKVDKYGVSRGVSTVEL
FT                   IVDLELLLHIIPEDSSLVPIIEKAFSEPIEFPSLGRREDIATIQKVDIVDVEKRQPSKS
FT                   TEISDGYNAYVPISLTENNSIHFKSHESSVGRDKLLGTRYLLTEKYE"
FT   CDS_pept        556420..558603
FT                   /transl_table=11
FT                   /gene="cas3"
FT                   /locus_tag="lmo4a_0530"
FT                   /product="CRISPR-associated helicase"
FT                   /note="Transcription-repair coupling factor (superfamily II
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83232"
FT                   /protein_id="CAR83232.1"
FT                   /translation="MHKYLAKSNPEETIQEHTDNLLKNYQRLKKLYPAVEIDWYLLELV
FT                   CLLHDLGKMNLLFQTKLGNASGKGKEIPHGYLSVAFVPDSKLEEMGYSEDEIKVVYQAV
FT                   ARHHERKYDFSDSEWKNEIIRLEEQWEGFNYSQLGENAEYSSEVEMLYFYPGSRIFEGN
FT                   SVADTETFKKYVLLKGLLNRIDFAASGGIDVELENDFLIDSMDVQLAHFKAENPEADWN
FT                   ALQKYMMQHQNENIVVIAETGMGKTEAGLLWLGNNKGFFTLPLRAAINAIYERITKNIV
FT                   TTNQAERVGLLHSETYSQYLLHEGNAEMDIDEYYTRTRQMSLPITICTLDQLFDFVFRY
FT                   AGFEHKLATLSYSKVIIDEIQMYSPDLLAYLILGLSYIDKFGGKFCIMTATLPGIVTDL
FT                   LLENGVDFVQPEEKFVSSRIRHSMEMVHTEIESEFIKPFFNNNRILVICNTISKAKKIY
FT                   SELKDHFQGEEIHLIHSQFIKRDRSAKEKAIFKDGQKDSTKKCIWVATQVVEASLDIDF
FT                   DLLFTELSDVNGLFQRMGRCYRNRALDVDTNVYVFDGGAKVCSGVGIFIDKLIFENSKA
FT                   ILNEHAGVLTEEKKMELVEQVYSAEALRGSEFYNDLIGTINYVKAFDSYELDKAEVRMR
FT                   FRNINSVSVIPEEVWQDNVEEINSYFVTLRKTSKEISTKEKMIARTNLAEFMVSVPDYL
FT                   YKKGESVVREINRYESVIEFKCGYSSDVGVFMR"
FT   CDS_pept        558659..558901
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="lmo4a_0531"
FT                   /product="CRISPR-associated helicase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83233"
FT                   /protein_id="CAR83233.1"
FT                   /translation="MLNKNIITEDDFEKEANFCYMKKAARQKVLQAYDLRMKETIKHRD
FT                   LGRNVSYRHLIRLECYKLVKHLMNDKEYEAFKIWW"
FT   CDS_pept        558864..559184
FT                   /transl_table=11
FT                   /gene="cas2"
FT                   /locus_tag="lmo4a_0532"
FT                   /product="CRISPR-associated helicase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83234"
FT                   /protein_id="CAR83234.1"
FT                   /translation="MIKNTKHLKFGGEDMYVILIYDISIENGGAKVWRNVFKICKKYLT
FT                   HVQKSVFEGEITPALLVKLRMELDKYIRDDQDSVIVFSSRQQRWLEKEFWGLTDEKTSN
FT                   FF"
FT   CDS_pept        complement(561235..561603)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0533"
FT                   /product="membrane protein, putative"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83235"
FT                   /protein_id="CAR83235.1"
FT                   /translation="MAILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLAN
FT                   KKVQTLFANQGLYNGFLAAGLVWGLFFAGAEFAETVQIFFLSCVVVAALFGGATSSKGI
FT                   LVKQGLPAVLALVAVLLV"
FT   CDS_pept        561750..563165
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0534"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83236"
FT                   /protein_id="CAR83236.1"
FT                   /translation="MQQEATGGQKIRPIPIIASFLMAGFIGLFSETALNMALSDLIQVF
FT                   DISSATVQWLTTGYLLTLGILVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFA
FT                   MLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLIL
FT                   ENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTKPKIDILSIILSTLGFGGVVFAFSS
FT                   AGENGWGSATVLVSIIVGGLALGLFVWRQLTMEKPLMDLKVFKYPMFTLGLILVFISFM
FT                   MILSTMILLPLYLQNSLALAAFSAGLVLLPGGVLNGLMSPFTGRLFDAYGPRALVIPGF
FT                   IVAVVALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAI
FT                   MNTLQQVSGAIGTAVAITIMSAGQKAYMETAQGVGPEQMVASLTAGIQNAFVFGLIMAC
FT                   IGLLCSLFIRKAK"
FT   CDS_pept        563294..564301
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0535"
FT                   /product="ROK family protein"
FT                   /note="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83237"
FT                   /protein_id="CAR83237.1"
FT                   /translation="MMAIPRDLKELNKKNIKSILRQQGAMTKAEIAEVTGLSVVTVNKL
FT                   IRDLVENEEILEQDNSVATGGRRAVSYEINPNFQQVLVISLQEKWKKITYSFSVYNLLG
FT                   EPEFVEDMSGEDLDITALKRNTKDLVCAFPKISCVVIGVPGIEIGGKLRAMDFPLLLNV
FT                   QLRETLEAEVNLPVLVETDTNAAILGYKNRPVKEENIVGLYYPERFPPGAGLLMNGEIL
FT                   KGQNGLAGEIKHMPLQVDWDNFDFSVDEIKAHIRKMVLLTMSFYDPETIVLYTNFYFGQ
FT                   KDFTEELTEELKQVYPYAVLPEIVLSRKFTTDYRIGLLAFGIDYLENNMTDWRI"
FT   CDS_pept        complement(564333..565649)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0536"
FT                   /product="glycosyl hydrolase, family 4"
FT                   /EC_number="3.2.1.-"
FT                   /note="Alpha-galactosidases/6-phospho-beta-glucosidases,
FT                   family 4 of glycosyl hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83238"
FT                   /protein_id="CAR83238.1"
FT                   /translation="MTKGIKIATIGGGSSYTPELIEGFIKRQDELPVRELWLVDVEAGR
FT                   EKLEIVGNLAKRMVEKAGVDMEVHLTLDREEALKGADFVTTQLRVGLLDARVKDERIPN
FT                   SYGVVGQETNGPGGMFKGLRTIPVILDICKDMERLCPDAWLINFANPAGMVTEAVLRYS
FT                   NQKKVVGLCNGPIGIERNIAETLGVDVSEIYVEFVGLNHMVFAKTVYHNGKDVTKDVVF
FT                   KMTEDEAGSSLKNINATGWDKTFLRTLNMIPIDYLRYYWQTKQQLEDQARAYAEHGTRA
FT                   EVVKKVEAELFELYKQEELAEKPKQLEQRGGAYYSEAACNLINSIYNDKRDIQIVNTRN
FT                   NGAILDIDPDSAVETNCVITRQGPIPLASGRLPIAINGIIQEIKTFERLTAEAAVTGDY
FT                   DKALLAMTINPLTPSESVAREMLDELLEAHKEYLPNFFK"
FT   CDS_pept        565851..566603
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0537"
FT                   /product="SIS domain protein"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83239"
FT                   /protein_id="CAR83239.1"
FT                   /translation="MLFLDKNLELNDTELDIYNYIVANLDKVVYMRIRDLATEAHVSTT
FT                   TILRFCRKFGCNGFSEFRVKLQLYLEEQKLAQIDMADETTYIDFLKRTAQPEFKAQIQN
FT                   AVEILRDRELVLFAGVGSSGVIAEYGAIYFSSLFTLALHIEDPLNHPFYHLSSKLSDKI
FT                   CMIAISVEGENEDIIRYIHQLKAQNCKVISITNSAKSTIARLSDANIAYYINKEMYQEA
FT                   NITSQLPALYTIENIAREIRTQLDKEKM"
FT   CDS_pept        566711..567154
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83240"
FT                   /protein_id="CAR83240.1"
FT                   /translation="MYSNMKEKVVFTLIMCSLMILCMSSYNIFLENGIGTDSLLIVLKA
FT                   FVPFLFIGFLLDFFVVGKIVYRLHALLVSEDASKFKKIIMMQLLMVTFMCVLMSTLSLI
FT                   VNQGEWSHLGFLILRNYFVALFLQIFIVSPFVRLISPRIFALL"
FT   CDS_pept        complement(567200..568861)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0539"
FT                   /product="sulfate transporter family protein"
FT                   /note="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83241"
FT                   /protein_id="CAR83241.1"
FT                   /translation="MFKHILLSLNGYKISYLRNDVISGVGVAALTIPVAMGYAQVAGLP
FT                   PIYGLYASFLPVIAYVIFASSPQLIFGIDATASAITGSIILGTAGLAAGSKEAIALAPI
FT                   LAFFCAIFLVLFSVLKLGRFAKYISAPVLSGFISGLSVSIIMGQIPKIMGLKESGDSFF
FT                   SSLGIIFGQFFQSNWISFAMGVVTVIIVITCKKVIPKIPMSLVVLILGTMAAYFFRLDQ
FT                   YNVDIVGKIPVGFPSLALPDFGASSWALAIGGGLVCAIATFAGSLLPSESFAMRNKYTI
FT                   DDNRELFAYGISNFVAAFSGCSPASASVSRTAANEQFRGKTQMVSIVAATIIALIVAFL
FT                   SGLLYYMPQPVLSGIVFAALVGIIDVDVLKGLFKVSRREATVWIVAALGTLLVGVIFGV
FT                   LLGIFLSFINVVSRSMKSPIAILGVIEGRHGYFDLKRKPEAKPIPNVVIYRYSASLFFG
FT                   NFNKFADGLKEAVQDDTKLVIFEASAIINIDTTATESMKDLLKWLDDKGIEYYFADLID
FT                   HLKTSFRKHDLGYIIDNGYTKKTVEDALDAYHAEHK"
FT   CDS_pept        complement(569000..569740)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0540"
FT                   /product="transcriptional activator,TipA family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83242"
FT                   /protein_id="CAR83242.1"
FT                   /translation="MQIKDLAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSENDVD
FT                   KLQQILFFKELDFPLKKIKQILDDPFFDKNVALDLQRHLLIEKKQRIETMLATLDQTIR
FT                   NEKGEITMTNKEKFTGFDFSTNPYEEEAKKRWGDKVVEKANEKVNNMSEKEKLTLKESF
FT                   DAEFRHLASVRELAPESEEAQLAIDHFFHYLNDTHGNIYSLEAFAGLGEMYVADERFTK
FT                   NIDQFGDGLSHFLKEAMNIYAKTK"
FT   CDS_pept        569980..571455
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0541"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83243"
FT                   /protein_id="CAR83243.1"
FT                   /translation="MKGKIKSSSMWLWHHLTPQIFAVICVFIITLIALFVPPYIGMADN
FT                   GDFFRIFSSNGLFVNNTNYDALQFGHFVKEFGIYQYFNENQVAIYSSQSIFIQMALLLN
FT                   KLFWSTTVFDVRFLGGLQLALLLPAIYLLVAGLTAKMKGWPGYVVAALTVFIFADTAYT
FT                   AYFNSFFSEGLILIMMLYISAGFLLLYQHKYNDYAMLGLIFVASLILITAKQQNAPIAV
FT                   VIAVCGILVFFIRKNRAFRISAAATFFVIFLSGVVMYAFIPGEFVTINQYQTMTRGVLL
FT                   DSENPEKSLEEMGMNSEFALLKGTNFYQKYKMIDLDSKLMEKEFYPNYNFVTVLSYYLE
FT                   NPKQFGKMLDLSAQNSFSIRPFEMGNFEKATGYKFKEKTHFFSIYSDVKEKLAPAKFTF
FT                   LILWALVFLICYGVSAFKHFREKNIRGMLLFDLVVLLIGSGFAVILVTIVGDGEADLTK
FT                   HNFLFNVCFDLTMLIGAASLLEVYLKKRGERNA"
FT   CDS_pept        571448..572944
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83244"
FT                   /protein_id="CAR83244.1"
FT                   /translation="MRKKMIVSILLAFVIFVVGEHSVIAKSDDGVVVFYDSLATGTENE
FT                   GNMDALLRMLNSLGKRVTIYSWEENPDLSQTSEIIVLQNKKDGLSNEWTNKLAKSKAKI
FT                   AYIGGNPPTFITDKLELKTKVMTDASITIQTAAGLSGKPQLVNETNLITSYKGTSFGEM
FT                   DAAENGQAAYGIQAGNYAYAPIFQADNTSEFALMDVLKALFDIKTTTNQYAFITGVNPF
FT                   IDFDLLKKTADTFYEKGIPFIVSAGPVFYNQDFQAAKNYAEILRYVQAKNGTIMMNVPA
FT                   VTYGDSPAGELERIMQKSVHFFAENDVAPLGVTAELYWNFDKVYGVEGFAPFNTGILLP
FT                   NQKIIHTTKVNNGSAFEKSPYSVANDLYATTTEGRNFPIDIAITYSFFDNEKELKAAAE
FT                   ELANDNISDFRFQDHEVKTNKDTIESSAGSLYINNQSVTLDDDLNYIKTKNKTVKQAGS
FT                   LEGFFGYQNTFFTIVIVLSLGIIGVLFVFGYRLYMKKYMK"
FT   CDS_pept        572955..574205
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0543"
FT                   /product="glycosyl transferase, family 2"
FT                   /EC_number="2.4.1.-"
FT                   /note="Glycosyltransferases, probably involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83245"
FT                   /protein_id="CAR83245.1"
FT                   /translation="MVVADYLALFAVVCIWGLLLINIVLIVAGYVYYLKNEARKVPEIP
FT                   AEVPFVSVMVPAHNEGKVIVKTVESLLAFDYPVDRYEIIVINDNSSDNSAELLAAIQAK
FT                   NPTRFLKIINTDNITGGKGKSNALNIGFAESRGELVAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRDASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEEIGGWDVKAVAEDTEISFRIYMMGYRIKFQAKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDVLLVLYALGLVHTTLAG
FT                   LSGALWLLAILLFIAGTFITLTTEKGEISFSNLLFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTVLKRETKWYKTERF"
FT   CDS_pept        574221..576272
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83246"
FT                   /protein_id="CAR83246.1"
FT                   /translation="MKKLTVIGLLIFAVLFLYRPDVLAADKNYQTVFGTDKTAQGKFTT
FT                   TKQNFTVENYWDVSNANVKLVYTITQLSEKEVSTMTLKINDVAFYSFKPDKADKGTKQI
FT                   EIEIPKDKLKKGVNVLSIESFVYTDLPDGRCTIDDTPANWLQFDKTSAVNVSYSDKAFQ
FT                   KTIAEFGERFTGIDTVKSEQGAVAVSNKAGDAELGAALEGLSGFSAANTLEDKNIAFGQ
FT                   YEEAKTRDGKNYLVLFSSYDNLPNDLKSQIKDDNKLEKQALFQVVTVGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNTKWLTTDEKIDTPATSVDKNTKLTTTGDKLKGIGHI
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLTAKKANGD
FT                   KLTFQIPSDLNVKGDFSVTVAFDLILTNNYCGFIADSEIPWAYITPESKINLNTSEETD
FT                   LLFEQYPYPFIANGDFNNAVVVVPDKLTTEDTDSLANIFNLLGRFHDGNRGDLTAVHAA
FT                   NWKKPKEGSNIIAVGTMKNNPVIKNANDDLYFQYNKTGEYFLSNEKISIEKNYGKQLGS
FT                   VQLITSDGVPILAVTGPGTKQTELGSDLIATKANLAKIYGDGAIVDTDNTIHSYRFKKA
FT                   ADTKEESFGSKISNNKEVTVFGAFALLSVVILVVAVLLILRKYRRSRK"
FT   CDS_pept        576287..577141
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83247"
FT                   /protein_id="CAR83247.1"
FT                   /translation="MKKITNNLFADIGFLFFILLCFITIGFMINTPDEYLRNIILLNIT
FT                   FLLVIITYFTNLTLGLILNVLYIFIYATYIIYEIVANQIAYGFGSYFWLIITPLFTVAS
FT                   AMFTRNTSRLQEENTKIKQQNLYLGTIDQETLLKNIVSFQNDERIFSSISRRYDLPLSL
FT                   MVIKVRHWRELKRFQSEDEMRLALQDISAILETCIRTSDVLYLLDKSDATWGLLLLTDE
FT                   PGGKLVADRIKSRIAEANTEEFAAKYRVKLELRIGTSQFDSEKVKTPLDFIELATKELE
FT                   YDV"
FT   CDS_pept        577392..577823
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83248"
FT                   /protein_id="CAR83248.1"
FT                   /translation="MNRNELVNLLNKHAEIVNLGTSEDAPSTEWVNNAEKALSIKLPSD
FT                   YKWFLETYGGGDICGEEIYSIYSIPFDEAVGGDIVYQNVISSNNIMNGYVVVSNTDFGE
FT                   EFFFDIKDMEKIYISLGAQKELYANNFIEYLNKRLMSYI"
FT   CDS_pept        577889..578719
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83249"
FT                   /protein_id="CAR83249.1"
FT                   /translation="MNLEEIVNCMLLNENDKEIQRTQTEHRIKLVDFWQVKKGDRVLEV
FT                   GCGQGDTTAVLANAVGTSGFVQGIDIAPRTYGAPFTIGDATDHLKKSQLGAQMDFKLGT
FT                   DILKGDITFPEDAFDVAVLSHASWYFSSKSELTLMLELLSKWAKRVCYAEWDTRITDVK
FT                   QTSHMLAVLTQSSYEAFKQETQSNIRTFITPIDMQEIIQEHNWKMGAETSIFSEKMQDS
FT                   RWEISYVKDFITKELEADLGLPEKFKAFLLSQSKLITLENSLPMASYCTSWQAK"
FT   CDS_pept        578797..579066
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0548"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83250"
FT                   /protein_id="CAR83250.1"
FT                   /translation="MRAVLTVIGKDNVGIVAGVSNKLAELNINIVDVSQTIMDGYFTMM
FT                   MMCDISQITKEFDEVKAELAGKGEDLQVKIHIQREEIFNAMHKL"
FT   CDS_pept        579085..580440
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83251"
FT                   /protein_id="CAR83251.1"
FT                   /translation="METNQILETIRMIEEEKLDIRTITMGISLLDCMDGDGEVARKKIY
FT                   QKIVTKARNLVAVGEAIESEFGIPIINKRISVTPIAIIAGSSADTDYVGFAKTLDAAAK
FT                   EVGVNFIGGYSALVQKGYTKGDEILIRSIPQALAQTERVCSSVNVGSTRTGINMDAVRQ
FT                   MGEVIKETADLTADTQGLGCAKLVVFANAVEDNPFMAGAFHGVGEADCVINVGVSGPGV
FT                   VKRAIEKVKGEPFDIVAETVKQTAFKITRMGQLVGQVASEKLGVPFGIVDLSLAPTPAI
FT                   GDSVAHILEEMGLEMVGTHGTTAALALLNDAVKKGGVMACGHVGGLSGAFIPVSEDAGM
FT                   IEAVQQGALNLEKLEAMTAICSVGLDMIAVPGDTTAETLAAMIADEAAIGVINNKTTAV
FT                   RVIPASGTKVGDMVEFGGLLGTAPVMPVNGKSSVDFIARGGRIPAPIHSFKN"
FT   CDS_pept        complement(580480..581448)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0550"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83252"
FT                   /protein_id="CAR83252.1"
FT                   /translation="MANIQEIAKLAGVSSATVSRVINNRDYVSEETRKRVQTIIDKLDY
FT                   VPNINAVSLKKGATKLIGIVIPSFSDSLNVFLKSFTMMAQEHGYNVTLFMTRIDPDKEL
FT                   EALEMLRQKQIDALVLVIRSNDWKTIEHYTKYGPIVTWQRVESEKIPSVFMNQYDGYTL
FT                   ALEHLYAKGYRKFVNVYGNTTGLNTQSRMLAFKDFCARYELDPHEFRQFYGQGSRQDGE
FT                   KIAHWFAETEHKPDAFLTPNDYFAAGLLTEARRLDYSVPEDFAICGFDNMEIAHLLDIT
FT                   TIHYPVNLQAENAFTLIMNQLFGSNLPLLDLDFHLVERKTT"
FT   CDS_pept        581620..582942
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0551"
FT                   /product="glycosyl hydrolase, family 4"
FT                   /EC_number="3.2.1.-"
FT                   /note="Alpha-galactosidases/6-phospho-beta-glucosidases,
FT                   family 4 of glycosyl hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83253"
FT                   /protein_id="CAR83253.1"
FT                   /translation="MKKGVKIVTIGGGSSYTPELVEGFIKRYHELPIRELWLVDIEAGR
FT                   EKLEIVGNMAKRMVKAANIDCEVYLTLDRREALKDADFVTTQFRVGLLDARIKDERIPL
FT                   SHGIIGQETNGAGGMFKAFRTIPVILGIVEDMRELCPDAWLINFTNPAGMVTEAVLRYG
FT                   NWDKVIGLCNVPIGAVKSASDVLEKPEEDLFFKFAGINHLHWHRVFDKDGTELTEKVID
FT                   GLYAPDANPGKVVENIKNMRFLYEQVKHLKMLPCPYHRYYYMTDAMLEEELASFKNEGT
FT                   RGEVVKKLEDSLFELYKDPNLDYKPEELSKRGGAHYSDAACEIINSIYNNKGTVMVVST
FT                   RNNGAIDDVPYDSAVEITSVIRAHGAEPINFGKFPPAQRGLLQVMKSMEELTIEAAVTG
FT                   DYATALQAFTSNPLVPSGDLAKTILDEMLEAHKEFLPQFAK"
FT   CDS_pept        583046..584317
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="lmo4a_0552"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase,
FT                   putative"
FT                   /EC_number="3.5.1.-"
FT                   /note="Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83254"
FT                   /protein_id="CAR83254.1"
FT                   /translation="MQTNLERIKKHIENLDRYTATPGQGTTRLTYSKEDLGARNYLKQE
FT                   MAKVGLTVSEDAIGNIYGRLEGDNPDLPAVIVGSHFDSVPNGGAFDGPAGVITGLEVAS
FT                   VFHEQQRKPHFPLEIIAMVEEEGSRFGAGLLASRTITGKVTKEMLHEMKDIDGITAAEA
FT                   MAKVGFDANQVVTAIRTKESVKAFIELHIEQGPVLENANEDVALVDTVVGLTEIKVTVK
FT                   GQAGHAGTTPMLDRKDALITAVEILGQLPELAIQEGGGTVLTVGKLNVYPNGANVIPDK
FT                   VVFTVDIRAKDEIHVQNTLTKTKEIIQSAEKNGITCEIEDMLYEPPTHLSKEIHQALTE
FT                   SADQLGLKYRTMVSGAGHDAMIFAGLTEVGLIFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLETVKKWTEESANESENKTSSFK"
FT   CDS_pept        584283..585458
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0553"
FT                   /product="N-acyl-L-amino acid amidohydrolase, putative"
FT                   /EC_number="3.5.1.14"
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83255"
FT                   /protein_id="CAR83255.1"
FT                   /translation="MNQKIKQVVLNNEEAMIAFRRDLHMHPELQWQEFRTTDKVAKELD
FT                   TLGIPYRRTEPTGLIADLKGGKPGKTVALRADMDALPVQELNQDLPYKSTEDGKMHACG
FT                   HDAHTSMLLTAAKALVLVKDELQGTVRFIFQPSEEIAEGAKAMIAQGAMEGVDHVFGIH
FT                   IWSQTPSGKISCVVGSTFASADIIQIDFKGQGGHGAMPHDTIDAAVIASSFVMNLQSIV
FT                   SRETDPLDPVVVTIGKMEVGTRYNVIAENARLEGTLRCFNNTTRAKVAKSIEHYAQQTA
FT                   AIYGGTAEMIYKQGTQPVINDEKSALLVQETITESFGEEMLYFERPTTGGEDFSYFQDE
FT                   APGSFALVGCGNPEKDTEWAHHHGRFNIDESVMKNGAELYAQFAYNYLNQN"
FT   CDS_pept        complement(585506..586522)
FT                   /transl_table=11
FT                   /gene="lacD"
FT                   /locus_tag="lmo4a_0554"
FT                   /product="tagatose 1,6-diphosphate aldolase, putative"
FT                   /EC_number="4.1.2.40"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83256"
FT                   /protein_id="CAR83256.1"
FT                   /translation="MVQITKGKFDGLQRLSNEKGVIAALAIDQRGSLKKMIQQAKGTEN
FT                   KKDVEDFKQLVSEELTPYASAILLDLEYGTPAIKARHEGSGLLTSYEKTGYDATTPGKL
FT                   PDLIEDLSALRIKENGGDAVKILVYYDPDEPAEINEIKYAFLERIGAECRAVDIPFFLE
FT                   PITYDAKVTDSGSLEYAKLKPAKVKASIKEFSKPRYGVDVLKLEVPVNFKYVEGFAEGE
FT                   VAYTQDEAARHFEECSDLSPLPFIYLSAGVTSEMFHKTIQFANQHNVQYSGVLCGRATW
FT                   ADGIEVYGKQGDDALREWLRTQGKENITSLDKLLDEGAVPWWTKYGSFEDVHVVEKQ"
FT   CDS_pept        586760..587953
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="lmo4a_0555"
FT                   /product="penicillin-binding protein, putative"
FT                   /note="Beta-lactamase class C and other penicillin binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83257"
FT                   /protein_id="CAR83257.1"
FT                   /translation="MNRRERRKHRRRKNMIIVLSTVFLLFIATSWMIFEFKSKQEQTVS
FT                   APTKKKAATATKPSENSAANEPEETKEPEPVEEKPKETIVKNQEIDNYLQKIGFSGSAL
FT                   VVRDGETIIQKGYMYANRDEKVLNTPDTLFYIGSSQKAIVATALLQLEEKGKINTNDPV
FT                   SKYIPDFPNGNKILVKNFLNHTSGIVGRPKLTSNMTPDQLIQAIEKRGIKSQPGKWDYM
FT                   DANYTVVGYLVEKVSGQPLATYLQENIFEPAGMKHTGYNQKDVDGGKNISIGYKIDDNG
FT                   IFQSPKLVDLSQLYGAGDISMPTTDMYLFDKALMDKKLISEASLKKMFTKGSKSTYGMG
FT                   FYVDPGSYNSHGVVTGWDVSNSVSHTGRTYVILFSNVQNHIASFGKVNNDIYGFLNK"
FT   CDS_pept        complement(587991..588911)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0556"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83258"
FT                   /protein_id="CAR83258.1"
FT                   /translation="MYQKHKWAAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVTDT
FT                   MDRKVEVPTTPKRIVALQNVSEMEILGVKPVGTTDYYITTYPEATKGTESVGNDKPSIE
FT                   KIANLKPDLIIISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNIANLLNKKAEKEKWD
FT                   KDYAASSKEAKATLKDAGVANEKAAVIQFYGKEIYVHDAKVFDGLYSGAGFTPTDAAKA
FT                   NKETKAISSEAIPEYAAGADRLFILMPADGNTDSVDEMLKGVWKDIPAVKKNQVYKVDN
FT                   TKWSDYSAAAQLYQMEDAVKQITGK"
FT   CDS_pept        complement(589022..589372)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0557"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83259"
FT                   /protein_id="CAR83259.1"
FT                   /translation="MTISKIMEIGPLVPAFEEEKIVILFGPTATNELREISVIHEFEDV
FT                   PNNALTKGNTLLIGEQEYTIEEVGSDANKNLEELGHISVYFRSGQNEVLPGAVVVSPEV
FT                   FPTMTIGDSIQF"
FT   CDS_pept        complement(589392..590378)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0558"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIBC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83260"
FT                   /protein_id="CAR83260.1"
FT                   /translation="MYQSIHVNKGQGGWGVGLDITPSEPRTKVVSITGGGIHPVALKIA
FT                   ELSGAEAVDGFKNSIPEEEMMCVVIDCGGTARIGVYPMKRIPTVDVLPSSPSGPLAKHI
FT                   TEDIFVSGVKPEDIEVRDQSADSGRPFDREKFKEDYAKIKEDQKEASELKEGFLVKFSR
FT                   GIGKAMGVFYQAGRDSVDMLIKNIIPFMAFISMIIGIINYTGIGKLIANTLSPLAGSLW
FT                   GMLLIAFICSLPFLSPILGPGAVIAQVIGVLIGSQIAIGAIPVTYALPALFAINAQAGC
FT                   DFIPVGLSLAEAKPKTVQFGVPAILYSRMITGVLAVVIAWVFSIGMY"
FT   CDS_pept        complement(590399..590920)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0559"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83261"
FT                   /protein_id="CAR83261.1"
FT                   /translation="MNYIEWFGTNFIGLFEAGGKQFVSFMTGIVPLLIVLLTFTYSIIA
FT                   FIGEERVNRAIQFSAKNMILRYTLMPVLSVLMLTNPMAYTFGRFVKEHQKPAFYDSVVS
FT                   FLHPVTGLFPYANAGELFVYLGIANGVVEAGYSMSSLAVRYFLAGLVVILMRGVITETI
FT                   TKFLMRKEKV"
FT   CDS_pept        complement(590945..591325)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0560"
FT                   /product="glucitol operon activator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83262"
FT                   /protein_id="CAR83262.1"
FT                   /translation="MNIVLIASLIFIAQTGLAFFQVRYYQHHMNKVADKYAGKTGYYLY
FT                   SEMERLKFRTSAVAILIVNENQIVHECQILTGKTVFAKFKTFTNYHHKDLSEILTELRS
FT                   KNKNTIQEKAIIKTVNSCMKAL"
FT   CDS_pept        complement(591380..592630)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0561"
FT                   /product="oxidoreductase, putative"
FT                   /note="Homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83263"
FT                   /protein_id="CAR83263.1"
FT                   /translation="MTLYRQLLARENENNPIRVGVIGAGQMGFGMISQIAAIPGMSVVG
FT                   ISDIHVEAAQKAADAYNATATKKEKILLSNDFKEIIHSDLVEVIVDATGVPEVGAKISL
FT                   ETLLAKKQLVLLNVEIDITIGPLMKKLYDSAGLVYTGSDGDEPAAITELYEFSKSMGME
FT                   VLVAGKGKNNKLKISANPDSCQAEADGKNMASHMLAAFQDGTKTMAEMNLLSNAIGYVP
FT                   DVVGMHGISGDVDSVIKDLDLKDQGGILNKFGVVEYVDGLAPGVFVIVKGQNEGVSHEL
FT                   SYLMKKGDRDHHILYRPYHLASLETPLTIAKAVLNHDHAIVPMGAPVSETVAVAKKDIS
FT                   TGEKLDGIGGFCVRGVLETHVDMATNGHIPIGLISGEVVARRNIKAGTFITDEDVSLDE
FT                   STTVWKLRKLQDETFSK"
FT   CDS_pept        complement(592889..593836)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0562"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="Transcriptional regulator, contains sigma
FT                   factor-related N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83264"
FT                   /protein_id="CAR83264.1"
FT                   /translation="MKWEEKRDMVKIATWYYHYGWTQAQIAKKIGISRSIISKTLQRAK
FT                   DLGIVEIFIKDETYYTVDLEQKLEEKFGLEEAIVVATHDMSDEEALNFLAKEAAYTLSK
FT                   RIAKVNTLGISWGKTIRKFANEFPFIPHKDLTIIPLIGGMGSSDIDLHSNQICYDLKKK
FT                   MKCHSKYLYAPALVEDTEMKTDLSKNKYISEVLEEGKTVDMAIVGVSSPYNHSTMEEIG
FT                   YINPEDIEELRYRDVVGDINSRFFTADGKEANTEINTHVIGLSLEELKNIPTVVALANG
FT                   LQKKEALVAALDAGLIDVIVITDRMAEYILQKND"
FT   CDS_pept        594208..594873
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83265"
FT                   /protein_id="CAR83265.1"
FT                   /translation="MEQLFTYKEFVSMMKNYGIKHKKRKLKCGENIMTNSTEPNSVILL
FT                   IHGYISSYTCESPGKLLSVFEPGVFLSYSILEELPPLVTNIALSDDCVVYEYKKEDIEY
FT                   ALSLFPENFGFQYFFLKKIGCHLYYRALLNGKNHHEKLYYAIKYLGILIGKKDENGNIL
FT                   LPPEVTIKILIEYSTLSKAAFYRQRIRLLEQEILKQHKKTFIVQKKVAKHYEKQLTSI"
FT   CDS_pept        594894..597041
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0564"
FT                   /product="leucine-rich repeat domain protein"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83266"
FT                   /protein_id="CAR83266.1"
FT                   /translation="MKINWKIVLVFVLIFALIVPVYSKAIEAEKSVVPEQPVEPVIEEA
FT                   IKETPENKETVSETPTKETIPETPTKETVSEPQKTEESTTKQPLKEPEPSKLKANSLTI
FT                   PANSRIVDLFPDPVMAESLVRNLNIQIKYKNDWVVTDVITQADLDNLSFFTDLSSVIIK
FT                   NIEGIQYMTNLKTINIRSDDNLQGISALLKAPNGYPKLEELTLTRAGITDVSPILKMNA
FT                   PKLVFLNLSKNKISDLSPFASLPNKFPNIDEIILDNNDISNIEPMVKYTSASLRYIHFT
FT                   SNYISDLSSFKDHSLPNLVEINCANQRIYLEPIEISAKYDFTVKPEEIIGVSKSIPMTT
FT                   FYPTAKMDDATSMITWKQEIIEIKPTIGLKEGGITEGVNYGWDDVSSIKDNNGRVVYSG
FT                   RFFQPLVYIVAPKIISYEKQLIYDIDTPLTEEQLLKDAKVVVDQPSKITTNFNDAIPSS
FT                   KEPTKYVVTIEASNIDGGESVNVEVIFQPKPPIITAEEEYTYLVGETVDANQFRLDVNA
FT                   TLTGVGSLVDDFEEVVDFTKVGDYVVTLSSPGNPPASQTAIPVTVVVHVRESMELHIPS
FT                   EFRMGVDKDLESVPILNRKQTLKCYGADGEVDLKVIDRRKLKQGWTITGAMTTFTNSSG
FT                   DIIQSSLKYQSKSPGSNPVYLSNENQPIEQKQATPTETGFVSTIFDLEESLTIEIQPND
FT                   ALVGDAYESKVTWTLEDAPRP"
FT   CDS_pept        597061..597339
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0565"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83267"
FT                   /protein_id="CAR83267.1"
FT                   /translation="MKKIGFIIFCCLFLCATPFYVEAKKADTATSKAGVVMKEKPSKVK
FT                   TGTDDRTGTYPTKFSKKLPKTGEAGDLPLIFAGISLVLFASKKILRR"
FT   CDS_pept        597400..598242
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83268"
FT                   /protein_id="CAR83268.1"
FT                   /translation="MTSRTVKLTTASLLALGLIVAPVLSGDFASAATSVTQDSKGIVKF
FT                   DKSTTPDPVPVDPDPIGPDPVVPDPTNPPTGSDGLWILAVSNWDFGTLDSSQLSKGAIN
FT                   VHSKDSKITTYVDTNGNGTQDLPGEVSVIKDVTPFAQVSDLRGSNNGWTLSVTGSEFKD
FT                   SSTPAKKIAGAELTIPKSIVSSKDSTAQAPTGYDNVTISMTGGAAVPVMAAKDMQTATP
FT                   TNYNDDQGMGTWNDSFGSAEVSATETSKPKLSIPKNVAVADGTYQSTLTWTLSDTPTV"
FT   CDS_pept        598322..599353
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83269"
FT                   /protein_id="CAR83269.1"
FT                   /translation="MKKIFAIIFACTIAIICLPNQHAEAAESNSFSVKAILPDNQVSKA
FT                   TYFDLQMEPKQKQKLNVEITNQSKEKMTINCVANTAITNEMGYVDYSIPKTKPDETLKY
FT                   PFADITELSDSEITLEPNETKTWSVTIQMPEENYDGIILGGLHFKEKKAEEKEKESSEN
FT                   DVQIKNEYAYVIGVKLTEKATVVKPELELNQIKPATRNYRNVVEMNLQNTKATLVGGLA
FT                   VDAKIYKKGSEKVLHESKRTDLSMAPNSNFNYSVDWENQELKPGKYKLHLVAKNKDDKW
FT                   EWTREFTISSDEAKKANEKALGLEKDYTWMYIAGGLLLFILLIIATYSIGKRAAKKKQQ
FT                   DEE"
FT   CDS_pept        complement(599412..600047)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0568"
FT                   /product="CBS domain protein"
FT                   /note="Putative Mg2+ and Co2+ transporter CorB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83270"
FT                   /protein_id="CAR83270.1"
FT                   /translation="MLIKNLCIPKINLTTVPGDATLQEAIHLLEESGYRCVPVLDEKGE
FT                   KFLGNIYKMHIYKHAANGGSLSDPVMSLIKNATKHICVNASFFEVFFTIKELPYIAVLN
FT                   EQGNFYGILTHGKLLGLLQDGWNVKTTSYVLTIATGEVQGALTKITKIIDRYSSIASLI
FT                   TLDNQTEDFIRRVLVSLPVGVTEEKKNEIVSHLERKGLRVVETEKIEK"
FT   CDS_pept        600254..601435
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0569"
FT                   /product="alcohol dehydrogenase, iron-dependent"
FT                   /note="Uncharacterized oxidoreductases, Fe-dependent
FT                   alcohol dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83271"
FT                   /protein_id="CAR83271.1"
FT                   /translation="MQKEILNFDYYNPTHIIFGKNRLEELNEVIPQDKKVLILYGGGSV
FT                   KKFGTLDKVKAALKTREVGEFGGIEANPTYETLIKAIQLVKEENYDFLLAVGGGSVIDG
FT                   TKFVAAGALFDDDPIHIFGSGIGEKRPITEALPFGTVLTLPATGSEMNSGGVITFVEKK
FT                   AKLGFGSAYTYPVFSLLDPELTYTLPKRQLANGIMDAYVHVMEQYMTYPVGALLQDRYA
FT                   ESLLQTLIEIGPDVIKEDNHDYNTRATFMWSATNALNGTLSRGVPQDWASHSLGHEITA
FT                   LYGIDHARTLAIVLPSLLNVRRNEKKDKLVQYAERVWGILNGSDEEKIDAAILQTREFF
FT                   ESLGAGTRFSDYGLGEEVVDLLVDQLERHGLTNISERGDQTLEVSRQIYTNAL"
FT   CDS_pept        601519..602997
FT                   /transl_table=11
FT                   /gene="dtpT"
FT                   /locus_tag="lmo4a_0570"
FT                   /product="di-tripeptide transporter"
FT                   /note="Dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83272"
FT                   /protein_id="CAR83272.1"
FT                   /translation="MSTKKEKTFFGHPRGLATLFNTEFWERFSYYGMRALLLYYMYTAV
FT                   ADGGLGFSQSTATAIMSIYGSLVFMSGVIGGWFADRVLGARQTIFYGGVLIMVGHIVLA
FT                   IPSGGAAALFGSMAFIILGTGLLKPNVSNVVGDLYPAGDNRRDAGFSIFYMGINLGAFI
FT                   APPIVSAVSDNAGSYHAGFGVAAVGMAIALVVYVLTGKRYLKDAGKKAPNPLQRSEAKS
FT                   LTFKIIGIVLGIGLLIAVLSLITGSLTIDTIILAVTVMGVGVPLAYFIMMMTSKKTEPD
FT                   EKSRLTAYIPLFLIAVLFWMIEEQGSSTLALFAAERTDLSIWGLNLNPANFQSLNPVFV
FT                   ITLSPIFAWIWTKLGDRQPSTPRKFALGLFFAGLSFVVMMLPGILHGNTTTLVSPLWLV
FT                   LSFFICIFGEMFISPVGLSATTKLAPKAFASQTMSLWFLSDAMGQSFNAQLTQLFNPDT
FT                   EIAYFGITGFVAIAFAVALFIFAPFLKKYMKGVH"
FT   CDS_pept        603126..603833
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0571"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.1"
FT                   /note="Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83273"
FT                   /protein_id="CAR83273.1"
FT                   /translation="MESSSRVVIYLTRHGKTILNTLDRVQGWADSPLTEEGALVAHDLG
FT                   RGLKGTNFVAAYASDRGRAIETARIVMKESDNHHLKLEKLAEMREFGFGKFEGEYNQAV
FT                   LKMVAKAHGFESIESYYDKTSENNSNIVIDTVHKMDETGMTENSAIFEERLTAGLDTIL
FT                   ADANKRGGGDVLVVAHGMVIHRIIEMIDPSKNLRIIENASVTKVIFEDGAYSIEEPGNM
FT                   FYVEAGKKAQGGV"
FT   CDS_pept        603834..604529
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0572"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.1"
FT                   /note="Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83274"
FT                   /protein_id="CAR83274.1"
FT                   /translation="MTTGKLNVYLVRHGKTMFNTSRRVQGWSDTPLTNEGIEVAEFLGR
FT                   GLRETPFDAIYTSDRGRTIETAGIILRESKQAHLEINELRDFREFGFGKFEGEYEDIMF
FT                   GKVMEHLGFQSMEEAFEKFGDDGYQIVSETVEKIDETGMSENWDVMVARLKNALDTVRR
FT                   ENQTENANVLVVSHGMAINTIISFFDKSLINPDLANASVTRLGFENGEWTIETVNDLSY
FT                   IEAGKLVLV"
FT   CDS_pept        complement(604571..605611)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="3-carboxymuconate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83275"
FT                   /protein_id="CAR83275.1"
FT                   /translation="MSKNQATAYIGTYTKAESQGIYRLVIDKTTGEIKENKLAGKMDNP
FT                   TYLKISDDEKFVYSVAKDGDKGGVAAFSVEEDGSLAFINQDVQTGNPPCYVDASHDGSI
FT                   VVSANYHLGTIVSYPTENGALKSSVSTIQHTGKSVHERQEKPHAHFAGFTPDQKYVITC
FT                   DLGTDKVTTYSATAGKLEKVTELDVKPGSGPRNLVFHPNAKYVYIMTELTSEVIFAEYD
FT                   EATGALNVIQTIASLPEGFDKENKGSAIHISPDGRFLYISNRGQDAIVSYAVAENGTLT
FT                   LAATTPVEGVGPRDFDLNYTGEILVATNENSNNVTVFGVNKETGALTLLQKDVKVPEPV
FT                   CIKFVK"
FT   CDS_pept        606011..606916
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0574"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83276"
FT                   /protein_id="CAR83276.1"
FT                   /translation="MSIQTIFGNGQYNWINIDTDSTDNLADFYEKYHIDDEVIAYSIDR
FT                   NERAHFEYDQKSNTFVIVFNVPDQRKMDNHYETIPMVFIIKDKQLITITNNDNQYITRK
FT                   MKRYLKESDDVTIFQFLFSSLYFIMDAFFPYVEEMDTDRRTINDKLKIKTTKKNLLSLS
FT                   DLETGIVYFVSASKQNAALLEQMKAHLIYRELNEVEKEQFEDALIEARQLVEMTGLSSQ
