(data stored in ACNUC7421 zone)

EMBL: FM242711

ID   FM242711; SV 1; circular; genomic DNA; STD; PRO; 2912690 BP.
XX
AC   FM242711;
XX
PR   Project:PRJEA32207;
XX
DT   30-MAR-2009 (Rel. 100, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Listeria monocytogenes Clip80459 serotype 4b complete genome
XX
KW   complete genome.
XX
OS   Listeria monocytogenes serotype 4b str. CLIP 80459
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RP   1-2912690
RA   Rusniok C.;
RT   ;
RL   Submitted (10-OCT-2008) to the INSDC.
RL   Rusniok C., Genomes et Genetique, Institut Pasteur, 25, 28 rue du Docteur
RL   Roux, 75015, FRANCE.
XX
RN   [2]
RA   N N.;
RT   "Variability in sequence, expression and immune-evasion in pathogenic
RT   Listeriae";
RL   Unpublished.
XX
DR   MD5; aa892dfaa739f409823f43b2e461dca3.
DR   BioSample; SAMEA2272134.
DR   COMPARE-RefGenome; Clip80459.
DR   EnsemblGenomes-Gn; EBG00001165575.
DR   EnsemblGenomes-Gn; EBG00001165576.
DR   EnsemblGenomes-Gn; EBG00001165577.
DR   EnsemblGenomes-Gn; EBG00001165578.
DR   EnsemblGenomes-Gn; EBG00001165579.
DR   EnsemblGenomes-Gn; EBG00001165580.
DR   EnsemblGenomes-Gn; EBG00001165581.
DR   EnsemblGenomes-Gn; EBG00001165582.
DR   EnsemblGenomes-Gn; EBG00001165583.
DR   EnsemblGenomes-Gn; EBG00001165584.
DR   EnsemblGenomes-Gn; EBG00001165585.
DR   EnsemblGenomes-Gn; EBG00001165586.
DR   EnsemblGenomes-Gn; EBG00001165587.
DR   EnsemblGenomes-Gn; EBG00001165588.
DR   EnsemblGenomes-Gn; EBG00001165589.
DR   EnsemblGenomes-Gn; EBG00001165590.
DR   EnsemblGenomes-Gn; EBG00001165591.
DR   EnsemblGenomes-Gn; EBG00001165592.
DR   EnsemblGenomes-Gn; EBG00001165593.
DR   EnsemblGenomes-Gn; EBG00001165594.
DR   EnsemblGenomes-Gn; EBG00001165595.
DR   EnsemblGenomes-Gn; EBG00001165596.
DR   EnsemblGenomes-Gn; EBG00001165597.
DR   EnsemblGenomes-Gn; EBG00001165598.
DR   EnsemblGenomes-Gn; EBG00001165599.
DR   EnsemblGenomes-Gn; EBG00001165600.
DR   EnsemblGenomes-Gn; EBG00001165601.
DR   EnsemblGenomes-Gn; EBG00001165602.
DR   EnsemblGenomes-Gn; EBG00001165603.
DR   EnsemblGenomes-Gn; EBG00001165604.
DR   EnsemblGenomes-Gn; EBG00001165605.
DR   EnsemblGenomes-Gn; EBG00001165606.
DR   EnsemblGenomes-Gn; EBG00001165607.
DR   EnsemblGenomes-Gn; EBG00001165608.
DR   EnsemblGenomes-Gn; EBG00001165609.
DR   EnsemblGenomes-Gn; EBG00001165610.
DR   EnsemblGenomes-Gn; EBG00001165611.
DR   EnsemblGenomes-Gn; EBG00001165612.
DR   EnsemblGenomes-Gn; EBG00001165613.
DR   EnsemblGenomes-Gn; EBG00001165614.
DR   EnsemblGenomes-Gn; EBG00001165615.
DR   EnsemblGenomes-Gn; EBG00001165616.
DR   EnsemblGenomes-Gn; EBG00001165617.
DR   EnsemblGenomes-Gn; EBG00001165618.
DR   EnsemblGenomes-Gn; EBG00001165619.
DR   EnsemblGenomes-Gn; EBG00001165620.
DR   EnsemblGenomes-Gn; EBG00001165621.
DR   EnsemblGenomes-Gn; EBG00001165622.
DR   EnsemblGenomes-Gn; EBG00001165623.
DR   EnsemblGenomes-Gn; EBG00001165624.
DR   EnsemblGenomes-Gn; EBG00001165625.
DR   EnsemblGenomes-Gn; EBG00001165626.
DR   EnsemblGenomes-Gn; EBG00001165627.
DR   EnsemblGenomes-Gn; EBG00001165628.
DR   EnsemblGenomes-Gn; EBG00001165629.
DR   EnsemblGenomes-Gn; EBG00001165630.
DR   EnsemblGenomes-Gn; EBG00001165631.
DR   EnsemblGenomes-Gn; EBG00001165632.
DR   EnsemblGenomes-Gn; EBG00001165633.
DR   EnsemblGenomes-Gn; EBG00001165634.
DR   EnsemblGenomes-Gn; EBG00001165635.
DR   EnsemblGenomes-Gn; EBG00001165636.
DR   EnsemblGenomes-Gn; EBG00001165637.
DR   EnsemblGenomes-Gn; EBG00001165638.
DR   EnsemblGenomes-Gn; EBG00001165639.
DR   EnsemblGenomes-Gn; EBG00001165640.
DR   EnsemblGenomes-Gn; EBG00001165641.
DR   EnsemblGenomes-Gn; EBG00001165642.
DR   EnsemblGenomes-Gn; EBG00001165643.
DR   EnsemblGenomes-Gn; EBG00001165644.
DR   EnsemblGenomes-Gn; EBG00001165645.
DR   EnsemblGenomes-Gn; EBG00001165646.
DR   EnsemblGenomes-Gn; EBG00001165647.
DR   EnsemblGenomes-Gn; EBG00001165648.
DR   EnsemblGenomes-Gn; EBG00001165649.
DR   EnsemblGenomes-Gn; EBG00001165650.
DR   EnsemblGenomes-Gn; EBG00001165651.
DR   EnsemblGenomes-Gn; EBG00001165652.
DR   EnsemblGenomes-Gn; EBG00001165653.
DR   EnsemblGenomes-Gn; EBG00001165654.
DR   EnsemblGenomes-Gn; EBG00001165655.
DR   EnsemblGenomes-Gn; EBG00001165656.
DR   EnsemblGenomes-Gn; EBG00001165657.
DR   EnsemblGenomes-Gn; EBG00001165658.
DR   EnsemblGenomes-Gn; EBG00001165659.
DR   EnsemblGenomes-Gn; EBG00001165660.
DR   EnsemblGenomes-Gn; EBG00001165661.
DR   EnsemblGenomes-Gn; EBG00001165662.
DR   EnsemblGenomes-Gn; EBG00001165663.
DR   EnsemblGenomes-Gn; EBG00001165664.
DR   EnsemblGenomes-Gn; EBG00001165665.
DR   EnsemblGenomes-Gn; EBG00001165666.
DR   EnsemblGenomes-Gn; EBG00001165667.
DR   EnsemblGenomes-Gn; EBG00001165668.
DR   EnsemblGenomes-Gn; EBG00001165669.
DR   EnsemblGenomes-Gn; EBG00001165670.
DR   EnsemblGenomes-Gn; EBG00001165671.
DR   EnsemblGenomes-Gn; EBG00001165672.
DR   EnsemblGenomes-Gn; EBG00001165673.
DR   EnsemblGenomes-Gn; EBG00001165674.
DR   EnsemblGenomes-Gn; EBG00001165675.
DR   EnsemblGenomes-Gn; EBG00001165676.
DR   EnsemblGenomes-Gn; EBG00001165677.
DR   EnsemblGenomes-Gn; EBG00001165678.
DR   EnsemblGenomes-Gn; EBG00001165679.
DR   EnsemblGenomes-Gn; EBG00001165680.
DR   EnsemblGenomes-Gn; EBG00001165681.
DR   EnsemblGenomes-Gn; EBG00001165682.
DR   EnsemblGenomes-Gn; EBG00001165683.
DR   EnsemblGenomes-Gn; EBG00001165684.
DR   EnsemblGenomes-Gn; EBG00001165685.
DR   EnsemblGenomes-Gn; EBG00001165686.
DR   EnsemblGenomes-Gn; EBG00001165687.
DR   EnsemblGenomes-Gn; EBG00001165688.
DR   EnsemblGenomes-Gn; EBG00001165689.
DR   EnsemblGenomes-Gn; EBG00001165690.
DR   EnsemblGenomes-Gn; EBG00001165691.
DR   EnsemblGenomes-Gn; EBG00001165692.
DR   EnsemblGenomes-Gn; EBG00001165693.
DR   EnsemblGenomes-Gn; EBG00001165694.
DR   EnsemblGenomes-Gn; EBG00001165695.
DR   EnsemblGenomes-Gn; EBG00001165696.
DR   EnsemblGenomes-Gn; EBG00001165697.
DR   EnsemblGenomes-Gn; EBG00001165698.
DR   EnsemblGenomes-Gn; EBG00001165699.
DR   EnsemblGenomes-Gn; EBG00001165700.
DR   EnsemblGenomes-Gn; EBG00001165701.
DR   EnsemblGenomes-Gn; EBG00001165702.
DR   EnsemblGenomes-Gn; EBG00001165703.
DR   EnsemblGenomes-Gn; EBG00001165704.
DR   EnsemblGenomes-Gn; EBG00001165705.
DR   EnsemblGenomes-Gn; EBG00001165706.
DR   EnsemblGenomes-Gn; EBG00001165707.
DR   EnsemblGenomes-Gn; EBG00001165708.
DR   EnsemblGenomes-Gn; EBG00001165709.
DR   EnsemblGenomes-Gn; EBG00001165710.
DR   EnsemblGenomes-Gn; EBG00001165711.
DR   EnsemblGenomes-Gn; EBG00001165712.
DR   EnsemblGenomes-Gn; EBG00001165713.
DR   EnsemblGenomes-Gn; EBG00001165714.
DR   EnsemblGenomes-Gn; EBG00001165715.
DR   EnsemblGenomes-Gn; EBG00001165716.
DR   EnsemblGenomes-Gn; Lm4b_00014.
DR   EnsemblGenomes-Gn; Lm4b_00015.
DR   EnsemblGenomes-Gn; Lm4b_00035a.
DR   EnsemblGenomes-Gn; Lm4b_00035b.
DR   EnsemblGenomes-Gn; Lm4b_00080a.
DR   EnsemblGenomes-Gn; Lm4b_00080b.
DR   EnsemblGenomes-Gn; Lm4b_00150.
DR   EnsemblGenomes-Gn; Lm4b_00160.
DR   EnsemblGenomes-Gn; Lm4b_00161.
DR   EnsemblGenomes-Gn; Lm4b_00398a.
DR   EnsemblGenomes-Gn; Lm4b_00398b.
DR   EnsemblGenomes-Gn; Lm4b_00413a.
DR   EnsemblGenomes-Gn; Lm4b_00413b.
DR   EnsemblGenomes-Gn; Lm4b_00453.
DR   EnsemblGenomes-Gn; Lm4b_00456.
DR   EnsemblGenomes-Gn; Lm4b_00761.
DR   EnsemblGenomes-Gn; Lm4b_00923a.
DR   EnsemblGenomes-Gn; Lm4b_00923b.
DR   EnsemblGenomes-Gn; Lm4b_01126a.
DR   EnsemblGenomes-Gn; Lm4b_01126b.
DR   EnsemblGenomes-Gn; Lm4b_01138.
DR   EnsemblGenomes-Gn; Lm4b_02022a.
DR   EnsemblGenomes-Gn; Lm4b_02022b.
DR   EnsemblGenomes-Gn; Lm4b_02685.
DR   EnsemblGenomes-Gn; Lm4b_r00001.
DR   EnsemblGenomes-Gn; Lm4b_r00002.
DR   EnsemblGenomes-Gn; Lm4b_r00003.
DR   EnsemblGenomes-Gn; Lm4b_r00004.
DR   EnsemblGenomes-Gn; Lm4b_r00005.
DR   EnsemblGenomes-Gn; Lm4b_r00006.
DR   EnsemblGenomes-Gn; Lm4b_r00007.
DR   EnsemblGenomes-Gn; Lm4b_r00008.
DR   EnsemblGenomes-Gn; Lm4b_r00009.
DR   EnsemblGenomes-Gn; Lm4b_r00010.
DR   EnsemblGenomes-Gn; Lm4b_r00011.
DR   EnsemblGenomes-Gn; Lm4b_r00012.
DR   EnsemblGenomes-Gn; Lm4b_r00013.
DR   EnsemblGenomes-Gn; Lm4b_r00014.
DR   EnsemblGenomes-Gn; Lm4b_r00015.
DR   EnsemblGenomes-Gn; Lm4b_r00016.
DR   EnsemblGenomes-Gn; Lm4b_r00017.
DR   EnsemblGenomes-Gn; Lm4b_r00018.
DR   EnsemblGenomes-Gn; Lm4b_t00001.
DR   EnsemblGenomes-Gn; Lm4b_t00002.
DR   EnsemblGenomes-Gn; Lm4b_t00003.
DR   EnsemblGenomes-Gn; Lm4b_t00004.
DR   EnsemblGenomes-Gn; Lm4b_t00005.
DR   EnsemblGenomes-Gn; Lm4b_t00006.
DR   EnsemblGenomes-Gn; Lm4b_t00007.
DR   EnsemblGenomes-Gn; Lm4b_t00008.
DR   EnsemblGenomes-Gn; Lm4b_t00009.
DR   EnsemblGenomes-Gn; Lm4b_t00010.
DR   EnsemblGenomes-Gn; Lm4b_t00011.
DR   EnsemblGenomes-Gn; Lm4b_t00012.
DR   EnsemblGenomes-Gn; Lm4b_t00013.
DR   EnsemblGenomes-Gn; Lm4b_t00014.
