(data stored in ACNUC23119 zone)

EMBL: FM242536

ID   FM242536; SV 1; linear; mRNA; STD; INV; 366 BP.
XX
AC   FM242536;
XX
DT   09-APR-2009 (Rel. 100, Created)
DT   25-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Acyrthosiphon pisum partial mRNA for odorant-binding protein 10 (obp10
DE   gene)
XX
KW   .
XX
OS   Acyrthosiphon pisum (pea aphid)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha;
OC   Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
XX
RN   [1]
RP   1-366
RA   Zhou J.J.;
RT   ;
RL   Submitted (08-OCT-2008) to the INSDC.
RL   Zhou J.J., Biological Chemistry, Rothamsted Research, West Common,
RL   Harpenden, Herts. AL5 2JQ, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1365-2583.2009.00919.x.
RX   PUBMED; 20482644.
RA   Zhou J.J., Vieira F.G., He X.L., Smadja C., Liu R., Rozas J., Field L.M.;
RT   "Genome annotation and comparative analyses of the odorant-binding proteins
RT   and chemosensory proteins in the pea aphid Acyrthosiphon pisum";
RL   Insect Mol Biol 19Suppl2:113-122(2010).
XX
DR   MD5; 3438b9fbad8bea148069748f69f33ac5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..366
FT                   /organism="Acyrthosiphon pisum"
FT                   /strain="LSR1"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /tissue_type="whole insect"
FT                   /db_xref="taxon:7029"
FT   CDS_pept        <1..366
FT                   /codon_start=1
FT                   /gene="obp10"
FT                   /product="odorant-binding protein 10"
FT                   /function="olfaction"
FT                   /db_xref="GOA:C1KUZ0"
FT                   /db_xref="InterPro:IPR006170"
FT                   /db_xref="InterPro:IPR036728"
FT                   /db_xref="UniProtKB/TrEMBL:C1KUZ0"
FT                   /protein_id="CAR85637.1"
FT                   /translation="STRPQPDEMEEIKRTLYNACAGKFPITEEIKNNAKNSIISDDPTF
FT                   KCFLKCCFDEMSMIDEDGIIDGDSLKAMAPDHIKPILEQVIPSCTKNVKQDGCEASFEF
FT                   ISCGIKLNPLIVALLPL"
FT   mat_peptide     1..363
FT                   /gene="obp10"
FT                   /product="odorant-binding protein 10"
XX
SQ   Sequence 366 BP; 129 A; 63 C; 74 G; 100 T; 0 other;
     tctacacgac cacaaccaga tgaaatggag gaaataaaaa gaacactgta caatgcatgt        60
     gctggaaagt ttccaattac ggaagaaatc aagaataacg cgaaaaattc aataatttca       120
     gatgacccaa cttttaaatg ctttttaaag tgttgcttcg acgagatgtc aatgattgat       180
     gaagacggta ttatcgatgg ggattcattg aaagcaatgg ctccggacca tattaagccg       240
     atcttggagc aagtcatccc gagttgtaca aaaaatgtta agcaagatgg ttgtgaagct       300
     tctttcgaat ttataagctg tggcataaaa ttaaatccat taattgttgc actcctacca       360
     ctgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page