FT                   ILQQLSGTYNNILNNNLNDTMKILTALSILLTVPTIITGFFGMNMPLPLEHNTFGWIVT
FT                   IFISVILWFGLSFILRKLMR"
FT   CDS_pept        complement(606960..608336)
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="lmo4a_0575"
FT                   /product="glutamate dehydrogenase, NADP-specific"
FT                   /EC_number="1.4.1.4"
FT                   /note="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83277"
FT                   /protein_id="CAR83277.1"
FT                   /translation="MAQTSTIQNDTKAAEEYAARVFETIKQRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVPWVDDSGTVHVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDSEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTITGKGLSYGGSLARTEA
FT                   TGYGLVYFTVEMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSAGFVY
FT                   DKEGIKVETVKQLKEVERKRISEYTTIHPSAEYYAGGDVWSVPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLDAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWTFQTVDEHLQNIMKDIYKNSSNAASEYGAPGNLVIGANIAGFLKVADTMISQGII
FT                   "
FT   CDS_pept        complement(608816..609127)
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="lmo4a_0576"
FT                   /EC_number="3.6.1.31"
FT                   /note="Phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83278"
FT                   /protein_id="CAR83278.1"
FT                   /translation="MLNDLYEEIKLRKEQPKEGSYTNYLFDKGLDKILKKVGEEATEVV
FT                   IAAKNDKQELIAEVSDLTYHLLVLLAEKNIPLAAIQTELKNREGKLSTTRDRKEINDL"
FT   CDS_pept        complement(609128..609445)
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="lmo4a_0577"
FT                   /EC_number="3.5.4.19"
FT                   /note="Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83279"
FT                   /protein_id="CAR83279.1"
FT                   /translation="MISVDFSKGLVPTIILDDQNGDVLMLAYMNEESYHKTLETGYTWF
FT                   FSRSRNELWNKGATSGHTQKVKQIWTDCDNDTLLIRVTQIGPACHTGKKSCFFNLIKED
FT                   F"
FT   CDS_pept        complement(609442..610197)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="lmo4a_0578"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="Phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribonucleotide (ProFAR) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83280"
FT                   /protein_id="CAR83280.1"
FT                   /translation="MLTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGAD
FT                   ELVFLDITATVELRQTMIDVVERTAEQVFIPLTVGGGISSVSDMKELLQAGADKISLNS
FT                   AAIKRPDLIQEGADKFGNQCIVVAIDAKWNGTNWSVFTRGGRNDTGLDAITWAKKAVQL
FT                   GAGEILLTSMDGDGTKNGYDIPLTKAISEAVSVPVIASGGCGNAAHMAEVFEKTNATAA
FT                   LAASIFHYGELSIQNVKTTLLEKGVNIRP"
FT   CDS_pept        complement(610187..610909)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="lmo4a_0579"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="Imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83281"
FT                   /protein_id="CAR83281.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKGFATDGAT
FT                   YLHIVDLDGALEGRPINLEVIQKMKTTAKIPVQVGGGIRSMAQVDYYLESGIDRVIIGS
FT                   AALTDPDFLRAAVQKYGAKIAAGIDAKNGLVATRGWLDVSQVNYLDLAKRMEKVGVETI
FT                   IYTDISRDGTLTGPNLEQMANLKEHVKVNLIASGGVSSRADLEALAKLGLYGAIAGKAL
FT                   YNRQISMSDIVEVEQIAY"
FT   CDS_pept        complement(610888..611514)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="lmo4a_0580"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="Glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83282"
FT                   /protein_id="CAR83282.1"
FT                   /translation="MIVIIDYDTGNTKSISKALDFIGLQNKISSDATEISQADGVILPG
FT                   VGAYPEAMKELTRRGLDKTLKEIAATGKPILGVCLGMQLLLESSNEHSFTSGLGLIPGH
FT                   VEKLPEEPEFAVPHMGWNQLQIKRATPLTKQLDGEYVYYVHSYYANCPEEYIIATSGYS
FT                   IEVPGMINNGNIYGAQFHPEKSGQIGLEILKGFKEVTYSCKSSQQ"
FT   CDS_pept        complement(611515..612099)
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="lmo4a_0581"
FT                   /EC_number="4.2.1.19"
FT                   /note="Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83283"
FT                   /protein_id="CAR83283.1"
FT                   /translation="MRTATKTRVTAETSIELSINLDSQTESTISTGVGFLDHMLTLFAK
FT                   HSRVTLNVKADGDTYVDAHHTVEDIGITLGLCLKEALADKASINRYGSSYVPMDESLGF
FT                   CALDLSGRSYLVFDAELTNPKLGDFDTELVEEFFQAVAFNTEMNLHLRVLYGKNTHHKI
FT                   EALFKAFGRALREAITINPEIKGVNSTKGVL"
FT   CDS_pept        complement(612100..613383)
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="lmo4a_0582"
FT                   /EC_number="1.1.1.23"
FT                   /note="Histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83284"
FT                   /protein_id="CAR83284.1"
FT                   /translation="MKILTGTAKELLNKLKTETNTNTSIQVETEVKTIIEKVKTAGDQA
FT                   LFDFTSKFDGVGLTELRVPAADIQAASAKVDPAFLEALQQAKANIESFHSKQKQHAFLD
FT                   NEKDGVIRGQLIRPLETVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPGENGI
FT                   NPHVLVAAQLAGVDEIYQVGGAHGIAALAYGTESIPKVAKIVGPGNIYVATAKREVFGL
FT                   VDIDMIAGPSEIVVLADENANPAFIAADLLSQAEHDILARAILITTSKKIADQTQSEIK
FT                   KQLENLPRKAIAQKSIETQGKIIITATTQEMFDIMNEIAPEHLEVQLENPMNYLHQIKN
FT                   AGSIFLGSYASEPLGDYFAGPNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKE
FT                   KDAIVLLAKKEGLDAHAKAIQIRFEEEN"
FT   CDS_pept        complement(613380..614021)
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="lmo4a_0583"
FT                   /EC_number="2.4.2.17"
FT                   /note="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83285"
FT                   /protein_id="CAR83285.1"
FT                   /translation="MKALKIALTKGRLEKDAVALLEKAGIDCSSMTDKKRKLIFHSSTQ
FT                   PISFILVKAVDVMTYVKHGVADIGIVGKDVLMEASKSHYEMLDLEIGKCQFCLASTPDF
FT                   DPSSYRRKIIATKYPTVASKFFREKGEDVEIIKIEGSVEIAPVLGLADAIIDIVETGST
FT                   LKENGLLIYEKMYPISARLIVNKASLKQNKTQIFQLIDQLEQAIKEERIE"
FT   CDS_pept        complement(614021..615199)
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="lmo4a_0584"
FT                   /EC_number="6.1.1.21"
FT                   /note="Histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83286"
FT                   /protein_id="CAR83286.1"
FT                   /translation="MNLNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPV
FT                   IEFEDVFSSEHQADAKLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVTLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALEIPNFQIELGHAAIY
FT                   RRVIQLLNLSETAEIDFRQLIQNKSLTGIKRFVANNPSTLDDFILAIPRLFGPATAILS
FT                   QAKNLTTDKGILTALHEMETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTSSSSPAVGLALNLDSLTTLQNRAGIIKKQTPTTLLIHYDLEALQ
FT                   QAEKFMQETPNSELSFFETASNAISFAKKWHIPEVVHVSSQGIQTIFQREVD"
FT   CDS_pept        615351..616178
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="lmo4a_0585"
FT                   /product="histidinol-phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /note="Histidinol phosphatase and related hydrolases of the
FT                   PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83287"
FT                   /protein_id="CAR83287.1"
FT                   /translation="MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSS
FT                   EFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFT
FT                   RDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGV
FT                   KQSIEADLGPFKPQRIGHISLFQKFQQFFGADTSDFSEEVMEEFQAILALVKKRDYELD
FT                   FNTAGLFKPLCGETYPPKKIVTLAKALQIPFVYGSDSHGVQDIGRGYDTYCQK"
FT   CDS_pept        complement(616163..616459)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0586"
FT                   /product="methylated-DNA-protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="Methylated DNA-protein cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83288"
FT                   /protein_id="CAR83288.1"
FT                   /translation="MIPADFEDRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATL
FT                   KHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSEGVTFKENGHVKMKDHFWQ"
FT   CDS_pept        616536..617567
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83289"
FT                   /protein_id="CAR83289.1"
FT                   /translation="MPDFSYAKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFKKDEYYQFTHETDLDFNEVRTFASNMFVAEEEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFFIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLVFNVDHDTGNKVLILDRLNRGDSVYWKDKFLSIDKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATSEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKREKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEEKGKNYMIV
FT                   YYD"
FT   CDS_pept        complement(617610..618905)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0588"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83290"
FT                   /protein_id="CAR83290.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGME
FT                   LKAVFVATILASVVGSLAMGLIANYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTISGLREKIVNAIPTELKFAVGAGIGFFIAFLGLKNAGIIVPNESTIVAL
FT                   GDLHSGPVLLAVFGIVVTVAYMTIGWKGAIFFGMATTAVAGMLFGLIDVPTQVVSSVPS
FT                   MESTFGQAIIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDNKIPRAGR
FT                   SLFSDSLATVFGAIFGTSTTTSYVESTAGVAVGGRTGLTAVVVAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEVAVPSFFVILMMVLTFSIATGIAIGFIFY
FT                   PITMVLKGRYKEVHPIMYVMMVLFILYFMFVV"
FT   CDS_pept        619221..620615
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0589"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /EC_number="3.2.1.-"
FT                   /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta
FT                   -galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83291"
FT                   /protein_id="CAR83291.1"
FT                   /translation="MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRF
FT                   FNDVGPTNTSNFYYQYKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRV
FT                   IDEMLANDVEPFMNLYHFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFT
FT                   FNEPIVPVEAGYLYDMHYPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIIL
FT                   NLTPSYPRSQNPADLKAAHIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEED
FT                   LAIIKNNIIDILGVNYYQPRRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEI
FT                   FERAIYDIAINLRDNYDNIPFFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWL
FT                   HKAIEEGANCHGYHLWTFMDCWSWANAYKNRYGLVEVDLDNDFKRTVKASGHWYKELSE
FT                   NNGFED"
FT   CDS_pept        620659..621387
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0590"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83292"
FT                   /protein_id="CAR83292.1"
FT                   /translation="MAQNQTKYSFIAEEIRKRIMNHAYPLNQPIPDEITLAKEFDCSRM
FT                   TMKKALEVLVLEGLLYRKRGHGTFIIKSALDADRLQIHNQEVNGFTKLLNGKKVISKVI
FT                   EFKVIFPTEEIAERLHIEMETPIYDILRVRLVKDEPYVLEHTYMPVGVIPGINQQILEG
FT                   SIYSYIQDDLNLKIASSYKQIRADKATLLDQQYLDCASDDPVVEVEQTVYLNNGLAFEF
FT                   SRSRHRYDKFVFTTVNIARR"
FT   CDS_pept        621812..623275
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0591"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83293"
FT                   /protein_id="CAR83293.1"
FT                   /translation="MKKKYFLCVFAVILFFTGFLFGNSPVNAAETDTSNVTYNYIDIST
FT                   LTETQKNSIIKGNPNETLTNDYENYSFVYQKNTSEPTTNTDNTSDNNKNQNGTLLKAGD
FT                   VGPNSYLIILGFILFGSGIGLLTLKKRHARQLLVFLVVLGGSSLLVGSIVQATENSNLK
FT                   TQESQTVAKGTKETKQPESMEGYTYVGYIHTSKNNTPPVVEKGTVTVNYQDEQGNSLAT
FT                   SETLKGDIGQPYQTATKNIEGYQLKEVNGNTTGTFTEKAQVVTYVYQKVPLATVTVKYL
FT                   DQDGNKIHDPQTISGNIGEPYDASTDKYKLQIEGYTLDTTKLPNNANGTFTNQAIEVTY
FT                   IYTKEAQDVKITIKFVDSNGDPFVLTDLTTYKNGDLVPIYPNLDQYHMRLNYNQQIYNQ
FT                   GEAVPDIVIPAKEGETYSLPERMTFNILDDQGKQIPYVISQNADFSSTGIERWENYQSI
FT                   PTNREGTLTSEDVVVTYQILVYGVMIPEP"
FT   CDS_pept        complement(623329..623787)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83294"
FT                   /protein_id="CAR83294.1"
FT                   /translation="MDLVWTIIIQLVLSYVATVTFAIITNVPKRALNACGITGTFGWMA
FT                   YWTLMQMDSGTGASSLAGAFVVAILSHFFAKHKKMPITIFNVPGIVPLVPGGLAYQAVR
FT                   NFVLGDYTEAIGFSVQVTVVAGAIAAGLMLSEVFNHSIRAFRGRKERI"
FT   CDS_pept        complement(623801..624553)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83295"
FT                   /protein_id="CAR83295.1"
FT                   /translation="MSNETTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIATIASNKK
FT                   GISFVTPTGLFMSLEGERNVQLQQIPTRTINLEKVSMVNEFSRDFAEKRISLKELHTKL
FT                   VNLDKDVRYFPIWLQIIAASLVSGSLMVIFGGGWFDFIPTCIIGAIGFIIFYYTQIFMK
FT                   VKFLAEFLASLSVGLLAVLTISIGWGINLDTMIIGGVMPLVPGVPITNAVRDLIAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVVFRFFL"
FT   CDS_pept        624717..624926
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83296"
FT                   /protein_id="CAR83296.1"
FT                   /translation="MANIEYEIIEEIGVLSENARGWRKELNKVSWNGRPPKYDIRDWSE
FT                   DHEKMGKGITLTDDEAEALKKLLD"
FT   CDS_pept        624948..625604
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0595"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83297"
FT                   /protein_id="CAR83297.1"
FT                   /translation="MFAYDIYEPIGRKDGDTFPVIFGLHGFGGDELEMAGRLELLMDRF
FT                   VVVSMRGDVDYGPAYGFYHMVTEGDPNPREVDYISERVAQFIDKICNDYTSIDKEQVFL
FT                   AGFDQGAVLTISIMQNYGGQYKAAALLSGRLPYYMEERPANLMLKDKRIFIGHGIEDAV
FT                   IQISEADDIAQFFEKMGCKVEKHRYFVGHNVNEAEEDDLYSWFESFLPNQSVKNK"
FT   CDS_pept        complement(625635..626819)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83298"
FT                   /protein_id="CAR83298.1"
FT                   /translation="MKNLIKVKVFPKFTKGYKEGYPLILKERIEKWPKELQEGDVLELT
FT                   DTNGQFIARGYHGEQNKGSGWLFTWDKKQQLDEDFLKSLITAAIEKRQFLFTDDSTTAF
FT                   RIFNGEGDGLGGFTVDYYDGYLVIQWYSLGIYAFQKMIIDIFLSFPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYAVSKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLSKTKEQLEVNGLDPSEQAIIVEDVFHYF
FT                   KYATRKQLTFDLVVVDPPSFARTKKVTFRAAKDYPAMLREIIDITAPNGTIIASTNYAG
FT                   FGMKAFKKLIAEAFQTSDRSYKIIETHSLPADFTVNKNFPEGNYLKVLFLTLDI"
FT   CDS_pept        complement(626907..628325)
FT                   /transl_table=11
FT                   /gene="cwhA"
FT                   /locus_tag="lmo4a_0597"
FT                   /product="cell wall hydrolases A"
FT                   /note="Cell wall-associated hydrolases (invasion-associated
FT                   proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83299"
FT                   /protein_id="CAR83299.1"
FT                   /translation="MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSK
FT                   GTTVDAIKKANNLTTDKIVPGQKLQVTEVNEVAKTEKQEKSVSATWLNVRTGAGVDNSI
FT                   ITSIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKVASTPVTTTQEVKKEATT
FT                   EQAAPAAETKTEVKQTTQATTPAPKAAETKETPVVDKNATTHTVKSGDTIWALSVKYGV
FT                   SVQDIMSWNNLSSSSIYVGQKLAIKQTANTATPKAEVKTEAPAAEKQAAPAVKENTNTN
FT                   TATTEKKETTTQQQTAPKAPTEAAKPAPAPAPSTNTNANKTNTNNTNTSTPSKNTNTNT
FT                   NTNANQGSSNNNSNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISL
FT                   PRTSGAQYASTTRISESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIH
FT                   GSGWGKYLVGFGRV"
FT   CDS_pept        628744..631074
FT                   /transl_table=11
FT                   /gene="secA2"
FT                   /locus_tag="lmo4a_0598"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="Preprotein translocase subunit SecA (ATPase, RNA
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83300"
FT                   /protein_id="CAR83300.1"
FT                   /translation="MRQNYDDRKIVKQYREIARQIVKKEGLYKNMDQAELCEQTNFWRE
FT                   KFKTKPMTERDKVNIFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLM
FT                   SLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVSVALNESGLDKEQKKAIY
FT                   TADVIYGTASEFGFDYLRDNMVRQKEDKVQSGLDFVLIDEADSILIDEARTPLLISDRK
FT                   EEDLSLYHKANELVEKMMKDDYEMEEHKRFVWLNDAGIEKAQRFWKVDSLYSAEAQSEL
FT                   RITMLLMRAHFLMHKDKDYVVLNDEVLIIDPHTGRALPGRRFNDGLHQAIEAKEGVEVK
FT                   EESRTLATITIQNYFRMYKKISGMTGTAKTEEEEFRQIYNMDVVVIPTNLRVNREDMQD
FT                   DIFYTKKEKGRAIVYEVSWRYEKGQPTLIGTSSIKSNEWISGLLDAAGIPHQVLNAKNH
FT                   AQEAEIIAKAGKRGMVTLATNMAGRGTDIKLDPDVHKLGGLAVIGTERHESRRIDLQLM
FT                   GRSGRRGDPGFSKFMISLEDDLLEQFESKSWEKLSAKLKRKAPRDGKPVKSRKIHAVVV
FT                   DAQKRLEGANYDIRKDLLSYDEVIDLQRKMVYKERDLLLERNKLGVSSEKILREVAEYS
FT                   FIHPSDISEEELEIYYSRQKELLGGTKFPVSFDQVTLMEPREVVEEIVSWHKNERNKFP
FT                   VETIAAIEREVYLNLMDQMWVMHLDAMVQLREGIHLRAYGQQDPLVMYQKEGALLFEKF
FT                   QADYHFYFAHALLELDPDGLIQG"
FT   CDS_pept        631190..632362
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83301"
FT                   /protein_id="CAR83301.1"
FT                   /translation="MKGSFTKFKQFFIENKFVLGLLIFLLVALDIYVLTKIAFIFDPLM
FT                   VILKTVAAPIILAGISYYLFNPIIDWLEKHKWKRGWAIALLYLVIIGLIILLFSFVIPA
FT                   VKDQIVSLFKSFPGYWDQITQKFDEFSRSSLFDQIKDKLNTNMSDIMKTLSTKGTSVIN
FT                   SAISSIGSIVGTVTEVVLAIVTTPLVLFYLLKDGKKLPDFLLKMLPVNGRAHTRQVLGE
FT                   ANHQISSYIRGQIIVSLCIGILLFIGYLIIGLPYALTLAIIAACTSIVPYLGPAIAITP
FT                   AIIIAIVTSPWLLIKLIIVWCVVQLLEGKFISPQVMGKTLKVHPITILFVILVAGNLFG
FT                   VLGVIFAVPGYAVLKVIVTHVFIWFKRISGLYGEQPVSEYVEPPTEEKEL"
FT   CDS_pept        632620..633333
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83302"
FT                   /protein_id="CAR83302.1"
FT                   /translation="MTIKKTLIVGLIGISSVTLFAPSAFAVTSEGDSKATVKFKAGTGV
FT                   VNPVDPENPTKPIDPLDPSNPTDPGTGNTGSLTLDYVSSVNFGEQEVSSTEQSYSSTSR
FT                   KPFIQISDRRGTGAGWKVTATATAFQNEDGAASLSGATLSFKNGETASASTTATTPTAA
FT                   QTVELPTDGTSIVSVVSAKASEGMGTWINRWFGATPNDTASLNDNVKLTIPAGSATLGD
FT                   HEATITWTLSDAPGV"
FT   CDS_pept        633401..634426
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0601"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83303"
FT                   /protein_id="CAR83303.1"
FT                   /translation="MKKSFLSLLFIIPLLVTCSNFTEARAAEGDVGYSVQAHIPANQID
FT                   KRQTYFDLKMQPNQKQTVEIDVMNSSNEEIQVEAAINYASTNRTGVIDYTKNDLTKKDK
FT                   SLEYPLPELAKIPDDQKLLTIPVNGKKTVRVMIEMPAESIDGVVLGAVEFKKKNTKETK
FT                   KTKGVSLKNEYSYIVGMQLAETDKQVKPHMNLLSIKPALLNYHTAIVANLQNDQPVILE
FT                   NLSIDAKVYQQNSDKLLYQTKKANMKMAPNSNFDFGIDLENQPLKEGKYRLKMTATNGV
FT                   ETWSWDEAFTIGKEGQNLNKEAVNLEKTNTWLYVAIAAGVVLIALIIILVIRKRRQKQE
FT                   K"
FT   CDS_pept        634444..636909
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83304"
FT                   /protein_id="CAR83304.1"
FT                   /translation="MAFKKLILVLTIAALFLGFKIVVAAENGSRDLAPNEAIVTNFAEL
FT                   KTAISEDNGIDTVYLGADVELSGGIIIPATKKTFTLSGKNPATGEIHTLTETMASAGAQ
FT                   SSVITVNTNTGAKETTLKDIHIVGKNYYGTISVYGAAKNVVQNYENVHYQGPQMIYNLN
FT                   GTANFKGTNDITIASVVSGSAAPNEVAEIKGVSVSGKLNINHASSNANSAFWFGGGTAD
FT                   VNTFTVEENADVTILSNGTGMFYRSGAKPIDIDVKKNAKLAITSNNNIFRDTPGGAVKI
FT                   ASGADVTMTKTAGGNPLLWVADDITVSPDARFILNKTGGTGYIIQFYNATAKLDVNDPL
FT                   SFLITTNSNTPMFYWPYANTFNLNAQMVNYWDTVGTIDRTDLAAQSFSLPNGENVTGSL
FT                   TYTGTTTKILSTNAGMTPTNFNQNTARMIAMGRLEGTINPVTDADNEIIGTATPNAFIN
FT                   ISYTENGENKVLEGQANDDGTYRIAIPNGFIKPYIKLTTTIKQDQKRITLDDITVEDVT
FT                   PPSGEAVTQIIQLGDPFPDVSELVTNIYDHSDNTSGAGITTTLQSAPDTSVFGPAEAIV
FT                   RLEDKAQNYVDIRVPVFIKDDETEIQDGKALRAADFSVNVKDIIELNDAELEQFILNKS
FT                   GAKAFNIETGEDLSAELKVASTNLKKETGTYAATIQIGELTKEIAIQVTGELKFNHVPE
FT                   TISFETMELNQQKNIAKRNADFDLSVLDSRGSGGKFSVTATVKSPLTSTTNSAHTLPNG
FT                   LIFIDNTGAKKILSDEPITIFESQSASEMIVPIEWADDQGILVEVDAAEAYVDESYETT
FT                   IEWTLTDAP"
FT   CDS_pept        637022..638425
FT                   /transl_table=11
FT                   /gene="phr"
FT                   /locus_tag="lmo4a_0603"
FT                   /EC_number="4.1.99.3"
FT                   /note="Deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83305"
FT                   /protein_id="CAR83305.1"
FT                   /translation="MTSVMWFRRDLRVNDNKALYHACKEDDLLLLFQVNPAQFITGSPS
FT                   HQAFFASVAHFKQEIDKTAHVQIMFGEPIECFQQLKDTLPSWDKVYFNRDETGYGAKRD
FT                   EAAQAFFDEQKIEVQSFHDSYLHSAEEVKKSPTEYYKIFTPYYKKWREEIKETPFKVTL
FT                   KPENIRKESLFPKYEEQFAEMTCDLPILDSGERAANTRLANFIKHDIADYDKARDFPEL
FT                   DKTSHLSRYLRTGEISIRTVWQALQETKATEGRATFEKELCWRDFYNMIYVSFPNQKNE
FT                   PIQENYRFIEWENNREFFKAWQEGKTGFPLVDAAMRQLKETGWMHNRLRMITASFLTKD
FT                   LLIDWRFGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTTQSQKFDPTAK
FT                   FIRKYVKELANLPDKYIHQPEKMSETEQKEYGLVLGKDYPFPLIDHKERRKLAIARYEF
FT                   SKEHSRGNI"
FT   CDS_pept        638563..638976
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83306"
FT                   /protein_id="CAR83306.1"
FT                   /translation="MAQFLKLFLTSAVVFLIFDLFWLLVASKKMYQQFIGDLMGDVKLA
FT                   PAVIFYFIYVVGVTFFVLLPGTEKGSLGYTILAGALFGLVCYATYDLTNLATLKDWPIT
FT                   MTIIDLVWGTAVTTVTSVIVYFINLHFFSGAGS"
FT   CDS_pept        638976..640745
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83307"
FT                   /protein_id="CAR83307.1"
FT                   /translation="MMESESKRLLQSMLNGAAEVISKKDELNRINVFPVADGDTGSNLA
FT                   SLMQAIIDHVSPREYSTKELLEEVASAALIGARGNSGMIFAQYLNAVAESYHHLESTFD
FT                   GLVQAFQNAVHKAYDALLDPKEGTILSVMKAWSEELAGTYGQERSFQQSLLNAQIVAEK
FT                   ALINTEFQMPILRKNRLVDSGAKGFYYFIAGLTNAYCGKAVSAPVRFTEVEQTAEHRHV
FT                   ETSEPKYRYCSEFIIKQATISHQHLQEILASKGDSLVIAGNEKQIKIHIHTNEPKEVLS
FT                   LMAAYGVMTYQKVDDMRLQYEVTKKPRAKIAIVTDSIADLPEAFLLEHQVHVLPMNILA
FT                   GEENFLDKLTVGPDMMQEKLRKQTKMSTAQPTIRTVDALLSFLENKYEHVLVISVAAKL
FT                   SGTYQLIKQRIKARELSSDWIRVIDSKLNSVAQGILVKQAVELVESGKSWESIYPEVEQ
FT                   MIERTFIYVAVADLSPMVQSGRIPRVLGKFAQKLSLYPIVSLDESGDGKLIGVSFSQKQ
FT                   SMKKIIKKIAKLQLKELAITHVSSRDTAAIWQKQLEKETGKISYLVDSSAAIAISAGLG
FT                   SVAVAGIKKEGTI"
FT   CDS_pept        640742..641515
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="Putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83308"
FT                   /protein_id="CAR83308.1"
FT                   /translation="MMYWTVALALLVYFILWFIISKIKGKYSLVDIAWGGGFVVVAWTG
FT                   FLTTFSMTAQSITILVLVTIWGVRLFWHLARRNWNKPEDYRYVNMRKRWGTTLVNLKAF
FT                   LNVFVLQGVLLFIIALPITHSFANETATFAWWQILGIVIWIIGFIFEVGGDLQLENFKK
FT                   NPANKGKLLTTGFWSVTRHPNYFGEALSWWGVFLVAYTQLTDLWLITSPIVITLLLLFV
FT                   SGVPLLEKKYRDRADFQAYANKTSKFFPFIGKKGL"
FT   CDS_pept        641642..642184
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83309"
FT                   /protein_id="CAR83309.1"
FT                   /translation="MKKEKTVLIMNFDEESISYQAFSEMKRLHQERKIIGYQMAVVKHE
FT                   PGNKLVAQDFLDFTGADKNMKDSLIGMLIGILGGPFGILIGWMVGAIVGSMRDAGEVKD
FT                   ALNVFERTLKTIPEGSTGVILIATEQELANVNDVAMDELHGRVQRMDEAIVAQEIKSAQ
FT                   ETEGKAKDSAKKHWFSK"
FT   CDS_pept        642366..642932
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83310"
FT                   /protein_id="CAR83310.1"
FT                   /translation="MSVKACYIEVKSAKNEDGYATIATTWVGKDMPVKPLTSKKTGAMW
FT                   SHECVFGVIGSKIGDFIPVHSVNSSLQEGVFTQRDIATQLIATFSGLKMTEIEWRENPL
FT                   ADTSNDGKTRAKWLPEKEFDIVHLFSDVYIDVCQPDEITSDFFTVIEEQDGYERNWFMC
FT                   TEQAKKLLKKMNFENISVGGNKILG"
FT   CDS_pept        643126..643926
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0609"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="Formate/nitrite family of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83311"
FT                   /protein_id="CAR83311.1"
FT                   /translation="MDVESSPLMQKIDYSTRKKIDLVNNSILRYIVRAMLACLFLTLGT
FT                   AVAVMIGDKVDHFAPGLGKITYAFMFSWSLVMIIYMNAELGTSNMMYMTTGVYQKIVKP
FT                   GKALQILLLCIVCNLLGGILAGYLVSLTSVFHNLPADHFLFTAVSGKLEKAPLQIFVEG
FT                   IFANIVVNTAVLCTLRMKDDAGKVIAMIFIIFIFAFLGFEHVIANFSSFSLAFFASGGT
FT                   LAAMTAGNVTVNLVLALLGNFVGGGLVIGLGYAWLNRTKSIYKD"
FT   CDS_pept        complement(643966..645072)
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="lmo4a_0610"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="Homoserine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83312"
FT                   /protein_id="CAR83312.1"
FT                   /translation="MTLQQKELFQKSPLLLENGETLSPVLVGYETYGTLSESRDNCILL
FT                   EHALTGTAHAAKHFESDAPGWWDDYIGPGKTIDTDKYFLVCTNVFGGCSGTTGPSSINP
FT                   KTGEPFRLQFPGFSIKDIIKVQRELLEQLEVTRIVSVIGGSMGGMQATEWAIDYADITD
FT                   SIINIASPLAAGPDAIGYNLIMRMAILNDPDFNGGNYVGQPEGGLATARMVGMMTYRTS
FT                   ELFSKRFERFTVAESSPAAFSKEHFQIESYLQYQGDTFVERFDANSYLYLTKAIDLFDV
FT                   TAPAKDDLPAFSKIKIPYLLIGITTDQLFRIHDLRRGYELLKEWDVPVTYHEVASEYGH
FT                   DAFLVEKEVPKFEPLIRSFLSNLPVKSI"
FT   CDS_pept        complement(645089..646366)
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="lmo4a_0611"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.49"
FT                   /note="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83313"
FT                   /protein_id="CAR83313.1"
FT                   /translation="MSNEYKFETIQVHGGHTPDGDTHSRAVPIYQTTSYTFDSPEHAAA
FT                   LFGLQETGNIYTRIMNPTTAVLEERLTLLEGGIGAVATASGMAAITYSILNIAGSGDHI
FT                   VAAATLYGGTHTLFSHTFKTFGIDVTFVDPNEPENFEKAIKDNTKAVFIETIGNPDINI
FT                   VDIEKVAEIAHASDIPLIVDNTFATAYLNRPFDFGADIVVYSATKFIGGHGVAIGGAVI
FT                   DSGKFNWANGKFPKLVVPDDSYNGLSYTNDVGAAAYITKLRVSLLRDTGAALSPFNAFL
FT                   LILGLETLSLRLEQHVKNAKQVANFLNDHPKVAWVNYPGLSDNKYHELAQKYLPKGPGS
FT                   IFTFGVKGGYEAGKKVIESVELFSHLANVGDAKSLIIHPASTTHQQLSEEQQLTAGVKP
FT                   ESIRLSIGIENADDIIQDLTKALEQI"
FT   CDS_pept        646814..647341
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83314"
FT                   /protein_id="CAR83314.1"
FT                   /translation="MKTFTRILVLLAGIAMIILGIWFLFHPGISLLTSTLMFGFLLLIS
FT                   GIFHTISYFSDRKTQNVSGWVLADGILSILLGFLLLFNEFDGTLTLVLLFGMWVLFAGI
FT                   MRTIGAFTAKQNNVQGWGWILTIGIIGIIVGFIALFNPVVSAIGIVLVVAIFFIVQGIG
FT                   AIATFFFIGKNS"
FT   CDS_pept        complement(647388..648698)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0613"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="FOG: PKD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83315"
FT                   /protein_id="CAR83315.1"
FT                   /translation="MKNIKKRLIVILAFGLVLSISTPVLATEFGEQNESTTESAPPTET
FT                   STKNNSIEEQKSKKELLKASANAVVGKTNLSFKIGDTPTAQDFVTVNDDSNNPTFTFKN
FT                   GQPVTNAPGNYSIKINVTFDDNTSTDITVNYIVKEAAPLATLKTTTPVIELGSKPTPNQ
FT                   FATPAAGAKLSFKSGVPSTKKTGTFTTTIIATKDGKTSELIVTYKVLDQEPPTISVNPD
FT                   DYPFVIKGETITPSTFVTATDNSGKVTLTFKPGYEPTYSRLGMHTFVVIATDPSGNTSE
FT                   FSSYYVIVSDKPTLKAPTLDLKRSTPSILYGVTMPNLGVIAEDEDENLIGWSIEDEKGN
FT                   FTITFETPLQPGDIFALYSSTEVEYSEKTYYIYDPETLKIRELYESPSEVKTINTKKSN
FT                   TNETKKIIPKTGDTNSISLTLIGLILGGSSVIILRKK"
FT   CDS_pept        complement(648917..649609)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0614"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83316"
FT                   /protein_id="CAR83316.1"
FT                   /translation="MSLLNEENSFYNVDLLNLLKDSSEAVLPYKRIRFRRNQQILAEGA
FT                   ETDYFYIIEDGVVSMSKNTCKEDSIISFLGKQDCISPLTLLGGAKSPANYTTISEVSVY
FT                   QFERKYVLNKFLSSPDVFWQMNALMQSMVTPMLEREGYVNLPSSEKVLAGLIACGERFG
FT                   RIESDGSCLIPYYFTQKILGNYLNLARAYVATNLRKLEEDGIISLSPKPWRVTDFENRK
FT                   QNLSNTYK"
FT   CDS_pept        complement(649685..650239)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0615"
FT                   /product="BioY family protein"
FT                   /EC_number="2.8.1.6"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83317"
FT                   /protein_id="CAR83317.1"
FT                   /translation="MFMRDQKLKFLVVDALFAVIIALLAQVAIPLGPIPLTGQTFAIGL
FT                   AATILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGIIFGPTGGFIIGFIFNALLTGWL
FT                   LEKTKFTVPYAIVANILGAIVTLIFGVLWLKVSTGLDWSAAFLTGMVPFIIPGIIKAVF
FT                   AALLGVLIRDRLIKAKLLRAS"
FT   CDS_pept        650428..650760
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0616"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83318"
FT                   /protein_id="CAR83318.1"
FT                   /translation="MEVNPQFKKGVLELCCLFLIQKKDCYGYELANQVSKYIEVAEGAI
FT                   YPVLRRLVKEEYCSTYLVESNEGPSRKYYQLTVKGEIYLQELISEWNNFTDSVAKLLTE
FT                   GDAVNE"
FT   CDS_pept        650753..651343
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83319"
FT                   /protein_id="CAR83319.1"
FT                   /translation="MNKQDFLNELNQRLELLDPKERRELLSDYQEHFRNGIEAGKSEEQ
FT                   IVFDLGKPEEIAADIISERGLREEPAEADYYYVPRKNQNENRSVSKQILIGVGLFFLDI
FT                   CLIIPIMVSLWSLVISLWATVGAFLLSPVILGVGIIFGADFEFYQMFVSIGLVGLGLML
FT                   LFAANALTQLTSKATVAIIAWHKYAVKGGGRNA"
FT   CDS_pept        651336..652436
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83320"
FT                   /protein_id="CAR83320.1"
FT                   /translation="MHKHHLSKKLFFAGLVLFIIGAIGVALTMNKGNMIEKGEPLTKQW
FT                   DLSAENINSIAFSSERDVTFEWKESTNGKNYIELKGNYSANDKKAIQKLDPVSEDGTSF
FT                   NITVPEEEDWYNGFGKIYAYGQQKVTVYLTKDTKLADLEVKSHSGDINVADFKVKKFVS
FT                   STNSGELKVSNLEANTAQMATSSGDLELSNMKANSSVETGSGQTDLTNLTGDLEVNGGS
FT                   GDVNVTGVKAKKLKIAIDSGDIELTSGTVTDLAVLTTSSGDIDASTKGKVQAESNSGAI
FT                   ELAGITNDVTAKTSSGDIDVAFIKQVKNIAINTDSGEVELELPGDFKAIYEASSNSGSI
FT                   KVPTSDSNTDNRVTVKTSSGDIKIEK"
FT   CDS_pept        652539..653042
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0619"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83321"
FT                   /protein_id="CAR83321.1"
FT                   /translation="MMNFHIRKATNSDAEAIQHVAITSWHHTYQDLIPGDVQDDFLERF
FT                   YNVETLHNRISATPFAVVEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELL
FT                   EVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNHHA
FT                   FEEE"
FT   CDS_pept        complement(653090..653476)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83322"
FT                   /protein_id="CAR83322.1"
FT                   /translation="MRFIIAYLSIFVLGIFSALLVETILYDNVTPQLVFSAILFAAPVI
FT                   LVASTLGEIFYGFSKKASYFTFAIWGFAYGVVATVIILSIIQVSGMLISVGVSILVGII
FT                   MALLAVIFFFLRGGKPTSGKAATK"
FT   CDS_pept        complement(653529..653873)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83323"
FT                   /protein_id="CAR83323.1"
FT                   /translation="MLDKKIISALSYFSLFFAPVITPAIIWCTTKDKEIRHHVRWALLT
FT                   QTTFVAGVVVMILLYNNVPFSTNSADTINFLALATVFFIVFLNVSILIFNLIRGITRIV
FT                   KHSDDNWARC"
FT   CDS_pept        complement(654022..655362)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0622"
FT                   /product="MATE efflux family protein"
FT                   /note="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83324"
FT                   /protein_id="CAR83324.1"
FT                   /translation="MSSVHKVASISLFTLAWPIFLEQFLRLMISYIDVFMLGHYSDDAV
FT                   AATGVANQILVISIIIYGFISVGVQIIVAQMIGAKKHKEIENVITNGLVVAFLIGIVMS
FT                   IIFIFMSKNFLTWMGIDPHLVQVGAPFLEIIGGSSVVIAIHASILPILRAHGYVRQSIL
FT                   VPVTISIINVVGNYLFLYGPLAYLDYGVAGVGISTAVANFVGMGLAIWMLRKYIGYTFH
FT                   FKKLEQVSKKLLYSILRLGLPSAGENLSYAGSQLVVTAIIAILGTEALTTKVYASTVSQ
FT                   FVALFAIALGQASQIIIGRAVGAKEIDKAYKQGLRSWKIGLVVAIVVSVSIYLFAEPIM
FT                   SLFTTNTEIIAMTKELFLLSIFLELGRATNIIIISSLNSTGDVRFPFICGLIVMWIVSL
FT                   PFSYVLGISAGLGLVGVWLAYIIDEGVRAVLMYRRWRSKVWSLKSVI"
FT   CDS_pept        655507..655989
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0623"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83325"
FT                   /protein_id="CAR83325.1"
FT                   /translation="MIERSGEMSSKNQDLGHSVIKAFMNFKHAEIKSFQIPGYSKSETR