DR   EnsemblGenomes-Gn; Lm4b_t00015.
DR   EnsemblGenomes-Gn; Lm4b_t00016.
DR   EnsemblGenomes-Gn; Lm4b_t00017.
DR   EnsemblGenomes-Gn; Lm4b_t00018.
DR   EnsemblGenomes-Gn; Lm4b_t00019.
DR   EnsemblGenomes-Gn; Lm4b_t00020.
DR   EnsemblGenomes-Gn; Lm4b_t00021.
DR   EnsemblGenomes-Gn; Lm4b_t00022.
DR   EnsemblGenomes-Gn; Lm4b_t00023.
DR   EnsemblGenomes-Gn; Lm4b_t00024.
DR   EnsemblGenomes-Gn; Lm4b_t00025.
DR   EnsemblGenomes-Gn; Lm4b_t00026.
DR   EnsemblGenomes-Gn; Lm4b_t00027.
DR   EnsemblGenomes-Gn; Lm4b_t00028.
DR   EnsemblGenomes-Gn; Lm4b_t00029.
DR   EnsemblGenomes-Gn; Lm4b_t00030.
DR   EnsemblGenomes-Gn; Lm4b_t00031.
DR   EnsemblGenomes-Gn; Lm4b_t00032.
DR   EnsemblGenomes-Gn; Lm4b_t00033.
DR   EnsemblGenomes-Gn; Lm4b_t00034.
DR   EnsemblGenomes-Gn; Lm4b_t00035.
DR   EnsemblGenomes-Gn; Lm4b_t00036.
DR   EnsemblGenomes-Gn; Lm4b_t00037.
DR   EnsemblGenomes-Gn; Lm4b_t00038.
DR   EnsemblGenomes-Gn; Lm4b_t00039.
DR   EnsemblGenomes-Gn; Lm4b_t00040.
DR   EnsemblGenomes-Gn; Lm4b_t00041.
DR   EnsemblGenomes-Gn; Lm4b_t00042.
DR   EnsemblGenomes-Gn; Lm4b_t00043.
DR   EnsemblGenomes-Gn; Lm4b_t00044.
DR   EnsemblGenomes-Gn; Lm4b_t00045.
DR   EnsemblGenomes-Gn; Lm4b_t00046.
DR   EnsemblGenomes-Gn; Lm4b_t00047.
DR   EnsemblGenomes-Gn; Lm4b_t00048.
DR   EnsemblGenomes-Gn; Lm4b_t00049.
DR   EnsemblGenomes-Gn; Lm4b_t00050.
DR   EnsemblGenomes-Gn; Lm4b_t00051.
DR   EnsemblGenomes-Gn; Lm4b_t00052.
DR   EnsemblGenomes-Gn; Lm4b_t00053.
DR   EnsemblGenomes-Gn; Lm4b_t00054.
DR   EnsemblGenomes-Gn; Lm4b_t00055.
DR   EnsemblGenomes-Gn; Lm4b_t00056.
DR   EnsemblGenomes-Gn; Lm4b_t00057.
DR   EnsemblGenomes-Gn; Lm4b_t00058.
DR   EnsemblGenomes-Gn; Lm4b_t00059.
DR   EnsemblGenomes-Gn; Lm4b_t00060.
DR   EnsemblGenomes-Gn; Lm4b_t00061.
DR   EnsemblGenomes-Gn; Lm4b_t00062.
DR   EnsemblGenomes-Gn; Lm4b_t00063.
DR   EnsemblGenomes-Gn; Lm4b_t00064.
DR   EnsemblGenomes-Gn; Lm4b_t00065.
DR   EnsemblGenomes-Gn; Lm4b_t00066.
DR   EnsemblGenomes-Gn; Lm4b_t00067.
DR   EnsemblGenomes-Tr; EBT00001732533.
DR   EnsemblGenomes-Tr; EBT00001732534.
DR   EnsemblGenomes-Tr; EBT00001732535.
DR   EnsemblGenomes-Tr; EBT00001732536.
DR   EnsemblGenomes-Tr; EBT00001732537.
DR   EnsemblGenomes-Tr; EBT00001732538.
DR   EnsemblGenomes-Tr; EBT00001732539.
DR   EnsemblGenomes-Tr; EBT00001732540.
DR   EnsemblGenomes-Tr; EBT00001732541.
DR   EnsemblGenomes-Tr; EBT00001732542.
DR   EnsemblGenomes-Tr; EBT00001732543.
DR   EnsemblGenomes-Tr; EBT00001732544.
DR   EnsemblGenomes-Tr; EBT00001732545.
DR   EnsemblGenomes-Tr; EBT00001732546.
DR   EnsemblGenomes-Tr; EBT00001732547.
DR   EnsemblGenomes-Tr; EBT00001732548.
DR   EnsemblGenomes-Tr; EBT00001732549.
DR   EnsemblGenomes-Tr; EBT00001732550.
DR   EnsemblGenomes-Tr; EBT00001732551.
DR   EnsemblGenomes-Tr; EBT00001732552.
DR   EnsemblGenomes-Tr; EBT00001732553.
DR   EnsemblGenomes-Tr; EBT00001732554.
DR   EnsemblGenomes-Tr; EBT00001732555.
DR   EnsemblGenomes-Tr; EBT00001732556.
DR   EnsemblGenomes-Tr; EBT00001732557.
DR   EnsemblGenomes-Tr; EBT00001732558.
DR   EnsemblGenomes-Tr; EBT00001732559.
DR   EnsemblGenomes-Tr; EBT00001732560.
DR   EnsemblGenomes-Tr; EBT00001732561.
DR   EnsemblGenomes-Tr; EBT00001732562.
DR   EnsemblGenomes-Tr; EBT00001732563.
DR   EnsemblGenomes-Tr; EBT00001732564.
DR   EnsemblGenomes-Tr; EBT00001732565.
DR   EnsemblGenomes-Tr; EBT00001732566.
DR   EnsemblGenomes-Tr; EBT00001732567.
DR   EnsemblGenomes-Tr; EBT00001732568.
DR   EnsemblGenomes-Tr; EBT00001732569.
DR   EnsemblGenomes-Tr; EBT00001732570.
DR   EnsemblGenomes-Tr; EBT00001732571.
DR   EnsemblGenomes-Tr; EBT00001732572.
DR   EnsemblGenomes-Tr; EBT00001732573.
DR   EnsemblGenomes-Tr; EBT00001732574.
DR   EnsemblGenomes-Tr; EBT00001732575.
DR   EnsemblGenomes-Tr; EBT00001732576.
DR   EnsemblGenomes-Tr; EBT00001732577.
DR   EnsemblGenomes-Tr; EBT00001732578.
DR   EnsemblGenomes-Tr; EBT00001732579.
DR   EnsemblGenomes-Tr; EBT00001732580.
DR   EnsemblGenomes-Tr; EBT00001732581.
DR   EnsemblGenomes-Tr; EBT00001732582.
DR   EnsemblGenomes-Tr; EBT00001732583.
DR   EnsemblGenomes-Tr; EBT00001732584.
DR   EnsemblGenomes-Tr; EBT00001732585.
DR   EnsemblGenomes-Tr; EBT00001732586.
DR   EnsemblGenomes-Tr; EBT00001732587.
DR   EnsemblGenomes-Tr; EBT00001732588.
DR   EnsemblGenomes-Tr; EBT00001732589.
DR   EnsemblGenomes-Tr; EBT00001732590.
DR   EnsemblGenomes-Tr; EBT00001732591.
DR   EnsemblGenomes-Tr; EBT00001732592.
DR   EnsemblGenomes-Tr; EBT00001732593.
DR   EnsemblGenomes-Tr; EBT00001732594.
DR   EnsemblGenomes-Tr; EBT00001732595.
DR   EnsemblGenomes-Tr; EBT00001732596.
DR   EnsemblGenomes-Tr; EBT00001732597.
DR   EnsemblGenomes-Tr; EBT00001732598.
DR   EnsemblGenomes-Tr; EBT00001732599.
DR   EnsemblGenomes-Tr; EBT00001732600.
DR   EnsemblGenomes-Tr; EBT00001732601.
DR   EnsemblGenomes-Tr; EBT00001732602.
DR   EnsemblGenomes-Tr; EBT00001732603.
DR   EnsemblGenomes-Tr; EBT00001732604.
DR   EnsemblGenomes-Tr; EBT00001732605.
DR   EnsemblGenomes-Tr; EBT00001732606.
DR   EnsemblGenomes-Tr; EBT00001732607.
DR   EnsemblGenomes-Tr; EBT00001732608.
DR   EnsemblGenomes-Tr; EBT00001732609.
DR   EnsemblGenomes-Tr; EBT00001732610.
DR   EnsemblGenomes-Tr; EBT00001732611.
DR   EnsemblGenomes-Tr; EBT00001732612.
DR   EnsemblGenomes-Tr; EBT00001732613.
DR   EnsemblGenomes-Tr; EBT00001732614.
DR   EnsemblGenomes-Tr; EBT00001732615.
DR   EnsemblGenomes-Tr; EBT00001732616.
DR   EnsemblGenomes-Tr; EBT00001732617.
DR   EnsemblGenomes-Tr; EBT00001732618.
DR   EnsemblGenomes-Tr; EBT00001732619.
DR   EnsemblGenomes-Tr; EBT00001732620.
DR   EnsemblGenomes-Tr; EBT00001732621.
DR   EnsemblGenomes-Tr; EBT00001732622.
DR   EnsemblGenomes-Tr; EBT00001732623.
DR   EnsemblGenomes-Tr; EBT00001732624.
DR   EnsemblGenomes-Tr; EBT00001732625.
DR   EnsemblGenomes-Tr; EBT00001732626.
DR   EnsemblGenomes-Tr; EBT00001732627.
DR   EnsemblGenomes-Tr; EBT00001732628.
DR   EnsemblGenomes-Tr; EBT00001732629.
DR   EnsemblGenomes-Tr; EBT00001732630.
DR   EnsemblGenomes-Tr; EBT00001732631.
DR   EnsemblGenomes-Tr; EBT00001732632.
DR   EnsemblGenomes-Tr; EBT00001732633.
DR   EnsemblGenomes-Tr; EBT00001732634.
DR   EnsemblGenomes-Tr; EBT00001732635.
DR   EnsemblGenomes-Tr; EBT00001732636.
DR   EnsemblGenomes-Tr; EBT00001732637.
DR   EnsemblGenomes-Tr; EBT00001732638.
DR   EnsemblGenomes-Tr; EBT00001732639.
DR   EnsemblGenomes-Tr; EBT00001732640.
DR   EnsemblGenomes-Tr; EBT00001732641.
DR   EnsemblGenomes-Tr; EBT00001732642.
DR   EnsemblGenomes-Tr; EBT00001732643.
DR   EnsemblGenomes-Tr; EBT00001732644.
DR   EnsemblGenomes-Tr; EBT00001732645.
DR   EnsemblGenomes-Tr; EBT00001732646.
DR   EnsemblGenomes-Tr; EBT00001732647.
DR   EnsemblGenomes-Tr; EBT00001732648.
DR   EnsemblGenomes-Tr; EBT00001732649.
DR   EnsemblGenomes-Tr; EBT00001732650.
DR   EnsemblGenomes-Tr; EBT00001732651.
DR   EnsemblGenomes-Tr; EBT00001732652.
DR   EnsemblGenomes-Tr; EBT00001732653.
DR   EnsemblGenomes-Tr; EBT00001732654.
DR   EnsemblGenomes-Tr; EBT00001732655.
DR   EnsemblGenomes-Tr; EBT00001732656.
DR   EnsemblGenomes-Tr; EBT00001732657.
DR   EnsemblGenomes-Tr; EBT00001732658.
DR   EnsemblGenomes-Tr; EBT00001732659.
DR   EnsemblGenomes-Tr; EBT00001732660.
DR   EnsemblGenomes-Tr; EBT00001732661.
DR   EnsemblGenomes-Tr; EBT00001732662.
DR   EnsemblGenomes-Tr; EBT00001732663.
DR   EnsemblGenomes-Tr; EBT00001732664.
DR   EnsemblGenomes-Tr; EBT00001732665.
DR   EnsemblGenomes-Tr; EBT00001732666.
DR   EnsemblGenomes-Tr; EBT00001732667.
DR   EnsemblGenomes-Tr; EBT00001732668.
DR   EnsemblGenomes-Tr; EBT00001732669.
DR   EnsemblGenomes-Tr; EBT00001732670.
DR   EnsemblGenomes-Tr; EBT00001732671.
DR   EnsemblGenomes-Tr; EBT00001732672.
DR   EnsemblGenomes-Tr; EBT00001732673.
DR   EnsemblGenomes-Tr; EBT00001732674.
DR   EnsemblGenomes-Tr; Lm4b_00014.
DR   EnsemblGenomes-Tr; Lm4b_00015.
DR   EnsemblGenomes-Tr; Lm4b_00035a.
DR   EnsemblGenomes-Tr; Lm4b_00035b.
DR   EnsemblGenomes-Tr; Lm4b_00080a.
DR   EnsemblGenomes-Tr; Lm4b_00080b.
DR   EnsemblGenomes-Tr; Lm4b_00150.
DR   EnsemblGenomes-Tr; Lm4b_00160.
DR   EnsemblGenomes-Tr; Lm4b_00161.
DR   EnsemblGenomes-Tr; Lm4b_00398a.
DR   EnsemblGenomes-Tr; Lm4b_00398b.
DR   EnsemblGenomes-Tr; Lm4b_00413a.
DR   EnsemblGenomes-Tr; Lm4b_00413b.
DR   EnsemblGenomes-Tr; Lm4b_00453.
DR   EnsemblGenomes-Tr; Lm4b_00456.
DR   EnsemblGenomes-Tr; Lm4b_00761.
DR   EnsemblGenomes-Tr; Lm4b_00923a.
DR   EnsemblGenomes-Tr; Lm4b_00923b.
