(data stored in ACNUC23119 zone)

EMBL: FM242528

ID   FM242528; SV 1; linear; mRNA; STD; INV; 675 BP.
XX
AC   FM242528;
XX
DT   09-APR-2009 (Rel. 100, Created)
DT   25-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Acyrthosiphon pisum partial mRNA for odorant-binding protein 2 (obp2 gene)
XX
KW   .
XX
OS   Acyrthosiphon pisum (pea aphid)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha;
OC   Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
XX
RN   [1]
RP   1-675
RA   Zhou J.J.;
RT   ;
RL   Submitted (08-OCT-2008) to the INSDC.
RL   Zhou J.J., Biological Chemistry, Rothamsted Research, West Common,
RL   Harpenden, Herts. AL5 2JQ, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1365-2583.2009.00919.x.
RX   PUBMED; 20482644.
RA   Zhou J.J., Vieira F.G., He X.L., Smadja C., Liu R., Rozas J., Field L.M.;
RT   "Genome annotation and comparative analyses of the odorant-binding proteins
RT   and chemosensory proteins in the pea aphid Acyrthosiphon pisum";
RL   Insect Mol Biol 19Suppl2:113-122(2010).
XX
DR   MD5; 0668cf2effa305d694cbe4e98040faf2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..675
FT                   /organism="Acyrthosiphon pisum"
FT                   /strain="LSR1"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /tissue_type="whole insect"
FT                   /db_xref="taxon:7029"
FT   CDS_pept        <1..675
FT                   /codon_start=1
FT                   /gene="obp2"
FT                   /product="odorant-binding protein 2"
FT                   /function="olfaction"
FT                   /db_xref="GOA:C1KUY2"
FT                   /db_xref="InterPro:IPR006170"
FT                   /db_xref="InterPro:IPR036728"
FT                   /db_xref="UniProtKB/TrEMBL:C1KUY2"
FT                   /protein_id="CAR85629.1"
FT                   /translation="SDPCNISTCYKSGTTKPPMAVTPTHLPVQSSSTQTSHPQTTYAKD
FT                   HVHGSTTTKSGVNATVTTASGASVNGTEPPAVVKSSAGVTGNSTTPKPTMTEGHVALKQ
FT                   KLNTIAVKCKDELHAPQEIMALVSNTVVPQNEQQRCYLECVYKNLNLIKNNKFSVEDGK
FT                   AMARIRFANQPEEHKKAVTIIETCEKEAVIDPKTTEKCAAGRVIRNCFVKNGEKINFFP
FT                   KA"
FT   mat_peptide     1..672
FT                   /gene="obp2"
FT                   /product="odorant-binding protein 2"
XX
SQ   Sequence 675 BP; 221 A; 186 C; 157 G; 111 T; 0 other;
     tcggacccat gtaacatatc tacttgctac aagagcggca cgacgaagcc gccaatggcc        60
     gttacgccca ctcacctgcc ggtacagtca tcgtccaccc agaccagcca cccacagacc       120
     acgtacgcca aggatcacgt gcacggttca accaccacca agtccggtgt caatgctacg       180
     gtcacgacag ccagcggagc gtccgtcaac ggcactgaac cgccggccgt cgtcaagtct       240
     tccgccggag taaccggaaa ctccaccacg cccaagccta caatgaccga aggacatgtg       300
     gctctgaaac agaagttgaa cacaattgcg gtgaagtgca aggacgagct gcacgcgccc       360
     caagagatca tggcactggt cagtaacacg gtagtaccgc agaacgagca acaaaggtgc       420
     tacttagagt gcgtgtacaa aaatcttaat ttgatcaaaa ataacaagtt cagtgtggaa       480
     gacggcaagg cgatggctag aatacgcttc gcaaatcaac cagaagagca caagaaggca       540
     gtaaccataa tagaaacttg cgaaaaagaa gctgttatcg atccgaaaac cactgaaaaa       600
     tgcgcagctg gacgagtaat cagaaactgc ttcgtcaaaa acggagaaaa aataaatttc       660
     ttccctaaag cataa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page