FT                   FIFILSRGLKSRGPKIRVSDLGHMLRISKPSVTQMIQSLEGKGLIKRVQNPEDKRSMYV
FT                   ELTEVGAGVSEKMLDEFQTSFEDMQEFLGEDDMKKLITLLEKLTDYLNTKSENKEA"
FT   CDS_pept        655997..657721
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0624"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83326"
FT                   /protein_id="CAR83326.1"
FT                   /translation="MMKLMKRLKPYWLSITAVLVLTFGQVIGQLYLPTLMSNIIDKGVV
FT                   TGDTNYIWSTGMQMLLISFASVILSVIVVYLASRISMGFGKDLRDKIFTKVEDFSLQEF
FT                   DKVGTSSLITRTTNDVVQIQNVLYMMMRLMVMAPIMLLGGIIMAVGRDAKLSLIFVVVL
FT                   PLLLLLVVILGGKAMPMFKSLQKKMDKLNRVIREGLTGIRVVRSFNRNEDELEKFEEAN
FT                   ADYATTAIKVNRLLSLMSPLMMLLMNLTSIAIVWIGSIFIGNGDMQVGDLMAFIQYAMQ
FT                   IMMSFMMLSAVFIMIPRAGASAERINEVLDMNAEILNPENPKTSTPPAKLSFENVTFRY
FT                   EGAEKPVIEDITFEANAGETVAIIGSTGAGKSTLINMIPRFYDVESGVVKINGIDVREM
FT                   DQSSLRQKIGLVPQKAVLFTGTIASNMRYGKEDATDEEIWAALRTAQAENFVSKLANGL
FT                   GSRVEQGGNNFSGGQKQRLSIARSLIRKPEIYIFDDSFSALDFKTDAKLREALKAETTE
FT                   AVTLIVAQRITSVVNSDQIIVMNEGKIAGIGTHEELKESNQIYQEIMRSQLSEEEIA"
FT   CDS_pept        657718..659535
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0625"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83327"
FT                   /protein_id="CAR83327.1"
FT                   /translation="MSGPGPGGGMRMQTTAKPKNFKQTLFRLLGYMKPRSVAIIVVFIF
FT                   AILSTIFNIFSPKELGKATTEIFKGVMSPAGIDNDKIFNILMIVLVLYLGSSLFSFIQQ
FT                   YVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQ
FT                   AITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGILN
FT                   DTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGY
FT                   VGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFEMM
FT                   DEEEEKDEIPANINQVAGEEHSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGPTG
FT                   AGKTTIINLLMRFYDVDGGQIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADNIA
FT                   YGREGATKDEVIGAAKAAYADDFIRRLPNGYDTILNEEGSNISQGQKQLLTIARAILSD
FT                   PSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGSVI
FT                   EQGTHQELLDAKGFYADLYNSQFTGAQAV"
FT   CDS_pept        659652..659951
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0626"
FT                   /product="rhodanese-like domain protein"
FT                   /note="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83328"
FT                   /protein_id="CAR83328.1"
FT                   /translation="MYQSITANDLEQDLKKAPHNILDVRDADAFVEGHIPDAINIPINE
FT                   LPEKLATLDKEKAYTIICYAGGRSERASQFLAAEGFDVTNVMGGMGAFHGTVTN"
FT   CDS_pept        complement(659996..661729)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0627"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83329"
FT                   /protein_id="CAR83329.1"
FT                   /translation="MKRMGIKVGICLLLITPLLSPFNAPVTAEENVDAQAAQDIVNIPD
FT                   PILKSYLNGLLGQPSTSDITEEQMDTITEVRINNNNLADLTGLDYAHNLTLLQLSAASI
FT                   TDYSIVTKLANLTTLDLTGYSLTSSSVPDLNGLQKLTRLTFNSSRLSNSDLTKFNQLPN
FT                   LTYLNLDRSSSINDVMSLKSLPNLATLSIQFCGVNDFRGIDTFPSLTNLAAYGQNVGSA
FT                   VPIETDITSADLNYNKTNQTIFIPFTLMTGRSINFDGVPFPFTTDASDASTYFTLNNQQ
FT                   IDGSRLTIDDKGITVSGITPEYLRTITKMEYNAFYNNPAGSYATPPNFTSYYVSGGTYD
FT                   QFFDITQVLVITNDSAINYTEKATVTEEQFLTDIHAETEDGTPVTSDFNIVVDFSKPGV
FT                   YTVTLNATNADGLQATPKQVAVTILEKPVITADKSINYKVDSTKTAEEFLTDISAKTSD
FT                   GSEVTSDFDSVVDLTKIGTYKVTLNAVSVDGIAADPVTVLVNVVSSEEPPTPPNPTPDP
FT                   DNPAVNPSQPTNVDGTTSPNASGDNVILPYTGDENQATTVLIGIILAGVAILFFRKRKH
FT                   S"
FT   CDS_pept        complement(661901..662527)
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="lmo4a_0628"
FT                   /EC_number="3.1.4.14"
FT                   /note="Acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83330"
FT                   /protein_id="CAR83330.1"
FT                   /translation="MTNVLFIKANGLPAERSVSVALYEIFLTEYKKSHPDDNVTELDLF
FT                   EADLPYYDVTMMSGLHKEAAGETLSPEEKRLADIANSYLDQFLAADKIVMAFPLWNFSI
FT                   PAQFLTYLFYLNQAGKTFKYTANGPVGLVADKKIALLNARGGIYSDGPMQSFEMSLSYV
FT                   KNVLAHFGISEPEMVIVEGHNAKPDQAKDIISAGAKEAVELAKIF"
FT   CDS_pept        662696..663151
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0629"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83331"
FT                   /protein_id="CAR83331.1"
FT                   /translation="MEVKKLKPCTERSELLYRMHLLSKEISHVFEQQTNMSFTKVEILF
FT                   HIQQTPGQSQNRLREKLYIDSASITRHLKRMEEQGLIVRKKQDENKRYTYLFLTSAGEA
FT                   ELATLLLEKEKFQNEALEAFSEEEVSALLKSVTKMMNNVEKMEEKLK"
FT   CDS_pept        663148..664089
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0630"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83332"
FT                   /protein_id="CAR83332.1"
FT                   /translation="MKAVVIENYGGKEELKEKEVAMPKAGKNQVIVKEAATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDEVFARPETTRFGTYAEYTA
FT                   VDDHLLAPLPEGISFDEAASIPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTLAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEERAKEKNVTATGIWLQPNGEQLKELGKLLANKTVKPIVG
FT                   ATFPFSEKGVFDAHALSETHHAVGKIVISFNK"
FT   CDS_pept        complement(664187..664429)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83333"
FT                   /protein_id="CAR83333.1"
FT                   /translation="MHPIEQLLANKNITATDIETTTRLKHGTLQKLIDKDIRTSDISLR
FT                   VLSQMAIFLNTGADIVAKQLSDIEVANDHAFLIED"
FT   CDS_pept        664538..666289
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0632"
FT                   /EC_number="3.1.4.46"
FT                   /note="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83334"
FT                   /protein_id="CAR83334.1"
FT                   /translation="MNDLKDSFKVLYQFKTDYLKVTLLLTILQAFVIGPFIYYFFFFIL
FT                   RIIGVPGITDANLGEIFSSPVAIILLLVLALLILLFVYYELGFFILMAIYQLRGENYTV
FT                   FKIIQRLHVKAKYFLSYQAIYFLLYFFLLLPIAGLSLPISITENLYLPHFITDELMKTT
FT                   TGMWFYVITIAIIFYISARLVFALPYFIEDKSLKISGAIRKSWKYPQKRLFGMLLKWVL
FT                   IIVAIGFLVSIIATLIMLPLFLIEKINPGIAMVVAGITLTILQVIGFFAASFFQGIIAQ
FT                   LLVKNAFLIEEQPASVSRNQFPHKKRFILVGIIVFLIFSGFNIYAVNATLYEPNTKIIA
FT                   HRGDTMNAVENTVEAIESAAKAGADYSEIDIQETKDHQFVVFHDMTLRRLAGNSKRVAD
FT                   MTLKELQQTKVSSGDYSSHIASFDEIIKTAKRNKIDLLVEVKLHGGESSDMVERLVALL
FT                   KKEKVTDKYLVQSLNQPVIEKIEQADPTLKTGIILALNIGNLPKTSADFIVLEDFSINK
FT                   RLLTQAKQNNKMVFVWTVNKEKLMQMYLRKNVDGIITNYPKKAIELRDSFSENDSLRSR
FT                   IENRLGF"
FT   CDS_pept        complement(666329..666823)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0633"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83335"
FT                   /protein_id="CAR83335.1"
FT                   /translation="MKKLKSVLLLMGIVTFALALTACGGTEDKASTEKPETAKAETKKK
FT                   ADSNELGDYKVEILSSEVVKDLSGKDAIAIKTKFTNNSKENISFMVAIDQQAFQNGTQL
FT                   DTAIATDGGLGGVDKDVQPGGTLEVTSTYTLQDTQSKVDVEAKELISLSKNSVKKSFEL
FT                   K"
FT   CDS_pept        complement(666903..668045)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0634"
FT                   /product="protein kinase domain protein"
FT                   /note="Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83336"
FT                   /protein_id="CAR83336.1"
FT                   /translation="MGEMTLAFIEEQYKELDNLNNKENPAVLTRNTSTGELFVRKIIPS
FT                   SFAPVIEQLKNLSSKYLPKIEAMIPNGNQLIVYEEYINGKNLADLMKANATFDADEVTR
FT                   LMLMLSDALTELHANAIIHRDIKPSNIMISSDGVLKLIDFDASRVFEVGKNQDTVNLGT
FT                   IGYAAPEQYGYSQTDARSDIYSIGVLMLELLLGKNTLPDKEQATSLEKIAMQAAAFDPE
FT                   QRYQSIQDFRTAVKNDSLGPSYVSELSDFTELDNFSTEPDWEKVSADYEKDFIPWYKHI
FT                   PGFRTGTPWKMVVGVLGYIFLLFGLFTPPTEGVKMSPIVNFFNNFFLIVPAFVIFTNLC
FT                   GIWSKLPLLKSSSPSTRKAGIVIYIIVCISIYGIYNEIFS"
FT   CDS_pept        668152..668607
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83337"
FT                   /protein_id="CAR83337.1"
FT                   /translation="MDGEKETSKLLHELKKATNLRQVLDENEAEFKSSEMVTYLKELLA
FT                   EKKLTKASVIRAARLHETYGYQIFSGVRRPSRDRTIALSFGFKLSGLEASRLLKYTEYP
FT                   PLYAKNRRDAIIIFALDHGYTLDQTNDSLYDLEEALIETYKEEKPLI"
FT   CDS_pept        668663..669055
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="Phage envelope protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83338"
FT                   /protein_id="CAR83338.1"
FT                   /translation="MINEQTILQAATSEKNAGDFPKVVQGFKDLGVTKYQFLVEKGVYV
FT                   FWDEMGNQVESKLNGVSMPVSEEISRDNMKDAIKQAQAGKIDFEIFIKLAGLAGVRLWE
FT                   ADLTAMKVTYIDNTGNDLVIEPIPSI"
FT   CDS_pept        669152..669892
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83339"
FT                   /protein_id="CAR83339.1"
FT                   /translation="MDMITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAVTSIPTTFLGAMVNQMLPEAVYRFLYGA
FT                   LIVVLLGIMIWKKKRHNEKPHFLSEYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLL
FT                   DEKWIAILFNVLLIALFALNLIKI"
FT   CDS_pept        669978..670256
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83340"
FT                   /protein_id="CAR83340.1"
FT                   /translation="MKKSWPDFAAFLLTILTVTWIILTWGLHISDIVPGGEKGVLYKLI
FT                   PLFLGIISTISVFFVKEKLIRWILLGFNILLLILIYFVYHIGEIGMF"
FT   CDS_pept        670272..670538
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83341"
FT                   /protein_id="CAR83341.1"
FT                   /translation="MDEPTKAVIYQILSRTEEQNATMDHLVFEMMQFPGAADFTKNELL
FT                   FGIYWLETYHYIFRMNENQKTRYYRTEKGHEKLAELELLKKNS"
FT   CDS_pept        complement(670577..671020)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0640"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83342"
FT                   /protein_id="CAR83342.1"
FT                   /translation="MTASDLEDFLSTAITDYANEKVEAGTWAEEEALAKSQDSFNKLLY
FT                   DGITTPNEYLYSIISGEKIGYIWFHVDETRSGKHAFIYDFVIFEAFRGKGFGTKTLEAL
FT                   DKLAKDMEITKIELHVFAHNQTAIGLYNKVGFQNTDITMAKYL"
FT   CDS_pept        complement(671051..671752)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0641"
FT                   /product="lipase/acylhydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83343"
FT                   /protein_id="CAR83343.1"
FT                   /translation="MKKTIQSVGVWGDSIMKGVLFNPEKNRYTLLKNNCIKRASEKLGL
FT                   TFQNHSTMGRTITKGHEILTKDLAKDATNDIAIIEFGGNDCDFNWTEVSENPTAEHIPS
FT                   TPLNIFETQLLEMIARLKKLDIKPILMTLPPLHAKRYFEFITRNGLNKDNILQFLGGDV
FT                   EMIYRWQERYSNTISRIAAETGSHIIDVRDSFLAEFHYENLLCADGIHPNEAGHIAMSQ
FT                   KFIQYASFHKA"
FT   CDS_pept        complement(671837..673516)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83344"
FT                   /protein_id="CAR83344.1"
FT                   /translation="MWKKHKWLIIAVLLLVIYVAPLFILGGNSHVRIHDNLDSNVTWYK
FT                   MVLNSGDYTAKVGTANIDQIMDDSVPRDSFDSEFVGIDWLYMIFSTPIAFAMSQLITRV
FT                   FAFLGLFLWARDYLIKDKKYLVPLYFVSLAFALTPFWPSGMLSTLGMPLALWAFLNIRN
FT                   NKRRIWNVIILTLLPFYSSLILGFCFFLVMVGCIWLYDVMKKKQVNIRFLLSIIYMGLI
FT                   YILVNYRFIYGMFLHAKPDSRSEFSLPNLSFSSSIRLSFKNFIYGHTHDQALAGFVILP
FT                   VLLLVLVLIIVKREWVKEKLFLWLFGFNLFLSFWYGFWWYRGWNGLKEHVEIMRTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLIKKGNWWRKLGYVAIALQLVVVFANNSEIYYRTGNDSP
FT                   SINQFYATEQMEEIKDYIGKPQSSYRVGSIGLHPSVSQESGFYTVDGYVNSYPLAYKRA
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYLFSAELGKNYDFGKDSKKHIKQLDFNSEAFKK
FT                   VGGEYILSAVPIDNASEVGLQFEKAFDNKESYWKIYLYKATK"
FT   CDS_pept        673820..678556
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0643"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83345"
FT                   /protein_id="CAR83345.1"
FT                   /translation="MLKHNWQKVFVVMVAVALVFQLVPWSNIFAGAEGNQTKTTQPDNQ
FT                   KVADENKTTVIPDNKETTKKLVNGKQLLKGSVDWNFTNKVTDANGNTKETYAPGDSLKF
FT                   SLSLAIPSYSEAVLDETYTFWIQKDFFQGDKVTFVNPAIDGLTPRQNVFTDDSMKNSIG
FT                   TKTINGVQYIGYTLKFNQSPEALAKYEDEPLTNAKFDMFATISTTITTKEDYQAIVIED
FT                   DKDVDISKIEVPVTPPTPDTDNGVLTASKVIDSAWRLDKDTGKYIKVATSSTNYTPEKD
FT                   DLVFYYVYATNNSGENTVLEKMVDELPAGFSIITEGSPEWQALSTASGSSLQRGWIASA
FT                   DQTNLAPGATRYELPFSPAQTISKNGGGIYRTIAAKVTDPTKDLTNVTKSPTKGGEGKS
FT                   GSVTPSGKDVYDMAITTKISSTYDKNNKYIGAVSSTTTPVSISEGSTVGVTYTAINQGN
FT                   YTKDVVVYAYVPAGYELNNDTSDFKNTNDKWKYETTVPSGGGVWSDIKVYSITLSGGMA
FT                   SGATATATMYMKAIGMPDDGTYSAVDFYMAGEIGSFSNFNGDSTLDGAITDVDSTPDMN
FT                   PGNDLISNVDGSTVKPIDGFQKEKPHVVKENAKSTATLQDEDDFDFDYVTFIKTPEVIP
FT                   SEGKVFEKTRLSAADAEKTARNMIGSDIMGSALKDYTPLADDGRITSPKTYMVYEMNIN
FT                   PSGVEDTLNSSFTDTLPKGLKMLEYDIAGLNSSNKHIYGFTTNKFEGTPKFTNADGQDV
FT                   IVYQKGLYSEKQVCIANSTLNDVGVRYFGNNADKMGVTGSVTKDARTLTLNFGQPSADP
FT                   MYSETKAAYKVYMIVVIDPDEIDYSSIMQNKATYTYNDKVITSYENSEMYWDAGGGTAY
FT                   AKKYVLDNKTNAYVSGSQYNVATPDADGNLSVGYKIRVRSAYEFDKSSINIGDVIAADN
FT                   FKSISNVEVNGYEASPNTGFQIDGELENPVPLAADKYAVEAKATANTLDITNPADIPQM
FT                   QLYNVLFKVNYQKVKYGAKLVNQAAGSEVATVVPLNLNLLKQDDISKTALTGYEFKAYY
FT                   ADENGKADLTKPVKDTNNNEIVMTDSSGAANFIPTGYKTTSKNQEWNVVLVETKTPTGY
FT                   ESNENKEYPVTVKSDANGNLSIPTSTETGLEITNDDHGAATATIDNHADVKMIDVNGAK
FT                   TWTGDKEADRPDSIEVQLLQDGVAYGSPITVTKADNWKYEFKNVPETNADGTKYTYTVL
FT                   ENTVANYTSAVTGLDINNTLIKPDVKMINLDGQKTWKNDTENDRPASIEIQLQQNGQDY
FT                   GFPVTVTKDNDWKYEFKNLPETTNDGVAYNYTIVEKAVPGYETKVDGMNVINTKIDAPK
FT                   TTVSGEKTWKNDTAKDRPDYIEVQLLQNGQTYGDPVKVTKENDWKYSFKDLPKTDANNN
FT                   AYRYSVTEKAVPGYKTTTDGMNLTNTKVTDEKNVTTASGTKTWVGDNEKTRPDSIEVQL
FT                   LQNGKAYGTPIKVTAKTNWKYNFTNLPEKDKTGEKYSYTISEKQVSGYSVKVKGMDLTN
FT                   TKVTKTTPKETPKNTHSTNKPSKTKKLPGTGDTNGMLLFAGGLVLLFLGLHLRRKSTK"
FT   CDS_pept        678649..678927
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83346"
FT                   /protein_id="CAR83346.1"
FT                   /translation="MMKEELLQAIEVGEPVLLVTAIGYIVGIVETKGELIRLNDVYINC
FT                   VSASRVNRFSRGLAVNVNQVIGMQLLSKSEKDEMIGGWKAYVAPTAG"
FT   CDS_pept        678970..679497
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0645"
FT                   /product="hydrolase, isochorismatase family"
FT                   /EC_number="3.3.2.1"
FT                   /note="Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83347"
FT                   /protein_id="CAR83347.1"
FT                   /translation="MILLVVDTQKLIMTNNLYNFDSLVPNIERLITNARKNKIEIIYVR
FT                   HDDGPDTELTNGKEGFDIYEKFQPTKDERIFDKTVNSAFKGTGLLAYLKEKGTKKIVVA
FT                   GLQTDFCIDATVKCGFEHGFQMIVPAHANSTEENHFMSGENSYKYYNEWMWPDRYATCI
FT                   SIEETINEMENN"
FT   CDS_pept        679584..680288
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0646"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /EC_number="3.-.-.-"
FT                   /note="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83348"
FT                   /protein_id="CAR83348.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFENAFKATFGKADHLKIENLYIKSRFY
FT                   SDEVYHRVVRGEMPKAEMHVYRITQALNDFDYQITKKEAEAFQHAYEQNQRKIELTSGI
FT                   KEILTWAKKNHITMGIITNGPKEHQQHKINDLQINEWIPAEHTFISGGVGIEKPDKKIF
FT                   ELVEKQIGINSAETYYIGDSFENDVIGSKSAGWHSIWLNRRDHLEPKDAAYHPDYCVEN
FT                   EQELFTLLQKIF"
FT   CDS_pept        680402..680818
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0647"
FT                   /product="transcriptional regulator, Rrf2 family"
FT                   /note="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83349"
FT                   /protein_id="CAR83349.1"
FT                   /translation="MKFSKATNYALHTMVYLANLSPEKSVGVKELATRQNVSPTYLSKV
FT                   LTMLVKAGFIESVTGVNGGYKLAEPASSISFLDVIQAIEGKGAFFHCDPKNHSESQPHC
FT                   LIGEVMNKAEQQMEDYLSKQTVGSIVVEIEKHQH"
FT   CDS_pept        680833..681426
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0648"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /EC_number="2.1.1.-"
FT                   /note="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83350"
FT                   /protein_id="CAR83350.1"
FT                   /translation="MKHHHNHHGEAGFKRKVDYLDRPERSEVLSPEDFLQAMPIGKTAS
FT                   ILDLGAGTGFLTIPAAKLVDNTVFALDLDAKMLELIESKAKEAGLANVETLEASMDDIP
FT                   LEANSVDVVLASLVLHEADSLADVLREVSRVVKTGGYFASLEFDTKGTDLKGPPMEIQI
FT                   SAEKLKEELAGFGFEVVKNWQLDEGMYVSIAVKK"
FT   CDS_pept        complement(681492..682280)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83351"
FT                   /protein_id="CAR83351.1"
FT                   /translation="MSLHNKNILPPLWLAYPEIERYSIGWRMGYGEDYQTKFFEWWETL
FT                   SSSEKLEYQTLFPEPITWDGWWEDKHPDEIISHGDFCVPIWEQSGLPKYNFNQMKNENQ
FT                   PELYLFENCYFSHCWMEEFSVSTQKYCCMEQFMIEQKAELFNDTTTKQKVLETNSLEQI
FT                   QALDKEVQSFDQDIWDKFKYAIALYGNWNKFNQKRILRDYLLSTGYSILVETNPSGSPN
FT                   MPNPLKRHGQNLLGLALMELRDELRRVWENESLCDWNLVK"
FT   tRNA            complement(682420..682509)
FT                   /locus_tag="lmo4a_tRNA11"
FT   CDS_pept        683379..683990
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83352"
FT                   /protein_id="CAR83352.1"
FT                   /translation="MKKTFLKHVVAPIIVALLVLTPITHVSAAVRNVDTTPVITQDEVE
FT                   SGIQDNSDELPDEFIVRDQISPNEPVSQERQLLKSASLGYEKWTKVSKTRKVTKGFIAW
FT                   HPEWKNYQYNVSGYFFSNAKVSVSASVGYGKFSFSVAKSSSAGQYIKADPKKWTRPAIY
FT                   GNVDITKYTVKKYNGAGIYTGSTTKYTNTATETFIKSRNK"
FT   CDS_pept        684084..684374
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83353"
FT                   /protein_id="CAR83353.1"
FT                   /translation="MLYRDNLVEMMQVDDVLYIVTYEPAKKEDALEKIGEIEHRIRHYR
FT                   IPNENFTSNYLSEGTEVYKAKNGDEFPRTILFKEDGEYFIASEAMKQPNKK"
FT   CDS_pept        684782..685315
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83354"
FT                   /protein_id="CAR83354.1"
FT                   /translation="MERKLVQEINLLENKKLVMNLNIVAIVIVLVLTVLGIVFSGGFQI
FT                   TNGLAGVMWLGVGYLVAIIIHEAVHGIFFKAFRPEAKVKFGFKNGMAYAGSPGAFYTKA
FT                   QFFIISIAPFIVLTGLFIFLRFLGVNEAVLYLIFALHTSGCVGDFYYCILLINQPAGIV
FT                   VEDTDKGISFYSEG"
FT   CDS_pept        685379..686296
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0653"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83355"
FT                   /protein_id="CAR83355.1"
FT                   /translation="MKRITIGNSALTASEISLGCMRMADLSKEDANKVINTALENGIDF
FT                   FDHADIYGGGKSEEVFADAIDMNATIREKMILQSKCGIRQGFFDFSKEHIIASVEGSLK
FT                   RLKTDYLDTLLLHRPDTLFEPEEVAAAFTELEKSGKVRHFGVSNQNPGQIELLKKYVDQ
FT                   ELIANQLQFSIMHTGMIDTGFNVNMTIDPSLDRDGGILEYSRLNNMTIQAWSPFQYGFF
FT                   EGVFLDNDKFPELNKVIDKIAADKGVTNSAIAVAWIQRHPASFQTVVGTMNPGRIADIA
FT                   KASDVTLSREEWYEIYRAAGNQLP"
FT   CDS_pept        686562..688442
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0654"
FT                   /product="heavy metal-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83356"
FT                   /protein_id="CAR83356.1"
FT                   /translation="MKEWMKQNWQFITTGISGILIVIGCLVGSEVGDFWTAVIFLSAFV
FT                   IGGFEQAKEGIQATIQTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYT
FT                   TNKSKREITKLMAFQPERAFRLLPNGDLEEVAAKELQLDDMLFVRPGESVPIDGVIVRG
FT                   STTLNEAAINGESVPATKTVGADVFGGTVNVSSAITVKVTQTFDNTIFSKIIRLVESAQ
FT                   SEPSKTARFIERFEDAYVKAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCAL
FT                   VASVTPATLAAISNGARHGILFKGGVHLENLRGVKAVAFDKTGTLTNGTPELTDRLFAE
FT                   NVDKQQVINVVGAMERQSLHPLAAAITQDLEAEITEKLTEIEVTDVPGWGVQAVYREAI
FT                   WQVGKAGFVGNEEARVFSNGAFERLAGEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTI
FT                   KALQAKGIKTIMVTGDNEQTGAAIQAELGMDYVVSGCLPEKKVDVLKELSVTYGSVAMV
FT                   GDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIPYAYNLSERLHWITWQN
FT                   ICFAIAVILVLITANVFQLINLPFGVVGHEGSTILVILNGLRLLRSNRKK"
FT   CDS_pept        688538..689266
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83357"
FT                   /protein_id="CAR83357.1"
FT                   /translation="MKKINWTQWIALFVFASMGISVVFTIYEIFTAPIKQPATGPHVTL
FT                   RGDYIFLLFEIILGIFILLLPSIIARRFKFEIPGLVYILFIVFLYGSIYLGTVQKFYST
FT                   VPHWDKILHTFSGAMLGAIGFSFVSLLNANNKVVMKLKPGFIAVFAFCFAVTMGAFWEV
FT                   YEYTFDGIMNLNMQRYNLSNGTPLTGRAALEDTMTDIIVDIIGALFIVIVGYFALKKGR
FT                   PWMERFEFKRKNWKKEPKKK"
FT   CDS_pept        689406..690056
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0656"
FT                   /product="transaldolase, putative"
FT                   /EC_number="4.1.2.-"
FT                   /note="Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83358"
FT                   /protein_id="CAR83358.1"
FT                   /translation="MFLDTGNLEEIKKALQFPFFEGVTTNPTILLKENKPRNTHIANIP
FT                   AKVVFVQAAGLTEEEIWEDVLRIQAIEPAEGTVIGLKIPAHEAGIKVIAKVRANFPNEI
FT                   ILATAIFSSEQGYIAALSGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLEDVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHQAALPK"
FT   CDS_pept        complement(690097..691917)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0657"
FT                   /product="sulfatase family protein"
FT                   /note="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83359"
FT                   /protein_id="CAR83359.1"
FT                   /translation="MILFYFLLIIGKFTFAYFQIFKDPNFLALGMDLLFIVLLLGLIHL
FT                   FAPVRSHIYWYAGMSLFIGILMLVCVLYARFYNEVPTYHSFSLIGEVGVVKNSASSLLS
FT                   GTDWLYILDIILLPFILYFHIKKGHEFPSFRLTSRVYGVSFISTLLVLSGFTYFMMQQN
FT                   IISDSKRAKRMGIFTFNISTALTGADHVKAADITAKNVNDIKGVSVKSNPDYFGAAKGK
FT                   NLIIVQLESFQRNLTNVKINGQSITPTLDSLQNETMYSNQFFQTVSKSNTADAEWSVYT
FT                   STFPSGYYTNTQTYGDRVIPSMPRLLGKNDYKTATFHTNDASFYNRDEFYPAVGFDKFY
FT                   DRKFFGDEDVIGFSPSDEVLYNKAFPILEEQYKNNQKFYAQLISVSSHMPFDIPKDKQE
FT                   IDLPSDLKDTELGNYFEAVHYADKQLGEFIQKLKDSGIWDDSVVVFYGDHHIIKTDQLP
FT                   EEQKKYVNRSTQLKANPADDYRIPFFLHYPGMENPGEIKNVGGEIDIMPTVMNLLGIKT
FT                   GDQIMFGTDILNSSNNYVPERYTMPEGSYFTNSYMYQPDESFETGAATNYDGTNKELSS
FT                   DVKKRFDASRKLLQYSDSYVNNLPLRDEDK"
FT   CDS_pept        692152..693543
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0658"
FT                   /product="amino acid permease family protein"
FT                   /note="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83360"
FT                   /protein_id="CAR83360.1"
FT                   /translation="MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGI
FT                   FILPGTVAAKNAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHISIPKAISGSFNPEVGTFINLPAI
FT                   IIVLVIAFLLTLGIKESTRVNTIMVALKVGVILLFLVVGVFYVKPDNWQPFMPFGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKNPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVINQDWVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEINQKYQTPVKNTWIFAVIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKDIQARGFKVPFYPVLPIVSFLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHS
FT                   ELLKK"
FT   CDS_pept        693632..694471
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0659"
FT                   /product="glyoxalase family protein"
FT                   /note="Predicted ring-cleavage extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83361"
FT                   /protein_id="CAR83361.1"
FT                   /translation="MVEISEELRLGEVVLNVGHLKEMAGFYQEVIGLKLLEENERMVRL
FT                   GVSGSDEALLVLKKIDNAVVPEVPRIGLFHTAFLLPTRESLADVLLHLAKSGYPIDGAG
FT                   DHAYSEALYLHDIEGNGIEIYADRPKAEWMRDGDGNLPMVTEQVDVDSLLQIATGEPFT
FT                   GMPNGTIIGHVHLQVADADKAEQFYKEALGMNLTTAIPTARFFAAGDYHHHIGSNVWAG
FT                   RNLENRGENETGLGWFTIITPDKEAITANLEQQGYDVKRIENTISVTDSNGIKIHFK"
FT   CDS_pept        complement(694555..694839)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83362"
FT                   /protein_id="CAR83362.1"
FT                   /translation="MEFMSMIVTGIVLAATVSGLSFVVSKLSGLSWFWIAFCANSGFFI
FT                   TFLAVQNSFPDNAALALSYLNLGIGIFLILQTIFQSSNWFFKKTMQRKH"
FT   CDS_pept        694937..695887
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0661"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83363"
FT                   /protein_id="CAR83363.1"
FT                   /translation="MIEFFKTTNGKMEQLSALEDGCWVKVTAPTDEEIEILSKEMDVPK
FT                   PYILDALDSEERSRIELKRAEQDVRHSLVIVDYPYESKDELGYAMYETLPIGIVLTRKH
FT                   LVTITLRDLPILKDVESMKLEEYDTTNHKQFLLKLLYAVSYYYLKYLNQIIKQTNNLEI
FT                   QIKQSMKNEQLYAFMAVQKSLVFFATALQSNKAILDKMEDVEHFMQQEDNHDLLRDVII
FT                   ENKQAIAMTDTYTQIISGMSDVFSSVISNNLNIVMKFLTSFTIILSLPTIVASIYGMNI
FT                   KLPFMHNEHAFALILLFTLLITTGVTVIFWRRKYF"
FT   CDS_pept        695911..696552
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0662"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83364"
FT                   /protein_id="CAR83364.1"
FT                   /translation="MEKQTYEKLAYYTIKEKILSGKLHVGQHISEAGIAKELSISRTPV
FT                   RKAIAVLVSEELIEYELNRGAIVIESSMSAGRFIELLEMAEILVVQTIEKCKNKNLTYK
FT                   PEQGNALLAEMREIQKEEDVEAYLSLLSKWLLQFVAQLANSYAEDIVRKMKRDFFNKAQ
FT                   KDIKIIPVLLEEETMETLEQLTYYMVEKKHDLAKEVIQKLVNLYIIRTFR"
FT   CDS_pept        696595..699285
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0663"
FT                   /product="phage infection protein"
FT                   /note="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83365"
FT                   /protein_id="CAR83365.1"
FT                   /translation="MRKVYEIFILDWRRLFKAPLALLLVIALIILPSLYAWFNIEALWD
FT                   PYSNTSGIKVAVSIDDEGAEIDVPGKKPQQVNVGDQLKKTLEKNKKLGWTFVSEDEAKK
FT                   GVKSGKYYASIHIPKDFSEDMVSVVNDNVTKPTIDYSVNEKINAIAPKMTESGATTIVN
FT                   QISSEFVGTVSKAVLEEFNKAGIDLENELPTIRRLKTKVFQVQDALPELKKMGAEAVKI
FT                   EAKLPELKAKANQVVELNEKIPELNKATENVLLVEQQLPKIDQLGQDILVLQKKIPEIK
FT                   QIAESVKEVDENFGTIKKTVNDAVNESGKALDVIDTAMEAIPTVEKIAQNGSGYVDKVS
FT                   DFADEINKSFDTLAPAIKQNLTLMKQMADNIYQVTEAIKNGSITPEQAITELKKMEQDI
FT                   DSLQQMITKQTATLESLNETLPNKPFTDLITNLKTINSQLGAQKETITKVRTELENGAQ
FT                   PSEELLNQLNEQAKNVSAKLDQILANYDSEIVPAIKVGLNQIQGDLKDSQKLLETLQAK
FT                   IPEITQVLKDSRETLQTGQTYLKEFQERLPEIQKTLDEATKVINTKLDTIIAGINEAAN
FT                   FYQNDYPNVKANIKKAANFIRDDLPGLEKEINQASGLIQEKMPEFEKAIKIAADLSREE
FT                   LPEFEKAINNAANKITDFDKNYDLQSIIKMLRNDADKDSSFIANPVKLKETSYYPIPNY
FT                   GSASSPFYTALCLWVGALLLISLLRVDVEVPAGIFSHYHRYFGRLLTFLSIGLMQALIV
FT                   TLGNIFLLGVSIAEPLLHVLFSMFISVVFMTIVYTLVSLFNNVGKGIAIILLVLQISGA
FT                   GGNFPIQVSPPFFQAIYPFLPFTYAVSLIRESVGGLYMPTVWIDMSVLAGFAILFIALG
FT                   ILLKKPLDKVVPKLSEKAKRSKLIH"
FT   CDS_pept        699331..699978
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0664"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83366"
FT                   /protein_id="CAR83366.1"
FT                   /translation="MANKFKTLDKMVYNLLLEKIKNGELVANEHLAEEKLATEFGVSRS
FT                   PLRKAIATLTAQGIVSYHENSGAVLNDCIIDSARYVQLMETIDIFVDAAIIKAAHYGYE
FT                   MDLEKLNERAQEMERFSYLTDIENYYDAHHRFILCLISFAENPYQVRIVKQIFFQMVHF
FT                   SDGINMFKSVEIREWTNKKSNQICELLAEEETELARKTIKSMFAELTIQAYR"
FT   CDS_pept        complement(699988..700524)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0665"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83367"
FT                   /protein_id="CAR83367.1"
FT                   /translation="MNQNKITAGGLEFLVRFALPTDRLKIHDLMMDTARWLKESGSTQW
FT                   SDILHGFDVHNMEQRIELGEVALFETEAGALAGAMIIRKTPSDWDTDLWEDLAIDTAYY
FT                   LHRIMVSRVFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNETLNQMYVRYGFQFSG
FT                   KKNGFYLYQKELSQK"
FT   CDS_pept        complement(700511..701515)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83368"
FT                   /protein_id="CAR83368.1"
FT                   /translation="MMTISQVKQTAKESLRGNWGIAIGIFVLAWLIETVGGGIIGWIPV
FT                   IGWIAIFLLTGPLYTGVAWVYLAISRREQPDVAYMFSGFKQFGRTVLAYLLISIFTFLW
FT                   SLLLIVPGIIKTYSYSQTFFILRDNPNISALDAITESRHMMNGHKGRLFGLSLTFLLWY
FT                   LIPLAVAIAGTVIVAGGMATTSYTADPAEVLSALAAGATFGGLVLILASWLITLGISLY
FT                   VYPYLITSIAVFYDDLYAATEGTFTEETVIVEEEVTPFGTTEADPFVEDTHPEGFGPEA
FT                   TKEPETPVVPEAPEAPETPETPEVPETPETPEAPETPEAPETPEAPKDNNEPK"
FT   CDS_pept        701703..701912
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83369"
FT                   /protein_id="CAR83369.1"
FT                   /translation="MAHENLRELEDQLIELRQTYQEVISETRDFEDPQLQNGPINAAEV
FT                   RLSALRHEIAEVEKKIKKAEKETE"
FT   CDS_pept        701980..702687
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0668"
FT                   /product="serine/threonine protein phosphatase family
FT                   protein"
FT                   /note="Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83370"
FT                   /protein_id="CAR83370.1"
FT                   /translation="MKPIFAVGDVHGEITLLDELLENWDKERERLLFVGDLIDRGENPA
FT                   AVLRRVKALADQTGAIVLKGNHEQMLLDFLENPSGKMHYYLSQGGMETIQSLIADSLDK
FT                   KMTPEGLAERVKEEAAELIDFIRNLPLYYEEGKYVFVHAGVDLTKKDWHDTEERDFFWI
FT                   REPFLFGQNKTGKVFIFGHTPVQNLHIDESSGIWVSEDKTRLDIDGGAVFGGELHGVVV
FT                   EEKVITKSFSVKK"
FT   CDS_pept        complement(702733..703296)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83371"
FT                   /protein_id="CAR83371.1"
FT                   /translation="MEQNKEKLTKPTSDKNYFWPIMIISFVAVVVILLLFFSPIGYQGA
FT                   VHFDITIFPRMNAIFNSFTFVFLVIALWAIIKKKNIKMHRGFILAAFTSTLFFLVTYLT
FT                   FHYLSAETSTFGGTGIIRPIYFFILITHSFLAAIVVPLALFALVWGWTMQIEKHKKIVR
FT                   WTMPIWLYVSLTGVLVYLFMAPYY"
FT   CDS_pept        703416..703832
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83372"
FT                   /protein_id="CAR83372.1"
FT                   /translation="MSIIARELTKAEEAEIIRLKEEGEVMLQTDGTPEERIEKITEYLK
FT                   NTSPDPDLAEELGYILGSLYGEAVREKYEWRWLFVSENDLEGYAITSKEHGYTFMVHDY
FT                   FMQVIVQNKPDNSKMLFELMVDMTGNRNDFRMIG"
FT   CDS_pept        703874..704503
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0671"
FT                   /product="endonuclease III domain protein"
FT                   /note="Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83373"
FT                   /protein_id="CAR83373.1"
FT                   /translation="MNVNEQKVLVLNNLVKHYGYQDWWEADNRLADWLSMILIQRTTEK
FT                   NAKQALANLAPYLDLDCLLEMDKAKLEELIYPAGFYKQKSIYIKALAEWFYGHGASLDK
FT                   FQTYSTEALRKELLGIKGVGEETADAMLLYIFERNVFIADLYARRLFTRFGFGEYTTYA
FT                   QMRDEFMPIIENIPHKLCKEWHSVIDVHGKHFGKDKSMNEAWLLES"
FT   CDS_pept        complement(704500..705396)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0672"
FT                   /product="transcriptional activator, Rgg family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83374"
FT                   /protein_id="CAR83374.1"
FT                   /translation="MVGYGKTVRDIRTSKGIHQKDLYDNIISKSFAIEFEKGKHDITLT
FT                   LFEKILKRMNMDLDEFFYIHRELSVSAEKNYLCMNQEHGNIYDLASLELLYSELSKHNG
FT                   ELVEVWKAFVRSRIKLVEHLFKYHEFTVDVITSKDKCTIQKYLFSIDTWTLEELKICAN
FT                   SIYFFEEDLQIQFLNQVIKAIHSYKNYDRARRVLCTLLINTIEMFISRGQLSSANKLII
FT                   LLDSLCLYNESAFYRNISHFLKGLVKMQNNHIQEGYKQAKKAIQIMNDLRFEEIAYLYE
FT                   ILLDQFIRIKGINIVKS"
FT   CDS_pept        705630..705911
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0673"
FT                   /product="transposase OrfA, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83375"
FT                   /protein_id="CAR83375.1"
FT                   /translation="MAKAKYDENFKKSLVALYRRGKTKHSICQEFSVPNSTFGKWIKKF
FT                   NNDDNIESNEILNILQAQELKKQRALLEEELSILTEAINVFENPPIKN"
FT   CDS_pept        706195..708924
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0674"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="FOG: PKD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83376"
FT                   /protein_id="CAR83376.1"
FT                   /translation="MKKILHIVIALSVICSIILVPVDWSAKADGNNKRDDLIKSVSFYN
FT                   SNGQNVTAKENYNEKLNYFLEVAFGGNSFQKGDYFNITLSSDALLYTEKAYDLKVDIDP