DR   EnsemblGenomes-Tr; Lm4b_01126a.
DR   EnsemblGenomes-Tr; Lm4b_01126b.
DR   EnsemblGenomes-Tr; Lm4b_01138.
DR   EnsemblGenomes-Tr; Lm4b_02022a.
DR   EnsemblGenomes-Tr; Lm4b_02022b.
DR   EnsemblGenomes-Tr; Lm4b_02685.
DR   EnsemblGenomes-Tr; Lm4b_r00001-1.
DR   EnsemblGenomes-Tr; Lm4b_r00002-1.
DR   EnsemblGenomes-Tr; Lm4b_r00003-1.
DR   EnsemblGenomes-Tr; Lm4b_r00004-1.
DR   EnsemblGenomes-Tr; Lm4b_r00005-1.
DR   EnsemblGenomes-Tr; Lm4b_r00006-1.
DR   EnsemblGenomes-Tr; Lm4b_r00007-1.
DR   EnsemblGenomes-Tr; Lm4b_r00008-1.
DR   EnsemblGenomes-Tr; Lm4b_r00009-1.
DR   EnsemblGenomes-Tr; Lm4b_r00010-1.
DR   EnsemblGenomes-Tr; Lm4b_r00011-1.
DR   EnsemblGenomes-Tr; Lm4b_r00012-1.
DR   EnsemblGenomes-Tr; Lm4b_r00013-1.
DR   EnsemblGenomes-Tr; Lm4b_r00014-1.
DR   EnsemblGenomes-Tr; Lm4b_r00015-1.
DR   EnsemblGenomes-Tr; Lm4b_r00016-1.
DR   EnsemblGenomes-Tr; Lm4b_r00017-1.
DR   EnsemblGenomes-Tr; Lm4b_r00018-1.
DR   EnsemblGenomes-Tr; Lm4b_t00001-1.
DR   EnsemblGenomes-Tr; Lm4b_t00002-1.
DR   EnsemblGenomes-Tr; Lm4b_t00003-1.
DR   EnsemblGenomes-Tr; Lm4b_t00004-1.
DR   EnsemblGenomes-Tr; Lm4b_t00005-1.
DR   EnsemblGenomes-Tr; Lm4b_t00006-1.
DR   EnsemblGenomes-Tr; Lm4b_t00007-1.
DR   EnsemblGenomes-Tr; Lm4b_t00008-1.
DR   EnsemblGenomes-Tr; Lm4b_t00009-1.
DR   EnsemblGenomes-Tr; Lm4b_t00010-1.
DR   EnsemblGenomes-Tr; Lm4b_t00011-1.
DR   EnsemblGenomes-Tr; Lm4b_t00012-1.
DR   EnsemblGenomes-Tr; Lm4b_t00013-1.
DR   EnsemblGenomes-Tr; Lm4b_t00014-1.
DR   EnsemblGenomes-Tr; Lm4b_t00015-1.
DR   EnsemblGenomes-Tr; Lm4b_t00016-1.
DR   EnsemblGenomes-Tr; Lm4b_t00017-1.
DR   EnsemblGenomes-Tr; Lm4b_t00018-1.
DR   EnsemblGenomes-Tr; Lm4b_t00019-1.
DR   EnsemblGenomes-Tr; Lm4b_t00020-1.
DR   EnsemblGenomes-Tr; Lm4b_t00021-1.
DR   EnsemblGenomes-Tr; Lm4b_t00022-1.
DR   EnsemblGenomes-Tr; Lm4b_t00023-1.
DR   EnsemblGenomes-Tr; Lm4b_t00024-1.
DR   EnsemblGenomes-Tr; Lm4b_t00025-1.
DR   EnsemblGenomes-Tr; Lm4b_t00026-1.
DR   EnsemblGenomes-Tr; Lm4b_t00027-1.
DR   EnsemblGenomes-Tr; Lm4b_t00028-1.
DR   EnsemblGenomes-Tr; Lm4b_t00029-1.
DR   EnsemblGenomes-Tr; Lm4b_t00030-1.
DR   EnsemblGenomes-Tr; Lm4b_t00031-1.
DR   EnsemblGenomes-Tr; Lm4b_t00032-1.
DR   EnsemblGenomes-Tr; Lm4b_t00033-1.
DR   EnsemblGenomes-Tr; Lm4b_t00034-1.
DR   EnsemblGenomes-Tr; Lm4b_t00035-1.
DR   EnsemblGenomes-Tr; Lm4b_t00036-1.
DR   EnsemblGenomes-Tr; Lm4b_t00037-1.
DR   EnsemblGenomes-Tr; Lm4b_t00038-1.
DR   EnsemblGenomes-Tr; Lm4b_t00039-1.
DR   EnsemblGenomes-Tr; Lm4b_t00040-1.
DR   EnsemblGenomes-Tr; Lm4b_t00041-1.
DR   EnsemblGenomes-Tr; Lm4b_t00042-1.
DR   EnsemblGenomes-Tr; Lm4b_t00043-1.
DR   EnsemblGenomes-Tr; Lm4b_t00044-1.
DR   EnsemblGenomes-Tr; Lm4b_t00045-1.
DR   EnsemblGenomes-Tr; Lm4b_t00046-1.
DR   EnsemblGenomes-Tr; Lm4b_t00047-1.
DR   EnsemblGenomes-Tr; Lm4b_t00048-1.
DR   EnsemblGenomes-Tr; Lm4b_t00049-1.
DR   EnsemblGenomes-Tr; Lm4b_t00050-1.
DR   EnsemblGenomes-Tr; Lm4b_t00051-1.
DR   EnsemblGenomes-Tr; Lm4b_t00052-1.
DR   EnsemblGenomes-Tr; Lm4b_t00053-1.
DR   EnsemblGenomes-Tr; Lm4b_t00054-1.
DR   EnsemblGenomes-Tr; Lm4b_t00055-1.
DR   EnsemblGenomes-Tr; Lm4b_t00056-1.
DR   EnsemblGenomes-Tr; Lm4b_t00057-1.
DR   EnsemblGenomes-Tr; Lm4b_t00058-1.
DR   EnsemblGenomes-Tr; Lm4b_t00059-1.
DR   EnsemblGenomes-Tr; Lm4b_t00060-1.
DR   EnsemblGenomes-Tr; Lm4b_t00061-1.
DR   EnsemblGenomes-Tr; Lm4b_t00062-1.
DR   EnsemblGenomes-Tr; Lm4b_t00063-1.
DR   EnsemblGenomes-Tr; Lm4b_t00064-1.
DR   EnsemblGenomes-Tr; Lm4b_t00065-1.
DR   EnsemblGenomes-Tr; Lm4b_t00066-1.
DR   EnsemblGenomes-Tr; Lm4b_t00067-1.
DR   EuropePMC; PMC2996996; 20846431.
DR   EuropePMC; PMC3019230; 21126366.
DR   EuropePMC; PMC3464598; 22530965.
DR   EuropePMC; PMC4609684; 26311854.
DR   EuropePMC; PMC4973958; 27489951.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01461; rli24.
DR   RFAM; RF01462; rli26.
DR   RFAM; RF01463; rli27.
DR   RFAM; RF01464; rliA.
DR   RFAM; RF01465; rli31.
DR   RFAM; RF01466; rli34.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01469; rli33.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01473; rli41.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01476; rliF.
DR   RFAM; RF01477; rli43.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01480; rli52.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01484; rli59.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01488; rli49.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01493; rli37.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FM242711.
DR   SILVA-SSU; FM242711.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2912690
FT                   /organism="Listeria monocytogenes serotype 4b str. CLIP
FT                   80459"
FT                   /strain="Clip80459"
FT                   /serotype="4b"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:568819"
FT   regulatory      306..311
FT                   /gene="dnaA"
FT                   /locus_tag="Lm4b_00001"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        319..1674
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Lm4b_00001"
FT                   /product="Chromosomal replication initiation protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03790"
FT                   /db_xref="GOA:C1L2Z8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L2Z8"
FT                   /protein_id="CAS03790.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGVE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
FT   CDS_pept        1868..3013
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Lm4b_00002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00002"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03791"
FT                   /protein_id="CAS03791.1"
FT                   /translation="MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLT
FT                   GSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQT
FT                   NISSGQASFTLNGLDPMEYPKLPEVTDGKTIKIPINVLKNIVRQTVFAVSAIEVRPVLT
FT                   GVNWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKLLDDASESI
FT                   EMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLL
FT                   ARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALR
FT                   AFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITPVRTY"
FT   regulatory      3030..3051
FT                   /gene="dnaN"
FT                   /locus_tag="Lm4b_00002"
FT                   /regulatory_class="terminator"
FT   CDS_pept        3121..4464
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00003"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00003"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03792"
FT                   /protein_id="CAS03792.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDFDRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFAREFLL
FT                   LFVDSSETEVINIGVSYLLIVSLFYVVVGVLFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYIGLWWATPVAWITATMLGVWRYKSGAWQKKAVIRRK"
FT   CDS_pept        4644..4865
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00004"
FT                   /product="Putative S4-like RNA binding protein"
FT                   /note="Similar to B. subtilis YaaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00004"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03793"
FT                   /protein_id="CAS03793.1"
FT                   /translation="MAETVKINSEFVTLGQLLQMIDVVSTGGMAKAYLSENTIYINGEQ
FT                   DNRRGKKLRNGDVILVPGVGKVKIEQGK"
FT   CDS_pept        4869..5981
FT                   /transl_table=11
FT                   /gene="RecF"
FT                   /locus_tag="Lm4b_00005"
FT                   /product="RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00005"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03794"
FT                   /db_xref="GOA:C1L302"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L302"
FT                   /protein_id="CAS03794.1"
FT                   /translation="MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLM
FT                   LALAKSHRTTNDKDFIMWEKEEAKMEGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKL
FT                   SQYVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQMQPIYLHNLSEYQRILQQRNQY
FT                   LKMLQMKRKVDPILLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQISRGLETLK
FT                   IEYKASITLNGDDPEVWKADLLQKMESIKQREIDRGVTLIGPHRDDSLFYINGQNVQDF
FT                   GSQGQQRTTALSIKLAEIDLIHEETGEYPVLLLDDVLSELDDYRQSHLLGAIEGKVQTF
FT                   VTTTSTSGIDHETLKQATTFYVEKGTVKKS"
FT   CDS_pept        6030..7970
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Lm4b_00006"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00006"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03795"
FT                   /protein_id="CAS03795.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
FT   CDS_pept        8065..10593
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="Lm4b_00007"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00007"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03796"
FT                   /protein_id="CAS03796.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPDITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYHYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
FT   CDS_pept        10727..12241
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00008"
FT                   /product="Putative cardiolipin synthase"
FT                   /note="Similar to cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00008"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03797"
FT                   /protein_id="CAS03797.1"
FT                   /translation="MRKLIQFLFIAVVLFLVEYFLINQAAILFLVTSGLIQLCGLIIVI
FT                   RLLLFDQRNTSSKVAWIAVIFILPVLGTISYLVFGRNPATRKFSTAQVMEKAKLINAIH
FT                   AIPNNTNEKLPRLSKRIAHLTSIEPIKGNKIEILTNGEETFPVLLDALRKAENHIHIQY
FT                   YIFKTDEISTKIRDILVEKAKAGVEVRFMFDGLGSSKLGKAFLAPLKEAGVSIHAFDPI
FT                   TSPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHIKITGQAVI
FT                   ELQESFLNDWVYMENQAGAADQFISEAGLQQYFSPVDVGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNA
FT                   YVKTMIEAGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDES
FT                   EAMHHLKRDFEKDFEDSRLFTMKDMENKPLLTRIKEVLSSLLSPIL"
FT   CDS_pept        12257..12775
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00009"
FT                   /product="Putative spermidine N1-acetyltransferase"
FT                   /note="Similar to spermidine N1-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00009"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03798"
FT                   /protein_id="CAS03798.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNLHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYQEMDI"
FT   CDS_pept        12917..13885
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00010"
FT                   /product="Putative mevalonate kinase"
FT                   /note="Similar to mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03799"
FT                   /protein_id="CAS03799.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVENSTKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFSKKITFVVADTGVPSETRDAVKDVQALYKENQTEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIEVARSSGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKELHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
FT   CDS_pept        13842..14813
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00011"
FT                   /product="Putative mevalonate diphosphate decarboxylase"
FT                   /note="Similar to mevalonate diphosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03800"
FT                   /protein_id="CAS03800.1"
FT                   /translation="MKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTV
FT                   EWDGNLAQDTFILNNEHKTDAKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSAS
FT                   AFAALALAGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVP
FT                   FTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILD
FT                   EDFIKVGEITERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAG
FT                   PNVKVICERENENIVADKLSGLAKNVLICHAGKEASVVSDEK"
FT   regulatory      14782..14787
FT                   /locus_tag="Lm4b_00012"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14794..15873
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00012"
FT                   /product="Putative mevalonate kinase"
FT                   /note="Similar to mevalonate kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00012"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03801"
FT                   /protein_id="CAS03801.1"
FT                   /translation="MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLE
FT                   DSERNELWIPHYENPVSWPIGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVI
FT                   ETELIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSCG
FT                   DIASCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWTG
FT                   TPVSTGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSSIKENRRI
FT                   LQELGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNEW
FT                   EKLGIKHLPFHTGRVQITE"
FT   regulatory      15892..15923
FT                   /locus_tag="Lm4b_00012"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(16178..16837)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00013"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00013"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03802"