FT                   TAVTNEQVVGKVTVEKINGSPTLHFLFTEDSESFFINSFDASFKIQVMPAHGDKNVINL
FT                   SYSGAAKNFKNIGTSSVEWNVNMADDWPPVGISDFSKISGDLYHAILVYEKPSSKVNYE
FT                   TEILVSYPLFEKRIPLGNVQNIKIEVWDEAKAIYRVGVAGVDYGTITYDVGTPFVGGPI
FT                   FQMNCTIPFKGISTKTRVSFDIDTNVDGKPGTTDPYLVSLSSVSSATKSLEFYPVNNAV
FT                   TQMTATFFGKVTTRFEDELGNPVTFDNYSTVTTPGKVNQDGKFEIAEPFLHNSVQNVDK
FT                   HAYDTLLDTNKYKLLEVTSPNKLSETADNLSIQIKRGYQNDVLYKIKALQKPVISALPE
FT                   IEYSKTVNRTMEEFLEDVEAKTDIPADIDCDLTNVKWGVPGDYPVLITAVNEDNQAADP
FT                   VPVTIKISKNPAPVITVDPEITYDKTVTKEESTLLNEVNARTNDGSTITSNINDKVKWG
FT                   VPGDYEVTLNAVNEDGVAAEAKTFIVRILKSPAPIITVDPEITYPKTITKTEAELLQEV
FT                   NAQTNDGSPLVSDMNDKVKWGVPGDYEVTLNAVNEDGVAAEAKTFIVRILKSPAPIITV
FT                   DPEITYPKTITKTEAELLQEVNAQTNDGSPLVSDMNDKVKWGVPGDYEVTLNAINEDGV
FT                   AAEAKTFIVRILKSPAPIITVDPEITYDSTIIKNETELLKEVRAKTNDNSAITSDAPDK
FT                   VKWQTPGNYTVTLNAINEDGIPADPVTFIVHIVEAQKAPIVIEENPAGTPTKPTKQKTK
FT                   ENTVSKKKTQLPRTGDTQSKAILGGVLCLGAWFLCRKK"
FT   CDS_pept        complement(708998..709285)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83377"
FT                   /protein_id="CAR83377.1"
FT                   /translation="MKVSKSFEAFAKEAPEVHSAWMETVHKLDAASKLDKKTEELAYIA
FT                   VMAATRLDSGLPFHVKMAKTNGATREEIISAILVGLPAVGNTVIRPYLLL"
FT   CDS_pept        709448..709822
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83378"
FT                   /protein_id="CAR83378.1"
FT                   /translation="MDAHIEKIQDVIELVKTRKYNEAEKLLFHLYETFQTESPKNIPEV
FT                   YFKRDRIGYTRWENADLNELGKIIQKILIYLDKQGFVKSDIVIAYMEGAEKISDLEGMK
FT                   NTDTLKILSVLYGIMYAYSA"
FT   CDS_pept        complement(709863..710678)
FT                   /transl_table=11
FT                   /gene="thiD-2"
FT                   /locus_tag="lmo4a_0677"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83379"
FT                   /protein_id="CAR83379.1"
FT                   /translation="MTIKKTLTIAGSDSSGGAGLQADLKTFEEYGTYGFSAITTIVTMD
FT                   PDNNWAHGVTPIDAQLVREQLKTILSGGPVDAMKTGMLGSIDIIKATREAIDKYDLKNV
FT                   VIDPVMVCKGEDELIQPENAEAIRDLLLPKATITTPNLFEAGQLSGLGKLTTLDDMKKA
FT                   AKKIIELGAKYVVIKGGKALESDKAIDLLYDGEEFTIYEVEKISPSHNHGAGCTFAAAI
FT                   TAGLAKGLTVEEAVAKAKDFVTAAIKGGFALNEFIGPVWHGAYNKAENR"
FT   CDS_pept        complement(710704..711570)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0678"
FT                   /product="Cof-like hydrolase"
FT                   /note="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83380"
FT                   /protein_id="CAR83380.1"
FT                   /translation="MIKVIASDMDGTLLNSDIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKANLYAPAICMNGAEIRDEHGKIILQHPIDRNLARNTYNTLTELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDVSAETIMDKVEERFESKDVHEIPDVERILGN
FT                   KDLTILKFISFSSDKDILAKAKQKLEKDSELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGVTLDETFAIGDNMNDISMLKMAGYSVAMGNGEEEVKDLAEHVTLSNDEHGVAAAIY
FT                   KMLETND"
FT   CDS_pept        711744..712307
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0679"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /EC_number="2.3.1.-"
FT                   /note="Acetyltransferase (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83381"
FT                   /protein_id="CAR83381.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELAHGRNRARKFCREINDTMDSESRA
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGDNCMMAPG
FT                   VHIYTATHPLDPVERNSGLELGKPVEIGDNVWIGGRAIINPGVKLGNNVVVASGAVVTK
FT                   NFPDNVVVAGNPARVIKTIEVEEK"
FT   CDS_pept        712304..712567
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83382"
FT                   /protein_id="CAR83382.1"
FT                   /translation="MIIADSKIFEQMENELAKAKAATTKASQDKHLHGLMLLVQLAKTG
FT                   DETTAAVEPIAIQPAEPAQIASMDGKKIELEDGANGDSLLDF"
FT   CDS_pept        712577..712954
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0681"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized small membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83383"
FT                   /protein_id="CAR83383.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKDVLGSYASTWETGVQYQM
FT                   FHAGGILVVGLLMEKQASRLYTWAAILFATGIVFFSGSLYVLSISKVSILGAITPIGGV
FT                   CFVVGWFLLILGVSRRTMSRY"
FT   CDS_pept        713068..714003
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0682"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ABC-type sugar transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83384"
FT                   /protein_id="CAR83384.1"
FT                   /translation="MTYALEIKGLRKIYSTGVEALRGVDLTVEEGDFYALLGPNGAGKS
FT                   TTIGIITSLVNKTSGQVSVFGYDLDTDIVRAKQQIGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVSRKEAIKRSEKYLKQSNLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRREMWTFLRELNESGTTIILTTHYLEEAEMLCRNIGIIQSGELIENTSMKS
FT                   LLSKLQFETFIFDLEPYEEAFEITGYNHVFEDKQTLSVEVERNQGVNHIFEQLSEHGIK
FT                   VLSMRNKSNRLEELFLKITEEKHQVGEKHV"
FT   CDS_pept        713996..714766
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0683"
FT                   /product="ABC transporter, permease protein"
FT                   /note="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83385"
FT                   /protein_id="CAR83385.1"
FT                   /translation="MFNLYYTALKSLAAKETNRYMRIWVQTLVPPVITTSLYFIIFGKM
FT                   IGSRIGEMNGFSYMEYIVPGLIMMSVITSSYANVSSSFFSQKFQKNIEEILVAPVPTHI
FT                   IIWGFLIGGIGRSVLVGALVTLISMVFVPIHIHSWTIGIITFLMTAILFSLAGLINGIF
FT                   ARSFDDVSIVPTFVLQPLTYLGGVFYAISMLPPIWQAISKVNPIVYMISGFRYGFLGVT
FT                   DVPVAISLSILVVFSAVLYSICWYLISKGRGLRS"
FT   CDS_pept        715027..715908
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0684"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83386"
FT                   /protein_id="CAR83386.1"
FT                   /translation="MNKENPLNKYHTGKFEKQRQDYPGLQSKMTPVPDTGESSYQGANK
FT                   LTGKKAFVTGGDSGIGRAAVIAYAREGADVAINYHPDEEVDAQEVKKIVEEAGRKCILL
FT                   PGDLRKEGFAKEVVKKAYNELGGLDILVLNAGLQQYQFDIQKLPAEQLRDTFEVNVFSV
FT                   VFAIQEALNYLKAGASIILTSSIQGVKPSAHLVDYAMTKSSLISLTKSLAAQLGEKGIR
FT                   INAVAPGPIWTALQISGGQPQESIPEFGQNQPLGRAGQPAELASAYVLLASDEASYTTG
FT                   QVYGITGGAPIN"
FT   CDS_pept        715927..716100
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83387"
FT                   /protein_id="CAR83387.1"
FT                   /translation="MPWNEKDYPDSWKNLRKTEREKAIEIGNALLKEGYSESRAIPIAT
FT                   SKAEEWYKNHKE"
FT   CDS_pept        717273..717617
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83388"
FT                   /protein_id="CAR83388.1"
FT                   /translation="MKIEQRSTTSNGNRLKAAIQKGDILIVGGGAGHAAIATTDNYILE
FT                   MSGSQNFASWFIGGISNNNHQFTKQNWIFGTSNEQGASSAPHIAKWIQLWRMPNQAMAK
FT                   QCADYADAKF"
FT   CDS_pept        719390..719803
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83389"
FT                   /protein_id="CAR83389.1"
FT                   /translation="MGFLEAYKSFWKNYINFNGRSSRSAYWYAMLGNGIILVALYICLA
FT                   VSGFSLFMTGGTGATRVSGGLAIVFIIALWAYLLAILIPAISITVRRFHDSGKSGFMAL
FT                   LYFVPGVGSLLILIFMCFASDAANQYGESSDDI"
FT   CDS_pept        719888..720298
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0688"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83390"
FT                   /protein_id="CAR83390.1"
FT                   /translation="MGFLEAYTSFWKNYVNFSGRAPGSAYWYVVVWNMMIIVPLRVMAA
FT                   IFSASSMIDGVGYAGIVVSFFLIGLRWLYWLGTIVPLTSLIVRRLHDTGRSGYLAFLAL
FT                   IPVVGSIIIIIFMCFESDGPNKYGDVYQKSEV"
FT   CDS_pept        complement(720337..720546)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0689"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83391"
FT                   /protein_id="CAR83391.1"
FT                   /translation="MYIEIYTVNGESIRLDDDAKINNISIHELSKADLKNLFNEKCIEL
FT                   TKYDLTYFINTNQVNWFLVSEGIH"
FT   CDS_pept        complement(720691..721485)
FT                   /transl_table=11
FT                   /gene="mogR"
FT                   /locus_tag="lmo4a_0690"
FT                   /product="motility gene repressor"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83392"
FT                   /protein_id="CAR83392.1"
FT                   /translation="MPKSEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEI
FT                   YHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLN
FT                   DLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRKTQKNTKKEKTNIFGKVVPAE
FT                   FKAPTSIKEQISYDKSREKNLVDLLSGVKSNVQLLSENQGEENNVYDLLKSIYSLSSLA
FT                   VQKEELDKKYQDLQTKYQELEQENSYLKQQNETMTDSFHTLV"
FT   CDS_pept        721857..722171
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83393"
FT                   /protein_id="CAR83393.1"
FT                   /translation="MEYFLSLLKIIVLLAVLAGISYFLVKKNKQANRTRKSENDLIKLK
FT                   DTLLISHQLRAVLLEADGEKVLAIISNNDIRTVSLKGNSNQNEALFRELLLKEETKENA
FT                   "
FT   CDS_pept        722164..722931
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="lmo4a_0692"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="Flagellar biosynthesis pathway, component FliP"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83394"
FT                   /protein_id="CAR83394.1"
FT                   /translation="MRKIASRRVFQVSFVVIFAISLVFFWPGVNVHAESWLDSLGVNGT
FT                   DGVNSSVALFVMVTVLSLSASIVLMFTHFTYCIIVLGLTRQGLGATNLPPNQVLVGLAL
FT                   FLSLFMMQPLITAWYDDVYKPSQKEDWSASKVWDETQPLLTKYVAENTYKHDINMMLKA
FT                   EGEDPVTKKEDAPLMALMPAFILTQITQGFLTGMFIYLAFIFIDLIVSTLLMYLGMMMV
FT                   PPMTISLPFKILVFIFIGGYGLITNMIFQTIHF"
FT   CDS_pept        722944..723216
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="lmo4a_0693"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83395"
FT                   /protein_id="CAR83395.1"
FT                   /translation="MNLTPITQIFQDFFYSGLALILPVSLICIVVVIVVAILMAMMQIQ
FT                   DQSLTFLPKIIAFVVALFILGPWMFEHMTDLFVGIFSKLPLMIRV"
FT   CDS_pept        723219..723980
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="lmo4a_0694"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="Flagellar biosynthesis pathway, component FliR"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83396"
FT                   /protein_id="CAR83396.1"
FT                   /translation="MEFEFFLAVVIVFSRVASFLFFFPLLKGRNIPNSVKVVFGMAISI
FT                   PVATGVDVSGITTLPDLLLRVTSEVVFGLALAKLVEIIAVIPKMAGFMIDYDLGFSQVN
FT                   LIDPSYGTQNSITAAILDTFFVVIFLSLQGMDYLIYYLMKSFEFTASVSILFEKGFIDL
FT                   LLGTLGFALASAVSIALPIMGSIFIVNIILAFISKSAPQINIFMNAFIIKITFGIFILA
FT                   CAVPILSTVFKNLTDEMIQQYVSFFDYLLKK"
FT   CDS_pept        723996..725042
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="lmo4a_0695"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="Flagellar biosynthesis pathway, component FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83397"
FT                   /protein_id="CAR83397.1"
FT                   /translation="MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYF
FT                   FGEMFIKNTIQAFVALLKQPPKLANMESYSLFYLMEFGKVLMPIMVMVVIFGLMNYGVQ
FT                   VGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDT
FT                   LISYTGQNWLYSLGQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKD
FT                   EMKDSEGRPEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPK
FT                   LLVKGEDELALFIRQVADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVMKEL
FT                   MDADKIKF"
FT   CDS_pept        725089..727164
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="lmo4a_0696"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="Type III secretory pathway, component EscV"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83398"
FT                   /protein_id="CAR83398.1"
FT                   /translation="MGNLGAIKKYFAILIAVSFVIALIVPLPPFVLDLVLVTILAFSVL
FT                   VYMRATSIKDWNELKSFPSLLLLMGIFRVSINISTTRAILTTGDPGQVIKQFGNFVIGS
FT                   NFVVGIVIFIILIVFQFIVANGSSRTAEVAARFTLDALPGKQMAIDADLNQRLITEPEA
FT                   KEKRAYLNMETEFYGAMDGAGKFVKGDVLFTVLLAVVNIVFGLIVGMVQGGLSFGEAAV
FT                   KYTELTIGDGIVSQIGSLLMAMSAGVIVTRVFDGSDDNVAVGIFKELMQNSVVVYTLAA
FT                   MFILMGVFSPLPTIPFVGIGVVLGIIGYRTQFNLKKKEQLELEKEMELIQSETNSAEAE
FT                   HNQAFGAAREKFPVVVELGLNIAALVKQKMNGETAKDKVVLMRKSILQDLGIGVPGINF
FT                   KDNTSFQPRGKYEIKVKGVAVASGVLKAGHLLALKTPGVMMDLDAEPTKDPIFGEDGYW
FT                   ILPGELEDAQMKNYQVLEPLSILITHLDVVLRKNLHELLMRQQIKDLIDGLADENQILI
FT                   DEIKKKEIDYSLIQGVLKQLLKEGISVRDLPTIVEGIIDGQTIYPNDLDGITAFVRERI
FT                   SKVICEQAKNQDGKIYALLLQDSIEMDTEIVNTPYYGYALNWALDKELPIIQKVRDTVN
FT                   KAQLTGREPVILTRRKDFRFGFVRVLERYQLDVPVLSISELSPETEVEQIALIEPT"
FT   CDS_pept        727186..728409
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="lmo4a_0697"
FT                   /product="flagellar biosynthesis protein
FT                   (flagella-associated GTP-binding protein), putative"
FT                   /note="Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83399"
FT                   /protein_id="CAR83399.1"
FT                   /translation="MGKHLVEKMEIFKANSKREIHKKIRLVTNEPYKITDERVTKLGIF
FT                   KKQYEVTAVIMSEVAIADGRMDFQETFQKSVVKNRPKTDDLLKKEKLLEMLAAGAELAQ
FT                   STPLLEERKTQEEELSAMRLELAALNRELAVKMREEREQNSDFVKFLKGRGISDTYVAD
FT                   FMQAGRKQFKQVETAHLDDITDWFVPYLSGKLAVEDSFDLSNHRIISLIGQTGVGKTTT
FT                   LVKLGWQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDVELIVATSPAELEEAVQYMT
FT                   YVNCVDHILIDTVGRNYLAEESVSEISAYTDVVHPDLTCFTFSSGMKSADVMTILPKLA
FT                   EIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTDGQNITENIFRPKSRWLAERFVG
FT                   TDRRQVLE"
FT   CDS_pept        728406..729185
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="lmo4a_0698"
FT                   /product="flagellar basal-body rod protein, putative"
FT                   /note="Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83400"
FT                   /protein_id="CAR83400.1"
FT                   /translation="MKGLYIGAAGMMNYMQHIQVHSNNVANAQTPGFKFDQLTSEVISR
FT                   NKVNYQNGPVTRQVGTIDYGVRPAATHINLTAGSSYITNRDRDFFMQDTDPTQGSNFFI
FT                   TAKNGEISLSRGGQFHSDQFGFLRTADGANLLSATGEAIQVGQKTSIRAEANGDLYNAE
FT                   TGQYLGRLGTKFVSANQADSLVKDGEGRLHVNGINTMNLPAGQGIIQNGVIETSNVDLG
FT                   VEMVQLMDNQRMVQASKNVVNMFDKVYDKEATGLIRQ"
FT   CDS_pept        729213..730001
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="lmo4a_0699"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="Methylase of chemotaxis methyl-accepting proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83401"
FT                   /protein_id="CAR83401.1"
FT                   /translation="MIPDLEKDYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKQY
FT                   ITFGEFFKHLKKDAVLLDEFISLITINVSSFFRNRNRWDALEKQVLPRLLENSRGKLRV
FT                   WSAACSSGEEPYSLAMMMERSVGTRHYDILATDLEPAILKRAVIGEYQSRQMEELNEQE
FT                   RHTAFVEKGDTYQILPKYRKSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAY
FT                   QKFAESLRRGGVLFIGGSEQILNPADYGLATLNNFFYIKT"
FT   CDS_pept        730025..730360
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83402"
FT                   /protein_id="CAR83402.1"
FT                   /translation="MGRMENIKNLAFFEDKPGLAEQILMLEKKTQLFLPNEFEIRQTVG
FT                   YEIGEKEVILGRLESFYFLALKGVGEDNYRSQAFASEADAKAFFVHLPEMENELVAFWL
FT                   NEVELVR"
FT   CDS_pept        730387..731238
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="lmo4a_0701"
FT                   /product="chemotaxis protein"
FT                   /note="Biopolymer transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83403"
FT                   /protein_id="CAR83403.1"
FT                   /translation="MEITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTIT
FT                   AVMMAHPWSDVKVVPKLFKILFTKEKMPDKVEVLVQYKEYADEIRRSGVLALEDSVDEI
FT                   EDPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA
FT                   AMGLIHAMGEMSNPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM
FT                   MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEEIERGQASQETAGG
FT                   TR"
FT   CDS_pept        731198..732025
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="lmo4a_0702"
FT                   /product="chemotaxis protein"
FT                   /note="Flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83404"
FT                   /protein_id="CAR83404.1"
FT                   /translation="MAKRRKKPQEEHVDETWLIPYSDLLTLLLALFIVLFASSSVDAKK
FT                   FEQMGNAFKKIVEEGAAGNQAYVSKEKGPDDPNVNAVLKAMEEQDKKKEATEQEKAKKA
FT                   AAALLKKQNEEKIEAFKKQIDSYIAAENLGTKMTTKYSDEGLLITIRDDILFQSGSAEL
FT                   TAGKREIAKEIGELFAQGKGTMEGIVSGHTDNVPISTSIYSSNWELSVARAVNFMEAII
FT                   QENSEVNPGEFSARGYGEFRPVAKNDIAANREKNRRVEIMVRPINRDTLDEDE"
FT   CDS_pept        732035..732535
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83405"
FT                   /protein_id="CAR83405.1"
FT                   /translation="MQLFLSGSHTLTDYDKQEIQAYLEKFAPVNHIHLLCYKSIENEVL
FT                   QFFLKKEHLAPRLSIYTFAPKECLPEPFLSTIDYLERLGSSYQSFGYFDTVIAKPTYEK
FT                   FLAQIVSKMDLVCCFYNGDKPTDVIPVDVAKSFDVQSMIYDLPKAKKHLLHRASSDKIK
FT                   LVN"
FT   CDS_pept        732558..734471
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0704"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83406"
FT                   /protein_id="CAR83406.1"
FT                   /translation="MRPLISICMIVKNEAHILRQSLASFRKFTEEIIIVDTGSTDETKE
FT                   IAQEFTDFVYDFEWTGNFSDARNFAAKHATGKWILAIDADECLEEESYRKLEKQLKSPI
FT                   EPIQMAQIISFTGEKGRVTTTNQMARVYKNDGTICFRGVIHEQLEAVDKHPIAAGVAEV
FT                   KIYHYGYMTEIVEKQDKSDRNLRLLEKEVKNNKNSGFVHFNIGQEMNRLGNKKEALKEF
FT                   SEAFRLRDHNHYIWAKLSAYHIAELLEQEKRYDESLAIIEEARIIWPNVPEFPLKKANI
FT                   LYVNHQLEDAKEIYQSLLENTAIDYQPIVLYEATNFMPHKMLGTIYLEEKDYTRAMTHF
FT                   SKAYAENSSDYGVMFQMIMLLSKFHQPKEIFAFMERHHFISSTETGLRLLSMTTQQGYA
FT                   ELSELIVQSLTDVYPPVAEATEVKIATIRNVFPVISESAILFGIKEELIDAADLCLWHY
FT                   ENPQLPIERVMKNSDVGDIYDFIFENGPRISKKRYLFVLERAIALGKGEFADYLLALRN
FT                   VYHDSINSHIADLFFQYDFADIALDFYNIVDADEVTKQGYINLINYLVDAEVLDEALAI
FT                   AERGIDNFSTDFRFYLWTIKIDTENRANRISEAMDEFPNNRYLAKLLDEVTMLQDTVTN
FT                   NR"
FT   CDS_pept        734484..735392
FT                   /transl_table=11
FT                   /gene="cheV"
FT                   /locus_tag="lmo4a_0705"
FT                   /product="chemotaxis protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="Chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83407"
FT                   /protein_id="CAR83407.1"
FT                   /translation="MTEEKGILLQSGTNELEIVTFTVGENLFCINVLKVKEIIHPLEVT
FT                   PVPDSNPAIEGVSQVRGEIMPVVNLARVMKLPEIEPENTKFIITELNQMKIVFRVDEVH
FT                   RIQRISWEQIEEPEKLSIGLEELAVGIVKLDGNLVLLLDYEKIIYEISGNADFAVTGED
FT                   RMARKVNREEKTIFIAEDSQMLRQLLEDTLHEAGYTNLQFFANGREAQEHIFKLLKEQK
FT                   EQTFENVNLLITDIEMPQMDGHHLTKVIKEDEIGRELPVVIFSSLITEDLEHKGAGVGA
FT                   DAQVSKPNIHQLINILDELVL"
FT   CDS_pept        735629..736492
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="lmo4a_0706"
FT                   /product="flagellin protein"
FT                   /note="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83408"
FT                   /protein_id="CAR83408.1"
FT                   /translation="MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAG
FT                   LAVVTRMNVKSTGLDAASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSD
FT                   EDRKQYTAEFGSLIKELDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDL
FT                   FNAKGLSAGTITLGSGSTVAGYSALSVADADSSQEATEAIDELINNISNGRALLGAGMS
FT                   RLSYNVSNVNNQSIATKASASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQML
FT                   TQLINS"
FT   CDS_pept        736767..737126
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="lmo4a_0707"
FT                   /product="chemotaxis response regulator"
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83409"
FT                   /protein_id="CAR83409.1"
FT                   /translation="MLKLLIVDDAMFMRTMIKNIVKDSDFEVVAEAENGLEAVKKYDEV
FT                   KPDIVTLDITMPEMDGLEALAQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKP
FT                   FQADRVLEALEKAAK"
FT   CDS_pept        737146..739002
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="lmo4a_0708"
FT                   /product="chemotaxis protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="Chemotaxis protein histidine kinase and related
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83410"
FT                   /protein_id="CAR83410.1"
FT                   /translation="MTTNMLDLFIEEASEHLQALNDNLLQLEKDPTNGQLVSEIFRSAH
FT                   TFKGMSATMGFQQVADLTHAMENVLDEVRNNRLAVTEHLVDIIFTCTSHLETMVSDIQH
FT                   GGQGAADISKTVADLEALLHPEQETDLAIEKTYRIQIQIEEAAILKAVRAVMCLERLAE
FT                   MGIISETLPDREAIELEEFEQSFEVVLESAQTKEKIEAVILDISEIEKVIVTEEVEEVQ
FT                   VIEPIKKAAKQTTKRLENKTIRVQLEKIEKLMNVFEESVIERARIDEIAEKTNNKELME
FT                   HLGRFSSISKEIQNGLLNMRMVPVDSVFNRFPKMVRTLAKELGKKIDLVIEGADTEVDK
FT                   IVIDEIGDPLVHLIRNSVDHGAETVEVRRKNGKNETATINLKAFHSGNNVVIEIADDGA
FT                   GINKRKVLEKAIAKNVVTRAESTKMTDAEIFDLLFDSGFSTADQVSDLSGRGVGLDVVR
FT                   NTILKIGGKISVESSENAGSTFRIEIPLTLSIIQSMLVATSERRYAVPLANVAEAITIN
FT                   PADIQHVHGKDLINYRETIIEVLDLGECFHETPLNDTDELLLLVVKNAKRTFGLIIKDI
FT                   IGQREIVLKTLGGFFSESQIAFSGATILGDGRVVLILNLETF"
FT   CDS_pept        739012..739314
FT                   /transl_table=11
FT                   /gene="fliN-1"
FT                   /locus_tag="lmo4a_0709"
FT                   /product="flagellar motor switch protein, putative"
FT                   /note="Flagellar motor switch/type III secretory pathway
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83411"
FT                   /protein_id="CAR83411.1"
FT                   /translation="MMEQVFQVELPEWEPKEPSQEGREKGSIRQVDNIGVNLIVRLGKK
FT                   EMPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
FT   CDS_pept        739333..739743
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83412"
FT                   /protein_id="CAR83412.1"
FT                   /translation="MKQEAYNAVKMKVDQEKTAILKELQLLLSKREKVVEKLAHEKEVY
FT                   YSRTKKERLQVAVLAGSMQLDAFSPSRIQQMEREIHQISQYIKSNEQILEQLEEKGKQA
FT                   KKMYDDTRKKWQQLENKREEQTLRDLKMVLLK"
FT   CDS_pept        739759..740805
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83413"
FT                   /protein_id="CAR83413.1"
FT                   /translation="MLIPDNLLQPLVGKKQIEPKESLAEELVELPFISLLMENSPAPLL
FT                   KGEADNGEQATIPLKEIAQPLVSAKLLDNAPETKLQAAPLELKEVKETLAAIAKQAIDQ
FT                   PKIENAPQAVETPVTNTPKEPTKNATREQQPPPELIMPTKESSKLAENVTKNQPVLAKL
FT                   PQEKEVVQLFKASIKEPVTAKEEVAVKKPAESNNIWHDTAKQLTPAAKSEVPVTLKQLD
FT                   KTITDQIEQLQKFQVKQNKAFFAIQPESLGKVEVLLKKMPDKIFVHIEYQEQTAKQKLE
FT                   QMAQDLHNRFRDRGVEVAVTMTEKQAPKENGQGSEGRHQGESKKEKERENPHQERAKQE
FT                   AFDLEEET"
FT   CDS_pept        740807..741229
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="lmo4a_0712"
FT                   /product="flagellar hook assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83414"
FT                   /protein_id="CAR83414.1"
FT                   /translation="MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPS
FT                   SPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNSALQSAVNFIGKDIKGVSLNGE
FT                   VISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN"
FT   CDS_pept        741249..742484
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="lmo4a_0713"
FT                   /product="flagellar hook protein"
FT                   /note="Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83415"
FT                   /protein_id="CAR83415.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLNGNLQPIQIPLNSAIP
FT                   GEATKNGSLSGNIPLDWGEKDTISSELSVYDNAGGKHKLQVNMKAATPDASGNVSYEYE
FT                   IQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGKQVNMGLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
FT   CDS_pept        742498..742734
FT                   /transl_table=11
FT                   /gene="fliN-2"
FT                   /locus_tag="lmo4a_0714"
FT                   /product="flagellar motor switch protein, putative"
FT                   /note="Flagellar motor switch/type III secretory pathway
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0714"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83416"
FT                   /protein_id="CAR83416.1"
FT                   /translation="MKINHTIPLRIDFELGRTKQPVGSLLDVKKGTVFRLEDSTANVVK
FT                   ITISGKCIGYGEILTKDGKMFVKITKLGEGSSS"
FT   CDS_pept        742755..743747
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="lmo4a_0715"
FT                   /note="Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0715"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83417"
FT                   /protein_id="CAR83417.1"
FT                   /translation="MSDKLSQEQIDALLSQISEGKVVDESTEIGDFGRFHPYDFHKPEK
FT                   FGAEHLESLKTIASAFTKKSMEFVSQRIRIPIHTEATLADQVSFASGYIETMPNDSYIF
FT                   CIIDLGNPELGQIIIELDLAYIIYIHECLSGGNPKRKLSERRLLSVFEELTLKSILEKF
FT                   CEALKDSFKSVHPISPEIVNIETNPALLRVTSPNDMMALVSVDIKSEFWISTMRIGVPF
FT                   FSVEEIMNKLENVVEYTFDKRRNFDAEVEQELHQVEKEARIRVGEIKTTWKELNKLEVG
FT                   DVLLTETHIRDTLKGYVTEKWKFECYMGKSGNQKAVKFMRHTGRTEQER"
FT   CDS_pept        743750..745297
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0716"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83418"
FT                   /protein_id="CAR83418.1"
FT                   /translation="MEQLLEKNITQMELDVIGEIANISFGSASTVLSDLLHQQVTISTP
FT                   KVEIVDLYNTKDIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNE
FT                   ELSELHLSAVQEAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDTNDQTMIK
FT                   VGFDLIIGDLITSNLMQLIPIDKGHELAKRLLGDAVPEPEPVKEEISLTAEELDVFLEV
FT                   CNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTF
FT                   IISKNAALIMADLMMMGDGLVQEDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKID
FT                   ISPPTMEFCNFGDTMIQKNIEEGKTVEVIFPLEVEGLLKTPMYQIFNPAAAKEMAQLML
FT                   GIQAKEVAEKEATTPAEIIEPEKPAEPVHQAVIEEKETLSEMEQILEDIPVTLEVVFGT
FT                   AKVKLEKFISWCEKDVIILKESMNEPLVLALNGVTIGKGILVRVDDHFGIQMTELVR"
FT   CDS_pept        745294..746706
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83419"
FT                   /protein_id="CAR83419.1"
FT                   /translation="MKNVRKLGLMTILFWLFFSVQAFAADPEPPIISLEGEQRVFTSGE
FT                   VISFHIENAADLKIILVNEHGQRKLLDEETYMVTDWDLDGSYRAEFYQANMSKPFVTVE
FT                   DLFEVKQLEDVAKDETAPSLKTIEITHDEDVLLTSVLHVSADLDDAESGVKQATLLVHS
FT                   ESNESEIELIRNNYTGKFAAEIPLEKFQLGEKLTFQLQLVDFAENEIIVDLENTVQLYQ
FT                   PKTPILSYDGSDITNVQKKIGQVGKQIELTLDKYTTEFPELATETGKIIPLIWQKTATE
FT                   WKGSLILPSELSGEIIHIQGMDQHLLVRATSEPFGDVQLVNNAILTGTILPDFTLISNL
FT                   YIEVNGQKFSVERADNRFKSAEITTTGKIVLHWTDWDGQVYSKQMNQEIKPVIEMPGKE
FT                   IIAPPPVIPNEKAQILTSPALKPSVESHEDTPKKQVKKETSTKDKSSSIPFWIPALMII
FT                   GVIIFSGNRAMK"
FT   CDS_pept        746729..747895
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83420"
FT                   /protein_id="CAR83420.1"
FT                   /translation="MKIDGIQESAENRNQLERELIKQNPVVKEGTIKAQMNTEVAVPKT
FT                   PPVSFSFKELSSLQLNGTSAASLELYMKLMMNNAKKANDLIFYVMRAGIKNPTDSTKWQ
FT                   TVRSEISSQLSTILMKQHNFEAYFSENPANQKLFLANQKIMNEISFLLKMLPTLTFETT
FT                   GKYDFLRMMQIASGNMETGIQMMREFQGHIEHATRLDPIVDARQETNWMIKVLREFGNM
FT                   FQSRHLLPYELQAENINIWKLGSEYLKLMNQLLPQIGAFPNGNIKIFHQQATKPLTELF
FT                   QELQRLADGQMTQGGIAVILDRMQGQLTRLAQLFQKMEIEAGFTDTERILGSVDAEFAS
FT                   DMTKMMLLAQQEMSFFDLLVKDFRSVSKQPIFFMIVAIFIILLLIILF"
FT   CDS_pept        748002..748466
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0719"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83421"
FT                   /protein_id="CAR83421.1"
FT                   /translation="MNNVSIGQISQSKQTNVVRGMQELNQTQQLYFEQMKANGKKQTPS
FT                   LTEINELITNVTDKKSLVEMDMTVDNVLSYKKAVQTFLNFYVNNVMDYDNIESRHPKYG
FT                   FSQKMTILKQVEKQTNELDDVMNLIDTKTGHLDMLNRIGEITGMILDVVL"
FT   CDS_pept        748476..748904
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83422"
FT                   /protein_id="CAR83422.1"
FT                   /translation="MQNELINQLEILIEKNVKATDAAILLGKLVQEENWIEAEERQLGL
FT                   QRELAALQNEYQALKTIIGEDNTLRTLQNTWTPAENAIIDERKKMLLEKENLLRVSVTE
FT                   NQIRTEMQLAFSEHMVDVITGHHAETQAENNMMINETF"
FT   CDS_pept        748924..750444
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="lmo4a_0721"
FT                   /product="flagellar hook-associated protein 1-related
FT                   protein"
FT                   /note="Flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83423"
FT                   /protein_id="CAR83423.1"
FT                   /translation="MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQTAV
FT                   YGDGGLLGGKQTGYGVKVIDIKRLTNTALTTQYNNQIAKQSASLYQSGALGQALNLFGT
FT                   PGKNTPSDNLDNFFTAWAALAKNPDQATNTTALLSSMSIFTDQLNQLHSGLKELETTIA
FT                   ADTDAAIQDLNSLIKKLGSINKAIGNAGSNPPNDLLNQRDQLLSTMAGYAGISVSAHPN
FT                   NPDVYDVTIGGRLVVQGDETTEITSTRTATGFEFSVDGQKLNMPEGSIIASVRVNQNEI
FT                   KSYQEKIETFSNGLAKALDDIQVKNVNKTMDDLQKINDALQANPNDEKLLSNRDELLRQ
FT                   LEKFPGVTRSGDTLTIGGVDHAIDTLGTSTYVTDVNDFSIPIFTQSSGKWILNPAITSN
FT                   ADNKPFLGVIAADIASLKTDKNIQGTTFPSFMDGIITEVATDASKSSATSTADTQALNS
FT                   LSESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML"
FT   CDS_pept        750456..751331
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="lmo4a_0722"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83424"
FT                   /protein_id="CAR83424.1"
FT                   /translation="MRISTNQQANSIINQLNNVSGNLAKYQLQVSSGKKYESMSENPGA
FT                   TAQILSYNHVLSQLNREKTDVTEAKSLLNTAETSLSSMSTSMNRVNALVLQAINGTSDK
FT                   DNMSQSAEEIKGLLDVLISVANSEDDGRYVFSGSSTSVKPFTTDKTTGEIIYNGTTENK
FT                   KFRVTDTLEVEVFHDGSAMTDVFNNIQKIVDAMKTGDKDALSALQETNSKNIEIITNSM
FT                   TNIGGQKNGVTAYDNVLSSKIVDFSERKSNVEEVNMPEAVSNLNKTSIAYQAALQSSVM
FT                   VQKLSILNYM"
FT   CDS_pept        751343..752632
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="lmo4a_0723"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="Flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0723"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83425"
FT                   /protein_id="CAR83425.1"
FT                   /translation="MGSSIASSLMDPTQYYSQFISLQKASLEKAKTPYQNQISSYQSRI
FT                   DLYASLKNALSESLKTMSSFTTYESKTKLATSSNETSFTVSSTSSSVNGSYSIEVQNLA
FT                   TADTYNKAVPDIEAKIGVSGTIKINGKEIKVDADSSMKNVMNTINSAGAKVNIYTLGEN
FT                   MVVTAATTGVENSIKYEGDSTVLEALGLVQNSPDHLAAEDAKLRINGATVTSATNKVTN
FT                   YIPGVTINLKKETTGAEKLTIQDQSDEKAASMITSFVNTYNALTSTMKTYTGKGTILQA
FT                   SAADLEANRALNNVFQHKKDGNTLFDFGISVDKEGVLKVDETAMKKMVAEDPSAVERFF
FT                   FGIGGIGDELYQSLNKTFGSTGFISDETTSMTNEINKLNLKLTDITSRNDTLLTNITDQ
FT                   YNKWLEMMQAMQSDAMTLDALIDGMNSSNK"
FT   CDS_pept        752651..753037
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="lmo4a_0724"
FT                   /product="flagellar chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83426"
FT                   /protein_id="CAR83426.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKIDKALGQLHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
FT   CDS_pept        753009..753290
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83427"
FT                   /protein_id="CAR83427.1"
FT                   /translation="MNQAKTHLAELKALFHSTGQLNVTLEEYQAKLNELLKSTEHLPKD
FT                   TKEAILKETREVINKGILFTQKQLESTENAFSENKSRNAANLNYAKFF"
FT   CDS_pept        753311..753712
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="lmo4a_0726"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="Flagellar basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83428"
FT                   /protein_id="CAR83428.1"
FT                   /translation="MENYTTHIGNYLNYLQTANQVVSNNIANANTPNFKASEASFEESF
FT                   GSSLRASGQNSIESAGNLTKTNTKHLAGTDIDETNAKLTTKSGSINEDGNNVNVTSEMI
FT                   SLTKNNQMYALAISALNYNSSINTAARGK"
FT   CDS_pept        753724..754134
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="lmo4a_0727"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="Flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0727"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83429"
FT                   /protein_id="CAR83429.1"
FT                   /translation="MFEGINTSGSALNAAKQWMEVSSNNIANADSSAAPGETPFLRKRV
FT                   VLSEITPFETALTGTKGVKVSEISSDTGSVKRVYDPTHPNANEAGYVNYANVDMTAEMT
FT                   NLMVGQKMYAANTSALQANEKMMEKDLEIGKV"
FT   CDS_pept        754151..754447
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="lmo4a_0728"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0728"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83430"
FT                   /protein_id="CAR83430.1"
FT                   /translation="MAIESINAASVLPKVTLGETAKTDNATGAGNTFTQMLDSMSDTQS
FT                   NAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV"
FT   CDS_pept        754515..756167
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="lmo4a_0729"
FT                   /product="flagellar M-ring protein"
FT                   /note="Type III secretory pathway, lipoprotein EscJ"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0729"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83431"
FT                   /protein_id="CAR83431.1"
FT                   /translation="MAKIKTMYSKLKNWHKGAILVGLFVVVTVLLLYMNTPKTEVTLYK
FT                   NLSETSQQQVTDQLAKMGVDYTVDKSGNILVDEKVETLVRDKFADLGIPYTGQDGNDIL
FT                   LNSSLGASEEDKKMQEKVGTKVNLEKEIVQSYGTTVDSASVQLTLPESSSIFEEASQKG
FT                   TAAVTLKTKNNQTLTSEQVLGIQRTVSAAVPNVASDDVAIIDTKNGVISEADTSKEEGS
FT                   SAYKNEVDIQNAIGKNVKTDIEGTLSSIFALDNFRVNTNVTVNFDEIKQNTEHYPNDGK
FT                   VRSNQKDTSTDTSKGSANTTESGTASNADVPNYTEQNGDDTNTYTSEKSSETTNYELDS
FT                   TIQEIKKHPALAKTNVVVWVDQNALNKNGVDMAEFTKAIGVSAGLTPNMTTEEAGADGE
FT                   VAAAPTFEGTFQNGDVTIMPIQFLDNATPAEKDTTEKAAPASKAWIWWLAGSLLFAIIA
FT                   AGIIAYIIFLKRKEQLEEALEPEEKDYIPAEEAIINPEEHPDFNFQTDAFDLSEPELKA
FT                   RKESLKNKLGEMAKEDPGRAAAVIQKWLNERQE"
FT   CDS_pept        756170..757276
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="lmo4a_0730"
FT                   /note="Flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0730"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83432"
FT                   /protein_id="CAR83432.1"
FT                   /translation="MAETLKETLEETNAELETVEVEETEEKSTPSAESGISRREKAALI
FT                   IWSLDEQIATEVVDLLPDASKQRLAREMAKMKEMDGGAVEEATREFLGELELLSGGIAK
FT                   LDREHLQRLFPDMTTEELNQLIYGVEAESRIGETALDILREIDDVDSLFTIISDESPQT
FT                   IAMIASYMKPEEASKLLALLPEEKMINTVIGIASLEQFDSEVMQNVSNLLRIKLDTMSN
FT                   SSLNKTDGIKNVANILNNVTRGLERTIFEHLDAEQAELSERIKEKMFMFEDIILLDNMT
FT                   LQQVLAEIQDNNKIARALKNEKEELKEKILSCVSKNRRDMITEELEVLGPIRLSDVEQA
FT                   QQDIANVVKNLEKDGKIVIQRGEQDVLI"
FT   CDS_pept        757263..757955
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="lmo4a_0731"
FT                   /product="flagellar assembly protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0731"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83433"
FT                   /protein_id="CAR83433.1"
FT                   /translation="MSLSNPRIPKGKVTLSDVKMELFYLDDIEETEEVESPYSKELEQL
FT                   ESHQKELEKHLSAIEIEQQKLANEKAALQAERQAIEELKREAEAEIEANKQAFEKEKTQ
FT                   MYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   KALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNAER
FT                   KILGGDKP"
FT   CDS_pept        757952..759253
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="lmo4a_0732"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0732"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83434"
FT                   /protein_id="CAR83434.1"
FT                   /translation="MNWSPKTEAWQELKNTVPYIQKGKIHTVQEQVYISKGPQVKIGDT
FT                   VMVGENKVLCEVISIEKENNMLLPFNQSDKVAYGDWVYVTDTKITIPADEYLLGKVLNA
FT                   SGDILNEEAGTAKFKQKMPLEAPPIHAFSRTEITETLETGIKAIDGMLTIGIGQKIGIF
FT                   AGSGVGKSTLLGMIARNAKADINVIGLVGERGREVKDFLRKDLGEEGLRKSVIVAATSD
FT                   ESHLMQLRAAKLATSIAEHFRDQGKTVLLMMDSVTRFADARRSVDIAVKDLPIGGKTLL
FT                   MESYMKKLLERSGKTKNGSITGIYTVLVDGDDMNGPVPDLARGILDGHIVLTRELATKN
FT                   HYPAIDVLGSVSRVMEEIVPESQWKSASKIREWMSIYQENELYFKLGTIEQTSDNAAIF
FT                   TSKEKSYFIHQFLKQLRDESVTLEETSKLMETLV"
FT   CDS_pept        759270..759938
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0733"
FT                   /product="transglycosylase, SLT family"
FT                   /note="Soluble lytic murein transglycosylase and related
FT                   regulatory proteins (some contain LysM/invasin domains)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0733"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83435"
FT                   /protein_id="CAR83435.1"
FT                   /translation="MNPVEQVISARQAEFQSAFEAAKQSATTFETKLNERLNATKQTTT
FT                   TNVQTVTDAELTRAREAYEALINQSETKSAVTTSSTTTETLAAPTGELTNWNNYQIKPI
FT                   SAENEGKYSDLIKTAAAKYGVPEALIKRVIQVESNYNPNVVSSAGATGLMQLMAGSNRT
FT                   DPATNIDAGTKELAGYIKKYDGDLRLALAAYNAGPGNVRKYGGVPPFKETQNYLKKIIG
FT                   "
FT   CDS_pept        759952..760596
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0734"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0734"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83436"
FT                   /protein_id="CAR83436.1"
FT                   /translation="MGNWQQKWESWRDMTTAMQQEIKIEAAEKVTSYIKNDQFEEAINV
FT                   IRQTENLLNELDFETKMNRVEEQLQAFTSDQEAAKSFEASQLQNLEKPNTTVSFDLASV
FT                   KSEAINQFTKRDFNLVDSHDTHMQFLKGNRNFYMDIFNPEESEEHHYANLHEKCQYKNI
FT                   GFICQDDAAAEIATNLTNEWLETLEAPKKKFLTVNIANLTAMKQNPEVLFQ"
FT   CDS_pept        complement(760645..760983)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0735"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0735"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83437"
FT                   /protein_id="CAR83437.1"
FT                   /translation="MLSFIKTLVWCACFLEFIFAFYTLKALGDAINLFPVISLTAFVML
FT                   AHCVCCIILTRSLTINNKIIFLFISGILLLGANLIEDLYINPIPGALYIIAGIIATIYD
FT                   RKIDASQN"
FT   CDS_pept        761172..761498
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0736"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0736"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83438"
FT                   /protein_id="CAR83438.1"
FT                   /translation="MKGLTELLKGSLEGMILERISRGETYGYEITKYLNDLGFDEIVEG
FT                   TVYTILVRLEKKGLVEIEKKKSELGPPRKFYRLSPAGEEELAIFWKRWDFMQGKIMQVK
FT                   GGQA"
FT   CDS_pept        761498..761821
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0737"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0737"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83439"
FT                   /protein_id="CAR83439.1"
FT                   /translation="MFKWYTKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWSFAK
FT                   GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDTQRKKLRD
FT                   SIK"
FT   CDS_pept        complement(761865..762512)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0738"
FT                   /product="fibronectin-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0738"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83440"
FT                   /protein_id="CAR83440.1"
FT                   /translation="MKEFIEPYQYNFIKNQLANVSRAYRSANDTSTLKALKSLTEEKIN
FT                   ELFPESVLEEHKELFSELHAITSTKEAEPFLEGVKAYVIPFAPPSDVKLKKLFAKTKKL
FT                   KIPAWSKLNLRDYTFYGWNDIAQQRKYIVTYEDGNLVGVQGTISTEIQKGVCSICHSHS
FT                   KVSLFMAKTKSSSDGIYTTNGNYICYDSDVCNEQIKAHETLDEFIEVVKKRK"
FT   CDS_pept        762783..764513
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0739"
FT                   /product="pyruvate oxidase"
FT                   /EC_number="1.2.3.3"
FT                   /note="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0739"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83441"
FT                   /protein_id="CAR83441.1"
FT                   /translation="MKKVKASETLVQTLKNWGIDHVYGLPGDSIDTVVDALRKEQEAIE
FT                   FIHVRHEEVATLAAAAYTKLTGKIGVALSIGGPGAIHLLNGMYDAKMDHVPMLVLAGQV
FT                   TTDVLNTGFFQEVNLPAIFEDVAVYNKQIDNAETLADVVDEAIRTAYKEKGVAVLTIPN
FT                   DIPSQVIKASLEAKSVKFEQENPKLDEAAIQEAVALIEKAEKPVILAGLGTKHAGPELI
FT                   AFSEKLKIPIIHSLPAKTIVPDNHPNALGNLGKIGTKPAYEAMQETDLLLMFGNDYPYS
FT                   DYLPKKADCIQIDIDPAKISKRFPATVGLVGDAAEIIGNLTAKTAPVEERKFLQACQEN
FT                   MQEWWKWLEEDIAKTTDPIAPEVVMANIQKIAEKDAIFSIDVGTATVWSTRYLHLTPEN
FT                   DFIVSAWLGTMGCGLPGAIAAKKAFPDRQAIAIVGDGGFSMVMQDFVTAVGLNMPMIVV
FT                   VLNNQQLSFIKYEQQSAGELNYAIDLPDINYAKFAESCGGIGFRVEKMADLEAAFENAK
FT                   LATKPVIIDVSVDSAAAPLPGKIVMDEALGYTKFEIQSVLEDHRFAKMPPLKTILRRFL
FT                   "
FT   CDS_pept        764675..766480
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0740"
FT                   /product="methyl-accepting chemotaxis protein, putative"
FT                   /note="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0740"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83442"
FT                   /protein_id="CAR83442.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVATLSDNM
FT                   VDNNVAPMKEIAKIQTNMAQINIDILTMFDTINGKSALIKDIDDLYAENDQAIHNFKKA
FT                   NLTAEDKKQLAYFEEKLADMKSSASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNEMNYKEVENSSQAISDFGVKISIIFTAVIIAVLISLFIFNAYITRVILKGIR
FT                   HLQTAVHKVASGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTDAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNTGLSESEAGQKIISETEATFTDLLHRVNDISAQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYIANFNTEVSE
FT                   EAVEVTEEPESETKDPGEPVLAENV"
FT   CDS_pept        766493..767221
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0741"
FT                   /product="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0741"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83443"
FT                   /protein_id="CAR83443.1"
FT                   /translation="MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYKLDN
FT                   EPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFTGKYVTKNELANNLPTTPIEQNGL
FT                   HGNPDKAFVGSISGDSPGLGVNHAPIAKLAAKYVNEAHVHDISGNSIQDIITVLSTGAP
FT                   VWIITTTDYHAPKNWQTVQTKEGKKKITYSMHSVVITGFDKDNFYINDPYGHKNRAVKR
FT                   SVLEEGWSAMGKQAIYLSRP"
FT   CDS_pept        complement(767265..767477)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0742"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0742"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83444"
FT                   /protein_id="CAR83444.1"
FT                   /translation="MVFAKKIVASIAVFISLGFIYFRVSTAVAFENTSNASLLPSTGDA
FT                   FSVWPIVIGVVLVALAVVLFIKKKI"
FT   CDS_pept        767924..769729
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="lmo4a_0743"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0743"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83445"
FT                   /protein_id="CAR83445.1"
FT                   /translation="MCGIVGYIGTNNAKGILLEGLEKLEYRGYDSAGIALQNKDLVTVV
FT                   KEKGRIADLASLVPSDAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTMVHNGVIEN
FT                   YTLLKEEYLKNHSFVSDTDTEVIVQLIELFAAELSTKEAFKKALSLLHGSYAICLIDQT
FT                   DTETLYAAKNKSPLLIGKGENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKDGFTLET
FT                   LEGEEITRASYTAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQAYQNEAGEINVDKT
FT                   IIDEILSSDRIHIVACGTSYHAGLVGKNLIEKMAKIPVEVHVSSEFAYNLPLMSKKPLF
FT                   IFITQSGETADSRQCLVKVKELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTK
FT                   AYTAQISVLAVLAVSLGREIGDEEALNINLAAELGIVATAMEAMVSSKEVIEHIAGEYL
FT                   ATSRNAFFLGRNIDYFVAMEAALKLKEISYIQAEGFASGELKHGTIALIEDGTPVLTLI
FT                   TQESINWNIRGNVNEVLARGAKTCVFAMENVAQPGDRFVIPQVHPLLTPLASVIPCQLL
FT                   AYYAALHRDCDVDKPRNLAKSVTVE"
FT   CDS_pept        769843..770580
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0744"
FT                   /product="riboflavin kinase/FMN adenylyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.2"
FT                   /note="FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0744"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83446"
FT                   /protein_id="CAR83446.1"
FT                   /translation="MEVSHVTLAPNKDSRPAVLTIGKFDGVHIGHQTILNTALSIKKEN
FT                   EILTAISFSPHPLWALKQIEIYREMLTPRMEKERWLAHYGVDHLIETAFTPRYAETTPE
FT                   EFVRDHLTNLNLSHIVVGSEFNFGKGRDSDVDLLRDLCKPYDIGVTSVPVIETNQTKIS
FT                   STNIRAFIRRGHFQEAEQLLGHPWYITGNVENGEMIGLDDYVLPATGTYQTDSGMVNVT
FT                   NQRTILVELSDGLQQLHMKNELS"
FT   CDS_pept        770666..771145
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0745"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0745"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83447"
FT                   /protein_id="CAR83447.1"
FT                   /translation="MKIPTTLKHKPVIVVENYEEVDGKNAYHSDAKGLSLGLAQWNDRG
FT                   KVDISAKVWRHTGDKWSRQSEELPLHRVLDLAILIARTKVHFKDAYRLPHLYDKENPTL
FT                   DRIGLQGDALTIAVCEDNEYIDEDMQLFEQALKNDDELLSERLKTLSKLLQEAGY"
FT   CDS_pept        771159..771497
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0746"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0746"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83448"
FT                   /protein_id="CAR83448.1"
FT                   /translation="MNKDNRKELIRAYKEKAPDAGVYRFISTKSGKYLIDNTMDLKGIA
FT                   NKLAFGIKIGAGNMLPPEMAKEAKEHGIETIQFEILEKVDIKPEMTKEDIKEENDVLLS
FT                   LWLEREDI"
FT   CDS_pept        771645..772040
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0747"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0747"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83449"
FT                   /protein_id="CAR83449.1"
FT                   /translation="MNPRKPEFILTLIAGITGIIAGITGIASGGLLAALSGSEELSETA
FT                   AMTTADTEALAAMGGLTVILSGVALVIGIALIIFAVLIKRNAKVFGILTLVAGIGGFFL
FT                   VNLLWIVPGVLAVIAGIMCLARKVQTI"
FT   CDS_pept        complement(772151..773941)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0748"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0748"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83450"
FT                   /protein_id="CAR83450.1"
FT                   /translation="MRHFLRKTFLILTSFTIFATLISLIFSNVYAEQSTSWLEQELDGN
FT                   EPFINAVERRLNKSREEVNLQDLESMTTLDVENASSFPEKITDFKNLTTLTVQMGTITE
FT                   VPDNLAELKKITTLNLYKNNLTEFPMVVFQLPVLDSLQLANNSIKEIPPELTSMSSHLS
FT                   SLGLQNNQLISIPTEFFTIDWASGYWPPLGLRPLLTSLAGNQITSDIPADYLDNYNNGG
FT                   NMLEHYSYKQGQDQLVYNGEPITVPFNTDFKQLSPDESKLGLASNKALFDAHEFEYYDD
FT                   GSSTLENGVATKEGPGFITIKSTLSTKSNPFAKVRVPIVVEAPPKGADITVEYKSTTGE
FT                   TLAPIDTLEGLLDANYTSNPKTITGYTLTETPANANGTFLKEPQTVTYIYSKDPVPAEP
FT                   VTVNYVDDKGKELAPSETFTGFIDDPYVSLEKTIDGYSLVSAPTNANGKLTANAQTVNY
FT                   IYQKILIPAEPVTVNYISDTGEKLADQTLLKGNIGDPFSTSPETITGYKLKTTPTNAKG
FT                   TFSDKTQTIEYVYEKKKNLLKKGSTLSVKRNNSTSAPTEISAANKPKLPKTGDTKPLDS
FT                   TLAGLFLLASTIILWRKNSH"
FT   CDS_pept        complement(774118..774219)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0749"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83451"
FT                   /protein_id="CAR83451.1"
FT                   /translation="MILLVLQQNKNQNKHPKNPQHLFQTHPKTLKIT"
FT   CDS_pept        774460..776391
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0750"
FT                   /product="leucine-rich repeat domain protein (LPXTG motif)"
FT                   /note="Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0750"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83452"
FT                   /protein_id="CAR83452.1"
FT                   /translation="MKKAFLCLSAVVLSLNFVWVNPLSGLASKIETTKLKSTMDTNQQV
FT                   NLKNNATDIVTSEDLGGQTWLINEVNRQLAPKKVGVDLTFDDLAKIKIISLSNKSLTGE
FT                   VPPEIKNLVSLEKLLLYSNKLSGEIPAELGELTNLSELRLDYNQFTGKIPDGLGNISEI
FT                   ALQSNRLVGQIPLSLYENRTGENEVNVSGNQVTINSKQSEPSVYSAYTFVYPSSTPEYS
FT                   GHIKANNSFISNLTNDMNLTPFLKNSPTFINLQAVYMFNSELFDGHDVTITDTNDGKVL
FT                   YDGALTSDISIPLTNFKSGIHVINVMLDNAPNNPQNQTTFLIDILPVAAHDLTVNYVDK
FT                   AGAEIHEPQTVSGNVGDDYDVTTPEFELSIDKYELDTEQMPTNGIGTLSSEAQTVTYVY
FT                   KKMEGAPVTVKYVDENGNEITTSDTLTGKLDDSYQAKAKEIAGFTLDNSKLPANASGVF
FT                   ETNPQTVTYVYQAVLATIKAHDSTIYVGDKWSAEDNFDSAVNSVGAAVSFDDLEVEGTV
FT                   DTTKAGVYPVTYSFAGESVTINVTVKAKDLPAPPVTPTKPVAPIQPTHPDQPNIQAAPG
FT                   EHQASTDKPEALKVTAAQKEQPTVAGNLKLPTTGDNLWDSVLYSVFGLIAVCVAFSLFF
FT                   RRKKQKHS"
FT   CDS_pept        776545..777054
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0751"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0751"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83453"
FT                   /protein_id="CAR83453.1"
FT                   /translation="MLNENIKAIRKSKGLSQEEIAIKLNVVRQTISKWEQGLSVPDSDM
FT                   LISISEVLETPVSTLLGETVMVSKVDDVKAISEKLEIINLQLAQRKTARRKLLYWLFVS
FT                   LCAIIATISAVFIILNSPYLGWDYSDPETSVIGVAFHTFEWLFVRLAPIILIGGVVGIF
FT                   LTRKNV"
FT   CDS_pept        complement(777158..777817)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0752"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0752"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83454"
FT                   /protein_id="CAR83454.1"
FT                   /translation="MSEKLDTVLGYLKEFPDYYKHVKKQTYTMNEKIIFEEEKAKHIFF
FT                   VLEGYAAVELEDNLRKTNYISIFVLPYNILGIDAFSSYPKKKHSITVMSKSLVLYKIDT
FT                   DFLLNILSIKPDVNDFLLTSIADVFARHYALLGMIAKTPKERIYMALENLAVEMGSEDE
FT                   EKNEIVLPNFINQSVLARYCRTTQPNISNLLTELVEEEFLVNKKSPYRIDKDSLDI"
FT   CDS_pept        778079..778456
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0753"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0753"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83455"
FT                   /protein_id="CAR83455.1"
FT                   /translation="MKFDDSKPIYKQIVHYIHTEIVTGIYKAGDKLLSVRELATKLEVN
FT                   PTTIQRAYAELEEAGIIFTVRGTGKYLTEDKRRMEQLENDIAKQLTENFISEMSKLGIN
FT                   KEKIIAWVKKVEEVKVNVSGE"
FT   CDS_pept        778440..779129
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0754"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="ABC-type sulfate/molybdate transport systems, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0754"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83456"
FT                   /protein_id="CAR83456.1"
FT                   /translation="MLVGNNIAKSYPNKLVLQNVDFEAKPGDMIVLSGENGSGKTTLLD
FT                   MLANLKKTDSGTLQLDNEVFIKNEIRQQIAYLNNELYAKKSTTIEEFMKQHALLFENME
FT                   LDKWDQLLAGWRINKRLKLGELSTGMLMKVKIGSVLARKAKLYLYDEPFASIDIVARSE
FT                   VMKAIISETEPDAITIISSHHLEGTEKLYNKLWLIKDNTLKTIETETYREATGNSLIDF
FT                   YKEEMNK"
FT   CDS_pept        779126..779830
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0755"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0755"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83457"
FT                   /protein_id="CAR83457.1"
FT                   /translation="MTKMITFYLKQISPILLIGLALIFGLNFLGFTINLLEGADLLFRA
FT                   IRGTTVMSLILVLITTWKITKLDTSKENVTLASLSGFSETKKFFGKLFAAYLSAICVIL
FT                   LQSAFIWYYGFETGRIEAGDALSFVSGTLMMFLFIAMFVCYFVIPVGWLKDHVKASSLQ
FT                   KAAVVLLLFAILIVNLLAEYYLHIYNSAGIISILPNGHFEISLLSIIWNVGLCSVIAGS
FT                   YIYMKSKKMDTI"
FT   CDS_pept        779845..781845
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0756"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0756"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83458"
FT                   /protein_id="CAR83458.1"
FT                   /translation="MLEVKHLKKSYKLGKKSETPVLKNINVTIQDGEFAAIIGKSGSGK
FT                   STLLNIISGLDTDYSGQVLYNGDDLQDIDLDAYHLNHIGFIFQSFHLVNHMSVIENVKI
FT                   PLYLNAELSESDRNARALDLLRQVGLDEFASKKPTQLSGGQKQRVAIARSLANNPDMII
FT                   ADEPTGALDSVTSAEIIQLLKDLAAKGTTVIIVTHDLNIADQTDAVLRLADGEVISFER
FT                   KKEVTQKVTHKNEKKLRLNWWATAKISFKSFFNRKFRNLLVALGTSIGIIAILLAFGLG
FT                   NGVNQSLSKIFGTTFSPNQITTYYKEDGGSRSPEPTTPLTSSEIKKIKQLYEAENITEI
FT                   YERTTIQGIKFEYDGQYLKDISAEMQEANFKASRYEDLTVKDEYLLSGKMVTNNETGAV
FT                   IPSSVARAILGKKDSDELTKSDGDKLIGKTITLVYAGRNSDTKNTVKIETTISGITNPS
FT                   KEGFARGFDVSTKTMNDFIKTTGIEKPILSVDAFTKTTAEAEEIVEKYEDNKDWANYSI
FT                   TNANAFVDTFSQFTDIIVYLIAFIAGLSLAVAGVMIAIVLYIGVVERTREIGVFRAIGY
FT                   RKRHIRGLFMMEASYIIILANVLSSLVAVTIAKIASPILETKIGFEDMIHISFWNFLVT
FT                   LAITITIGFIFSIYPSNKAAKLDAAEALRSE"
FT   CDS_pept        781874..782377
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0757"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0757"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83459"
FT                   /protein_id="CAR83459.1"
FT                   /translation="MKKPLKISLIVVGIAVVIFAGVMLSYRFIKSMDVTENAEINKSAT
FT                   GDHVLLATQGSKFKDSVMDQVKKDMEGKNVHVSIIDTTKLDKVKADDYDKVVLFTTVQS
FT                   DDIPENVSTFMNDNKDKSIHIAVTADSGRWDDKPKDIDAISEASKAENKQDFVDDLTKA
FT                   IVAE"
FT   CDS_pept        complement(782528..782827)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0758"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83460"
FT                   /protein_id="CAR83460.1"
FT                   /translation="MKYCCISIIIIICYYFTNEKMKLDFGISTTTIVEEVKKNREGYST
FT                   LLNKLAEKELKGITTLRNFRLLVSSIFLIIVILLIAITYLAKKRQRITEDFIAN"
FT   CDS_pept        782945..783232
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0759"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0759"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83461"
FT                   /protein_id="CAR83461.1"
FT                   /translation="MLQQDNEVDRIKSILPLVVARNSIIETLGRNPVWGISLTDDVNNL
FT                   KIDNQLVTEVIPFDWNNETLYLCYFSGLESSNSPSEMGISFQLVNIFSLS"
FT   CDS_pept        783339..783626
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0760"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0760"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83462"
FT                   /protein_id="CAR83462.1"
FT                   /translation="MEMNASFIGLYAITVYYLYGYLEKRERLEWLLLLPVLMALTITIT
FT                   NTNAYYENIVTNPLEQNIVSFIASFIILVVCLTIPVSIVLFFRKRKGEVQ"
FT   CDS_pept        783623..783829
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0761"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0761"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83463"
FT                   /protein_id="CAR83463.1"
FT                   /translation="MKNIKMKVARVEKDISQEELAKLIHVSRQTISSVEAGNYNPTLNL
FT                   CIAICKALGKTLDDLFWEEDDNV"
FT   CDS_pept        783822..784337
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0762"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0762"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83464"
FT                   /protein_id="CAR83464.1"
FT                   /translation="MFKNLFKKPKMKDEMLEMKQNQYGARAFNMMIIIVAIVILIKAVV
FT                   LEASISELWVELLLLIVGGGYYFYSVLKNNVPFMPTISLKQTIRLVFLISAIFGISVGI
FT                   RNVFFLYADNMSGTELSYQMMMFFFISLFTAIGSGVIFGALAYCLYQLSKWQEKNIMKK
FT                   IEVENAED"
FT   CDS_pept        784392..784688
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0763"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0763"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83465"
FT                   /protein_id="CAR83465.1"
FT                   /translation="MDIAKWFDNAELYSISQVLKENAARFEDDCIGIIFPCYNFAASRM
FT                   VCEFNERIQLVSQYIFVIVTYSNTALMCASTELYEHFLMSTYHLVGVFWKINP"
FT   CDS_pept        784784..785620
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0764"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /EC_number="3.8.1.3"
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0764"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83466"
FT                   /protein_id="CAR83466.1"
FT                   /translation="MSVLNIEGAKLSYQKVGQGPILIFIPGANGTGDIFLPLAEQLKTS
FT                   FSVVMVDRRGYGDSELTAAIPERASHAYDDYRVTRDAADIAALAKALSDVPVYILGSSS
FT                   GSIVAMHVLKNHPEVVKKIAFHEPPINTFLPDSEMWQEANEKIVQTALTKNMAEAMQLF
FT                   GETLHIATIDAESMSKPAVTIDEVTKDSTTQQMKYWFAYEIRQYTSSNISLDDFKPYVH
FT                   QITLLNGTDSKGSFPQDVNAFIAKQLGLTIVDIPGGHLGYIQKPAGFAKVLLSIWG"
FT   CDS_pept        785746..786426
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0765"
FT                   /product="transcriptional regulator, Crp family"
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0765"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83467"
FT                   /protein_id="CAR83467.1"
FT                   /translation="MNIRTELQNSQLCEGLTEAQLSELMNKITVKEKHYKNNEILFYTD
FT                   EVTKVYILVKGNAAIAKNTSSGKRILGKNVTEPGELAGEIYYFSHRNPFWDYAIVLEPT
FT                   TVLEISGIDQGTLQTLDLALQNQLLVNLLKSVTRKFEYIGEKVRMVSEDSVRAKISNYL
FT                   FGIQDDDGSIELTETREEIADYLDITRPSLSRELGRMQKENIIRIEGSSVIILDAIIFD
FT                   TFIE"
FT   CDS_pept        786507..787118
FT                   /transl_table=11
FT                   /gene="btlB"
FT                   /locus_tag="lmo4a_0766"
FT                   /product="bile tolerance locus B"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0766"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83468"
FT                   /protein_id="CAR83468.1"
FT                   /translation="MLLTRNEPFTAEKIQAKADILELVQFERFCRDNALWDAMETCFTK
FT                   DSNVKISWFQGTGHGFIEASKKMTNPAPHKIYNIQVWIKNDRAVAIMQATIQTRTIING
FT                   VEMELNSDAKLVTRVERIDGKWYINAFEGVYEKDSLMPVVPSKNADVPAELLANFRKSY
FT                   ACLALSLTLNGYEIDNNLPGIDRPEQVTQFFKEADEWLLQ"
FT   CDS_pept        787233..788054
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0767"
FT                   /product="lipase/acylhydrolase, putative"
FT                   /note="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0767"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83469"
FT                   /protein_id="CAR83469.1"
FT                   /translation="MKKSKTVQILLVFSVVALILSMVGVVSIWYGQKNHQTNNAKTTAK
FT                   KETTVTKKQDMFKITALGDSLTYGVGDTEGGGYVRVVENFYKQKEKNVENVNLAISGAK
FT                   SDQLLKQLDQKEVQNQIKSADVILMTIGGNDLFRGGEALDDFKSDAIKQAEASYTSNLK
FT                   QIYQTIRNLNPSAPVFHIGLYNPFMSLENASEMSAVANEWNMQSQNLSQNEKNIIYVPT
FT                   FDLFQQNGDAYLATDKFHPNHAGYQFIGNRVTEVIETGGGEGDDGASTSSN"
FT   CDS_pept        788026..788931
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0768"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0768"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83470"
FT                   /protein_id="CAR83470.1"
FT                   /translation="MTERALQVTNLHKKIRKREIIKGISFEVMPGEVFGFLGPNGAGKT
FT                   TTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYSFLTGQENLAYFAR
FT                   MDSSIKKERIQEVTELVGLEKRINDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNG
FT                   LDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVAHLL
FT                   SSRAQLRWRVTPIEQAKAFLESVTEVEVDGEYLVTAMNEESAEWNEQLVAKGIKVHEID
FT                   KRKPSLEDLFLELTGGQSID"
FT   CDS_pept        788924..789904
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0769"
FT                   /product="ABC transporter, permease protein"
FT                   /note="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0769"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83471"
FT                   /protein_id="CAR83471.1"
FT                   /translation="MINLVYNEQLKLWRKKRLIVILALVAIIVAIFTYAQFRHHQEDEK
FT                   QAGTSDWHVQTQQQIVDLENRLGTGRLPEEYQKYFKVLVGQLQYYLDHDINPNAPGAPT
FT                   FLKTFVENGISLLFPLFIMVIAADLISAETSAGTMKFLLTRPVKRWRILTSKYVSMLLS
FT                   ISAIMVLSAVIAYLISGIVFGYGGWDAPVLTGFGMKDGAVTTTDVYQLPVWQLLLMEFG
FT                   LAWFVSMVVGVLTMFVSVLVRSTAAVMGIMLASLITGTILTNLVSSWPSAKYLFMVNLQ
FT                   LTNYLNGSSPPVEGMTLNFSMLVLTAWMLVAFVLSYFIFTKRDVY"
FT   CDS_pept        790031..790921
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0770"
FT                   /product="glyoxalase family protein"
FT                   /note="Predicted ring-cleavage extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0770"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83472"
FT                   /protein_id="CAR83472.1"
FT                   /translation="MIKGIHHVSALTKSFSENHHFYSDILGLRLVKNTVNQDNIHMRHL
FT                   FYGDYTGSPGTLLTFFEVPRIGSSYNERAFFGNITLGIPKDTNSYWEKRLNDFAISFIK
FT                   QGQTLTLQDPDTMGIILTEIPETISNPTIHTDIPAEKQIVRIIGADYHVPDPAATSQFF
FT                   TDLFGLESQNGVLVDMSEMSFAKLHATSSDKKSRTGRGTIDHIAYTVETKEAVDELHDI
FT                   AVRNDLEIEEFVDREYFKSLYIREPGGLRIEFASAGPGFTIDEPLETMGDRLALPSFLE
FT                   EKRTEIETYFGGDLS"
FT   CDS_pept        790918..791877
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0771"
FT                   /product="glyoxalase family protein"
FT                   /note="Predicted ring-cleavage extradiol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0771"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83473"
FT                   /protein_id="CAR83473.1"
FT                   /translation="MIKDLKGIHHVTAMTSSAEKNYAFFTEVLGMRLVKKTVNQDDIHT
FT                   YHLFFADDKGSAGTDMTFFDFPNLPKGRHGTDSISRVAFRVPSDAALEYWLDRFEQLEV
FT                   PHSDIKTLFGKKYLTFQDFDDQQLQLISDENNEGVAAGTPWKNGPVPEKYAIYGLGPVF
FT                   LTVVSLKNMEAILQTIFGFRKVTEEDGLHLYEVGEGGNGAQVIVEERTDIPAAMQGYGG
FT                   VHHVAFRVEDHEELQKWIDRMNTIEAPNSGYVNRFYFESLYVPVSERILFEFATDGPGF
FT                   ASDEPYETLGEKLALPPFLEPKRAEIEKMVRPINTKRS"
FT   CDS_pept        791884..792492
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0772"
FT                   /product="carboxylesterase, putative"
FT                   /note="Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0772"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83474"
FT                   /protein_id="CAR83474.1"
FT                   /translation="MEHIYIPGKNKDLAPLLLLHGTGGDEKSLVEVAEFIAGDAAVLSL
FT                   RGDIKEGGANRFFKRFHDGSLDLEDLESKTAELITTTRELAEKYQLDFERMIAVGYSNG
FT                   ANIAANALLQAEDSFHKAILFHAMPAGNKQPEFSISHRNVFLSAGLNDPLITAKASEEL
FT                   VEILEKRGAKVETVWTAAGHSLTMEELEEAKKWYQNNQK"
FT   CDS_pept        792502..793122
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0773"
FT                   /product="FMN-binding split barrel domain protein"
FT                   /note="Conserved protein/domain typically associated with
FT                   flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0773"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83475"
FT                   /protein_id="CAR83475.1"
FT                   /translation="MTIFKSADLSQKENYKFLTGSIIPRPIAFVTTLAEDGVTVNAAPF
FT                   SFFNVVSSEPAIVSIAVQRANGEQKDTARNAAFTKELNIHIVSESFVGEMNKTAARLAP
FT                   DVSEIDKTSLYLEQVPGMKTPKISEANIVLTAKLEQIIPIKNDADEIVSDLILARILTY
FT                   DFADEVFDSEHHYILPEKLEPVARLAGNDYTKLGDIFRIERPN"
FT   CDS_pept        793450..794706
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0774"
FT                   /product="hflX family GTP-binding protein"
FT                   /note="GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0774"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83476"
FT                   /protein_id="CAR83476.1"
FT                   /translation="MERKVLIVGISQKQKDFDYSMEELANLAAANNMEVVGEIRQNIDR
FT                   ENRATYVGKGKVDEIKGLAEMQDARLIIFNDELSPSQIRNLEEALELDVMDRTGLILAI
FT                   FANRAKTKEAQLQVQIAKLQYELPRIFGQGEDMDQQSGKGGLSNRGSGEKKIETDRRTI
FT                   KHQIRHLQKELDMLVDDREVRRRKRKKNEIPVVSLVGYTNAGKSTTMNGLVRAYSETAD
FT                   KQVFEKDMLFATLETSVREIVLPDNKQFLLTDTVGFVSKLPHQLVKAFRSTLEEARDAD
FT                   LLIHVVDYSDPHYKTMMKTTEETLKAVGVEDVPVIYAYNKADLLEDEIYPKQTENTIVF
FT                   SAREEESLVFLTEVIRKELFASYEKATFLIPFEAGQVVAYLNEHADVLETEYLENGTQI
FT                   VAEVSPADLQKLAEYQIAE"
FT   CDS_pept        794772..795644
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0775"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0775"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83477"
FT                   /protein_id="CAR83477.1"