FT                   /protein_id="CAS03802.1"
FT                   /translation="MGNYVKISQDNKPIGWIDSENVIDEKTMDSIENDEESIIPEELID
FT                   KVNDYVTIENNEFVLSNKAEDVLTSEEFVEVEGQIDRTNAEIEADETLSETHIEGNIIV
FT                   QEIYEDEPNQLLKASKKAYIKAKYTWWGMQIQFSHKAVVDFNDFYWGAGTIGGLGANKR
FT                   MGKFLAKKGIKIASRYAVCLSLFGGGLAWGMGKKDKGKGVNLNCVLYVPATITTAK"
FT   CDS_pept        complement(16900..17475)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00014"
FT                   /product="Putative autolysin (amidase)"
FT                   /note="weakly similar to autolysin (amidase)"
FT                   /db_xref="PSEUDO:CAS03803.1"
FT   CDS_pept        complement(17494..17850)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00015"
FT                   /product="Putative autolysin (amidase)"
FT                   /note="weakly similar to autolysin (amidase)"
FT                   /db_xref="PSEUDO:CAS03804.1"
FT   regulatory      complement(17860..17865)
FT                   /locus_tag="Lm4b_00015"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        18300..19406
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="Lm4b_00016"
FT                   /product="Putative AA3-600 quinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00016"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03805"
FT                   /protein_id="CAS03805.1"
FT                   /translation="MSKVLKSLLLTALLGVTGLISGCGDLTVLNPKGPVAKGQSDLIIY
FT                   SIIFMLVIVLTIFVLFTIMLVKYRERKDISNYEPDMHGSKKLEIFWTLIPVAIVIALAI
FT                   PTVKTIYAGEEAPKVTSHKDPIVIYATSADWKWIFSYPDESIETVNYVNIPTDRPVLFK
FT                   LTSADTMTSFWVPQLGGQKYAMSGMTMNLYLQADEVGTYKGRNANFNGEGFADQRFDVV
FT                   AQSEKDFKKWAKETKASSPVITQDIYDRLLIPGSSKKKTYSGTHLAFVDVAADPEYVFY
FT                   AYKRFGYEMTNPHNPNTKSTISDEPMLPVRPVTVTNPQFERHDMKPQIIKNGEGYHEDK
FT                   HREDEMKKMEEDIQTNEFNKKESDDAGK"
FT   CDS_pept        19425..21404
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="Lm4b_00017"
FT                   /product="Putative AA3-600 quinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00017"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03806"
FT                   /protein_id="CAS03806.1"
FT                   /translation="MKWNEFIVTGDPMILGAQISIVLVSIGVVALLTYTKKWKWLMKEW
FT                   ISSVDHKKIGIMYLLAAVLMFFRGGVDALMMRTQLALPDMKFLDAQHYNEVFSTHGTIM
FT                   ILFMAMPFIIGLMNIAVPLQIGARDVAFPFLNNLSFWTFFMGAMLFNLSFVIGGSPDAG
FT                   WTNYAPLATDFSAGYGINFYLLGVQIAGIGTLMTGINFFVTILRMRTKGMTLMKMPMFT
FT                   WSSLITSLIIIFAFPVLTVALALMSFDRLFGTAFFTLTNGGLPMMWANLFWVWGHPEVY
FT                   IVILPAFGIFSEIISTFSRKKLFGYPAMVAAMAVISLLSFLVWVHHFFTMGSGALVNSF
FT                   FSITTMMIAIPTGIKIFNWLFTMYKGRITFTTPMLWSLAFIPNFVVGGVTGVMLAMAAA
FT                   DYQYHNTYFLVSHFHYVLIAGTVFSCFAGLTYWYPKMVGYRLNEKIGKWFFWIFVVGFN
FT                   VCFFPQYFLGLDGMPRRIYTYVQGDGWTTLNFISTVGGFLMGVAFLVLCYNIYYSYKNS
FT                   KREVTGDPWDARTLEWATSSAVPPKYNFAVLPEWNDLDDFWNRKQKGDPYVNDKNYKPI
FT                   HMPSNTMVGFVMSVFFFIAGFGLVFYWYWMGIIGLVGILGCMIYRSFQNNDGYHVEVDE
FT                   IKATEEHNARELATGVKEGNPWNL"
FT   CDS_pept        21392..22003
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="Lm4b_00018"
FT                   /product="Putative AA3-600 quinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03807"
FT                   /protein_id="CAS03807.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
FT   CDS_pept        22005..22337
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="Lm4b_00019"
FT                   /product="Putative quinol oxidase aa3-600 chain IV"
FT                   /note="Highly similar to quinol oxidase aa3-600 chain IV"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00019"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03808"
FT                   /protein_id="CAS03808.1"
FT                   /translation="MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYSTLTT
FT                   NVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIG
FT                   HMNHLL"
FT   regulatory      22344..22382
FT                   /gene="qoxD"
FT                   /locus_tag="Lm4b_00019"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(22344..22382)
FT                   /locus_tag="Lm4b_00020"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(22388..23506)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00020"
FT                   /product="Putative Bacillus anthracis CapA protein
FT                   (polyglutamate capsule biosynthesis)"
FT                   /note="Similar to Bacillus anthracis CapA protein
FT                   (polyglutamate capsule biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03809"
FT                   /protein_id="CAS03809.1"
FT                   /translation="MKSRKKGIILVLSIIIIFSIGLLVNNIMTNNKDTAKPKKKTVAAV
FT                   KKKKETPPKPKEPFNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLE
FT                   TAITTRTKKVPYQEFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRA
FT                   NNLAYVGAGKNEDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINL
FT                   VEEKIKEERAKNKDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHW
FT                   LQSFEVYKDVPIAYSLGNFLFPDYVSGHSAETGIYKLNFNQGKVTAHFDPGIISGNQIN
FT                   MLDGSAKTAQLNYLQSISPNATINSNGDISAK"
FT   CDS_pept        23732..25165
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00021"
FT                   /product="Putative beta-glucosidase"
FT                   /note="Similar to beta-glucosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03810"
FT                   /protein_id="CAS03810.1"
FT                   /translation="MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGR
FT                   WEALFNPAKALATDYGFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGD
FT                   ETTPNEKGLAFYDAVFDECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFC
FT                   EAIFTRYKDKVKYWMTFNEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALA
FT                   TKLGHEINPENQIGCMLAAGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTK
FT                   RFFKEHNINIKMEDGDLDALRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNP
FT                   YLKASEWGWQIDPLGLRITMNTIYDRYQKPLFIVENGLGAVDTVAEDGSITDDYRIDYM
FT                   REHVREMGEAIEDGVELLGYTPWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSK
FT                   KKSFDWYKKVIETNGKDID"
FT   regulatory      25177..25204
FT                   /locus_tag="Lm4b_00021"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(25177..25204)
FT                   /locus_tag="Lm4b_00022"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(25212..26033)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00022"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00022"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03811"
FT                   /protein_id="CAS03811.1"
FT                   /translation="MGNSFSKWGKWILVLGLMFSVFSVSTAGQAAAKETVINKQMVTTA
FT                   SLNVRSTNSTSGKVIGWLKSNTKFKAIAKTSNNWYRFSFKGKNGYVSGKYVKAATAAPA
FT                   PKPSTPKIVQMNVPLIVQRPQLPTGCEITNIAMMLRYAGKNVDKVKLAKEMKRHKSNPN
FT                   YGFVGNPFSKSGWTIYPPALVNQVKKYTGSAKNMTGTNLAGIKNQLNKKRPVVAWVSNF
FT                   HGFSVHAITITGYDKNNFYYNDSWSGQKNARISQSYFNTCWSKQAKRSISY"
FT   CDS_pept        26274..27014
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00023"
FT                   /product="Putative transcriptional regulator (GntR family)"
FT                   /note="Similar to transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00023"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03812"
FT                   /protein_id="CAS03812.1"
FT                   /translation="MAEPKYAIIINDIKRLISDGTFKPGEKIYSEDELKKKYNVSNTTV
FT                   VRALHELVRAGILARYQGKGTYVSKSIINEEVIFNEYTTVPNGRFNRKTKITNEHTKVV
FT                   AINEIQDARIAKKLQIPPENMIVHFQRIRLIDDVPWTVQNNYMAKSNLINVDLTNFERF
FT                   NSLSEVIKELYGINILHEAMKERIEVEFPVKDKNNFKLLEIDSELPLYHIERITYVPEG
FT                   QPYEYIESYLRHNFYSIEIEKKKQ"
FT   CDS_pept        27030..27431
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00024"
FT                   /product="Putative PTS system, fructose-specific IIA
FT                   component"
FT                   /note="Similar to PTS system, fructose-specific IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00024"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03813"
FT                   /protein_id="CAS03813.1"
FT                   /translation="MNFIIAAHGRYAQEVKNSCQMITGQTTNISAITFTEEMGVTDVLD
FT                   AYTAVYSPGNETAIIVDIVGGTPCNAAQMFSTKHPEVKVVSGLSLGLLIPLSLGESLEE
FT                   AMLGAKENIQFVEQKASYTIVSDDGEEED"
FT   CDS_pept        27431..27919
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00025"
FT                   /product="Putative PTS system, fructose-specific IIB
FT                   component"
FT                   /note="Similar to PTS system, fructose-specific IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00025"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03814"
FT                   /protein_id="CAS03814.1"
FT                   /translation="MGSNGIKHVRVDERLIHGQVATMWTNTIKATRIMIVDDAVVKNEM
FT                   EKVALKTAVPAGVKLSILTVKGAANNINNDKYAGQQVFLIVKSPHALRGLVDAGVELPQ
FT                   INVGNMSTKAGSRQIKKSVSVTDENLEDFDYLSQKGIKITAQMVPSEDAVEFASLLKK"
FT   CDS_pept        27942..28745
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00026"
FT                   /product="Putative PTS system, fructose-specific IIC
FT                   component"
FT                   /note="Similar to PTS system, fructose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00026"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03815"
FT                   /protein_id="CAS03815.1"
FT                   /translation="MDLAVWQIILLVILAACTILDALTLVIGLNFPVITGTLAGIIMGD
FT                   MVLGLAIGATLQLMVLGVGTYGGASIPDFTTGAIVGTVFAVLSGQDAEFAIGLAIPVGL
FT                   LMVQLDILARFTNTFFLHRIDSNIASGNISAVKRNIWYGALPWALSRAVPVFIMLTFGQ
FT                   SVVDFILNEIPEWLMGGLRVAGGILPVVGIAILLRYLPTNKFVAYLIIGFVAAAYLKVP
FT                   MLGVALIGVALAIIYFKQNFKNPVAAGANGAALVGEENEDGEYED"
FT   regulatory      28711..28716
FT                   /locus_tag="Lm4b_00027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28726..29547
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00027"
FT                   /product="Putative PTS system, mannose-specific IID
FT                   component"
FT                   /note="Similar to PTS system, mannose-specific IID
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00027"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03816"
FT                   /protein_id="CAS03816.1"
FT                   /translation="MANTKTEQDFEKVLKRRDLIAANFRWLFASQICWNYERMMSTGYL
FT                   YSILPTLRKLYKTDDDLKDMMNMHNQFFNTNPMVGGLILGMDMAIEEREKKASKEVVTG
FT                   LKTGLMGPFAGVGDTIFGVILPTIFGSIAAYMGLQGNVTGVVIWVLVNILVVGARFTLL
FT                   PLGYKQGAKLVTEFADRLNALTDAAILLGVTVVGALIPTVIKATVPFVYKSGKVELKMQ
FT                   DMLDQIMPSLVPVLLVALIYALLGHKKMTSTKAILLVMVIAIILFNLKILG"
FT   CDS_pept        29575..30279
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00028"
FT                   /product="Putative phosphoheptose isomerase (hypothetical)"
FT                   /note="Similar to phosphoheptose isomerase (hypothetical)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00028"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03817"
FT                   /protein_id="CAS03817.1"
FT                   /translation="MGLTFFDKARELTEELEKTQAESIHQAAKLVADSIMNDGIIQAFG
FT                   SGHSYAAAIEVCGRAGGLIPSKVIMDPAGGYYESIEGVGSLLTHRLQAKPNDIFFLISN
FT                   SGRNPMGIELAEWIKSQGCKLIVVTALDASQTAASRHSSGKLLYEFADVILDNRSVQGD
FT                   AALELDGLEGKVCGTSSFSAVLLLQQTIYEAVELMLEKGYTPPVYRSANIDGGYEYNFA
FT                   IEDKFADRIFHF"
FT   regulatory      30289..30315
FT                   /locus_tag="Lm4b_00028"
FT                   /regulatory_class="terminator"
FT   CDS_pept        30334..30975
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00029"
FT                   /product="Putative copper homeostasis protein CutC"
FT                   /note="Similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00029"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03818"
FT                   /protein_id="CAS03818.1"
FT                   /translation="MILKEACIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGIAKH
FT                   VVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGLL
FT                   DKPAIIELLKATAGLEVTFHMAFDELVDSEKLPAIDWLAEQDVTRILTHGGDGAKLPEE
FT                   TFLQWRKYIDYAAGRIIILPGGGIKSHNMEWITKETGAAEIHGTDLFGER"
FT   CDS_pept        31180..33084
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00030"
FT                   /product="Putative PTS system, beta-glucosides specific
FT                   enzyme IIABC"
FT                   /note="Similar to PTS system, beta-glucosides specific
FT                   enzyme IIABC"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03819"
FT                   /protein_id="CAS03819.1"
FT                   /translation="MKYEQLAKDILKNVGGKENINSVFHCITRLRFKLKDENIANTKEI
FT                   EKLDGVISVIKSGGQYQVVIGNHVPDVFKAVLEVGGISAEGDEGSSAPATGNIFNRFID
FT                   MISGVFTPVLGVLAATGMIKGFTAMFVAFGWITVTSGTYQLLYAIGDCLFYFFPIFLGY
FT                   TAMKKFGGNIFIGMAIGGALVYPTLAGITAGDPLYTLFAGTIFESPIHVTFLGIPVILM
FT                   SYASSVIPIIVATYFGSKVEKGFKKIIPDVIKTFVVPFCTLLIVVPITFIVIGPIATWA