FT                   /translation="MKKTGWGILGAVAAFTGYAYWSTKHLTVTDYEIVSDKIPAEWDGA
FT                   TFVQLSDLHSASFGLYNNPLLSMVNELAPDAVFLTGDMIDGDESPFVAMAVVRKLAKEF
FT                   PVFYVSGNHEGRSAFYEDFKADMEKHHVAVLENERYFLKKDGAAIMVAGVRDPRFVRED
FT                   WAEKELPKEVWEEAALKEALDDATANLSPDYFTILLAHRPEFWPLYQAYPIDLVLSGHA
FT                   HGGQFRLPLTEGLFAPGQGLMPKWTAGIHRAGGKALIVSRGLGNVTKLPRLFNDPEIIR
FT                   MTLRAKGDA"
FT   CDS_pept        795650..796639
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0776"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="Lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0776"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83478"
FT                   /protein_id="CAR83478.1"
FT                   /translation="MIYLDNEDVLDQAYNFAMEEYALRSLDENETYFMFYRMKPTIIVG
FT                   KNQNTLEEINHAFVKEHHIDVLRRLSGGGAVYNDEGNISFSMITKDDGNSFQNFAKFTE
FT                   PVIRALRKLGVNAELSGRNDIEVNGKKISGNAQFATKGRLYSHGTLLFDVDLSMLEKAL
FT                   QVDPEKYLSKGVKSVRSRVTTIREHLAEDIDILTFKQILLESIFETKDIPRYTFTEADK
FT                   QGIEKLRTERYRNWDWTYGKSPKATIKCKKRFPAGTIEFQVSLEKGQVKEATIYGDFFG
FT                   TEDVAELAGKIIGCRFEREEVEKAWNAIDTKAYFGGIEKEAILAMLFE"
FT   CDS_pept        796772..797524
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0777"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0777"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83479"
FT                   /protein_id="CAR83479.1"
FT                   /translation="MAIKKLNDFYFKKLGSWNLVHSFIKGFWRAFFLVVLLLIIANIIV
FT                   VYLLDNVFLIPVILISLLCIPLFYYVLIYSRAKKFIRTRYQLRNFKELTVMRRYLLFAY
FT                   LEKSGFSSRDDLDKLLRFIHSEMAEEQKNHKPLSTIIGVFIAAFLAILGGTFLFLMDDV
FT                   VERLIAAVIIIVMAVVFYFIGLTLMSIIRSKSEKNTRKEHELTKEIIAIQTAMLVSENT
FT                   SYHPFLAMEKKVNENDFLKEIITSRSFL"
FT   CDS_pept        797559..798206
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0778"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0778"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83480"
FT                   /protein_id="CAR83480.1"
FT                   /translation="MTTKRKETRESVCYREIKKKIRNGELKPGDRLIENTLSQQLEISR
FT                   TPIRKAIGMLAADGYVEYNDFRGAFVRDSIINKERYFEMTEIIGLFLKQAIQKIRTKKI
FT                   TFNKMRVVAKLVEIEREQPTDPATYFEYEKWFVSDLLTYMKNNYYLKISDDFFNNIQEF
FT                   GDEEVIKIAQNACVKTIANIQRFIDALDAQDYDKCIAIIDQVIDAHVLVAYR"
FT   CDS_pept        complement(798248..799237)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0779"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /EC_number="1.1.1.1"
FT                   /note="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0779"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83481"
FT                   /protein_id="CAR83481.1"
FT                   /translation="MKSFQALFIEKEADNTSLHFRETTIDNLPENEVTIEVHYSGINYK
FT                   DGLAVLPDGKIVSEYPFIPGIDASGVVTHSKSDRFQVGDEVIVTSYDFGVSYFGGYSEF
FT                   IRVPADWVVPLPDGLSLKEAMILGTAGFTAALSVDALEFSGVTPDAGKIAVSGATGGVG
FT                   SLSSAILAKRGYSVVASSGKRDAKEFLEKFGVSEVVSREAFQPEKVRALDKQLYAGAID
FT                   CVGGKPLAYLLTAVQYGGAVTTCGMSAGGKLDTTVFPFILRGIQLFGIDSVLCPMPKRE
FT                   RIWNRLATDFKLTNLESLVTEVVFSELPEALHQVMNGGVTGRYLVKIK"
FT   CDS_pept        799416..800345
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0780"
FT                   /product="conserved hypothetical protein"
FT                   /note="Sphingosine kinase and enzymes related to eukaryotic
FT                   diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0780"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83482"
FT                   /protein_id="CAR83482.1"
FT                   /translation="MGKALLIVNPSSGKEKGKIYQGKTEEVLKKRYDEVEVRLTEKAGD
FT                   ATEFASWASEQGFEAVIAMGGDGTLNETINGLAIHEKRPDFGFIPLGTVNDLARSVGIP
FT                   LKPEKAIQALEKAIAVPMDIGRIGDQYFMNVLAIGMIAQAVDQVSVEQKTKFGSVAYFL
FT                   EGLKAFNRNELLHFKLEYDEEVWEGEAALVVAGLTNSVGGMESWAPDAKIDDGYLHIII
FT                   LTKLGLLDAANMIPQLIRGNLKNSDGVVYIKTKKLTIDASGDDLSINVDGDPGPGVPAE
FT                   IEVLGSHLNILAPKKSSKKRFGPFILKK"
FT   CDS_pept        800385..800717
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0781"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83483"
FT                   /protein_id="CAR83483.1"
FT                   /translation="MEEELEVIHKGLANAKNGFKAVPGKLYLTATYIVHKPNDYFDEEI
FT                   NIPLNRVAKIRGVRTKILGKELLSNILEIDMISGVKYQFVVNKQKKWLEAVSKVLESRG
FT                   ESEKLA"
FT   CDS_pept        complement(800756..801622)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0782"
FT                   /product="ROK family repressor/kinase"
FT                   /note="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0782"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83484"
FT                   /protein_id="CAR83484.1"
FT                   /translation="MTILAFDLGGTAVKFGVLTTAGEILEKGKFKTPDSLEEMIQSLVD
FT                   VKANYDYTFQGAAFSCPGAVNNETGIIGGASAIPYIHNFPFKQLLEEKLGLPVTMENDA
FT                   NCAALAEVWIGAAKDKQDIIFMILGTGVGGAVIRGGKVHHGANLHGGEFGYMLMDRDGH
FT                   TLSELGTVVNAATRIAERLDVPKASIDGLRAFELRAEGNKIAKEELDTMFYYLARSIFN
FT                   LQYALDPELVVIGGGVSERADFIQELNEYVAKVKATVPIATISPTVVGCQFGNDANLIG
FT                   ATAFHLA"
FT   CDS_pept        801780..802163
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0783"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0783"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83485"
FT                   /protein_id="CAR83485.1"
FT                   /translation="MEIKVQKKLTDGRIAFSSEYGECVGIWADEDPEPSRIYTVEITIP
FT                   DMISAELLHESEEKHCVLEIDEEGLVHVIGKLEDYEEDGFAVLRLEESIICFDTKFSEE
FT                   IEMLHGRFVEFVIPEIKLSNVGI"
FT   CDS_pept        complement(802216..802683)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0784"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0784"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83486"
FT                   /protein_id="CAR83486.1"
FT                   /translation="MVWDATNIFLFAANILTVLYILYNDAVIPLWKGKTVLSVKLRSRG
FT                   RWDGYIFVGIIVLLFVSNTFFREGPFSTSVLLGIMGVLFIYICFFRSSKAVFKESGLFY
FT                   ALLFFPYAKIERMNLSEDGVLVIETNRQRLMLFARSEKDLEKMLAVFTTYS"
FT   CDS_pept        802853..803200
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0785"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83487"
FT                   /protein_id="CAR83487.1"
FT                   /translation="MTEKNVEELMLMHKRIIENLEEFSMPAKQQMEKLKDFVVTDELAS
FT                   DFSDIALQYAKILFDHGWLTKEQLDMFLVVDKKLEGMSNNEDLWSDEALETSIEWAECR
FT                   EQGKEILKTFE"
FT   CDS_pept        803237..803608
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0786"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83488"
FT                   /protein_id="CAR83488.1"
FT                   /translation="MIKVKSIHWLDEDAREADVVLTDGEYNVVCFSHPCELTLNGVYNK
FT                   LIYCFDPFDIFKLNQAEYSMEKPNDNQELSILKGKLIDATDSIIQIGEFRIDISEGDIA
FT                   QDIHEGDFVELKVHRIDTE"
FT   CDS_pept        complement(803683..804561)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0787"
FT                   /product="PTS system, mannose specific, IID component"
FT                   /note="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0787"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83489"
FT                   /protein_id="CAR83489.1"
FT                   /translation="MSEQITVNEKKITKSDLMGVFIRSNLFQGSWNFERMQSLGFCFSV
FT                   IPVIKRLYPEKGPEREQAIKRHLEFFNTHPYMAAPILGVTTAMEEQKANGADIDDGAIN
FT                   GIKVGLMGPLAGVGDPIFWGTVRPVLAALGAGFATDGSIIGPILFFVLFNAIRLGFRYW
FT                   GVFYGYTKGTDVVSDMSGGLLQKLTEGASILGLFVMGALVNKWTTIYVPLVAYTTEDSK
FT                   TGKDVPTTVQSILDQLMPGLLALLLTFACMWILKKKVNALWLILGLFVVGILGYWSGIL
FT                   GLPPAGYSPLG"
FT   CDS_pept        complement(804579..805394)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0788"
FT                   /product="PTS system, mannose specific, IIC component"
FT                   /note="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0788"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83490"
FT                   /protein_id="CAR83490.1"
FT                   /translation="MSAIQLILVFLVSCISGMGSILDEWQTHRPLIACTLIGLVLGDIT
FT                   TGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTILVITGGQDISVGISLAIPLAALG
FT                   QVLTILVRTITVAFQHMADKAGKEGNLRSLDWIHVTALLLQAMRIAIPAVIVAVTVGTS
FT                   AVENLLNAIPDVIVNGLNVAGGFIVVVGYAMVINMMSAKYLMPFFFLGFVVAAFTAFNL
FT                   VALGVLGLVAAIIYIQLNPKYQLKEAIQQYGGGGGGRSADDDLDDDLDD"
FT   CDS_pept        complement(805569..806054)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0789"
FT                   /product="PTS system, mannose-specific, IIAB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0789"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83491"
FT                   /protein_id="CAR83491.1"
FT                   /translation="MEIRLARIDDRLIHGQVATVWTKETQVERIIVISDDVAKDEVRKT
FT                   LLTQVAPPGVKASVVDVQKGIRVYNNPKYATTPVMLLFTNPTDVLTLVEAGVNITTVNI
FT                   GGMAFREGKHMITNAVSVDETDEAAFRKLDEKGIELEIRKVASDNKVKLIPLLDKDK"
FT   CDS_pept        complement(806054..806488)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0790"
FT                   /product="PTS system, mannose-specific, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system, mannose/fructose-specific
FT                   component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0790"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83492"
FT                   /protein_id="CAR83492.1"
FT                   /translation="MPVGIIIGTHGEAARELLKSTEMIIGKQDNVEFITFVPGENTDTL
FT                   ITKYKEKLDKLDTSEGVIFMVDLFGGSPYNASSQIALPEDNMDVVTGVNIPMLLETLSM
FT                   RAASNQKDLVETALTAGSGGVKSLKQSLPKIETEVGEDDL"
FT   CDS_pept        806858..807235
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0791"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83493"
FT                   /protein_id="CAR83493.1"
FT                   /translation="MKQYQNLNIWIEAEVWDEYNWDMEDSNLDVIVTFSNRSKWIATFF
FT                   TYKNIQSLQAKNKQTGECMNGTYFFASDMILIDNTSRERVYEVIAQLMEQEEFETAFTK
FT                   YPDVDKSEDYLYPTNFFKDSY"
FT   CDS_pept        complement(807313..810129)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0792"
FT                   /product="sigma-54 dependent transcriptional regulator,
FT                   putative"
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0792"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83494"
FT                   /protein_id="CAR83494.1"
FT                   /translation="MKRIDRIYEFILENPSTKTIREQLEKNEGFTASTISETLSILRNN
FT                   VSMELNELHRQGKIIKIVGRPVLYFPKRAVEDEIGRTLSDNELEFDSCESLLKMLKPSI
FT                   VERSPFDDLIGVNDSLKTPVEQAKAAVLYPPNGLHTMILGQTGVGKTLFANLMYRFSQH
FT                   AKRLPADAPFIIFNCADYYNNPQLLMSHIFGHVKGAFTGADNDKGGLVEKAEGGILFLD
FT                   EIHRLPPEGQEMIFYLMDSGTYNKLGETDRTRKSNVLIIGATTENPESSLLKTFMRRIP
FT                   IIITLPSLEERTAFERVELLKYLLSSEAHRVNKPIRIEDEAAKALIGNTTYGNIGQLKS
FT                   NIQLVCAQGFLNSFDKDEEILIDFKTLPINIKDGFFHFSNRRKELQAIAEYLEPYTTIF
FT                   PEMNNTLITSDEYEPNFNLYKIIEDKASILMDQGVEDDDIKKFIKMDIDIHLNSFYNKF
FT                   KNTIHNRENILKIVNEEILNFAEGIELRIEHQLGKKLNERFLLAFSLHLTSFIKRIESN
FT                   KPLKYTNIENVVNDQPEAYELSREIKDDIEATFHIRVPNMEVMYLTLLISSLLKEQENA
FT                   RVAVLVATHGNNTASSMVSVAKKLLGEGLVEGIDMPLDQSPKIVLDKLTERAREMDMGR
FT                   GLLLLVDMGSLTSFAPVISERTGIPVRSIDMVSTATVIEAVRKSNILDMELDSIYDSLK
FT                   DFRGYGGYNSDDDTLDSNQKPHAIVTICATGEGTAEKLQLFIENILDTITTDAIKVIPI
FT                   GLHEMDTKLEQLQEENDILMAVGIQDPKIQIPFIPLERLFGIDGEEQLVSLVKQRNIIV
FT                   KKGETGRIAKEIIEESLNEFLTYLNPKKTIEILSSFASVLEKKLGYKLDNTFKINLLIH
FT                   VGCALERMVLNDGLIYREPKNMLETDIFKALEQTNKEVIYKMNLKLTNDELCYLYDILN
FT                   EIQPEVLS"
FT   CDS_pept        810322..810957
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0793"
FT                   /product="acyl-carrier protein phosphodiesterase, putative"
FT                   /EC_number="3.1.4.14"
FT                   /note="Putative NADPH-quinone reductase (modulator of drug
FT                   activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0793"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83495"
FT                   /protein_id="CAR83495.1"
FT                   /translation="MSKVLFIKASPLPNEVSRSSQVAETFMAEYKAKNPSDTVEELVLY
FT                   NTEVPLLDLELMTAGRELQAGKAFTDLAPDVQKKLNAYNSLTEQFLAADKYVFVFPLWN
FT                   LGIPPLLKAYIDTFVVAGKSFRYTDHGPEALLKDKKAILIHGSGGIYSAGPTSSFTHGE
FT                   PYLRTILQFIGINVVPSIFVEGIDHNPSKEAEIVAAAKAVAQESAAEF"
FT   CDS_pept        811150..812526
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0794"
FT                   /product="amino acid permease"
FT                   /note="Gamma-aminobutyrate permease and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0794"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83496"
FT                   /protein_id="CAR83496.1"
FT                   /translation="MEEQKEELQRGLKNRHIQLIAIGGAIGTGLFLGAGKSIHLAGPSI
FT                   MLVYLIIGAILFFVMRALGELLIHNPTTGSFTEFAEQFIGPWAGFITGWTYWFCWIVTG
FT                   IAEITAVGMYVKFWVPDLPQWIPALACVLILLLFNLATVKAFGEIEFWFAIIKVVVIIA
FT                   LIVIGFVLVFIGYKHGTSTASFSNLVDYGGFFPNGIAGFLLAFQMATFSFVGIELVGVT
FT                   AGEADDPERTLPKAINNIPIRILIFYIGALLVLMSIYPWSNIDPNTSPFVSVFSMIGIP
FT                   AAAGIINFVVLTAAMSSCNSGIFSTSRMLYTLSAEGKAPKKMHHLSSNGVPATALITST
FT                   ACLLIGVFLNYFLPEQVFILVTSIATICFIWVWGIILVAHLRFRHKHPEIAEKSKFKMP
FT                   LSPLMNWVSLIFFGGLLVILGFAADTRIALFVTPVWFLILAIAYQVLKASNRKTKIRHN
FT                   "
FT   CDS_pept        812791..817218
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0795"
FT                   /product="activator of (R)-2-hydroxyglutaryl-coA
FT                   dehydratase, putative"
FT                   /note="Activator of 2-hydroxyglutaryl-CoA dehydratase
FT                   (HSP70-class ATPase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0795"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83497"
FT                   /protein_id="CAR83497.1"
FT                   /translation="MIHAGLDVGSTTAKAVALNDQGDILFQTYRRHYSDIKKVTLEIMQ
FT                   DMQKKCGMTEMTFKITGSSGLAISKFLNVPFVQEVIACTEAVEQVIPETDVVIELGGED
FT                   AKIIYFSGGIEQRMNNACAGGTGAFIDQIATLLQTDPTGLNELAQNANTIYPIASRCGV
FT                   FAKTDVQPLLNEGARKEDIAASIFQSVVTQTISGLACGRPIRGKVAFLGGPLTFLDQLR
FT                   YRFTETLKMKDSDIIAPQNAEYFIALGTAFTGLNDVPLKVDDMIYRLSNMDMTTMATDT
FT                   VILPALFEKQEDLEDFRARHNQMKAKRTKLEDYEGDAYLGIDAGSTTTKLILMSQTNEI
FT                   LYSFYSSNNGNPLQSVIDATSDLYEILPEKVRVAQSGITGYGESLIKAALKIDVGEIET
FT                   VAHYRAAREFLPDVDFILDIGGQDMKCMKIKKGALDSLMLNEACSAGCGSFLETFAQTL
FT                   NLSIEEFAARALEAKAPVDLGSRCTVFMNSKVKQVQKEGVSMEDLSAGLAYSVVKNALQ
FT                   KVIKLRSPKDIGEKVIVQGGTFYNESVLRAFELLTGREVVRPDIAGMMGAYGAALIARE
FT                   HYETGEVTEMLVLEKLREFSAETSQSRCNLCSNTCQLTVTRFGDDRMFVSGNRCERGER
FT                   VETKRNLLPNLYAYKLKRTFDYKSLKKSEATRGTIGIPRALNVFENYPLWHTILTNLGF
FT                   RVVLSSKSSKNLYDKGIETIASEAVCFPAKLTHGHIMDLIKKKADRIFYPSVVYEKPEF
FT                   GEATNNFNCPVVAGYPEVIRVNVDALEEKNIPMISPFLTLDNEKALIEQMSLAFPEVPA
FT                   ADMEKAVQAGLEEAELCRKDIQAEGEAALTYIKKNKIKGIVLAGHPYHIDPEVNHGIPE
FT                   LITMNGMAVLTEDSISHLGEMDHKLRVENQWKYHARLYRAASFTAKSEDLEFVQLTSFG
FT                   CGLDAITTDMCQEIIEGHNKVYTLLKIDEINNLGAARIRVRSLKAAMEEREKNNVKPGI
FT                   MSKPKERPLFTKEMKKTYTILAPQLAPTHFEMLEAACKVGGYNLEVLPAVTPRAVDEGL
FT                   RYVNNDACYPAILTIGQMMDALKHGDYDVNNLAVLMTQTGGGCRATNYISMLKKALGEA
FT                   GLDHIPVISLNANGLEKQPGFKMTPKVLVRFLAGISLGDALDRMLYRTRPYEVEPGSAN
FT                   KMFRHYLDAGRALMENYSFGAYKKLANEMVRAFDNLPITNEVKPRVGVVGEILVKFHPG
FT                   ANNNIVDVIEDEGGEAVVPDLTDFILYCCYDDHFAANTFGRSKVKSFAKQSVAIPLINQ
FT                   FRKPVTDALKKSERFEAPASIESIAEKASQLLSLGNKMGEGWFLTGEMFELLDSNVPNI
FT                   ACLQPFACLPNHITGRGMIKGLKKMYPEANIMSIDYDAGSSSVNQLNRIKLMLSIARKQ
FT                   LETTEVVTEKETNTRFNPREKILGKAKQVRESAPVEMIGNKVKQARDADPVGAIAQKVK
FT                   HVASSSEHVQTDND"
FT   CDS_pept        complement(817254..818102)
FT                   /transl_table=11
FT                   /gene="phzF"
FT                   /locus_tag="lmo4a_0796"
FT                   /product="phenazine biosynthesis protein"
FT                   /note="Diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0796"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83498"
FT                   /protein_id="CAR83498.1"
FT                   /translation="MDISVYVASAFSKNNKGGNKAGVVLNEPTLTTAQKMTIAKQLGYA
FT                   ETAFLTESNCADFKLEYFTPKEEVALCGHATIGTFAILMHLNKIHKSRYTIETNSGVLT
FT                   ITIKEDTIFMEQNQPTFYDTIPPNKLTGCFDLNLLNTNYPIQIVSTGLKDILIPVKSEA
FT                   DLYALEPNFEKVKEVSKQYEVVGMHLYTFSDDRIICRNLAPLFDINEEAATGTSNGALA
FT                   CYLYQHQYLQKELYVFEQGHSLHSPSEILVKLDVTGNNEIARVYVGGNGYYSETKYLSI
FT                   E"
FT   CDS_pept        complement(818129..818605)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0797"
FT                   /product="ebsC family transcription regulator, putative"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0797"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83499"
FT                   /protein_id="CAR83499.1"
FT                   /translation="MNKKTNACRILDKQKVNYELREYAWSEDALDALHVAEETGNNPAQ
FT                   IFKTLVLTGDKTGNIVACIPANKTLHLKHLAKISGNKKCELIAVDTLEKLTGYIRGGCS
FT                   PIGMKKLFPTFIDNSAESLDTILISAGKRGLQIELAPTDLKKVVRAEFAMITEE"
FT   CDS_pept        818729..819382
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0798"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0798"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83500"
FT                   /protein_id="CAR83500.1"
FT                   /translation="MKKGLFSMVLVLAMVLVLSACGGASRVEPKKAGEITVNAVVYNKD
FT                   TDKVKDVYGEDGSKFEKEFETSFKESFISTFTASFSSDVNLDKQVDEFYDALRKQVNEK
FT                   TSYTTKVTNDDKESPEIQFAVKGLDMKGVQTELVEELTKAATADPSLATDDQKMAEKTM
FT                   EIYTKAVQNADAVSEAKTVTLKLKADPDDDSLWKMENDMAFMQELTTAFFMGGM"
FT   CDS_pept        819487..820377
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0799"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0799"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83501"
FT                   /protein_id="CAR83501.1"
FT                   /translation="MTTIKIALIQQKAVPNNKEANLKLAIKYIREAHKKGADLVLFPEM
FT                   WSNGYAPPFEDAFNHPLATGFGAERFKWLNEAIEADSAYVSTLKKLAKELQIGICATYL
FT                   SKTEQKIQNTAIIIDRKGEIILDYAKVHTCDFSLEILLQSGEEFKVCEFDGIKLGVMIC
FT                   YDREFPESARVLMLKGAEIILVPNACDMNPARLNQLNSRAFENMVGVAMANYPGEKWGR
FT                   STAFSPIVFDENGDYRDNTIIETDDVSEGIFIAEFNLDEIRTYRENETWGNAYRKPQTY
FT                   TDLISLDVEAPFKRN"
FT   CDS_pept        complement(820413..821114)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0800"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0800"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83502"
FT                   /protein_id="CAR83502.1"
FT                   /translation="MVLLGALVNGLGILIGSVIGMKLHNIPERMKDTVMKGMGLSVIVL
FT                   GIQMAFKTSNSLIVILSICFGAVIGEWLNIDYHLNQLGHWIERKVGAKGKSNVSKGFVT
FT                   ATLIFVIGAMGIIGALDSGIRGNHDVLYTKSVMDGFIALLLSTTLGWGVMLSAIPVFLF
FT                   EGIIALFATQINQFVPADLMTLIIKELTATGGIMILAIGLNLLGLTKIRVANLVPGILV
FT                   VALIVTGLYYF"
FT   CDS_pept        complement(821228..821869)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0801"
FT                   /product="conserved hypothetical protein"
FT                   /note="Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0801"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83503"
FT                   /protein_id="CAR83503.1"
FT                   /translation="MKIGIIGATGRAGSRILEEAKNRGHEVTAIVRNAGKITQTHKDIN
FT                   ILQKDIFDVTLSDLSDQNVVVDAYGVSPDEAEKHVTSLDHLISVLNGTVSPRLLVVGGA
FT                   ASLQIDEDGNTLLESKGLREAPYYPTARAQAKQLEHLRSHQAEFSWTYISPSAMFEPGE
FT                   RTGDYQIGKDHLLFGSDGNSFISMEDYAIAVLDEIERPNHLNERFTVAGK"
FT   CDS_pept        complement(821953..822873)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0802"
FT                   /product="rarD protein"
FT                   /note="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0802"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83504"
FT                   /protein_id="CAR83504.1"
FT                   /translation="MENKQNGQLGGIIAGALAYVCWGVLPIYWKLVTNVPPMEILAYRI
FT                   IWSFIFMLFLIVCLRKASMVFQETKDVLLKPKTLIAIIAAAFLVTANWYLFIYTVNSGH
FT                   VTEASLGYYINPLVNVLLATVILKERLSRGEIIAVISATIGVLILTWHLGSVPWAAIGM
FT                   AVTFSLYGLIKKVVSVSVWTGLTLETMIITPFALIYVIFFATNGLMQYAAQTNIILVGA
FT                   GVVTAIPLLLFATAAKKISYTMVGFLQYIGPTLMLALGVLLFKESFDHMQLFAFMFIWL
FT                   ALIIFTISHIYSAAKIKQLANAAKK"
FT   CDS_pept        complement(822981..823511)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0803"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0803"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83505"
FT                   /protein_id="CAR83505.1"
FT                   /translation="MTVEKWNVDPAHSSIEFQVKHMMVSKVKGAFSDFTADIEMDPEDL
FT                   TSAKLNFSVAAASVDTRQAQRDGHLKSEDFFNVEKYPNVTFTATKITADGDDEYEVTGD
FT                   LTIRDVTKPLTLEVSYEGTGKDPNTGNMVAGFEAKGKFNRKDFGLNYNAALETGGVLIG
FT                   DEVKLNIQIEASK"
FT   CDS_pept        823767..824228
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0804"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0804"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83506"
FT                   /protein_id="CAR83506.1"
FT                   /translation="MVGINTDTENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAM
FT                   INVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKLNKTIPNDSMDLTLKLSK
FT                   KGEDLSKRSTANAFMYKAMMKVFENLTENEIEELIRLNKKVETLLKKSK"
FT   CDS_pept        complement(824280..825740)
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="lmo4a_0805"
FT                   /product="lysine-specific permease"
FT                   /note="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0805"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83507"
FT                   /protein_id="CAR83507.1"
FT                   /translation="MKKETHGEIRRDLKTRHLSMIAIGGSIGTGLFLASGNAIHTAGPG
FT                   GALVAYIAIGIMVYFLMTSLGEMATYMPVSGSFSTYASRFVDPAFGFALGWNYWFNWAI
FT                   TLAVDISTAAIIVQFWLPNTPAWLWSAIFLILIFGLNALSVKAYGESEYWFSIIKVATV
FT                   IIFLIVGVLTIVGILGGEVIGFSNFTAGDAPFKGGFFAILGTFLIAGFSFQGTEMVGIA
FT                   AGESATPETSVPKAIKQVFWRILLFYIFAIFIIGMIIPYTNPNLLSAEATDVAISPFTL
FT                   VFEKAGLAFAASVMNAVILTSVLSAGNSGLYASTRMLWAMARDKKAPKFLGKVNRRGIP
FT                   MAALIVTTIVGAMTFITTLTENGTVIYTWLLSASGLTGFIAWVGIAISHYRFRKAFIKQ
FT                   GHDLSELKYKAKFFPFGPILALILCILVIVGQDYAAFLKPEFTNPAWWQKIGISYIGLP
FT                   IFLVFWLSFKFTNKTKVIPLEDCKFDQK"
FT   CDS_pept        complement(826096..826857)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0806"
FT                   /product="blue-light photoreceptor"
FT                   /note="FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0806"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83508"
FT                   /protein_id="CAR83508.1"
FT                   /translation="MTAYPQFDVILKALNLSSVGVIITDPEQKDNPIIFVNTGFENITG
FT                   YAKEEALGSNCHFLQGDDTDKEEVAKIRHAINQKSTANVLLKNYRKDGTSFMNELTIEP
FT                   IYDDHNHLYFVGIQKDVTTEHDYQQELEKSLTEIEKLSTPIVPIKENICVLPLIGSLTH
FT                   DRFQHMSEYVSEYMDHGKEDYLIMDLSGLAEFNEDAVMNLVKFHGFMKLTGVELIITGI
FT                   SPKFAMTLIRYEENLASLTTYSTIKEALQFY"
FT   CDS_pept        827010..827363
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0807"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0807"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83509"
FT                   /protein_id="CAR83509.1"
FT                   /translation="MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRL
FT                   VEEKTAEDDEIESNIGPVLIKRWTEMFLEEALTIDYNDTEKTMILKSDGQYYNRNLLLV
FT                   TNTDEVISCPITS"
FT   CDS_pept        827515..828153
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0808"
FT                   /product="GTP-pyrophosphokinase, putative"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0808"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83510"
FT                   /protein_id="CAR83510.1"
FT                   /translation="MEQPSVDELKNWRNVMLLHRFALEEVNTKLKILNEEFQFIHDYNP
FT                   MEHLKSRVKSLESIGAKLEKKQVDITPENALKYVHDIAGIRITCSFVSDIFRIHEMLAG
FT                   QSDITIKRVKDYVTNPKPNGYRSLHLLCEVPVFLTNRSEKMTVEIQIRTVAMDFWASLE
FT                   HKIYYKYQQEAPEELVKELQDAARIITHLDEKMKNLNDQIDQYKKEKEK"
FT   CDS_pept        828282..830330
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0809"
FT                   /product="Na+/H+ antiporter"
FT                   /note="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0809"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83511"
FT                   /protein_id="CAR83511.1"
FT                   /translation="MEIFLYVLALLVAIFISNLLNRFVPFVSVPLIQIGLGVLIAIMPI
FT                   TFDLQLNPELFLVMFIAPLLFNDGRQTDKAALWGMRMPILVLALGLVFATVVVIGYFVH
FT                   WMIPTIPLAAAFALAAALAPTDAVAVSSLSGRINLPKRIMNLLEGEALINDASGLVAFQ
FT                   FAIAAMVTGVFSLMDASISFFVIAIGGILVGLILSWLKFRLLKWVRGLGMEDVTFHMLI
FT                   QILTPFIIYLAAEEIHVSGILAVVAAGIMHSMEQKKMDPQLVKLNVVSQSTWSVIIFVL
FT                   NGLVFLLLGTQLPAITEVVWNDSGSSNLQVMAYILSITAALILLRFLWVYISWSIGAKQ
FT                   RQKQNKKTQLPKFRPVVLTSLSGVRGAVTLASALAIPFFLDDGSLFPQRSLIIFIASGV
FT                   ILCTLVIATFILPLLAKSEEVTTEDERAEIATRIRILRNVIRELKEQTLPETKAATDEV
FT                   IEDYRKRIYDLQQNNSSNRGMDERERAKRLEIIQWERENTQKMTDEGRIVATDSYRYQH
FT                   YLNMMEQAIKQRFRTKVKTAWMFLYRLMMLVIHPKKWGRITHKVKKGISKDSERFQAIR
FT                   QLREDNEILIISKLKEQLTKENADIIGPLITEHTIFLERVRKEHSPRGKRAKFEQKKRE
FT                   VQVVAFQLERDIIQNMFEKGGISRELARDLRQNLNMIETYLYDDFLE"
FT   CDS_pept        complement(830374..830844)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0810"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83512"
FT                   /protein_id="CAR83512.1"
FT                   /translation="MKNYPFFKYNMNIKTFFTFIVALAILGLGLYLFITYEVLRVWQFW
FT                   LLYAVFVISTINIFSTYVNGTVSINNRALFYKRGFSDKKYPFSQYMLECDTLLHGRTIS
FT                   FLPYYTINILNLETGKEEKIKLRNAAIVHKNGRKNFHLEIESLAEQLKKIQA"
FT   CDS_pept        complement(830872..831333)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0811"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83513"
FT                   /protein_id="CAR83513.1"
FT                   /translation="MKKHRFSKFNINAGSVTLLVMFSSFFILSVILSILFSMTWEFYAI
FT                   LSALVIISFFNFKNFFPGEVAVSEEAFYYKSKAYPYSKYIIECDAKLIRFKSPSARAMP
FT                   YYRIVIINKDTRAEKLIKVHNAARRYKGANKQMQVEMEELRDQLKQYQS"
FT   CDS_pept        831544..832086
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0812"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0812"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83514"
FT                   /protein_id="CAR83514.1"
FT                   /translation="MDIGKRIKNLRLSKNLTQEELGERTDLTKGYISQLERDLSSPSIE
FT                   TLFAILEVLGSTPKDFFDEEEHNQKVIYGELEHTFFEDEEKGYRIKWLVPESNEKEMEP
FT                   VLLEIEANSCFKSFEPSLSETFAYVLKGEVTVLLGRNEYVAKKGEAIYFHAADEHQIIN
FT                   RSNEQAILILVATDSYL"
FT   CDS_pept        832096..833196
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="lmo4a_0813"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="ABC-type sugar transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0813"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83515"
FT                   /protein_id="CAR83515.1"
FT                   /translation="MIVTETIIRFENVTKQFDNDPPVLDNVSFEIEKGKFYTLLGPSGC
FT                   GKTTILRLIAGFLEASEGQIFLGEKVINQIPANKRPVNTVFQDYALFPHLNVYENVAFG
FT                   LRIKKLKKEAIDEKVKEALRFVNLKGYEKREISEMSGGQRQRVAIARAIVNEPEVILLD
FT                   EPLSALDLKLRTEMQYELRDLQKRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGT
FT                   PIDIYDEPINKFVADFIGESNIVNGKMIQDFEVEFVERRFECVDQGFRPNEVVEVVIRP
FT                   EDLEITSAEKGQLQVTVDWMLFRGVHYEVGCIDTDGNEWLVHTTRKVRVGDKIGLAFEP
FT                   EAIHVMRLGETEEEFDKRLDSYDEVQ"
FT   CDS_pept        833196..834005
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="lmo4a_0814"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /note="ABC-type spermidine/putrescine transport system,
FT                   permease component I"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0814"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83516"
FT                   /protein_id="CAR83516.1"
FT                   /translation="MNRRTRTVYLVPYVLWILLFVVAPILLIVYYSFFDVDGNFTVDNY
FT                   IHFFTPVYLKMTASSFWYAFLITVFTLLISYPTAYLLTKLKHKQLWLLLIILPTWINLL
FT                   LKAYAFIGIFGTYGAANQFLEILGIGSKQILFTDFSFLFVSTYIFIPFMILPIFNAIEE
FT                   INPTLIQASRDLGASSLTTFRRVIFPLTADGVKSGCQAVFIPALSLFMITRLIAGNRVI
FT                   TLGTAIEEHFLVTQDWGMGSTIGVFLIIAMILIMFLTGSKKKRGARK"
FT   CDS_pept        834002..834808
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="lmo4a_0815"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /note="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0815"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83517"
FT                   /protein_id="CAR83517.1"
FT                   /translation="MKKSKWGTIYLVLVFVILYAPIFYLIFYSFNKGGTMHNFSGFTLG
FT                   YYKEVFQDTRLLIIVLNTFVIALLSSVIATIIGVCGALAIKFMPKPFAKNSLLSLNNVL
FT                   IVSPDVIIGASFLIFFTILGVKLGFISVLVSHIAFSIPIVVLMILPKLQEMSPTLMDAA
FT                   RDLGASQWQVLSKVILPYIMPGVLAGFFMALTYSLDDFAVTFFVTGNGFSTLAVEIYSR
FT                   ARQGISLSINALSTLIFLFTIILVIGYYFINQRNTSKNIRTGATKE"
FT   CDS_pept        834805..835878
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="lmo4a_0816"
FT                   /product="spermidine/putrescine ABC transporter
FT                   (substrate-binding protein)"
FT                   /note="Spermidine/putrescine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0816"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83518"
FT                   /protein_id="CAR83518.1"
FT                   /translation="MKQLLKIFVPVIVVALLMMLLATTMNRSEGYAGSNTLTIYNWGDY
FT                   IDPSLITKFEKETGIKVIYQTFDSNEAMMTKIEQGGTTFDIAVPSDYAISKMKEENLLI
FT                   PLDHSKLPNEKYLDPRFMDLSFDDDNKYSMPYFWGTLGIIYNKEMFPNKNFDTWNALFD
FT                   PELKNQILLIDGAREVMGLGLNSLGYSLNDTNKAHLQAARDKLETMTPNVKAIVGDEIK
FT                   LLMADNEAGVAVTFSGEAAEMLSENEDLEYVIPKDGSNLWFDNMVIPKTAKNVDGAHKF
FT                   INFMLKPENAAINAEYVGYATPNEKAVQLLPKEISSDERFYPDMDELNNLEVYDNLGKR
FT                   MLSYYNELFLEFKMYRK"
FT   CDS_pept        836143..837639
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0817"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83519"
FT                   /protein_id="CAR83519.1"
FT                   /translation="MVPFELSSLFLSKTQLDKLFILKQLESGMTTFSSLEMKLKISKRK
FT                   IKEIVLSLIKEMNVIRSDQRNELSVDREIIQFKLKLKDNEYVELINDFRVKYLLESSLY
FT                   RVLLFVLEKRTFSIVIMANDLSYSESYTYKLFGKLKQFFKHMNYGIQLKKENAFFFKLD
FT                   GNESTIRILHYLAVSVASKGNQWLFTSISQNEIMNTQFYIDSHRYKRLSPVGKNRVNSI
FT                   LAVYELALKNKYKITNLNTEVSELGNAINREIEINLYLKYLKEEVVNNDTQLQEEIIHL
FT                   AFLINYFSQEVRTDDEKEILGKHILSLTNNSIAKNCDNILKLINRRYELSEETNNILLY
FT                   SLCNRFVVIYYLGLYKFMPLYNVPPLLGDKECFIGKCIDNSLTDYKHDASYEKVKYSFT
FT                   QVISGYLNLELSLSQKIYVEFFHRPEYKSIIENAIKHNYNQKVLQITNNYLEADIVISD
FT                   THGYDKKKFFYFRDVFDQGSWEKLGLYLNQVIRDEILETN"
FT   CDS_pept        complement(837669..837995)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0818"
FT                   /product="DNA-invertase, putative"
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0818"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83520"
FT                   /protein_id="CAR83520.1"
FT                   /translation="MEHFNDRDINFISIQNNIDTSTSMGKFFFTIMSAFAEIEAELIRE
FT                   RVLSGMDAAKEKGKVLGRPVENKYIYEVINDYLNTNLSIVELAKKYNISRPTVYNYLQR
FT                   KRYS"
FT   CDS_pept        complement(838029..838229)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0819"
FT                   /product="site-specific recombinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0819"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83521"
FT                   /protein_id="CAR83521.1"
FT                   /translation="MMKTIGYARVSTVHQQLDSQLNALKRYGCHKIYIEFDSGRNIQRK
FT                   ELSKALNALEPGDTFVIFKLD"
FT   CDS_pept        838498..838635