FT                   GQLLGAGTIWVYNLSPIIAGLILGGFWQVFVIFGLHWGLVPVAINNLTVLGHDPILAMT
FT                   FGASFAQIGAVLAVFFKSRNKKIKSLSIPAFISGIFGVTEPAIYGVTLPLKKPFIMSCI
FT                   AGGIGGGIIGFAGSQTYIMGGLGIFGLPNFFKPGSGISGEFWWVVIAIVISFILGFILT
FT                   YVVGFKDPADVVVEQSNTVEGETLIERETIPAPVVGEIVTLADVKDEAFSSGALGKGVA
FT                   IIPTVGRVVAPAAGTVTTIFPTGHAIGITTKDGAEVLIHIGMDTVQLEGKFFTAHVKQG
FT                   DVIEKGQLLTEFDIEGIKAAGYDVTTPVVVTNSNQYLDVMITDAKEAKLEERLITLVI"
FT   regulatory      33099..33126
FT                   /locus_tag="Lm4b_00030"
FT                   /regulatory_class="terminator"
FT   regulatory      33153..33158
FT                   /locus_tag="Lm4b_00031"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33166..34041
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00031"
FT                   /product="Putative microcin C7 self-immunity protein
FT                   (MccF)"
FT                   /note="Similar to E. coli microcin C7 self-immunity protein
FT                   (MccF)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03820"
FT                   /protein_id="CAS03820.1"
FT                   /translation="MLAKGDLIGIICCSDGRKKEDEKDLKRLKQVLEKEFGLQVVFAKT
FT                   IFQIDDSPFNGTPEERAAELMKLYQNMDVKMIFDISGGDAANQVLPYLNFNIIKKAAKP
FT                   FIGYSDLTVILNAIFAKTKQPGFNYLLRNLVGEASEIQRVQFQKTFFENQIAINGKSLN
FT                   EFEWSLGEIVGGNIRCFLKLAGTEFMPDVSNKIILLESLGGKEAKIASYVAQLEQLGVF
FT                   SKCLGIVVGEHTEAEKNGEYDRIGILYQQIGLKYKLPVFRTKEIGHSSEAKPCLIGTKV
FT                   NVSRETLTNF"
FT   regulatory      34065..34084
FT                   /locus_tag="Lm4b_00031"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(34190..34810)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00032"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00032"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03821"
FT                   /protein_id="CAS03821.1"
FT                   /translation="MTKTKFVIFIALTVITLLLFLVPKGIQYLKSQNPELLNTAESIKL
FT                   QAGEYTVGKDIKVGIYDMQVTKGSLSYYSTRLSKGDEIIGINLLDANKLYFEGSGEVEL
FT                   TPAEFNPIKPSANIFTIQHSGSYEVGKQIPAGKYSLTYTIDKSSKKKPFIQILPSYTDD
FT                   ARIEIQFETKPAYNINLKTGEILTVSKTISEELDTMTVLLKKN"
FT   regulatory      complement(34792..34796)
FT                   /locus_tag="Lm4b_00032"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(34803..35387)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00033"
FT                   /product="Putative ABC transporter (ATP-binding protein)"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00033"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03822"
FT                   /protein_id="CAS03822.1"
FT                   /translation="MLTNINYSFEPGKIYGVFGKNGSGKTMLLRSLAGLIIPTSGKIFI
FT                   DNKELHHDISFPPSMGIIIENMELLPQFDARTNLKILSKIKNIASDEDIDNAIDRVGLS
FT                   PHIDKKVKKYSLGMKQRLNIAQAVFEKPAVILLDEPTNAIDDQGIELINQLLLEEKKRG
FT                   ATIIIASHHKEDIEPLCDMSIRMDQGKIIHD"
FT   regulatory      complement(35394..35399)
FT                   /locus_tag="Lm4b_00033"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(35447..36169)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00034"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00034"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03823"
FT                   /protein_id="CAS03823.1"
FT                   /translation="MKNNKLIILVVICLFLQAILFMAFDFPFKTLPILDGFPVGLATPV
FT                   VTRLLLYWYLPIIAFSFYISGNLKDLLSSYGFLQISRNYKKEYWLMKQFLKLLIKVILF
FT                   TSLQLALIFIFTPYSIYSTAPFLYLILGYSIMLFTIFSLQYLLELFIDAQKALLLINGY
FT                   VIISILMADLIYQNTTVTWPYYLLLPNYGMGFRTGLIPFTNTSTLLISVPTSLIILLVV
FT                   LLCVFIVAIKKFKTTDIL"
FT   CDS_pept        complement(36171..36494)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00035b"
FT                   /product="Putative ABC transporter (permease)"
FT                   /note="Weakly similar to ABC transporter (permease)"
FT   regulatory      complement(36179..36184)
FT                   /locus_tag="Lm4b_00034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(36452..36883)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00035a"
FT                   /product="Putative ABC transporter (permease)"
FT                   /note="weakly similar to ABC transporter (permease)"
FT                   /db_xref="PSEUDO:CAS03825.1"
FT   CDS_pept        complement(36870..37634)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00036"
FT                   /product="Putative yybM protein-Bacillus subtilis"
FT                   /function="similar to yybM protein - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00036"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03826"
FT                   /protein_id="CAS03826.1"
FT                   /translation="MKNQFTYLINNKTTQGMFILILFIPCIEIVQLYIMLKPDAVNIHP
FT                   AFAFFLAGSSRGHITQILLLWFLTVLSLLLGADSPIQEYQTGVRNIIINKIGKKAYILQ
FT                   KLAVSFILCFITMLTTLLLNFILVSIVFLGGTYKMGLNGLGSLNTLFDFSIQNPYLADF
FT                   GFGFMACLMAGMAGLIATSSSLFFLNKKFAYPAAFFIWFLMILPNNSIMFIFQPFTEYG
FT                   FEIILPIFLVFSLIVLIIVGVLYLYEVKYVKE"
FT   regulatory      complement(36890..36895)
FT                   /locus_tag="Lm4b_00035a"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(37642..37647)
FT                   /locus_tag="Lm4b_00036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(37705..38154)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00037"
FT                   /product="Putative yybN protein-Bacillus subtilis"
FT                   /note="similar to yybN protein - Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00037"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03827"
FT                   /protein_id="CAS03827.1"
FT                   /translation="MIIIKNFASKNIRLIMALVIGVLVFAPVFHSKAADNNIGFDFKLK
FT                   PNCANSGSSSRYRETSSVNNPWKVRLDNSTEGKGTIASFWLGTYNKNKNAVQGSTIMNV
FT                   KQGAKTRYCGAYKVANKNTTYLAAENNNYNSKTYYVDGIWDEETW"
FT   regulatory      complement(38157..38162)
FT                   /locus_tag="Lm4b_00037"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        38376..38714
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00038"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00038"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03828"
FT                   /protein_id="CAS03828.1"
FT                   /translation="MKVEGLLGFLGAALGIGFSLMVLVIPDISQALEEESFFFYMLTIG
FT                   SLVLSGVGLAGSFIVSHKPRLGGAMMVAAAIGCTMSISIMFLLPIVLLAVGGLIALINY
FT                   EEAASVEE"
FT   regulatory      38725..38742
FT                   /locus_tag="Lm4b_00038"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(38725..38742)
FT                   /locus_tag="Lm4b_00039"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(38751..39560)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00039"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00039"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03829"
FT                   /protein_id="CAS03829.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFANLVHPKADVIASNGGVVAVSGEIILQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVYYTKNPPYYFTDEEDKGRVNATKLVPIKTKESFLEHADQFINGIVIEEEDFDK
FT                   LAALRSELEKLSDVSILSSHANNIEILPKDMDKKYAVKNLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTTANDADGIYYFLKKYLNR"
FT   CDS_pept        complement(39577..40632)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00040"
FT                   /product="Putative transcriptional regulator (LacI family)"
FT                   /note="Similar to transcriptional regulator (LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03830"
FT                   /protein_id="CAS03830.1"
FT                   /translation="MKKITIQEIAKLSGVSVSTVSRVLNNSPSVSAAKRKKIQAIIDEH
FT                   NYTPSVFARGMVNKQTKNIGVILPDISNPYFISLITQIQKFALDYMFSTILFNTMLAEP
FT                   NNKNNQHPLTEEDYLKIILEKQVDGLLILGGEIDKEIVPKEYITALNQLNNEIPVVVIG
FT                   SKIPELNCLFIERNLKKGVTTLVSHLTALGHKNIGFIGGEAGVKITTYRLESFKEAMTS
FT                   YQHPVNDDWVVLSDYYTADGYAAMTQLLENSATLPTALVAINDNVAIGAIRAINDAKLS
FT                   CPEDIAIVSCDQFMNGDYQTPRLTSMDQHNEYLGKMAILQLISAINGQVEPMIINHNPE
FT                   LIIRESCGSKL"
FT   CDS_pept        40834..41799
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00041"
FT                   /product="Putative xylose repressor and to glucokinase"
FT                   /note="Similar to xylose repressor and to glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03831"
FT                   /protein_id="CAS03831.1"
FT                   /translation="MDIQESVIGIDLGGTKILIGEVTKDGEVLNSKSYPSNTENQTKAT
FT                   ETLLKVLDDYTQNIGFIAPKQTGIGVGLVGRVNHKSGVWLEIEPGKSNPTPLADILEAK
FT                   TGLPVSLGNDVVCATMAEKQFGWGQETNDFIYLNVGTGLAAGFVVDGRIIQGGHFNAGE
FT                   IGHAVVDIHSDVLCGCGRRGCVERLASGLGIKEEALRRLNNYPTSILAEAETELTGKMV
FT                   LHAAEQKDELAEEIIDNATFQLANLIMNLVRTTDPECVILGGGVTQNEHFFQKILGNLQ
FT                   SNTIRFVTKGVVRSKLEKDKVGLIGAAVIGMRLGNEGGKE"
FT   CDS_pept        41796..44198
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00042"
FT                   /product="Putative endoglucanase"
FT                   /note="weakly similar to endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00042"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03832"
FT                   /protein_id="CAS03832.1"
FT                   /translation="MKPSMKRQIAQTGIIHRPLPIETKHALETLAKKKQVLSSRTLFSS
FT                   KQHVSLEFAHQGAGDFTISDQDEIKLSSPVVMPHWPAGAPDDGDYTNFGNVTISAPIEN
FT                   EDWSGFNRVRIQVFPDFPGVTNPYLMISFKNDGSVKVPDIYGREGVHGVNLINHEWNDV
FT                   IFEIEGLPRDRMTEMSFSYYLNGPERLTAGTMELFINEIKLEQISEPEISKGWIPQDNT
FT                   LVYSHNGYSKGMPKVAFCANKFAATSFTIHDKETDKVVFTGKSYQNATETGDFIILDFS
FT                   DLQTVGEYYLKFADMQTEIFQIGTSEVIWESSIWKSLNFIFCERCGCPVFGKHTTCHAD
FT                   IIAEHDGKQLSFNGGWHDAGDVSQQLIQTAEVTMALYEMASSLPEKEEMLRMRLLEEGE
FT                   WGLDFILKTRFGDGFRATSAGMTRWTDGLVGGMDDAIARVHNQAYENFYCAGIEAYIGS
FT                   QIADNATMQNHLLRIAEEDLLFAIKELEKHGTSQKPIFWEHTYQTSESLYYATASWAAS
FT                   MVYQLTNKEIYAEKAAEWLYLMLEAQEKAGIRDSETSELYKGFFYRDKTHKVIQHFNHQ
FT                   AREHLYLLALEAALETQPSNAEKQTWLQAVEMYGDYLKKVTRFTKPYPLIPAGLYKKDE
FT                   YLDEASFHLQHLLIDERAIEEYQLQFEQGIQINDEIALRKFPIWFSFRGNNAILLSAGK
FT                   AASIAGKILKDKSLLDIAEGQLQWVIGMNPFGQSMMHGEGYRYAQQYSVLNGEITGEIP
FT                   VGMETFRNEDEPYWPEFNNATYKEVWVGNAGKWMSIVADLNKITGKS"
FT   CDS_pept        44211..45569
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00043"
FT                   /product="Putative PTS system, cellobiose-specific IIC
FT                   component"
FT                   /note="Similar to PTS system, cellobiose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00043"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03833"
FT                   /protein_id="CAS03833.1"
FT                   /translation="MSSERSLSSRFIEGLSIFAQKISSQKHIMAIRDGFAAMIPITIIA
FT                   AFFLLVNNVLLQPENGLLKFIPNVENYLGVGIQVYNATLGIMAILAAFLIGNFLAKSYG
FT                   MEGRTEGVIAVAAYVVLIPASSHLMSVDGKAFEAGGVLTQEMTSSTGMFLAIIAALVSV
FT                   TMLAKFSKSKKLKISMPESVPPAIAKSFNILIPSFLVLSILAIIEVLVVSFVSMSIPEI
FT                   IVKVLQIPLVGGFQTLPGILLYVFLAGFLWVFGIHGAFVLGAISGPVLLTSLQQNIDAV
FT                   NAGTALPNIVTQPFLDAFVYMGGGGTIICLVIAIFIASKRPDHRMVTKFGLIPSIFNVS
FT                   EPLMFGLPVVFNPIYGIPLVIAPLASTAMAYFATSWGWISQTYILIPWVTPPVLSGYLA
FT                   TGGDIRASILQIAIIIVGTLIYLPFVLVANRAYVLEQKAAGKVEAETVTNGEV"
FT   CDS_pept        45571..46656
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00044"
FT                   /product="Putative Glucosamine--fructose-6-phosphate
FT                   aminotransferase (C-terminal domain)"
FT                   /note="Similar to Glucosamine--fructose-6-phosphate
FT                   aminotransferase (C-terminal domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00044"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03834"
FT                   /protein_id="CAS03834.1"
FT                   /translation="MKPTMMTYINEEEEMCRVILADFQTNAEKLESLVKNGAKEWLILA
FT                   TGSSLNAAQSAKYYIENLADVRITIEEPFNHLYYEKLSSHLDLVIGISQSGQSTSTISA
FT                   LERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLTGL
FT                   HFAYKTVQIDETRFNNEISAFSRAIDAIPATIAETEAFYERWQEEFATAPKFTAIGYGP
FT                   TVGTCKEFETKFSETVRVPSQGLDLEAFMHGPYLEVNPQHRIFFLETASAVTERLVLLR
FT                   DYESKYTPFTYTVKFGKGEDDRTLVIPTDLDEYQAPFLMILPFQILAHHIAELKGNKLT
FT                   ERIYTDFGVAMKSKTKPGDYA"
FT   regulatory      46669..46702
FT                   /locus_tag="Lm4b_00044"
FT                   /regulatory_class="terminator"
FT   CDS_pept        46888..47913
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00045"
FT                   /product="Putative ornithine carbamoyltransferase"
FT                   /note="Similar to ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00045"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03835"
FT                   /db_xref="GOA:C1KV77"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024903"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV77"
FT                   /protein_id="CAS03835.1"
FT                   /translation="MNKKRDFIDTKDFSKEEILFMIEIGRKMKESIKNGHYPQLLKHKT
FT                   LGMIFEQSSTRTRVSFETAMTQLGGHAQYLAPGQIQLGGHESVGDTAKVLSRLVDILMA
FT                   RVERHQTVVELANTAAIPVINGMSDYNHPTQELGDAITMFEHLPKGKKIEDCKIVFVGD
FT                   ATQVCASTMFMATKLGMDFVQFGPKGFQLREEHLKIAEENCKVSGGSYLITEDVDIALK
FT                   DADFIYTDVWYGLYEAELSEEERMKTFYPKYQVNKELISKAAPHVKFMHCLPATRGEEV
FT                   TDEVLDAPYSVVIDEAENRLTAMRALLVYFMNPYVREAGFAVAEKYDAELELLLRNGAG
FT                   L"
FT   regulatory      47970..47975
FT                   /locus_tag="Lm4b_00046"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        47986..49371
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00046"
FT                   /product="Putative amino acid transporter"
FT                   /note="Similar to amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00046"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03836"
FT                   /protein_id="CAS03836.1"
FT                   /translation="MEKKKKFRLFDAVLMAVCVVLVVESAAPAAAIGSSQFFWWIALLI
FT                   LFFLPYGLVSAELGTTYDDEGGIYDWVKRAFGRKWGARVAWLYWINYPIWMASLAVLFV
FT                   EVITQIFPVSFGTPVSILIQLIFVWIVVIISCYPVSDSKWILNIAAFCKVAIMLCLGVL
FT                   GIYFAMTKGLANDFSGKALLPTFDLESLSFISVILFNFLGFEVVTTLASDMENPKKQIP
FT                   QAIIYGGVLIAFFYLLAAFGMGAAIPTSELSTSGGLIDSFIMLIGGVNPFVIIIGIMFM
FT                   YTLVANLVSWALGVNYVAMYAAKNKDLPAVFGKTNPKNDMPTGTSILNGIVASVLIVAA
FT                   PLIPNENIFWAFFALNVVALLGSYILMFPAFLKLRKVDPDRERPFKVPGGKILLYLMTF
FT                   VPMILLIITLIFSAVPLNGSSAELNEKIPILIGTVVAVIVGEICIWLAGKRKDKGEIGN
FT                   END"
FT   regulatory      49344..49349
FT                   /locus_tag="Lm4b_00047"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49358..50452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00047"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00047"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03837"
FT                   /protein_id="CAS03837.1"
FT                   /translation="MRTIDSSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQK
FT                   AFVDVATAISRFEPVTVVASSSQYVNARYMLPDEIRVVEMDNDDAWVRDSGPTFVVNDS
FT                   GDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLADFVLEGGSIHVDG
FT                   EGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFN
FT                   YVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEES
FT                   KGVDAVEGTLPREEGDRLAASYINYYTANGGVVFPLFGDPNDELAREKLRQLYPNCEVV
FT                   GVKAREILLGGGNIHCITQQVPRG"
FT   regulatory      50443..50448
FT                   /locus_tag="Lm4b_00048"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50456..51406
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00048"
FT                   /product="Putative carbamate kinase"
FT                   /note="Similar to carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00048"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03838"
FT                   /protein_id="CAS03838.1"
FT                   /translation="MNSMNQKIVVALGGNAILSSDASAEAQQSALEKTAEYLVQFIENG
FT                   DDLIISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKH
FT                   GLDKVAVSLITQVVVDKDDPAFKKPTKPIGPFLTKEEAEKEMAETGAIFLEDAGRGYRK
FT                   VVPSPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKL
FT                   AELISADLLVILTGVENVYINYNQPNQKKLERVTVSELEKYIDEKQFAAGSMLPKIEAA
FT                   TAFVKERPNAKAIITSLENIGAMLEHGAGTVIIAG"
FT   regulatory      51423..51441
FT                   /locus_tag="Lm4b_00048"
FT                   /regulatory_class="terminator"
FT   regulatory      51492..51497
FT                   /locus_tag="Lm4b_00049"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51507..52616
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00049"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00049"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03839"
FT                   /protein_id="CAS03839.1"
FT                   /translation="MGQLKGLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQ
FT                   NYKEVAVAISNFEPVTMFVSPNQYKNARKELPDTIRVIEMSNDDAWIRDYGPSFLVNDK
FT                   GEMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCDLERLDYYSQKDFILEGCSIHVDG
FT                   EGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHAQKVIWLKHGFYLDETNGHVDNIFN
FT                   FVAPGEVVLSWTDNKSDPQYEISRECYDILANQTDAKGRTFMIHKLHCPDPVLITQTES
FT                   EGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPKDKDAQELLEQLYPDRKIV
FT                   GIKAREILLGGGNIHCITQHLPDKSTIRE"
FT   CDS_pept        52633..53412
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00050"
FT                   /product="Conserved hypothetical protein, hypothetical
FT                   regulator"
FT                   /note="Conserved hypothetical protein, hypothetical
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03840"
FT                   /protein_id="CAS03840.1"
FT                   /translation="MDFFEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVSKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
FT   CDS_pept        53516..54175
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00051"
FT                   /product="Putative DedA protein"
FT                   /note="Similar to E. coli DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03841"
FT                   /protein_id="CAS03841.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
FT   regulatory      54160..54179
FT                   /locus_tag="Lm4b_00051"
FT                   /regulatory_class="terminator"
FT   CDS_pept        54254..55486
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00052"
FT                   /product="Putative arginine deiminase"
FT                   /note="Similar to arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00052"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03842"
FT                   /db_xref="GOA:C1KV84"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV84"
FT                   /protein_id="CAS03842.1"
FT                   /translation="MKMEQALNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIP
FT                   YLKMMQKEHDFFAKTMKDSNIEVLYLEKLAAEALREANNKESFLTKMIKESNQMDESAL
FT                   YVRDYLMSFDEEEMIRKLMSGLKKSEIPERKKKHLNEMMDEQYPFFLDPLPNLYFTRDP
FT                   AAVIGNGVTINRMFQPARRRESMFIELILKHHPRFSNQEIPVWSGRGEPFSLEGGDELV
FT                   LNEETVLVGVSERTDARAVERLAESLFSRSPKIKRVLAVEIPETRSFMHLDTVFTMVNF
FT                   AQFTIHPAIQNQQGELNIYILEKSENGLEITPRRDFQRVIAEVLDEPEIDFIPCGGEDV
FT                   IVSAREQWNDGANTLAIAPGEVITYDRNQVSNDLLRSAGIKVHEVISSELSRGRGGPRC
FT                   MTMPLVRENLK"
FT   CDS_pept        55765..56058
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="Lm4b_00053"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00053"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03843"
FT                   /db_xref="GOA:C1KV85"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV85"
FT                   /protein_id="CAS03843.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
FT   CDS_pept        56114..56650
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="Lm4b_00054"
FT                   /product="Putative single-strand binding protein (SSB)"
FT                   /note="Highly similar to single-strand binding protein
FT                   (SSB)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00054"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03844"
FT                   /protein_id="CAS03844.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
FT   CDS_pept        56694..56933
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="Lm4b_00055"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00055"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03845"
FT                   /db_xref="GOA:C1KV87"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV87"
FT                   /protein_id="CAS03845.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
FT   regulatory      56945..56969
FT                   /gene="rpsR"
FT                   /locus_tag="Lm4b_00055"
FT                   /regulatory_class="terminator"
FT   CDS_pept        57086..57697
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00056"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00056"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03846"
FT                   /protein_id="CAS03846.1"
FT                   /translation="MYRKLATVGMTVLLVGALSACSFNDDKDTSSNNSSNETTSSKSSN
FT                   NESSSDSLQNKSFDMSYEDAINAFKDKHSDAEISSVELEKSLGKYVYKVDGISNDNEYE
FT                   MKFNAETKEQLSDETDRLDREDAGGVEKENEKLSLDGIKSPKEAMDKAVSEQAGDVTSW
FT                   KIERELDTTYYEVTVKQDNNKYEIKLNAKTLEILQTEQDD"
FT   regulatory      57710..57739
FT                   /locus_tag="Lm4b_00056"
FT                   /regulatory_class="terminator"
FT   CDS_pept        57954..58568
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00057"
FT                   /product="Putative two-component sensor histidine kinase
FT                   AgrB"
FT                   /note="Similar to Staphylococcus two-component sensor
FT                   histidine kinase AgrB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03847"
FT                   /db_xref="GOA:C1KV55"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV55"
FT                   /protein_id="CAS03847.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLMMFVLAPFVF
FT                   QNIPSNNWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE"
FT   CDS_pept        58552..58713
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00058"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00058"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03848"
FT                   /protein_id="CAS03848.1"
FT                   /translation="MKNMNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVK
FT                   MQEKNENK"
FT   regulatory      58797..58802
FT                   /locus_tag="Lm4b_00059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58809..60104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00059"
FT                   /product="Putative sensor histidine kinase"
FT                   /note="Similar to sensor histidine kinase (AgrC from
FT                   Staphylococcus)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00059"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03849"
FT                   /protein_id="CAS03849.1"
FT                   /translation="MFSILMAIIQITGIFIAIQILTNKVFSIKEGLVTIAIAMLAFPLF
FT                   TLVQYWSMIFVLIVFVSALYWKNKNVVVSASITLVVIILLTISDSIVGFILVPGLNFKY
FT                   DEIFNELLPTLIYCAGMLANLLVFSFLLRKLIEKVNISRFVEHRKYAYIIFSIVALTVL
FT                   AFYMNIYAGSIAGFDGSVLKINTLIFTGYTILLIVIVTVVINTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDMPGLKYYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKISMDSIDLCKVVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSIIIVFANSLPVNMPPIYKIFEEGFSTKGEGRGLG
FT                   LASLREIMKKYSHVALDTKVTDREVIQELEIM"
FT   CDS_pept        60123..60851
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00060"
FT                   /product="Putative 2-components response regulator protein
FT                   (AgrA from Staphylococcus)"
FT                   /note="Similar to 2-components response regulator protein
FT                   (AgrA from Staphylococcus)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03850"
FT                   /protein_id="CAS03850.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHELDTTKGVV
FT                   KMSNGENCYASSKLIKSLSL"
FT   regulatory      60854..60870
FT                   /locus_tag="Lm4b_00060"
FT                   /regulatory_class="terminator"
FT   CDS_pept        61017..62990
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00061"
FT                   /product="Putative YybT protein"
FT                   /note="Highly similar to B. subtilis YybT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03851"
FT                   /protein_id="CAS03851.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATIILSVITFFFSWWLSALVVVGGII
FT                   LTVAMFYFEYRLNEDVQLYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDEKGIMSIAWRDHRFDTIVKRKERILYLYDRT
FT                   EYYDLNKKFQANKSVFAVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEDDLIQLAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDSATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
FT   CDS_pept        62993..63439
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="Lm4b_00062"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00062"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03852"
FT                   /db_xref="GOA:C1KV60"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV60"
FT                   /protein_id="CAS03852.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQTLEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
FT   CDS_pept        63464..64816
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="Lm4b_00063"
FT                   /product="Putative replicative DNA helicase"
FT                   /note="Highly similar to replicative DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00063"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03853"
FT                   /protein_id="CAS03853.1"
FT                   /translation="MDNNFQDRTPPQNIEAEQAVLGAIFLEPNALITASEILMPDDFYR
FT                   TGHQIIFETMLDLNDHGKAVDVLTVYEALAAKGNLEDAGGLPYLTELSGAVPTAANLEY
FT                   YAHIIEDKALLRRLIRTATQIATDGYSREDELDMLMDEAEKSILEVSQRKNVGAFKNIK
FT                   DVLVKTYDDIEILHNRKGDITGIPTGFNELDKMTAGFQRNDLIIVAARPSVGKTAFALN
FT                   IAQNVATKTDENVAIFSLEMGAEQLVMRMLCAEGNINAQNLRTGALTSDDWQKLTIAMG
FT                   TLSNSGIYIDDTPGVRVNEIRSKCRRLKQETGLGMIVIDYLQLIAGSGRGGENRQQEVS
FT                   EISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRE