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0820"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83522"
FT                   /protein_id="CAR83522.1"
FT                   /translation="MIVGMETSEQVLKKAIRKYFHEESITLESFKEVWLMRDETIINLE
FT                   "
FT   CDS_pept        838797..840617
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0821"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="Aspartyl/asparaginyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0821"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83523"
FT                   /protein_id="CAR83523.1"
FT                   /translation="MKLMKYICVCLLMGQIFVTPVLSYAEETDQSTGNNVSEGNKINSL
FT                   TDSEDTSNQSGELDEEDIIDGNVKNKNAINQSEDTNKENKAMLKVKDSTLYVGDKWVSE
FT                   DNFFSATDKDGNKLTVGNLEVEGTVDTSTAGVYEITYKNGSLSEIAKVKVEAKQTGSIT
FT                   LRYVDTYGNLVKDPVDGWEPEPQTIIGNIGESADGDLYWIEMRGWQKISNLPEGIKYEA
FT                   YPQTYDIVYDNIGVIYISYKDSLGNELKPKERNTDYVSKFDWSLEELPQPVPYEVMPID
FT                   IEGYKNTGVEGDPASGSMEFSEPIKRITFIYDKIDNSAINVHDSIIYTGDNWGPIDNFD
FT                   GAFDKQGNVIDFQNIKVEGFVNSNQAGIYEVKYSYEGVTSLAKITVKENKTNLKVKDAT
FT                   LSVGDKWSPKDNLVFATDKDGNELTVGNLEVEGTVDTSKAGVYEVTYKNGNLSETAKIT
FT                   VKDLNENDQTSLEIKDSTLYVGDKWEATDNFISATDKDGNTLKVTDLQIEGVVNTKKAG
FT                   IYEVTYRNGNLSKIAKVTVKEKPSISTSNGDQGGKQSQDKGSKNKQDTNNTNSSLPKTG
FT                   EQSTFYLSLMGIILLLSGLVMMYRRVKLKK"
FT   CDS_pept        complement(841593..842366)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0822"
FT                   /product="oxidoreductase"
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0822"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83524"
FT                   /protein_id="CAR83524.1"
FT                   /translation="MKKYVVITGASSGIGYATAKQFAKHKKNLILIARREANLLKLKNE
FT                   IEKEVPEIEVLIKAIDLTKIDRLEKLFSELDLYFIETWINNAGLGYYSEVKNQSLTKTL
FT                   QLLHLNIEALTVLSVLYVRKYHDQSGTQLINVSSAGGYTMVPAAATYCASKFYVSSFTE
FT                   ALSLELRESDSPLQAKVLAPAATKTEFGQKANNVSDYDYDKKFNNYHTSDEMAQFLLDL
FT                   YDSDKIVGMIDRTTFSLTLTENLFSYANQASFNQK"
FT   CDS_pept        complement(842451..842822)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0823"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0823"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83525"
FT                   /protein_id="CAR83525.1"
FT                   /translation="MNYTIGAFSKEVELSIDTLRYYEKEKLILPKRNEINRRIYDSSDI
FT                   TWINFIKKLKQTGMPIKNIKEYAKLRYLGDQTIEQRMTLLYRQYDILVEKREETELYTQ
FT                   FLLNKIDIYKEMLSERDIK"
FT   CDS_pept        843137..843838
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="lmo4a_0824"
FT                   /EC_number="4.2.1.1"
FT                   /note="Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0824"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83526"
FT                   /protein_id="CAR83526.1"
FT                   /translation="MTKEKVLWGYDEKTGPEMWGHICSDFEIAHTGKAQSPVDIEQADV
FT                   VKLKPSTMKFYYKETDYTIRRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLL
FT                   DGYIYPIEWHFVHEKPDGTTLVMSAWMEIDNTNNVEFKDLPTYFPEVFADFETEREITL
FT                   DVNEFMPEERVFYTYQGSRTTPPTVEGVTWIVLKNAKTLGQEDFTEFEKAIGNTSRPVQ
FT                   DLNGREITFYN"
FT   CDS_pept        843906..844448
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0825"
FT                   /product="HD domain protein"
FT                   /note="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0825"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83527"
FT                   /protein_id="CAR83527.1"
FT                   /translation="MYEKARQMMIEAHSGQVRKITGEPYFSHPLNVARILRRAGFREEV
FT                   VVAGLLHDAVEDTEMTDADIRATFGDEVADLVASHTENKTLSWEERKAHTIEQVRTGNL
FT                   EEKALIVADKLDNLTSVKYALSSEGKSVWSYFKRGYDLQKWYNQGIKNNMEYGLNPSEI
FT                   PPFFDEYARLVKWIFKK"
FT   CDS_pept        844586..845458
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="lmo4a_0826"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0826"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83528"
FT                   /protein_id="CAR83528.1"
FT                   /translation="MVYGAIEAGGTKFVVAIGEKSGKIIKRESYPTTEPAETMKAVIQF
FT                   FKQYEDELKAIGIGSFGPIDIRKSSTTYGYITQTPKLAWRNYDIVGAMKKEFNVPIGFT
FT                   TDVNAAALGEVSLGAAAGLDSCIYLTIGTGIGGGAVVSGKILEGFSHPEMGHIMVRRHK
FT                   RDRFTGSCPSHSDCLEGLAAGGAIEKRWGQKAAELADNEEVWNLEAHYIAQALMNYTLI
FT                   LSPERIVLGGGVMKQRQLFPLVRQKLKALVNNYVQLPDLEEYIVPPKLEDDAGITGCVL
FT                   LAVDAEESN"
FT   CDS_pept        845543..846469
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0827"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /note="Dioxygenases related to 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0827"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83529"
FT                   /protein_id="CAR83529.1"
FT                   /translation="MSITNLLNIKYPIIQGAMAQIAKAPLVAAVSNAGGLGIIASGGMT
FT                   ADMLREEIQKTKALTDKPFGVNLMLMMTNIAELTEVIIEEKVGIVTTGAGTPKTFMPIW
FT                   KEAGIIVIPVVPSVMIAKRMEKMGADAVIAEGTEAGGHVGETTTMALLPQIVDAVTIPV
FT                   IGAGGIADGRGIVAALALGAKGVQIGTRFLATDECPVHPDFKAAVIKASDRDTMVTGRK
FT                   AGAPVRSIKNKMIKEYIRLEEENADRDTLEELTLGSLRKAVQEGDTDNGSVMAGQIAGL
FT                   ITEIKPCKDVIEEMMTEAKNVIAGLEL"
FT   CDS_pept        846784..847212
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0828"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83530"
FT                   /protein_id="CAR83530.1"
FT                   /translation="MDWLTILNNPKKSKRDKLEAIGFIRDTLDYGDIPDDTALEIVNNL
FT                   AKQVVKQNDSDIKESILDAMLEGSKAPFVEKTINLAPIVKHLNEFNEACLSYILSLLGN
FT                   SGEIAYRAIIESYKTNLSLKEDVEEALAEMDYRIKNNL"
FT   CDS_pept        complement(847274..847678)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0829"
FT                   /product="conserved hypothetical protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0829"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83531"
FT                   /protein_id="CAR83531.1"
FT                   /translation="MSFAVPYLVFNGEGQDALTFYADVFQAEISSVQRFKEMNNFDGDA
FT                   VFGERLMHSRLAKNGEEFIYITDAPYDGFTIGNRVTILINFETEDDIKYAYEVLSATGK
FT                   VEMELQVAFWGSTYAQVTDRFGVFWQLNFG"
FT   CDS_pept        847903..850533
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0830"
FT                   /EC_number="3.6.1.-"
FT                   /note="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0830"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83532"
FT                   /protein_id="CAR83532.1"
FT                   /translation="MLWVKESIEQLLSKLHTNLDTGLTKEQVKQKHAEFGTNEFEEGKK
FT                   ESLLQKIGHHLVEITTIVLLFAAAISAYLAITTGYGWAKVVVILGIVVLNMVLGIYQEN
FT                   SAEKALAALQSMNAHLTTVVRDGVRMQVDATELVPGDIIEIVAGDMIPADARIISSSSL
FT                   QVEESALTGESVPVEKDANAVVSEKAPIGDRLNMLYSGCLVTNGRATAVVVEIGMETEM
FT                   GKIAGLLNSTSKLMTPLQLRLKELAKRLSIVALLAGILIFIIDVYVYGETIIETLMIAI
FT                   SLAVAAVPETLPVIVTLTLAYGVQNMVRKNTIIRRIPAVETIGNTSVICSDKTGTLTQN
FT                   KMIIQQIWAADHTPIKATAEFDTAEQKVLEMLSLSSNATIDVTDGEETIIGDPTESAII
FT                   RLLEEKGTTKKALEAKYPRVFELPFDSDRKLMTTIHQVEDGFLSITKGAFDRIPVNFSE
FT                   AFLAEAERVHDSFAEDALRVLVVAYKKYPEMPTDLSSEALETDLTFAGMVGMIDPPRPE
FT                   SKAAVLAAKKAGIKTVMITGDHIVTASAIAKEIGILTDGDKAITGAELAEMSEADLERN
FT                   IRDYAVYARVSPEDKIRIVKAWQKNGEIVTMTGDGVNDAPALKAADVGAAMGITGTDVS
FT                   KNAADMVITDDNFATIVDAVKEGRTAYENIRKTIYFLLSTNFSQIFIMLIAIILGWGAP
FT                   VVAVQLLLINVVSDGIPGFFLSREKADDSIMERKPIPKNAGIFANGLGKKMATQAVVFT
FT                   IVTLAGFYIGQFVTINNSIGASYEVGMTMAFVILAWSSVAHIFNVRSDKSIFTIGFLSN
FT                   RGLFFSAICSMLIILGLAIIPPLANMFFLVEMSLTHWILAFILSMFPLLFVEIQKLIQR
FT                   KRAKA"
FT   CDS_pept        850548..851396
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0831"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83533"
FT                   /protein_id="CAR83533.1"
FT                   /translation="MNETEKLVAASLERNFGKNIGTRYPGNEEAQMRAEEVIEEIAIVI
FT                   TPLVEKLGIESKTVKKTIPFLYELQKNQFCDMSAYPYPLLLVNGTSADTEKYWRDLPTY
FT                   WTDDANKIVLPYVLEHIKNNKVRQKLLAFHAWLLGEVAEMNGVLGADFRVKLVFESDMR
FT                   IRLRVYEVEQIAIEVHFLDNHDTEQQHLGYDVSLDADFTEKARLLLRQGILTENLGLEA
FT                   LKAYMKSVLPIAHSLKNLEQLTEEETKKLTKLLTQEEPKIMEDTDLTSKALDFLQNAAL
FT                   Q"
FT   CDS_pept        851508..852065
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0832"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0832"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83534"
FT                   /protein_id="CAR83534.1"
FT                   /translation="MIRQAKKSDAPKIAPLLLVIWKDMELPILEVETEEAITNALIEAI
FT                   QTEDYRYSYRHLHVYEKDGDIAGVLAGYPGEIEPEIDRAWNAIAKKHGITYDEPIFVDK
FT                   ETFPGEWYLDSIVTNEKYRGHGVGTALLAKLTEIAAADGEKVVGLNCDKGNPHAKRLYE
FT                   RLGFHVTGETTLSGHEYEHMQK"
FT   CDS_pept        852082..852744
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0833"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0833"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83535"
FT                   /protein_id="CAR83535.1"
FT                   /translation="MKKIIFTVVMSLVLVLAGCADVTNTVKVDKKGEATISFDIDISSV
FT                   AGIFASSYSDEVESKLKEAGFTVDKKSNTSYHIEKKLDKNETTKSDMKPEDFGVKITNS
FT                   KSFFTQKIKVDADIDIEKIWKKEMADVPFPKEILSQVDYTFILDLPISSIGENNAKSVD
FT                   GGKLTWDVPLDKKSEMYFEVTVPNVKNIAIVGGILLVAIIGLLIYLIKRHRKKKKQL"
FT   CDS_pept        complement(852760..853149)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0834"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0834"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83536"
FT                   /protein_id="CAR83536.1"
FT                   /translation="MQQTIKEASEHTGLSAHTIRYYEREGLIPFLARDKNNNRIFDNDA
FT                   LHWLELLTCLRVTGMPLAKQKEIVELTKGGDGTVSERIAVLKEHQQDMYRRQAELDRAF
FT                   KKIEKKLACYEELEQAVNKSVDQFS"
FT   CDS_pept        853270..854094
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0835"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0835"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83537"
FT                   /protein_id="CAR83537.1"
FT                   /translation="MNLKDTVKLANGVEMPRLGFGVWKVQDGDEAVNSVKWAIEAGYIS
FT                   IDTAAAYKNEEGVGQAIKESGVKREDLFVTTKLWNAEQGYESTLAAFDESLRKLELDYV
FT                   DLYLIHWPVKGKFKDTWRAFEKLYKDKRVRAIGVCNFHEHHLKELMEDAEIAPMVNQIE
FT                   LHPQLTQEPLRKFCAENNIVVEAWSPLGNGKLLSNPEIKAIADAHGKSVAQVILRWDLQ
FT                   IGVVTIPKSVHQERIIQNADIFDFELSEEEVAKISGLNKDERTGPDPDNFNF"
FT   CDS_pept        854173..855141
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0836"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0836"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83538"
FT                   /protein_id="CAR83538.1"
FT                   /translation="MDAKTIIENRFRNQKLIQTAWSNSPERIVFHFGAMQSQNYGQSLW
FT                   AVGSRMTTPSEKAVEQAINNGEIIRTWLLRGTIHLFSAKDYHWMMELIAPSIDKICKPY
FT                   RAKLGLTDEVLHKATEVVSEIVSEQAVTRKDLVAHLATKDLPSAGIPFAQLLVYLSSRK
FT                   VICSGPNETFRNTMHIPADTNHFTREEAIKELAKRYIQSHAPATLKDFCFWSGLTVSDA
FT                   KIGLVAMPKLGDYYITTLARNDAVTSTIPLAGFDEWIIGYRDRSAVLPEIWHDEIMTKN
FT                   GIFRPAIITEGKVVGKWEKPKKRAELDGDFWDRYIQFRNML"
FT   CDS_pept        855182..856462
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0837"
FT                   /product="3-hydroxy-3-methylglutaryl-CoA reductase"
FT                   /EC_number="1.1.1.88"
FT                   /note="Hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0837"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83539"
FT                   /protein_id="CAR83539.1"
FT                   /translation="MNAFDKFYKKTVEERRAILTEYADLNEEEEAFLASTGALSFDKAN
FT                   HMIENTIGIYSLPLGLGMNMLLNDKRYVVPMAMEEPSVVAAQSAGAKLIAQNGGITGSA
FT                   TKRKMIGQIELISVSDIQAAKENIIANEEQLIAIANQAHPSLQKRGGGAVEIQVRTAQT
FT                   ANDETLLIVHLLVDTQEAMGANMVNTMVETLAPELEMLTNGTANMRILSNLVDEATATA
FT                   VCRINPESLATKTQSGEWVRDRIIAAYEFADADIYRAATHNKGIMNGIDAVIMAFGNDW
FT                   RAVEAASHAYAARTGSYKPMSKWSKDAEGYLVGELTLPMPVAFVGGSIGIHPIATLSKK
FT                   IARVESAKELAMLVCAVGLTQNLSALKALVTEGIQRGHMSLQAKSLAMTAGAEADEIEK
FT                   VATFLQESKQLNVVAAKEFITKLRSGK"
FT   CDS_pept        856661..858295
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0838"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0838"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83540"
FT                   /protein_id="CAR83540.1"
FT                   /translation="MGDINIQQMIFQFIGGLGIFLFGIKYMGDGLQMAAGDRLRDILDK
FT                   YTTNPFMGVLAGILVTVLIQSSSGTTVLTVGLVSAGFMTLKQAIGVIMGANIGTTVTAF
FT                   IIGIKLSEYSLPIIAVGAVLLFFFKNHKVKNIGQVFFGFGALFYGLDLMGQGMKPLAGM
FT                   ESFHELTAQMSTNPFLGLLIGTIFTAVVQSSSATIGILQELYGQGAIDLQAALPVLFGD
FT                   NIGTTITAVLAAIGASVAAKRAAATHVIFNLIGAVIFMLVLPLFTALVSYLQGLFGLNP
FT                   EMTIAVAHGTFNITNTFIQFWFIGAFAWLVTKLIPGDDSRIDYKTKHLDTNLIDQSPGI
FT                   ALEMAREETLRMADYAKFGLQEARQYLVNRESKHAESTIQVEEAVNNLDRKITEYLTKI
FT                   SSVALTNNETEEHALMLDTVRDIERVGDHMENIVENIDQLIKNKAKMSEEASEQLIEMF
FT                   ELTTANFERAVKAMHKKDRTLAEETILVEKDIDKAERRLRKNHIRRLNEGKCQVVSGIL
FT                   YIDIVSDLERIGDHANNIAESVLELNE"
FT   CDS_pept        858450..862097
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0839"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.-"
FT                   /note="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0839"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83541"
FT                   /protein_id="CAR83541.1"
FT                   /translation="MRNRKTMDGNTAAAYISYAFTEVAAIYPITPSSTMAELVDEWSSK
FT                   NKKNLFNEPVKVVEMQSEAGAAGTVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELL
FT                   PTVFHVSARTISAASLNIFGDHSDVMAARQTGFAMLAEGSVQEVMDLSAVAHLASLKGS
FT                   LPFLNFFDGFRTSHELQKVEVLEYDELENSLDKEALQQFRNRAMTPNNPKTLGSNQNPD
FT                   IFFQQRETVNRYYEEIPNIVQNYMKEINQLRGTDYDLVNYYGAEDATDVIVAMGSVTPV
FT                   IEQVIDYLTTQGKKVGLLNIRLYRPFPAETFLAKLPKTVERVAVLDRTKEPGSGGEPLL
FT                   LDVQSVLYDSETRPLVIGGRYGLGSKDVTPDQILGVYSHLTTENPKPRFTIGITDDITN
FT                   LSIENTGPSDLTSEKTFQCKFWGFGSDGTVGANKAAIKIIGDNTDLYAQGYFSYDSKKS
FT                   GGLTVSHLRFGEKRIRSAYLIQQADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGK
FT                   QLERHLPAAMREYIAKNNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKA
FT                   LADLKASAIATYGKKDMAVAEKNIFAMDQTVANLHKVEVPASWANPVVTAETNATTEKP
FT                   AYVQNILEPVNRLEGDNLTVGDLISNGMVSGAYPPGTAAYEKRGIALEVPEWISENCTM
FT                   CNECAFVCPHAAIRPILTDEEEMESAPEGFMTREMRGKDGLRYRIQVSPMDCTGCNLCA
FT                   ETCPAKDKALVMKPFEEVAAKENPNWSFAINVKPKKNPGKKNTVPGSQFEQPLLEFSGA
FT                   CAGCGETPYVKLLTQMFGDRMMIANATGCSSIWGASAPATPYTVNDKGHGPAWGNSLLE
FT                   DNAEYGYGMYLANQTMRKALNNKVTKALREEAMSETLREALVDWQTQMDVSEDTRERAE
FT                   ALQLALLSEMEDSAALESIYNDRELFIKRSQWMLGGDGWAYDIGFGGIDHVLASGEDVN
FT                   IFVMDNEVYSNTGGQSSKATPTAAIAKFASGGKSVGKKDLGIMAMSYGNIYVAQIAMGA
FT                   NKRQTLKAIEEAEAYPGPSLIIAYTPCINHGISSGMKTMLSETQKAVECGYWSLYRYNP
FT                   ALEEKGKNPMTMDYKKVDFDQFEDFLKRETRYSALYKANPDVATKLSEKTRLDAEKRFK
FT                   RYATMAGLDLEKILKKKEVTEEVKAPVDDERAARKAAREARRLAREQGK"
FT   CDS_pept        complement(862346..864310)
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="lmo4a_0840"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0840"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83542"
FT                   /protein_id="CAR83542.1"
FT                   /translation="MVNTLDMKYLHLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLS
FT                   DVHGEYSAFEQVLRNGSGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETE
FT                   DLHAWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYE
FT                   EILQHIISLGRAEEFISALSRLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDF
FT                   QWGNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDP
FT                   CKYFQPKNEDNTDYSNAEITQIARMHKAISIIQFKLEGEIINRRKEFNMEHRLLLQFID
FT                   YKKGTIQLKGKTYQLLDTHFPTIDPENPYTLTDGEKDLIEKITASFKNCRRLQKHVQFL
FT                   YSKGSMFLTYNGNLLYHGCIPLHEDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPP
FT                   GTKEKKYACDIVWYLWTGAISSLFGKSEMTTFERYFVAEKETHKEEKNPYYKLRNDEFI
FT                   CKQILEEFGLDGECGHIINGHTPVKEGKGESPIKASGKMLVIDGGFAKAYHKETSLAGY
FT                   TLLFNSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGAKLSEQA
FT                   EDLKVLLDAYRNGLLHENR"
FT   CDS_pept        complement(864421..865332)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0841"
FT                   /product="permease, putative"
FT                   /note="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0841"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83543"
FT                   /protein_id="CAR83543.1"
FT                   /translation="MEFLLILLPVFGIFAIGFIGQKTLKFDIPNLSKLTLYLMSPFLAF
FT                   NTFYTNPLTMDYVYLAIYIFALCLSLILLVSLVSFLLGYNLQDRCALILASAFMNNGNY
FT                   GTPVVLLVFGAMGLDIAVVLMVLQQLAMSTIGIYFAAKGSKDANGMKTVMKRVVRMPIA
FT                   YGALLGLALQLLHVSLPSALMTCVKLVGDAAIPTIMIVLGMQLAVISFRRIELAKVGIA
FT                   LVLKLLIAPIIAFGLTLILPVDEMTKQIMILLAAMPTAANTTLMAVQFDTKPDLVSSAT
FT                   FISTVLSIITLPIVLYFLHPVF"
FT   CDS_pept        866132..866410
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0842"
FT                   /product="transposase, IS3 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0842"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83544"
FT                   /protein_id="CAR83544.1"
FT                   /translation="MPTKKYTEKFKISLVYLHYKGTPKQTLCDDFGVSIASLSRWIKGY
FT                   DPTSVDLNEAANILQMYELKKQKAKLEAEVLALSKAIKLFNSDLNPV"
FT   CDS_pept        866601..867491
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0843"
FT                   /product="transcriptional activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0843"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83545"
FT                   /protein_id="CAR83545.1"
FT                   /translation="MVAYGELIREVRLSKGLTQKEVYTGIISKSYAIGFEKGKHDITLV
FT                   LFEEILERVMLSSDEFFFMNRGYSLAEEDNFWYKFAHAANQNSLKELQALHKEVLQQKG
FT                   ERAMLREAIVHSRIEVHEQFLLNNKFDVSIVSKEDKEVIQTYLWKVQSWTLEEIRIFAN
FT                   SVDYFDEDVQIYFFQLVLKSIEKYKHYDRGKKVFSTLLTNITEELIARNQLDYASQLLD
FT                   ILYELSASHDCAFYRIMHHYYQGLIWMKSEQVEQGYNKSKSAIEILDTLGYESLALLYQ
FT                   TLLMQFLEKEQIEIL"
FT   CDS_pept        867574..868209
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0844"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0844"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83546"
FT                   /protein_id="CAR83546.1"
FT                   /translation="MNDSTTQNLINNIEQRPGMYLRTETINSLCDFLNGYFMHNKNELT
FT                   KGFSMDFWFFNEFIKNYYNESSSVSGWANMLLYNCEHDQERAFRAFFKRYHEFTQIHVE
FT                   AVFKATLDERNISFHTDMTKGKNLVVGLDLKQLAPIYHNPKSYLVLQLSKDNGYLLLVE
FT                   SDNVYYQERILFKDLAKINHEISSLFGTVQKQQQIELAILDEILYYPS"
FT   CDS_pept        868350..869006
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0845"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0845"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83547"
FT                   /protein_id="CAR83547.1"
FT                   /translation="MTQQYQLVLQDQYDPRSGQLIKKEIIPTKNVVEHLTSYLLCIKNQ
FT                   AEYRNFIKWYEREIRQVLKEHPEQDFIIKISFQQLYFRETMLLLENIKAFSKQITIELV
FT                   GDSQISAGEREHFSPEDIDAFLKGRLKMLKKWHYFISKHIESGAMEQTLIFTPYIDELK
FT                   YSLKKGAKLLDNQTELAFFLSFWKSWAKLRCVHFVLIVDEMSTDFPEEVAIRCEM"
FT   CDS_pept        869029..870036
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0846"
FT                   /product="cell wall surface anchor family protein (LPXTG
FT                   motif)"
FT                   /note="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0846"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83548"
FT                   /protein_id="CAR83548.1"
FT                   /translation="MFESCKKIVISMLAVIIIVSLGSGVFSPIRAHADATQNPNGFTVL
FT                   VKYMDETGTEIAPSETLTEYYYVSVEKSIPGYKLKETPSNATGRITDSGIEVHYIYERS
FT                   IKVSYVDETGQDLLPTVEVADSDAAVLETITGYTFVRKEVSADNSHIIFRYKKNISTIP
FT                   DFGKPNQVMVNYVDENKTQIAPSFYLSGLFNESYQVPMKKIKGYTLLKYDPEILGVFTE
FT                   SAQTINIIYQKNRPEQSPSVENPPNPIVPIAPQVEVEPPKAEIAEKPVSPKEQITPPTT
FT                   KKTKAVLKKQIAKATLPKTGDSSIDLLVTCLGIIAISCGIYLIVQQSQKRRRKE"
FT   CDS_pept        complement(870078..870491)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0847"
FT                   /product="phosphate-starvation-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0847"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83549"
FT                   /protein_id="CAR83549.1"
FT                   /translation="MKRLEKISSIVPILLRITLNLALIMVGFTLVAFLIREAFTIFNNI
FT                   FFLDTDVSYYYMTQDILTFFLYFEFIALIVKYFESHFHFPLRYFIYIGITAIIRFIIVD
FT                   HSSATSTLILSGAILLLVAALFLANTKLLKREG"
FT   CDS_pept        870664..872301
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0848"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0848"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83550"
FT                   /protein_id="CAR83550.1"
FT                   /translation="MELAFPVAVNHVIDTLLPGKDFGLIITAALALLFFYILNTFMQYI
FT                   VTYFGHMLGLNIETDMRRDLFSHLQKQPFGFYDNQKTGKLMSRMTTDLFEIGEVAHHGP
FT                   EDIFISIMSLFGAFFLMLNINVKLAISTFILVPILTVLIVYFNKRMTKVTTGIFKDLGN
FT                   FNAGVENAISGVRVVQAFANEPHEKGRFRVLNQAYRQSKLMFYKVMGLSFSFNYFLMRL
FT                   ISLFALLFGAYFTINGEISYGEFVGFILLTNVFIRPIEKINNVIESYPKGFAGFKRFLE
FT                   VMDTEPAIQDEKDAKPAKAFRGDIAYNHVSFEYSDGKNVLNHINLSIKAGETVAFVGPS
FT                   GAGKTTICNLLPRFYDVSAGEITIDGENIKRFTLPSLRAQIGVVQQDVFLFSGTVRENI
FT                   AYGKLDASDEEIEHVVKLAHLSKVVEEMPDGLDTIIGERGVKLSGGQKQRLAIARMFLK
FT                   NPPILILDEATSALDTETEQVIQASLEELAEGRTTLIIAHRLATIKHADRIIVVNETGI
FT                   AETGTHDELLAQDNGAYKRLYDAQFNTI"
FT   CDS_pept        872595..873980
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="lmo4a_0849"
FT                   /product="hexose phosphate transport protein"
FT                   /note="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0849"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83551"
FT                   /protein_id="CAR83551.1"
FT                   /translation="MSLFSLKKKNHFVPLEIQRQQWFKHFIVAFMSVFICYLTVYLLRN
FT                   NFKAAQTLLIEQNHFSTTELGMIGLAFSVMYGIGKTILGYAVDGRNAKKIMSFLLGISA
FT                   IISIIIGILLVTKQATVGVLFILWGANGFVQSPGGPASYSTITRWTPKLKRGRWLGFWN
FT                   ASHNIGGALAGIVAFWGATTFFNGGAGGMFIVPGIIAIIIAIICFSVGHDEPEELGWNS
FT                   AAEIFEEREEQGESETKDLSRFQILCRFVINNPWVWTLCVINIFIYIVRIGIDNWAPVY
FT                   CIQALGWSTKDAIMTISFFEIGALLGSLSWGWLSDIMKGRRMLCSIIAVVIEFFMLISY
FT                   SQVTSVYSMYTVLFILGFLVFGPQLLIGVSVIEFVPRNALAVTNGLTGTFAYLFGDSFA
FT                   KVFLGYIADPTKAGIQIFGYTLHGWGATFTIMFTALIIAGLMMIPVALKQEKIIRQAKV
FT                   LHL"
FT   CDS_pept        complement(874088..875299)
FT                   /transl_table=11
FT                   /gene="tetA"
FT                   /locus_tag="lmo4a_0850"
FT                   /product="tetracycline resistance protein"
FT                   /note="Nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0850"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83552"
FT                   /protein_id="CAR83552.1"
FT                   /translation="MSSTKSIINKKTLLFGLISVFLCGMGFSIIMPVVPFLVTPYVTNA
FT                   SDQALMVTLLTSVYALCVFFAAPGLGALSDRFGRRPVLLICFIGSAIGYFIFGLGGALW
FT                   VLFLGRIIEGITGGSISTLFAFFADITPQEERTKYFGWVSAAAGAGAALGPAFGGLLAH
FT                   FGYAMPFFFGAAITFINLLFGYFYMPESLDEANRLKRIPLMRLNPFSQLLNILTIKNLG
FT                   RLLIAGFFIWVPNGSLQAVMSQFAIDSFSWKPALIGMMFSIMGIQDILSQAFVMPKLLL
FT                   KLTDKQIAILGMIAEIIGYLLIAASSIFTLAPLLVIGMFVFGFGDSIFGPSFNGMVSKS
FT                   ASASEQGRIQGGSQAIQSVARIIGPIIGGQLYITFGHAAPAVMGVLLITVAIFILYKKT
FT                   SLAK"
FT   CDS_pept        complement(875429..875899)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0851"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0851"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83553"
FT                   /protein_id="CAR83553.1"
FT                   /translation="MDKNEQVMANVRDLFNKLAWINKVKMEKALEGYKPSEVHCIEYIA
FT                   KNEDPNVTKLAEAFYMTKSAISKITKKLMDKGYIESYQKPENKKEIYFRLTAKGAEINQ
FT                   VHDDLHQEFLDRDKVVFEDVTDAQYAEVLKFVDKYSRHLDNEMQKVYNQKSE"
FT   CDS_pept        876101..878749
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0852"
FT                   /EC_number="3.6.1.-"
FT                   /note="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0852"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83554"
FT                   /protein_id="CAR83554.1"
FT                   /translation="MEIYRKSAAETFEQLEATEQGLTTSEVTKRQEKYGFNELKNKKKD
FT                   PLWKLFLETFKDPMVIVLVIAALVQLVLGEVVESLIIFLVLIVNSIISVVQTRKAESSL
FT                   DALREMSAPVAKVIRDGSKQSIHARELVPGDVVILDAGDFVPADGRLFESGSLKIDEGM
FT                   LTGESEAVEKYIDTIPDEVGLGDRVNMVFSGSLVVYGRGMFVVTGTASETEIGKIAGLL
FT                   ETAEAKQTPLQRKLESFSKKLGLGILALCVLIFAVEAGRVLLGDNSADMATAILNAFMF
FT                   AVAVAVAAIPEALSSIVTIVLAVGTNKMAKQHAIIRKLPAVETLGSTSVICTDKTGTLT
FT                   QNKMTVVDYYLPDGTKENFPESPENWSEGERRLIHIAVLCNDSNINSEGKELGDPTEVA
FT                   LIAFSNKNNQDYNEIREKFIREGEIPFDSDRKLMSTLHTFNDNKAMLTKGGPDVMFARC
FT                   SYVFLDGEEKPMTEEILTKLKATNEEFSNQALRVLAYGYKRMPADTTELKLEDEQDIVL
FT                   VGLTAMIDPPREAVYASIEESKKAGIRTVMITGDHKTTAQAIGRDIGLMDADDIALTGQ
FT                   ELDAMPEEELDKKLEHIAVYARVSPENKIRIVKAWQKKGKITAMTGDGVNDAPALKQAD
FT                   IGVAMGSGTDVAKDSAAMILTDDNFVSIVDAVGVGRTVFDNIKKSIAYLFAGNLGAIIA
FT                   ILFALVLDWINPFTALQLLFINLVNDSLPAIALGMEKAEPDVMKRKPRDINEGIFAGGT
FT                   MRAVISRGVLIGIAVIISQYIGMQISPEMSVAMAFTTLILARTLQTFAARSNVQTAFGA
FT                   GFFSNKYVIGAVLLCFVLYGITVLPGAREIFSIPATFGLHEWSIAAGLALGAVVMMEII
FT                   KVVQNKFFKEA"
FT   CDS_pept        complement(878914..879171)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0853"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0853"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83555"
FT                   /protein_id="CAR83555.1"
FT                   /translation="MILTIYLIAITLISFLLFAIDKRKAIKHAYRIPESVLLFTAFLGG
FT                   AFGSWMSMQLFHHKTQKPKFRILVPLAMVWTVGVLVWWLY"
FT   CDS_pept        879250..879627
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0854"
FT                   /product="endoribonuclease L-PSP, putative"
FT                   /note="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0854"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83556"
FT                   /protein_id="CAR83556.1"
FT                   /translation="MAKEIIQTSSAPKALGPYSQAVKVNGLIFTSGQLGINPETGELAE
FT                   GATKQAEQAFKNLAAVLEEAGSGLEKIIKATVFFKDLNEFTAVNEVYATFFSSDFPARS
FT                   AFQVAKLPLDAEIEIEVIAEA"
FT   CDS_pept        879847..880986
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0855"
FT                   /product="vitamin-B12 independent methionine synthase"
FT                   /EC_number="2.1.1.14"
FT                   /note="Methionine synthase II (cobalamin-independent)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0855"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83557"
FT                   /protein_id="CAR83557.1"
FT                   /translation="MYIKIKRIEAKEMNQVAPFYADHVGSILRTKAIKDAREKFQNGEI
FT                   TDTTLREVENTEIKYIVEKQKEVGLKSITDGEFRRAWWHFDFLENLDGVEGYDAAGGIQ
FT                   FSKVQTKSHSVKITGPIDFTTHPFIEDFIFLKEAVGDKHVAKQTIPSPAMLHYRGDIEY
FT                   QPYLEDADKFAKDLAVAYQKAIQAFYDAGCRYLQLDDTSWSYLCSDEQREVVRQRGFDP
FT                   DTLQETYKNLINEAIKFKPADMVITMHICRGNFRSTWIAEGGYGPVAETLFGKLNIDGF
FT                   FLEYDNERSGDFAPLKYVTRKDLKIVLGLITSKTGELEDEAAIKARIEEASEIVPLSQL
FT                   RLSPQCGFASTEEGNILTEEEQWDKLRYVVQLAKDVWGK"
FT   CDS_pept        881091..882191
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0856"
FT                   /product="excinuclease ABC subunit C domain protein"
FT                   /note="Nuclease subunit of the excinuclease complex"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0856"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83558"
FT                   /protein_id="CAR83558.1"
FT                   /translation="MDDKLQKKLTLLPESPGCYIYRDENNEILYIGKSKCLKNRVKSYF
FT                   HSKQIGKTARLVRQIRDLELIITTSEKEALLLEMILIQKYQPPFNIQLKEGTSYPYIKI
FT                   TNEKNPHIEVVFEVKRDGAHYFGPYPGRFSARQTVDLIEKLFPLCRCDGKPGRPCLYYH
FT                   LGLCLGPCQAEIDPAVYKKQIHKISRFLEGDVKNVKAKLQEDMLTATENLEFERAAELR
FT                   DKIHAINETIEKQHIIFPGLKNRDIIGCYEQDNHLSVFVFFVRNGAINGSKWHVFQIEK
FT                   SLQEDLAKFLNQFYEDPNNIQPKELLIAEKLDKKLLNEPLRKACLFPQKGGKKKQIELA
FT                   IENAKSAYIAYAKMKEYDFEKQITNQ"
FT   CDS_pept        882361..883803
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="lmo4a_0857"
FT                   /product="glutamine ABC transporter,
FT                   permease/substrate-binding protein"
FT                   /note="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0857"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83559"
FT                   /protein_id="CAR83559.1"
FT                   /translation="MKKFSRFILMMAIACVAAFIFTGNGLNAKAAEETYLIGTDTTFAP
FT                   FEFEKDGEHVGIDMDILKAIAKDQNFKYEIKAMGFNAAVQALEANQVDGVIAGMSITDE
FT                   RKQKFDFSDPYFDSGVVMGILKDNDEIKTYDDLKGKKVAVKTGTEGYAFAEKIKDKYDF
FT                   DIVVFDDSAQMYDDVKTRNSVACFDDYPVLAYGVQTGNGLKIVTDKEKGNSYGFAVNKG
FT                   KNQELLEKFNAGLVNIKASGEYDKILENYLGDNAIKENTNEKGFMGIIKSSWPALLSGL
FT                   WLTIRLAVVSLIIAFIIGITFGFMKVSNSKILRGIATVYVDIFRGTPLIVQAFFFYFGI
FT                   PAALDFRMPVFLAGVIALSLNAGAYMVEIVRGGIQSVDKGQMEAARSLGLPHKKAMMKV
FT                   VLPQAIRMMIPSFINQFVITLKDTSIMSAIGLVELTQSGKIIMARTFESTWTWLIIGIM
FT                   YLIVITILTKISDRLERRLRND"
FT   CDS_pept        883796..884524
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="lmo4a_0858"
FT                   /product="glutamine ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.21"
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0858"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83560"
FT                   /protein_id="CAR83560.1"
FT                   /translation="MTKLKVTGLKKSFGANEVLKGIDIEVKEGEVVCVIGPSGSGKSTF
FT                   LRCMNNLEEITAGDVVVDDFNITDKKVDINKVRENIGMVFQHFNLFPHLSVLENITLAP
FT                   VELKKMDKEAAKSNALRLLEQVGLREKAEEFPNQLSGGQKQRVAIARALAMDPDIMLFD
FT                   EPTSALDPEMVGEVLGVMKELAKDGMTMMIVTHEMGFAREVGDRVIFMDGGYIVEEGKP
FT                   AEIFDNPTNERTISFLDKVL"
FT   CDS_pept        complement(884573..884863)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0859"
FT                   /product="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0859"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83561"
FT                   /protein_id="CAR83561.1"
FT                   /translation="MKKRIILTSIAVCAALSLVGGYFFLDNQQTSTPEKKSAVSKKSPH
FT                   KHSKINVTIGKNKENFHLEKDFGDKQLEVERITGRVSQSTLKQKNDKQNKK"
FT   CDS_pept        885195..885323
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0860"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83562"
FT                   /protein_id="CAR83562.1"
FT                   /translation="MKNARNRLFETSVIKVFLYIILKTTKKIRVSNAFLKKSRYFG"
FT   CDS_pept        885395..885574
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0861"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83563"
FT                   /protein_id="CAR83563.1"
FT                   /translation="MKTNFEDGVMRLDNNQKDLNQVIRQLKEKGIVVEKTKSRKDIWKS
FT                   VSSKAMPNMTLRLQ"
FT   CDS_pept        885796..886554
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0862"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0862"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83564"
FT                   /protein_id="CAR83564.1"
FT                   /translation="MKKEAVNQQSIYVHIDHVINNVATSGISFCDFLNGVGQPPENILL
FT                   IKHNIEDASYNAHTAFHYLEPGDLANISKENFNPLCWIDFEDVELLNQLTPQEVAEMLY
FT                   LAHTGRHLRSPFYYKLQNNFVYLTREDGRYNKVYYRNLNHFYMLLSYVIARKTSELVNE
FT                   KSIFSFSKKKYVAEPPVELLKKMADHFKDGACIALDDVVRTRTQIEVPIGHGLTEEMTE
FT                   LEISSKIYYEEEVAKLVYDLKQNEWKYIEK"
FT   CDS_pept        886634..887188