FT                   DYYDREGENDGTIEIIIAKQRNGPVGDVKLAFVKEYNKFVNLEVRYDDAMA"
FT   regulatory      64825..64861
FT                   /gene="dnaC"
FT                   /locus_tag="Lm4b_00063"
FT                   /regulatory_class="terminator"
FT   CDS_pept        65075..66367
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="Lm4b_00064"
FT                   /product="Putative adenylosuccinate synthetase"
FT                   /note="Highly similar to adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00064"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03854"
FT                   /db_xref="GOA:C1KV62"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KV62"
FT                   /protein_id="CAS03854.1"
FT                   /translation="MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKF
FT                   DGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHI
FT                   ILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHN
FT                   LGEKNRLLERFYELEGFKLEDILEEYYDYGQQFKEYVCDTSVVLNDALDDGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTEL
FT                   FDTIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETL
FT                   KICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMER
FT                   IAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA"
FT   regulatory      66383..66411
FT                   /gene="purA"
FT                   /locus_tag="Lm4b_00064"
FT                   /regulatory_class="terminator"
FT   CDS_pept        66670..66963
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00065"
FT                   /product="Putative a small heat shock protein of
FT                   Clostridium acetobutylicum"
FT                   /note="Similar to a small heat shock protein of Clostridium
FT                   acetobutylicum"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00065"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03855"
FT                   /protein_id="CAS03855.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSEWE
FT                   GQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
FT   regulatory      67017..67038
FT                   /locus_tag="Lm4b_00065"
FT                   /regulatory_class="terminator"
FT   CDS_pept        67112..70318
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00066"
FT                   /product="Putative YueB protein"
FT                   /note="Similar to B. subtilis YueB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00066"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03856"
FT                   /protein_id="CAS03856.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSSYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLNLSQKENEEHMKNMDAYTKTQEENAPFGAEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQANAKMTSEFQILEDSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILRENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYNADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRSAFGEGFSFTTDPKTLPTDTLKSDTINRLKSEGVTLE
FT                   SSSYTVEGSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQTAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKASSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREASKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAATSEGNLKSAEVVYKTFEAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGAALLFTGL
FT                   NLFVWHRSKEEVEEDDSDEI"
FT   CDS_pept        70308..70823
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00067"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00067"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03857"
FT                   /protein_id="CAS03857.1"
FT                   /translation="MKFKIAALLMLLCFAFAPGVLAADSDSYLENNGKMDIKTDRLQKT
FT                   EEEKTKELEQMEETELDKNGIPLFTDEMDEKIAKEKAAEKAEYDRIKDSLFEEESTSGE
FT                   TVKKTKEKLFTDEYETTAVNTETPTTTETTVEDETKKTKQKTVGGAIAGTLVALAGGIY
FT                   VAARNVFE"
FT   CDS_pept        70841..71092
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00068"
FT                   /product="Putative YukD protein"
FT                   /note="Similar to B. subtilis YukD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00068"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03858"
FT                   /protein_id="CAS03858.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKID
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
FT   CDS_pept        71114..72310
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00069"
FT                   /product="Putative YukC protein"
FT                   /note="Similar to B. subtilis YukC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00069"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03859"
FT                   /protein_id="CAS03859.1"
FT                   /translation="MNKTIEMDGTTYDFTYEDLVWSITFPKSKTRAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAKRTYGFEQVRKMGREDKLRALRNIADLGELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTVQDIATILEEAYVKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVKGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEKVNESTTTEDETTNTEAK"
FT   regulatory      72311..72316
FT                   /locus_tag="Lm4b_00070"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72324..76820
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00070"
FT                   /product="Putative DNA segregation ATPase FtsK/SpoIIIE"
FT                   /note="highly similar to B. subtilis YukA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03860"
FT                   /protein_id="CAS03860.1"
FT                   /translation="MNREALLIVSNGQQCHKNHLSPEKVVTIGNTIEHEITYPELAESI
FT                   EVKYDEGSWNAGTTALQANQAVNVENLAFYLCQDLHTQVYDVVTNISVTFGVGIENDVT
FT                   LDDTKSDFILLRDAKEKLFKLQVLNGEVYHNFSLVTEDCVLEPGDQLYTDGVTITIGKE
FT                   DISVLAVKNRVTSKLAPLFAADNSFGEDYPDYHRSPRIIYRAPEEKISMAKPSSKPSKP
FT                   TDGLIKIILPPLIMVAITVMISIFQPRGLYIIMTIAMSAVTITMAILNYIKSRKKYKID
FT                   SKQRVESYDLYLKRKTKELHETSEKQRHALTYHYPDVTELEKMALRVDSRIYEKTMFHH
FT                   DFLTFRVGRGDEASSFSVEFQQEEFSQEKDELVEEAVKIKGQYLSINEVPVATDLMHGP
FT                   VGYIGPRRLVLEQLQMLVMQTSLFHSYYDLQFITIFPEEEKADWDWMRWLPHANMRDVN
FT                   VRGFVYHERSRDQVLNSLYQILKERKQALTEQASKQEKLYFTPHYVVLITDEKLVLDHT
FT                   VMEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRDAKSGNIILEQGDLVNRAFVPD
FT                   HLPADFDKEVISRALAPLNHLQNLKNSIPESVTFLEMYGVERVEELNIAGRWAKNETYK
FT                   SLAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVA
FT                   FLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHI
FT                   NQYQKLYKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQ
FT                   KPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELF
FT                   QSAWSGADYVPDKESTDYIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVI
FT                   DHIHAYTEASGIEALPRPWLPPLPERIFAQDLHPVNFEEAWKEPKKPLQATIGLLDQPE
FT                   LQAQVPLTLDLTKDGHVAVFSSPGFGKSTFLQSLVMDLARQHNPEQLHVYLLDFGTNGL
FT                   LPLIDLPHVADTMMVDEVEKVQKFLRICLNEIKTRKKLLSQYRVANIEQYERASGKELP
FT                   NIIIVLDNYDAVKDAGLGDDFEKIITQITREGASIGMFMIISASRHMSLRTQMATNIKQ
FT                   MIALYLIDKNDISSTVGRTDTPLEEYPGRALVKLETVTTFQTTLPSQGEETIQQIEGIR
FT                   NEAKLMREGWQGELPESVPMIPEKIKLADFCEWMETKEVVANGNIPIGVDFEYVKPVGI
FT                   DYKQTGVLIIADAIGRNLVSINKNIANSLVQNPNISLLISDTANFDLVEMSTKANLYSN
FT                   NTEDLKQNMKKVLSIYQSRTEKADELRKAGDNLGVTAMIQGLKDIVVFVGDYDILLKTL
FT                   DEEDQKTLIDMINNGKTYGCYLILSGSIQAFKGYGDLNKAVQAQRNYIFFDRLSNSSPF
FT                   SFSFTIYREQELLPEEGYVIAGQEWQKIKIAKYEEEV"
FT   regulatory      76810..76815
FT                   /locus_tag="Lm4b_00071"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        76826..77143
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00071"
FT                   /product="Putative hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03861"
FT                   /protein_id="CAS03861.1"
FT                   /translation="MLTKEILPIGSVVYLKESLKKVMITSRLITIQGDEEKEFYDYGGV
FT                   VYPEGTKDDNILAFNAEDITDVKFRGFVDDDEVVLVKRMREWQKEEFGVSPEEEDEILE
FT                   L"
FT   regulatory      77118..77123
FT                   /locus_tag="Lm4b_00072"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77133..77567
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00072"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00072"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03862"
FT                   /protein_id="CAS03862.1"
FT                   /translation="MNYDERVRVLIELKVDLSGKLEMMENEEELLCRQKHDFVSTWSNA
FT                   KTEDAYRKLNEAVRKKIKETTEYAREIDEKITARIKRIEAAYKAEYQSNRSYTWRIAEI
FT                   DPIKFKQKYNERLNQLSYLSCDGSVKTRLIKEFRQNNFLK"
FT   regulatory      77566..77571
FT                   /locus_tag="Lm4b_00073"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77579..77887
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00073"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00073"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03863"
FT                   /protein_id="CAS03863.1"
FT                   /translation="MVSPMPDKTVKMDKGSINPKLDKLISSLDNFDNINKKMGTIVGSQ
FT                   EISGEAADALSESLLVLVSYGEQYSLVIRNLKEVIVDYCKSVEEIDKTAANAVSKGV"
FT   regulatory      77893..77898
FT                   /locus_tag="Lm4b_00074"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77906..78547
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00074"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00074"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03864"
FT                   /protein_id="CAS03864.1"
FT                   /translation="MKSRNWLKGLGVTMIVVTLILTGCGNGDAEKTDTKEQTKSVEEEG
FT                   KEVKIESNEGKPQHEQLITVKLPPEAEYLNDETLEVYEQDKKKYDQTEQLITNNSVTIL
FT                   LGDFCYYEPAWSSLTCSAILVNGTDTNIEDLSFKAEIMNKPMSGKIFSDDKVPELTKAK
FT                   TGKFQPNEGIPIILVFSEENPKNEENAEPQKINIKDIKVKIKDIQYKAVK"
FT   regulatory      78546..78551
FT                   /locus_tag="Lm4b_00075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78559..78873
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00075"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00075"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03865"
FT                   /protein_id="CAS03865.1"
FT                   /translation="MAKEIKVNPDFLKKVESNVTNYIDAQKEVSVELLAVRTNLASNFS
FT                   GIACDEIKNYITELMNDLEKEFGVFITKNHEKVKALGESYKELDGQLGQTFNYGMERTK
FT                   "
FT   regulatory      78857..78862
FT                   /locus_tag="Lm4b_00076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78870..79832
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00076"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00076"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03866"
FT                   /protein_id="CAS03866.1"
FT                   /translation="MSGKIKFNIAEAQNISLELKIAAGRYTQETEELLKVLKNNSLCDK
FT                   DQDVVEQRGRIEKNNQRLIEYEKFVNTNLAKSNSVIEELFMSVEVLYAQQVSEFRNPNS
FT                   AGYKELMGNVKAISYQKISQISGLGEMLTSKGSVGAIKDIRDTLLGTLVDDTYLKLIDD
FT                   TVEYQGENKNITDLYGDKISKVGSRRKKLDTPTKYLSTAYLISDTLKSFNSYGNSKDSS
FT                   RLAGDLTGIAITKGADFAVGKLATTALSGFGVSGVKGAIAGAIISVAADKIIDPTVEYV
FT                   KESKVEAKRDDWETKGIYKGWKKIRDLKLEYTVGNYQAS"
FT   regulatory      79925..79930
FT                   /locus_tag="Lm4b_00077"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79936..80271
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00077"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00077"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03867"
FT                   /protein_id="CAS03867.1"
FT                   /translation="MYINLKSSDGNVITTKVGSCWTCVFLSFFGPLLRGDIKFFVLYVI
FT                   LDGAGLFITLNYDRDIGIAIMAMVTLLFESNYNTWFIRGKMNNGWEPETEKDREILLEK
FT                   GVIKTEV"
FT   CDS_pept        80305..80745
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00078"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00078"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03868"
FT                   /protein_id="CAS03868.1"
FT                   /translation="MNSNEISEIIIQQNKGKTIIKLLYTLPILLFGIFILFKVKESLLL
FT                   GACGIILLVIVAPTYFTVAKHFFSGKPLLKVDQDGIEGWSKRFKWNEIEKVALRRDWGA
FT                   VYLTVYVRKNGGIHKYNINTKEIERSATELIKQIGYLKNKYE"
FT   regulatory      81293..81298
FT                   /locus_tag="Lm4b_00079"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81308..81904
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00079"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00079"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03869"
FT                   /protein_id="CAS03869.1"
FT                   /translation="MIAITLFLSGCENGDTEKTDTEEQTKNVEDEGEKVEIESNEGKPQ
FT                   HEQLIKIELPPKADYLNDETLEVYNQAKKKYDQTNQLITNDSITVLVGDYGYYDSVWGS
FT                   LDCSAVIKNGTNSSIKDLSFEVSVEDNAISGKTFLNSEALPLTKTQIGDFEPNTGVPIV
FT                   IAFPEKNATGEGEDKKIDTKNVKIHISNIQYKVEK"
FT   regulatory      81960..81965
FT                   /locus_tag="Lm4b_00080a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81972..82262
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00080a"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="PSEUDO:CAS03870.1"
FT   CDS_pept        82142..82687
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00080b"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT   regulatory      82911..82916