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0863"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0863"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83565"
FT                   /protein_id="CAR83565.1"
FT                   /translation="MTKKLIKEVALTLFAEKGYDGTALSEIAKAVGIKTPSLYAHFASK
FT                   EALFLEVYQDSIQMELTELGRVAEREDLVGEEKLQSIFFVATDFSSNPDEKKFFQRAVF
FT                   YPPKSLFQELKEETKTYEQLTNRILRETLEKIVSEEALVKWMHVFYALLDGLSVEHGIY
FT                   DETEFELRRKSAWAVLASLLK"
FT   CDS_pept        887205..887546
FT                   /transl_table=11
FT                   /gene="sugE-1"
FT                   /locus_tag="lmo4a_0864"
FT                   /product="SugE protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0864"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83566"
FT                   /protein_id="CAR83566.1"
FT                   /translation="MAWFYLIMAGLSEIVWAFGLKESHGFTMLGWSLLTIAFLIVSFGL
FT                   FSISMKSIPIGTAYAVFTGIGAAGTAIIGMIFLSEGVSFWKIVSLIVLLTGIIGLKLVD
FT                   GNESEKEAK"
FT   CDS_pept        887549..887869
FT                   /transl_table=11
FT                   /gene="sugE-2"
FT                   /locus_tag="lmo4a_0865"
FT                   /product="SugE protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0865"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83567"
FT                   /protein_id="CAR83567.1"
FT                   /translation="MDWIFLLVAGLCEMVFVVMLKLSDGFKKVGYAILTVIFMSASFFL
FT                   LSLALKTIPIGTGYAIWTGIGAVGSVTLGMIVFKERKSVGKLLFITMIIAGVVGLKLTS
FT                   GV"
FT   CDS_pept        888019..889131
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="lmo4a_0866"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="D-alanine-D-alanine ligase and related ATP-grasp
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0866"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83568"
FT                   /protein_id="CAR83568.1"
FT                   /translation="MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNE
FT                   GEWIQGPLLSGKLDFVEQLRFSATDSIKLATTESEKSEGEAISPAVLEADGQETVVFPL
FT                   LHGPNGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLI
FT                   DWKNYQAEMITEMEEVLTYPVFVKPANLGSSVGISKATNKKELADAMTEAFLYDRRVVV
FT                   EQGVVAREIEMGVLGNDTPVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPE
FT                   ILEQMKEYAVQAFLGLDASGLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETG
FT                   LPYGALIERLVDLAKERHAAKNALKYKLED"
FT   CDS_pept        889156..890568
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="lmo4a_0867"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0867"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83569"
FT                   /protein_id="CAR83569.1"
FT                   /translation="MRKLLFYGRERFNLKKTVGEVVAMLDSSIHVDTFRDVVITGVCFD
FT                   TRQIKSGDLFVPFVGNVRDGHEFVGQAREMGAVATFWQKNVPNPPTDFPVILVEDTLLA
FT                   LQELAAKYIQQVKPKVIAITGSNGKTTTKDIMAAIVETTYKVHYTGGNFNNHIGLPYTI
FT                   LTMPEDTEVAVLEMGMNHRHEIEVLSKIAKPDIAIITNIGEAHIEYLGSREEIAKAKLE
FT                   ITAGLNPSGILIYPHEETLLLGNINGDFRQLTFGKSEAAEIYPLEIRAEAEGTSFITNW
FT                   EPELEIFVPIIGEHNVFNTMAAMLAAREIGIEGEKIQSALKNMERSKSRLEWITTKSGA
FT                   RILNDAYNSSPTALKTVLKTFMHMDSSGKPKYLVLADMLELGDLSTKLHQESAEVLEND
FT                   TIQKVFLYGDAMKAFGEVAESKIGQGKVHHFDTKESLETALLAEIKGNEWILVKGSYGM
FT                   GLKDVVENLIIK"
FT   CDS_pept        890635..891348
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0868"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0868"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83570"
FT                   /protein_id="CAR83570.1"
FT                   /translation="MVACLCIHGFTGSPSEVKPLADYLREHTDWDVLAPTLPGHDHLRH
FT                   LKNVTYKDWIVFVDSILSQMLKEDDEVYIIGFSMGGLLAGWLARHYPEVKKLVLLSTAV
FT                   NAMEWPQLVENSKQVLTEAKEVTLKNSPMFKRYQKKVTETPWTSTLQFKKMVALAKPVF
FT                   EHIEIPTFIAQGSADQVVPAEKSVNFLMESIPGPKELFILEGSKHVICQDEQADKLFAA
FT                   VLTFLQKDVAILNTK"
FT   CDS_pept        complement(891360..892385)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0869"
FT                   /product="DNA-binding transcriptional regulator, lacI
FT                   family"
FT                   /note="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0869"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83571"
FT                   /protein_id="CAR83571.1"
FT                   /translation="MKKVTMQDIADRLNITKNSVSQALGNKNGVSEQTKLAVFKMADEL
FT                   GYKYKREIAREVVKEKFALLATSFALSQRSFFGEIIDNMKQSIIAHQAELIIFPVTDEE
FT                   AATNQLPEQLTSENWTGIFLLSHINTDYSKKVIDLGMPVVLIDHHDPHLKADAVISQNK
FT                   DGAFMAVEFLIQNKHQKIGFLGDVTFSPSYEERLEGYKKALQYYHIPFNEKYAITRIKE
FT                   EQTTLYRTLDELDELPTAWFCVNSGLGFILNTYLQSKGYNIPKDLSIICFDNTEFTVLS
FT                   NPQLTTMCTNLSFMGEKAVELMYNRIRKPDEGFVHLALATNLIARDSVGENKKTDSASE
FT                   S"
FT   CDS_pept        892630..893949
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0870"
FT                   /product="sugar ABC transporter, sugar-binding protein"
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0870"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83572"
FT                   /protein_id="CAR83572.1"
FT                   /translation="MKIRKIAIAALSVVVAGSLLTACGGGNSKSDDNGKTKVTFWAAPN
FT                   PTQVKYWDEMAKAYEKENPDVTIEVSQMKESPSSEATIQSAIASKTAPTMSENINRSFA
FT                   AQLADSKAIVPLNDVKGLDDVVKERNMSETMDSWKFSDGNQYVLPVYSNPILFAWRLDT
FT                   LKELGYDAPPKTYSEALEVGKKLKAKYPDKVLWAKGDLSDPTAWMRWFDFFPLYDAASK
FT                   GNAFVEDGKLVADDKAGTELLTFMSELQKNKLLLASKATDPFETGTSIMADNGPWTFPN
FT                   WDEKFPELKYNENYAITAPLVPDSMANEKNIATYADSKGVVMYAQATDKEKEAAMDFLK
FT                   FVYNDDKNDLKFLETTNLIPARDDATENETFTAFFKENPELEVYAANVPYSIPAMDDAK
FT                   YNDIQQILGEEAWNPVVRGEKKPAKAWSDMKKAEDGVLQK"
FT   CDS_pept        893946..894824
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0871"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0871"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83573"
FT                   /protein_id="CAR83573.1"
FT                   /translation="MKRRNNKLGWSFTSPYLIFTAIFFLVPLVWSIWLSVTDWNMMSPD
FT                   INFVGFDNFIKAFTSPAVKAAFFVTYKFLIVFVPMALIISMIVAVLVNGLPKFKGLYLV
FT                   AFFLPYLSSGVVTSLIVQGLLSYNSALNVFLRGHFGWDIDWLGTPMSALVIISLMIAWK
FT                   MSGYYALILISGLASINHEIYEAAAMDGSGRFRTFWKVTVPMLYPALFTVIVLAVGVSF
FT                   GIFTEVYQLTGGGPNFATNTWQMEIFNQAFVNLNSGYASAISLMAATVTFASIGVIKKM
FT                   LEKWGQRNGWT"
FT   CDS_pept        894811..895644
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0872"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="ABC-type sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0872"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83574"
FT                   /protein_id="CAR83574.1"
FT                   /translation="MVGHNSKAGKIVRYILTTLLMLIMIYPFIYLVLNSFAAWDQVDKK
FT                   LIPTEFTTRSWDWLFGNSVVAAPAPWIHAFINTIIVSTIATGLMLLFGLMVGYALAKVD
FT                   FKGKKIVNNAILFQMFFPAIILLIPQFLMITDFGLLDTYAGMIIPTMLSLWAVFMYTNF
FT                   FKAIPDTLIEAAKLDGASDLKILFRVVLPMSKSITTVIFLFLFTDRWTNLLWDMLVTKS
FT                   DGTVTLNVLISQMFGPYATYPGPMYAASVLLTLPLIILFLFFSKKFQEGMQFTLK"
FT   CDS_pept        895660..897192
FT                   /transl_table=11
FT                   /gene="treC-1"
FT                   /locus_tag="lmo4a_0873"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.93"
FT                   /note="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0873"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83575"
FT                   /protein_id="CAR83575.1"
FT                   /translation="MEFWRRSVFYEIYMKSFQDSNGDGLGDFKGLTSRLDYLVDLGIDG
FT                   IWLTPFYPSPQVDNGYDVSDYCDINPDYGDMTDFRAFMKAADARGIKVIIDLVLNHSST
FT                   EHTWFKESRSSKTNPKRDYYIWREKPNNWESFFGGSAWEMDELTGEYYYHSFAKEQADL
FT                   NWANEAVRAEMEQVLAFWLNEGVAGFRLDVINNLTLVLEFSDNPVASGEMEHVYDRNQS
FT                   GLEQALEDIASFCRKERDVFLVGEISSDKLPEIARYSSKKMLDVTFNFNFGSVDQLDAK
FT                   SVFTTLNEMETALNEGQWPTLFFGSHDMSRFRSRLASGDLVKTQLLAFLMLTAKGVPFI
FT                   YYGEEVGMPDLTFSSVKEMRDIQGTAAYYQALQTGTDEKQALEIAIEKTRDKARGPMIF
FT                   PDGKPYTLGEPWIKMATLPEEEARMMWDFYQALLAFRKENDFKEMEYTFLKLDGEVLSY
FT                   QRGEFIFLLHFGEEEVTYPLQGNYQLVFGEAMMVENGIRMGAYTGIALRVEE"
FT   CDS_pept        897194..898108
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0874"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0874"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83576"
FT                   /protein_id="CAR83576.1"
FT                   /translation="MNTIENLLQVYRENSAAFGTRITLNGARDKDVYNITAPFHWLGQE
FT                   YIAGRVESRDSEFSEVRFFEKTETDIYQLVENTTVLALQDPFVTFVQGELIIGGVEVFP
FT                   KETDPTMLDWRTNLYRATSLTDFEQILAGPIGMKDLRIKELADGRILVLTRPQGEKGGR
FT                   GKIGAIVMDSLTELTIEKMEAAPLLKRNFSGEEWGGGNELHLLEDERIGVLGHIACFDE
FT                   AGNRHYYACSFQLNEDFSQIEQEKIIAERANFAPSEPKRPDLADVVFSGGLIRNTDGTA
FT                   TLYAGIGDSDAQKLTIPDPFKNN"
FT   CDS_pept        898130..899197
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0875"
FT                   /product="glycosylase, putative"
FT                   /note="Predicted glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0875"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83577"
FT                   /protein_id="CAR83577.1"
FT                   /translation="MNIYRYEENPLITPLDVKPIHEGFEVIGAFNAGVAEYNGEVLLLL
FT                   RVAEKPVSEDPEVVLAPVYNAKSKELELQPFRLDDENYDFEDPRMIRSKAKLEGFSYLT
FT                   SLSYIRIARSKDGHQFTLDEKPFLYPFNEYQTFGIEDARVTQIGDTYHVNFSAVSEFGV
FT                   ADALVTTKDFENLEYQGNIFAPENKDVLIFPEKINGKYYALHRPSLKSIGNLDIWIASS
FT                   PDLRSFGDHRHLLGIRPGEYDSGRVGGGCVPIKTEEGWLILYHGATEENRYVMGAALLD
FT                   LNDPTIVLKRTKTPILEPVADYEKNGFFGDVVFACGAIQEGDTLHMYYGVADTSMAGCD
FT                   MKISEILHQLEVENK"
FT   CDS_pept        899194..900867
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0876"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0876"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83578"
FT                   /protein_id="CAR83578.1"
FT                   /translation="MIWQQHLNAWQNADLSDEWRRELEQVEQEQERFDGYLTFGTGGMR
FT                   GKMGVGTKRINLFTIRRVAKGLGDYVVANGGAEMGVAIAYDSRHHSGAFAKETAKVLAA
FT                   QGIKVYLSATIRPTPALSFCVREKGAFAGVVITASHNPSIYNGFKVYDKNGCQITLGVA
FT                   QEIAGYLENITDIFTIPVRELTNPLVMTLGKEMDDAYLKALTAVVSRPNLLADYGNELR
FT                   ICYTPLHGAGKELVMRGLLENGFSETTIIAEQSEPDGDFPTVISPNPEEENSFELAKKQ
FT                   AKEIQADIILATDPDADRLGVAVLTKQATYQILTGNQLGALLLQYILEAKTSVTGADTM
FT                   INTIVTGDLGGRIAHDFGINHIQTLTGFKYIGEKIAEMEGTEKNFLFGYEESYGYLIAP
FT                   FVRDKDAVQAALLTAEMALFYKKEGTTLLQKLTNLYEKFGYHKEHLHTITLDDSDGTAK
FT                   MNQVIDALRKEPTCIPGITVLEDFLTSKRINLSTMEMTNIELPKENVLKFYLNDNAWFA
FT                   IRPSGTEPKCKIYFQTIGETEEIATKAMDELKKRVLAKWD"
FT   CDS_pept        900858..900950
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0877"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0877"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83579"
FT                   /protein_id="CAR83579.1"
FT                   /translation="MGLIKSWKLFSDDFQLFLKDLSIKIDEKPG"
FT   CDS_pept        901323..902879
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0878"
FT                   /product="ATP-dependent RNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0878"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83580"
FT                   /protein_id="CAR83580.1"
FT                   /translation="MTLTKFSEFGLDEKIVKSVNRMGFEEATPIQEKTIPLGLAGKDLI
FT                   GQAQTGTGKTAAFGLPMIHKIDQKSNNVQALIIAPTRELAIQVSEELYKLSYDKHVRVL
FT                   AVYGGSDISRQIRSLKKNPQIVVGTPGRILDHINRRTLKLDHVETLVLDEADEMLNMGF
FT                   IDDIETILKEVPAERQTLLFSATMPDPIRRIGERFMHSPELIRIKAKEMTALLIEQFFV
FT                   KVHEKEKFDVLSRLLDVQAPELAIVFGRTKRRVDELSRALDMRGYVAEGIHGDLTQAKR
FT                   MSVLRKFKEGKIDVLVATDVAARGLDISGVTHVYNYDIPQDPESYVHRIGRTGRAGKEG
FT                   MAITFVQPREMGYLRIVEETTKKRMQPLQAPTWDEAFAGQLRVATEKIQEAITEENLAD
FT                   YKTFANELLEKYDATDIAAAMLKMLAKEPDKTPVHITEERPLPSRGGGGYKGKNGKGGK
FT                   GGGYRGGSGKGGSYRDRNNSGKGRRSGGGSGSGGGGNRDRRGGGEQRSGGNKGNYSQKS
FT                   K"
FT   CDS_pept        903323..903811
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0879"
FT                   /product="membrane protein, putative"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0879"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83581"
FT                   /protein_id="CAR83581.1"
FT                   /translation="MKMKILTVNAIIAALYVVLGMIVAPIGFMALQFRIPEIFNHLIVF
FT                   NKKYFWGIIVGVFITNLFFSGLGWIDLVFGVAQSAISLLLMIGISKYVKGIIPRMIINT
FT                   ILFSLTMAIIAWELVIVFDLPFLITWATTAASEFIVMGVGIPLMYLLNKRLNFRKMID"
FT   CDS_pept        904094..904783
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0880"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83582"
FT                   /protein_id="CAR83582.1"
FT                   /translation="MEVKKESVQDYLYQNMREQWKILFGIETEIHLHKWLINYKNNCLF
FT                   LYNVHGLLIGESSNDLKDEQRKLVYKKTASTLEIIDSLSTLQIPLSAAKQAIQMVCDYL
FT                   YDYLPLGSVVILNKKYLGKAFEVDAIQQVRFVITQRFACIPDTETFYPYGGIIYPIGQI
FT                   EGERVMYFTPPLIEEVQHIGFQDDTDRAFVLEMKEELIKRKNFQSIAFIDSKKREQAQQ
FT                   VIERRGR"
FT   CDS_pept        904786..905076
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0881"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83583"
FT                   /protein_id="CAR83583.1"
FT                   /translation="MSEIKVDYKTFASESAKLEQAITQFEPFTARFTAETVPRLDGFNS
FT                   DFIESLRGTLTNMADDTGPELLATIKTFSQKVQVLTNEFETLDEELANQGE"
FT   CDS_pept        905080..905277
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0882"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0882"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83584"
FT                   /protein_id="CAR83584.1"
FT                   /translation="MYYTLYQRQVLEALETMIYHMDKNFSQMDLENANIQYDMEEIQLN
FT                   IRRYINAAIDQIGDYRFTEE"
FT   CDS_pept        905281..906756
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0883"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0883"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83585"
FT                   /protein_id="CAR83585.1"
FT                   /translation="MKRDLKINFGILEQIRDELYQFMRALENMKSSVNNIDNLLANASG
FT                   KSIEAISQDKKDVITAIDTYKEQVNDVYVLISDYIGDMTSYIRPINQYGLMRVDRDDIW
FT                   WNISQIEGANAVNVTKPSRYGYTAIAGYETDANNDIIAEQIEADITYLKTRISGEISAL
FT                   WQIHDQQIAPFEDTDDHFKSRSETLYDRYTSWEERNKDIMLGIETGIYNLFTGVIKGLV
FT                   GVVGGFITLVAGVIKYLKNGVTYLLTAPFGTTPEDVLASLDETHSLFASILKDPALIIE
FT                   GMAQDISDTFDEKGIMYSIGAVVPDIVVDILITKGLGKVGKLANFGDSIADVGKYADEV
FT                   ADVGKYADDIAKISKIEKFKNKLDMLRSKMPSSKLRNEGNMAVADVRIEGLPNEFLAHS
FT                   KIHGPDSKGADLAQFSPTPENRLLESYTVDKFPRYNDTEAKILEDIASQIQDPNISGQI
FT                   DLYTERATCQSCTNIILEFRRKYPNIKLNIFTE"
FT   CDS_pept        906767..907144
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0884"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0884"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83586"
FT                   /protein_id="CAR83586.1"
FT                   /translation="MDNLSYIDIKKLVETDYYDFIKDDGFTPEQSAAATMEDFTLMMKK
FT                   KYKNYFSVIQSLSLICLQQGFITDYLLERLNALKELNNLSDEEINVYENDKITLKNILE
FT                   KNEFTIDIDIAFKARIDMLLE"
FT   CDS_pept        complement(907358..907711)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0885"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0885"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83587"
FT                   /protein_id="CAR83587.1"
FT                   /translation="MTKVYNIGVEATLEVIGGKWKPVILCHLREGKKRTGELKRLIPNI
FT                   TQKMLTQQLRELEKSGVIVRKVYEQIPPKVEYSLSEYGESLSEILNKLCLWGENHVDLL
FT                   LTKNEDIVLLKRD"
FT   CDS_pept        907845..909005
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0886"
FT                   /product="major facilitator family transporter"
FT                   /note="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0886"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83588"
FT                   /protein_id="CAR83588.1"
FT                   /translation="MKKVNPNLTLLALAISAFGIGSTEFISVGLLPLISSSMGVSISTA
FT                   GLTVSIYALGVMVGAPVLTTMTAKMNRKNLLLLVMLVFLIGNLVSAFAVSFGMLLTGRV
FT                   VAAFAHGVFMSIASVIAADVVHPSKRASAIAVMFTGLTVATVTGVPLGTFIGQLFGWRM
FT                   SFLFIVAIGVIAIIANFFLVPKNLSNGKSISFKAIGQLLVNKKIVMVLLMTAFGYGGTF
FT                   VVYTYLSPMFSGMGYSTSMIVILLIVYGVMVAIGNTIGGHFANERPAKALFVMFSLQGI
FT                   TLLLLQFTSTNAIFGLMTIMLMGFFAFMNVSGLQLYVVQLAERYLPETVSMASALNISA
FT                   FNVGIAMGAFIGGLVTEYIGLGYTPIVGFLMVFIAIILTFYMKKDK"
FT   CDS_pept        909213..911231
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0887"
FT                   /product="transcriptional regulator/antiterminator, BglG
FT                   family"
FT                   /note="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0887"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83589"
FT                   /protein_id="CAR83589.1"
FT                   /translation="MKLNQQCIQILDFLMEQEDFKNIGYISNALGCSERSVRYSLEKID
FT                   IFLHEQTLPALIRHTRKGVLLPEKNIVNPVVRKFKQQITPKKYRYSQEEVQQFLLLKLL
FT                   LSEEVLPVTYFEEVLFISRSSVLNHLRAIEGELFLNNLDLSHQPRHGFLVTGNLITKTS
FT                   LFARSFLRFINIREFYQFLDSENSLSKKGELFFYNLFELEILQEVNREAHSVEENMTRA
FT                   MDEQLYLTLIAILLKQHEAKPDFQFTADFTIKDELDQALETIIGSLKQYQYGREDEAVI
FT                   EAFVTGICEKMGEIYQVDFVHGDTDFFTQIKAHIKLMIRRVRAGVTIENPIFNEFMRDN
FT                   REIFMRVKESLDALKPLLPISVSSQEISFLAIYFASEVQRNKQTVEMKPNLLIICPEGV
FT                   AVSKMIAIQLKRMFEFESIQTIGLRKFKRAMMADFDFVISTVDLPDMQDAKVLRIHSYL
FT                   QKEDMELLQKHLRMKLVKSDKQIINKFSKILAIIGENTQITNLSKLEFDLLEALISDEG
FT                   ETPKRLIPPFQFTEEAIVMEETCPTWRQAIKLGTKCLEHLEVIEPSYHEKIIHNLKAYG
FT                   PYMVVAPGVVIAHAGASDGVLMDGIGVTIIEDGIMFFDRYEEPVHVIFTLALKTKEAHL
FT                   IVEQLMKLALDEEKMQKIKMASSKRDIYHYVKSAIFE"
FT   CDS_pept        911246..911575
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0888"
FT                   /product="PTS system, beta-glucoside-specific, IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0888"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83590"
FT                   /protein_id="CAR83590.1"
FT                   /translation="MDIEKISFSLISLAGDSFSKLIEALQAAKESDSELVEQLLKEADD
FT                   LMIEAHKVQTEMLIQETRGEQANFSVLLVHAQDTLMNTILASTLIREMIEMHQEIKTLR
FT                   KEEEK"
FT   CDS_pept        911576..911911
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0889"
FT                   /product="PTS system, beta-glucoside-specific, IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0889"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83591"
FT                   /protein_id="CAR83591.1"
FT                   /translation="MEINQLHVLLVCNLGASTGVMVTKMKEIAQNSEKLTNTDVKIEAH
FT                   PAGELREHIEDFDVILVGPQIKHQLKHLSEIAAEYNKPIQVIDTKDYGTVNGANILKDA
FT                   IILKLNK"
FT   CDS_pept        911931..913256
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0890"
FT                   /product="PTS system, beta-glucoside-specific, IIC
FT                   component"
FT                   /note="Phosphotransferase system cellobiose-specific
FT                   component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0890"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83592"
FT                   /protein_id="CAR83592.1"
FT                   /translation="MSSKNKQSFMNRFIAFMEKYFEPVAARIEKQRHISSIKNGMIALI
FT                   SVLIIGSFSLIISAIGNMFPAGSVVKEFFVQNAAALNLPFQFTFGLLSIYAAITISYSH
FT                   AKQMKVPVLHSVMAAVMVTLILNTKMVDGVLNTEFLDSRGLFIAIFAALISVELIGLFI
FT                   RKNITIRIKGLPAGIATTFEAIIPLVVLLFSAVGLSILMQSVTSGQIIPEAFTTMLAPA
FT                   INSIDTPYAVFLICFLEMLFWFIGLNGYAILIGFVLPFMTQYLGANAAAYAAGEPIPHV
FT                   FAPNFWDYFMGFSGSGITGALVILALFSKSRELKAVGKVSVVPAIFTISEPVVFGLPIC
FT                   FNPYLFIPFVLGTPILAVGQWFVFHFGWVRPPIANVGGTPIPLAQYLATMDWRAIILII
FT                   FVLAAAVCMYYPFFKMYEKSLIKEEEVVSERQAAHDALDLDF"
FT   CDS_pept        913277..914005
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0891"
FT                   /product="glucosamine-6-phosphate isomerase, putative"
FT                   /note="6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0891"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83593"
FT                   /protein_id="CAR83593.1"
FT                   /translation="MKLIINENEQLVAETVSQKIIELVKEKPASLICIAGGDTPLLTIE
FT                   ALIKANQAGEVDFSETQFVGLDEWVGLGRETKGSCIQTLYDAFFDRLKNVSSEQICFFD
FT                   GKATSLTDECARVDKFIDDRGGMDFILLGIGLNGHIGFNEPFVPVDVNCHVVELDDVTK
FT                   RVMSKYFDTDLPLTHGISLGMQQILAAKEIYLVATGEKKIDIVKQVVEKEPTVAIPATL
FT                   VKDSNTTLVVDKIAASGVEA"
FT   CDS_pept        914005..914958
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0892"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="Predicted oxidoreductases (related to aryl-alcohol
FT                   dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0892"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83594"
FT                   /protein_id="CAR83594.1"
FT                   /translation="MEKIIVNGRKNGQKIEIACSNLVMGAGDFLRADNMDFAGPVLDQY
FT                   FEMGGNIFDTARHYRHSEKAIGTWMNMRGNRDSVIIQTKGGHPVREASDVPRVTPEAIH
FT                   EDISVSLDTLQTGHVELFALHRDNPEVEVGPIMEAMHKEVEDGRVYAIGLSNWELPRII
FT                   EANEYAVSHGLTPLSFNSPNFSLAKVNRPRWENCVSANEAMIRWHEATNLPLFSWSSQA
FT                   GGFFSGRFSEEDTSDTEMVEVYYSEANWERYSRAKQLANQKGCTPIQISLAYVLTQSFP
FT                   TAAVIGPENATELQSSVAAAGIKLTASEVDWLDLKA"
FT   CDS_pept        914976..915743
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0893"
FT                   /product="conserved hypothetical protein"
FT                   /note="Hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0893"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83595"
FT                   /protein_id="CAR83595.1"
FT                   /translation="MNIKEKIAVQLYSVRKEMERDLEGTLRKMHEIGFRYVQLDGMRGN
FT                   DPSEVRRLLQKYELKVIGMHIKHDRFMNDLDGIIEEAYFFDCKTVFDKYIEEEDQTTAG
FT                   YTATKAALINAAEKLHPLGFRIGLHNPEYDFNECIHGRRVMDYITDPVDGICIYAEPDT
FT                   YWIRAAGHDETEFIKRYSGRAPIVHMKDFVSGFELEDMDNNLVEIGQGEVDFRAIMEWG
FT                   EANGVEYYCVEQDRSKRAMFETLEANYQYLLQL"
FT   CDS_pept        915861..917249
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0894"
FT                   /product="LysM domain protein (LPXTG motif)"
FT                   /note="FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0894"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83596"
FT                   /protein_id="CAR83596.1"
FT                   /translation="MKKRWLVFAIICLIITGFLSPKAEAATDYGSSFFTNVTLQNQNGE
FT                   QATNFKENSKVRVAYDFVITQPVASGETMTLTIPEQLKLINYGGFPLMDSQGNTIANAT
FT                   IDQTTGTITLTFTDYVNTHTNLSGSLYYNATFNSKNIQTDQVNPIAFPVKNTTQTINAF
FT                   ISKVNTGGGTGSPTIVFKQGRMDDKDLSILHWTVTLNNALTPIDNAVYTDTLGSGQNLL
FT                   GNATIKYRDANKKVITTNIQPITLDANRNFELSIGTLNNQSVVITYDTKITTKQKSYTN
FT                   KATLSGDNLDPVSRNATVNDYGSGGQGTGTPPTPPVKEEPPFIPAEKQPIEKTVETDFG
FT                   PLEVVKDSEQNGKIKVVYKVKDGDTLPGVANKFDVTVAEIKDWNNLTSDTLQAGQKLQL
FT                   TIEKTLLSKITVPPVQKVTSTTRVDGIVKATGTLPHTGDTNPLIPFVTGVSLVALGFTF
FT                   GRRN"
FT   CDS_pept        complement(917295..917771)
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0895"
FT                   /product="secreted protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0895"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83597"
FT                   /protein_id="CAR83597.1"
FT                   /translation="MKKKGYVLLIIALLSLTLNWLPEIAHAQKEATGTTYTTATSSELM
FT                   EMFLPYSIQNPYIETTKNSAELMFVTETAATITAKTNNQTQKIAGNTENHQFTLANLEP
FT                   GNNLVTITATMADGSTESKTITINLPEKPKKGSKSFHDQSKNQQMTHRKKGHLL"
FT   CDS_pept        917904..918386
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0896"
FT                   /product="bacterial membrane-flanked domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0896"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83598"
FT                   /protein_id="CAR83598.1"
FT                   /translation="MELDNLEKKLPEKIKTVWRQTEGIAVLVFLLCSVAAAIILYYTGA
FT                   SVWWSAIGFGLTVLYAAFIYLFIIPFRFARWSYQIKPDEMEIQHGIIFRSRVLIPMIRI
FT                   QHVETEQGPLLRRQKLVSLSITTAAKTHKIEAVNESESDELRHHILELVKVAKEDV"
FT   CDS_pept        918379..919854
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0897"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0897"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83599"
FT                   /protein_id="CAR83599.1"
FT                   /translation="MFEERRLHPIALIKEIITNVRRNIVPIVVGLFSVFRAINSNGYLP
FT                   DWAVYLIIVIVILLILTPAVLKYITYKYTLEDQGIRIKYGLIFRKNTYIPYERIQTVQK
FT                   KQWFFFIPFNVCQILIETAGGNGKAEADLVAVPVGVVDELKDLRDGKKRDIQEAVPETE
FT                   ETTVEVAEAPEKTVMLQTKQLILMAVTSGGVFGTLLIVLAFMQQFREVIPTDWMEAQAE
FT                   QLWKMGIIVLIVLIVLILLVLWGISIVTTLFKYFQFKLMKYPNSLVVEKGLLERNHTTI
FT                   SLSRIQGITIIESPLRQMLGLVAVKVTTAGNSGDEKLSGDILLLPIMKKELALKTLKEM
FT                   LPDYLFEIEKMERAPKASLRRFLQIYLIWTIIPAAVASILFFPLGLISIILPVLAGIKG
FT                   VASYRATGVFTDKHTLLVQSRPIFSKLTHIIRKERIQGLSLRQSIWMEKGESRHLNVWL
FT                   KSGSTSTEAYVRYINQDLAIKVYNWYSPSKTIN"
FT   CDS_pept        920004..921383
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="lmo4a_0898"
FT                   /EC_number="1.3.3.4"
FT                   /note="Protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0898"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83600"
FT                   /protein_id="CAR83600.1"
FT                   /translation="MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETV
FT                   KRDGFLIEKGPDSFLARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVM
FT                   GIPTDKEALLASTLVSEIGKARALQEPTMERNNQEQDQALGDFFEARFGKELVKTIIEP
FT                   LLSGIYAGDIYKMSLRATFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGG
FT                   LDTLPKAIAAALPKGNLHTAKQATNITKKNSSYEISFADGDKMEADGVIIAATHDALIH
FT                   LLAEKTTEPFAGQPLTTLATVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKW
FT                   PHMVPKNKMLLRGFVGKAGETWLEQASDEAIVSAVLTDYAEIMDLHAAPLFYEVSRMKS
FT                   AMPQYLVNHQDRLKQLKKNVKADYPGVYFAGMSYEGVGIPDCIAGAQTAINELAEYLEE
FT                   V"
FT   CDS_pept        921385..921741
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="lmo4a_0899"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="Phosphopantetheinyl transferase (holo-ACP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0899"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83601"
FT                   /protein_id="CAR83601.1"
FT                   /translation="MIKGIGLDMIDLERVKQVVEKNPRFIERVLTEKEIKQFEKYEGNR
FT                   KIEFLAGRFAAKEAYAKANGTGFGKHLSFTDVEILQVEDGRPHVTLPANAGENVFVSIT
FT                   HTARSAAAQVIIEI"
FT   CDS_pept        921760..922866
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="lmo4a_0900"
FT                   /EC_number="5.1.1.1"
FT                   /note="Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0900"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83602"
FT                   /protein_id="CAR83602.1"
FT                   /translation="MVTGWHRPTWIEIDRAAIRENIKNEQNKLPENVDLWAVVKANAYG
FT                   HGIIEVARTAKEAGAKGFCVAILDEALALREAGFQDDFILVLGATRKEDANLAAKNHIS
FT                   LTVFREDWLEDLTLEAPLRIHLKVDSGMGRLGIRTVEEARQIETTIASDNQLQLEGIYT
FT                   HFATADQLETSYFEQQLAKFQTILTSLKNRPTYVHTANSAASLLQPQIGFDAIRFGISM
FT                   YGLTPSTEIKTSLPFELKPALALYTEMVHVKELAPGDSVSYGATYTATEREWVATLPIG
FT                   YADGLIRHYSGFHVLVGGELAPIIGRVCMDQTIIKLPREFQTGSKVTIIGEDNGNAITA
FT                   DDAAQYLDTINYEVTCLLNERIPRKYLH"
FT   CDS_pept        923072..923350
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0901"
FT                   /product="transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0901"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83603"
FT                   /protein_id="CAR83603.1"
FT                   /translation="MLEKENRMIISVELTQEMIQELDVVVEKEKMGRSEVIMEATQQFL
FT                   QEKRARELRDEMERGYAEMATINFAIACECTHVEAEAEDRNISILGG"
FT   CDS_pept        923357..923701
FT                   /transl_table=11
FT                   /locus_tag="lmo4a_0902"
FT                   /product="transcriptional regulator, PemK family"
FT                   /note="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0902"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83604"
FT                   /protein_id="CAR83604.1"
FT                   /translation="MVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAA
FT                   ITAKIQKAKLPTHVEATRKDGFERDSVILLEQIRTIDKQRLTDKITHLDEDLMAKVNKA
FT                   LEVSLGVVEF"
FT   CDS_pept        923951..924787
FT                   /transl_table=11
FT                   /gene="rsbR"
FT                   /locus_tag="lmo4a_0903"
FT                   /product="regulator of sigma-B activity"
FT                   /note="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0903"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83605"
FT                   /protein_id="CAR83605.1"
FT                   /translation="MYKDFANFIRTNKADLLNNWMNEMEKQSDQLINDIAKEAMYEETS
FT                   KEFVDLIVSNVTENGSKFNEKLDDFAEKVVHLGWPIHFVTTGLRVFGLLVYTAMRDEDL
FT                   FLKREEKPEDDAYYRFETWLSSMYNKVVTAYADTWEKTVSIQKSALQELSAPLLPIFEK
FT                   ISVMPLIGTIDTERAKLIIENLLIGVVKNRSEVVLIDITGVPVVDTMVAHHIIQASEAV
FT                   RLVGCQAMLVGIRPEIAQTIVNLGIELDQIITTNTMKKGMERALALTNREIVEKEG"
FT   CDS_pept        924793..925149
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="lmo4a_0904"
FT                   /product="anti-sigma factor B antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0904"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83606"
FT                   /protein_id="CAR83606.1"
FT                   /translation="MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVV
FT                   IDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMD
FT                   LESGLEKLKQELGE"
FT   CDS_pept        925152..925562
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="lmo4a_0905"
FT                   /product="anti-sigma B factor"
FT                   /EC_number="2.7.11.1"
FT                   /note="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0905"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83607"
FT                   /protein_id="CAR83607.1"
FT                   /translation="MTFQSCVKIINEWDIVAARQLGRKISKEIGFGTVDQARITTAISE
FT                   LARNIFLYAGRGEICIEKVSESGKQGMIIVAKDKGPGIVDIRKVMQDGYTTSGGLGAGL
FT                   PGVKRLMDSFDIESSIEGDSKGTVITTTKWVR"
FT   CDS_pept        925579..926583
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="lmo4a_0906"
FT                   /product="sigma factor B regulator protein"
FT                   /EC_number="3.1.3.3"
FT                   /note="Serine phosphatase RsbU, regulator of sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0906"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83608"
FT                   /protein_id="CAR83608.1"
FT                   /translation="MEKAFEGKYRDILIQYLEHQDEEILYTCEKLSREAMEERVSPEEI
FT                   VHLHRSVLELYGKELPDFVRLSFDVLLEIMVGYGLAYMEHLSLRTEQKELRSEIAQAED
FT                   MQKTLMKTEVPEHDELDFGVISVAARQMSGDYYSFTEEGDKQIGIALADVIGKGIPAAF
FT                   SISMIKYALAGMTGDDRKPSIVLESLNQVAEENINDNMFITMFYGLYHEDTHLFEYGSA
FT                   GHELGLYYQHKEKSFSDLYAKGLPLGVDKNAVYRQFDKKIEVGDAIFIMSDGVTETRTD
FT                   SGFIEREELTEIIAAHISLSAEKMVHAIYDQLVKMQNFELHDDFTLICIKRTK"
FT   CDS_pept        926733..927077
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="lmo4a_0907"
FT                   /product="anti-sigma factor antagonist"
FT                   /note="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lmo4a_0907"
FT                   /db_xref="EnsemblGenomes-Tr:CAR83609"
FT                   /protein_id="CAR83609.1"
FT                   /translation="MNISIEIKERDTDHIDIFVAGEIDAYTAPKVKEALEVYQVKEGIV
FT                   LRIDLTEVSYMDSTGLGVFVGAFKSLRQRQSELVLFGLSDRLFRLFEITGLSDIIEIKN
FT                   VEGEMNGNNA"
FT   CDS_pept        927061..927534
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="lmo4a_0908"
FT                   /product="anti-sigma factor"
FT                   /EC_number="