FT                   /locus_tag="Lm4b_00081"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82925..83698
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00081"
FT                   /product="Putative carboxyphosphonoenolpyruvate
FT                   phosphonomutase"
FT                   /note="Similar to carboxyphosphonoenolpyruvate
FT                   phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03872"
FT                   /protein_id="CAS03872.1"
FT                   /translation="MTKNFEKLKSLHELPTPLILYNCWDVASARAIQQGGAPVIATSSY
FT                   AIAESLGVVDGEHLTFDEMFSVISRIAENVSLPLTVDIETGYARNLEELAQNVERLLVI
FT                   GVCGVNLEDQLIGVTNPGLCSTEEQCDKIETIKETAVKMSTEIFINARIDVFFQGRDET
FT                   ADLVEEAISRANAYKEAGADAIFIPGLLSPNLIRAFVEKSPLPVNVMRMDGMLSNEDLQ
FT                   KIGVKRISYGPFSFFQANLAIQLEVERIFEGGKAL"
FT   CDS_pept        83695..84747
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00082"
FT                   /product="Putative Ada protein (O6-methylguanine-DNA
FT                   methyltransferase)"
FT                   /note="Similar to E. coli Ada protein (O6-methylguanine-DNA
FT                   methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00082"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03873"
FT                   /protein_id="CAS03873.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESGNGF
FT                   RDAFSKTMGEVPHKSNDIIILYSAWLETKLGSMLAISDDESLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTVIIQQIEAELARYFNGELIDFKTPICYIGSDFQQSVWNELRRIPI
FT                   GETISYKSLAEKLGRPTASRAVARANGANQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPR"
FT   CDS_pept        complement(84769..85407)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00083"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03874"
FT                   /protein_id="CAS03874.1"
FT                   /translation="MKKITAPRIPDEDLTVYPNDTYFIEDIGEVSEQIFRKTTLTGEIF
FT                   EHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGVN
FT                   FSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKA
FT                   QFLNCALNGVDLSSCIFESITAMPQDLKGVSIDFSHAPALMPLFGIRVK"
FT   regulatory      complement(85416..85421)
FT                   /locus_tag="Lm4b_00083"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      85525..85530
FT                   /locus_tag="Lm4b_00084"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85538..86494
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00084"
FT                   /product="Putative phosphoglycerate dehydrogenase"
FT                   /note="Similar to phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00084"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03875"
FT                   /protein_id="CAS03875.1"
FT                   /translation="MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELIKNVTEV
FT                   DAIICPLSSPISAKVLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATA
FT                   ELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVA
FT                   KRAAAFGMKIIYSGHHPKEAAKEWNAEFVSQEELLKRSDVVTIHAAYSPSLKYLLNETT
FT                   LKTMKSSAFLINAARGPVVEEAALIKALEAGVIAGAALDVFEFEPKIGEDLAKLDNVVL
FT                   TPHIGNATVETRTAMGKIAIANVEAVLAGKAPLHSVY"
FT   regulatory      86507..86531
FT                   /locus_tag="Lm4b_00084"
FT                   /regulatory_class="terminator"
FT   tRNA            86582..86654
FT                   /locus_tag="Lm4b_t00001"
FT                   /product="transfert RNA-Lys"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 82.13"
FT   regulatory      87015..87020
FT                   /locus_tag="Lm4b_00085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        87028..87369
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00085"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00085"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03876"
FT                   /protein_id="CAS03876.1"
FT                   /translation="MKKLQWLTNRLFATSILLITTLFIIPPTFAIADGSKVSFYEYIYG
FT                   APFRWLTVISTTDKKGAFTEMFFSGNEGITIQWPNLMINFLLIFLAITIIFSLAKKLYD
FT                   KKNVKKDNP"
FT   regulatory      complement(87358..87378)
FT                   /locus_tag="Lm4b_00086"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(87436..87804)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00086"
FT                   /product="Putative transcription regulator (merR family)"
FT                   /note="Similar to transcription regulator (merR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00086"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03877"
FT                   /protein_id="CAS03877.1"
FT                   /translation="MAFSIGEFSELVGIPSSTLRFYEKEGLITPDRDKNNLRIYSEEDA
FT                   NWLKFLLHLKGAGLSVEELKQYTIWRAAGDSTISERLNMLKKKKVILEQEIEDLQKNLD
FT                   TVVRKIGIYEEKVKTRRV"
FT   CDS_pept        complement(87860..88843)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00087"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00087"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03878"
FT                   /protein_id="CAS03878.1"
FT                   /translation="MKKRQLGNTGLVTSELGFGCMGLNYHRGPAKDRKEMIEVVRTAMD
FT                   AGITMFDTAEVYGPYTNEELVGEALVGKRNHVQIATKGGFKINGLNNEVDSRPESIKAA
FT                   VEGSLKRLKTDYIDLYYIHRIDPSIPIEEVAGTIQNLKQEGKILHWGLSEASAKTIRRA
FT                   HKVEPLAAVENEYSIWWREAEKEIFPVLEELGIGLVAYSPLGRGYLTGKLDINASFNEN
FT                   DNRGGLPRFQKEAMEANQVLLAFMKEIADEQNVTTAQLAIAWILDQKPWIVPIPGTTKQ
FT                   SRIKENIASTDIRFDDGARQKIADALSQIEIVGDRYSAAENKRIGK"
FT   regulatory      89219..89224
FT                   /locus_tag="Lm4b_00088"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89234..89923
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00088"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00088"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03879"
FT                   /protein_id="CAS03879.1"
FT                   /translation="MKYIDYHDYMHKDAIIYAYLQNNFPYIRKRIKAWESFTLDREDIL
FT                   LVKSGAIFEEISGKKKGIARCFFSKSLIFPTRNQIVLKAFETSEICFINAETAFGKLEK
FT                   DQILSNFFLQIAEKNEEDMRRQAFLGTENSKNKIISTLNFLLENNKSNNKTPIFPEWLQ
FT                   INVLAQLANCSISTISSTVNELHAEGILDIKSSPWKLKGREKRIEILENEHQKIKLNER
FT                   KHKSNVF"
FT   CDS_pept        90000..95879
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00089"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00089"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03880"
FT                   /protein_id="CAS03880.1"
FT                   /translation="MKKNILVVMIVSVLAISAIVSAFFLMRDDAYAIETEGFTYSPKGK
FT                   VVDFSSEAKYNDTWINNEKTITDKKEMKPINLARTLFLKDGRIQFLGKSVAVKSASDLI
FT                   ELPSKTSITESKGSYKAKSDSNKTLAQLPKGTVVKLAEGRYIILDNAYLKNKQGLNKKL
FT                   PKNVLVSIDENKKVTLMGDKTIEELGGDDAYIEMENNHYHFDLKKEMLVSQTAKETDID
FT                   IRSIKVEIDDNAEKRSLKTAKETANETTKDSTQKEPEKQSNDTSGQKTTQNNETSEGKD
FT                   NQTQGASGNNANGNANNNTARSNGTGGSDSGANGSQPGGTQNKPNEGDVNKANEIIKKL
FT                   NEAENTNTFQVPIVDVNLTVKGQVATAKLKLTDASKRLNSLEAILYDSKNNIVKKEKLN
FT                   STKANQNFTFNNLKYGETYQVVVQGSYKSASNKNQDTIFFRQTVEAKPVVLTPKVTERG
FT                   EDYMKAELTATELYGHIDKLVLKIKENNSNVTTSQKVTVDASQLTKDGQVEVKFNSLSS
FT                   AKEYIIEMEELIVDGKNVTDDSWYFISSTLKAKPTIEGINLSYSTDKGEFVASPVNLID
FT                   RDESITSIRYVAYLEDDYKANGSNAKEYAYSVVDANQKKTAVKVGRTVDMNDGSYIFVG
FT                   YISGNNGQSDYTFATPASNSVIVGKKTKPTVEFSLKEAEQDKLTINYEIFDADNTLLFD
FT                   NLTHPTLKLYKSDAQGMYSGNPVATVDLTKKSDITNLLEFDGLESEAYYVVVMTGSYNL
FT                   DDGAGIMVDELIGQSSVFRTTEITKVNASFSLDSVDTTKATINVKLSEAAVNLNDANLK
FT                   IYEKKTNTLVKTIPLHGDFEKLMSDLGNSYPFKDLSINKEYLVKIEDGYDSGMNHVPVE
FT                   GQFIFKTKKEAPETDKVLLDYKASEMKLGGLAGIAATEKPLIDDYNAVSSITYSIYKAD
FT                   DLNTPLVEQEVSTAADFEKHVYFDLTNKLLGRGYSYVIKADVVWNDNYEDHHIEINSDT
FT                   IQIKKEKPTVEYEILSRTASEIKLNVYVEDEEESIVPGTLEITSTTGGNEQLQSGKNNV
FT                   TLSLSSEGTTTIKTTGDYIITSGSSAISDIFMTKQLAALNTTAPQVGAKIAMDASGKSM
FT                   TIAPEPNAVAKTSVMRTKYDLKDAASSKPDYSITKSGPNQFNTQNLNLPIGNIWFDNSY
FT                   QLTLDMKMNYTENKIDNQNLANNYYLSIGNGASFVSSLSGAVSTTNNVNSADVFKVTKA
FT                   STDSEGNISGVTFKNIWTDKYIAYRNGILISNSETPDSFKLIRQADGSYVPELSGRYVS
FT                   FSVGLVTDEAAGSKIDLYSTQEKLEQVSEAISVKALEEPAISAENISVYDKRVKIDVIG
FT                   EDKDNTTVKKDNKNELFVNVYKADGTTLVKSIRIDGLPTRDVSVTELSPDSDYVVKVEG
FT                   KYDLLDGKGEKDKVYFSETIKTEKSLPSMTSTDYSWNPAYGQRAIKGNIHFTDESSVLT
FT                   NIEYRLYDAATISSNLSNLVALEQELGNKTPVATFDNMTNSPEFSIYNSSGAQNFVSGK
FT                   TYVIAAYMKTSLTRAPIFLSDAKELYISPPSGVSAPITLENVSTREATLKFSYNDPQSY
FT                   FVGGTNKEFQYVLKNTTNGKEIKKGSFQGGNTASWINTFEELEPATGYTLTISTQYDNL
FT                   NGGLVRAWNTSFNFTTDDEYVTSNSLTIQLDAGAKVVKLQAKEVKPGSTTIENIKMEFY
FT                   ELIDYGGNNEHNQLVETKNITLPSSYPATIAADFNVAGKKKNQSFLGKMIVTYRTPTNE
FT                   VKTYEKTSNFITLQEDIAAGLKAFKSVRATNKTLEVKLDTPQVNLTDKGDYTYELKGEN
FT                   GEVIDTEKVAAEDISKTVSLSMEPTSDYTLTVINPDNQPVALYQGNNEENNLKAEINKD
FT                   SFTLMSNNTADAETTMTVTVEPKELTAWQTVQSWFGKDFTETYNIQKDELDTGVKIDEN
FT                   YQDTKVTVEETKSGKNFGIIELEESK"
FT   CDS_pept        95876..98185
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00090"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03881"
FT                   /protein_id="CAS03881.1"
FT                   /translation="MKPTWKIGIIVAAVPLIIIAVVLWGSFKEARYNLVSLPDDGVVLN
FT                   NEQETLQFQKGNTLYRSWNSDQLIAKNDKEDTRNEIMESTILYLNKEALMFTKSVPVID
FT                   TNGVSSKLKGRQVYQQTNSSYKYKNSEITENSIVKLANRQYYLNADATLYLGGKEIKKV
FT                   SKPLLLIDKTGSVTIYENKKKSRFLGHMTLKVNDKTVLDASNETYTVGERKIDLASFGG
FT                   TDNEKIVVKEDKKKTAESAKEKESAKKTASNSSQSENESNQTTKGTGNQLNATKKYGNN
FT                   LNVGNGTSDSEPNDGKDTKNNGSGSNANGGTNQSDLNEIDNYEAILRKIEDLNKKLERN
FT                   IPVLRIGYIAPGVTSVKVNYNYVDPNNTLIGVTKISAVDEKTGKTVNTQYVSAVDTEAT
FT                   LKGLSPNGKYHLEFTYQYDLGTNKGIQEVKMQSDSFTTQTVAAIYQMQSVTSTTMKVNI
FT                   ALDAQIDDVKRARIKVTKADGDFFYMNVSANFLNGNGETLNVTGLSPKTAYQFQTIIEM
FT                   KNGETIELNSSEKYYTMQATVLRNLRASQSVNKVLQVQYDWSSADYTLNQATIELEDEE
FT                   DKTEVDYQIVNQEKGNIHLVPDTKRELINLKAKLVLKTTNNNTKESKTFEYPVKQEIEY
FT                   DKQAKLTMDLTPFQTEENSELQSEKQDVVAEKETNGNDLTAKMEDVLAPQNATYDMSFS
FT                   MQRKALETYQLEFERKIAGIDDDNWTVWKSQQVTTDEAGQVKVTETISKLAKESFDYRV
FT                   AVYDAQGALQLYVYQK"
FT   CDS_pept        98242..98484
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00091"
FT                   /product="Putative ATP synthase C chain"
FT                   /note="Similar to ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03882"
FT                   /protein_id="CAS03882.1"
FT                   /translation="MDLVVACSVIGAALAIGLATLGAAIGQGIAVSRATEIIGKNPNAK
FT                   KEVMGGLFLGLLMIVALMLFALAIAVILLWVNPFI"
FT   CDS_pept        98496..99527
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00092"
FT                   /product="Putative ATP synthase delta chain"
FT                   /note="Weakly similar to ATP synthase delta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00092"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03883"
FT                   /protein_id="CAS03883.1"
FT                   /translation="MEKMIQTIILYSVFAVGFLYLLHFTLRKLENILTSFFYEVSQDQS
FT                   LEKESLLRRLKRQKVATTQEEQKNRQLAIESEQKEELFLEEIDQLIAQNKSYEQQLQAW
FT                   ENEKPKQIVEVPRFETTPHAPYKSLSSYINEIFQQVFIESEEDEARLFTEAIREFDALV
FT                   RTEKIRCALPYKVILQLFEMYSPEQLHLFAQSFQRYSERSSKLPVKQIYQSSYLSPEQK
FT                   LKVMQEEGTLDELDAEFIQFLFYMMTHYSYRQTRNLYRNFLEVYNIHFYTGLICIHVAS
FT                   KDSANHFEKLWQPAHRGYKIEYQVQKELIGGVIIQYGSKSIDMSYQELIKRSTEKMEAE
FT                   VKL"
FT   CDS_pept        99524..101020
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00093"
FT                   /product="Putative ATP synthase alpha chain"
FT                   /note="Similar to ATP synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00093"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03884"
FT                   /protein_id="CAS03884.1"
FT                   /translation="MKTIHFDMNKYETHVDLEYLKEHGRVEKISDGVIFCSGLENAALH
FT                   QAVLIDERHRGVILELNEEFVGIGLIDKTNDILEGMHVGVSGKFIEVDLFEEMAGRVID
FT                   TTGKMLYEESEEKPTATSPLFCVTPAIMTIDSVTRPLNTGLAVIDSITPIGRGQRQLIL
FT                   GNRQSGKTQIAVDTIINQHDQNVHCIYVAIGLKAAYIAEVIETLRNHGAMEYSTVVATA
FT                   ASDSLTAQYLTPYAGMAVAEALRDQGKDVLIILDDLTKHADAYRAITLLFNRPPGREAY
FT                   PGDSFYIHSSLLERAVQMNEEHGGGSITAIPMIETLSDDVTAYIPTNVISITDGQLFLK
FT                   SDLFNRGQKPAVDVGVSVSRIGGDAQHPIIRKLSKNLTLILSQFEELKELLDFGNALDD
FT                   GSMKMVSDGRLLTELFKQKILSPLSVTELIVILYAFQNGFLTKIPPANIQTFKDLLLEK
FT                   AHMHKDFESFSAQIETINELNESHIEMLEEIIREAGRLFS"
FT   regulatory      101003..101008
FT                   /locus_tag="Lm4b_00094"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        101017..101886
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00094"
FT                   /product="Putative ATP synthase gamma chain"
FT                   /note="similar to ATP synthase gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00094"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03885"
FT                   /protein_id="CAS03885.1"
FT                   /translation="MSSIDQARKTIKALNSTYKIVHVTELATLGKLSALREKAEAAVSY
FT                   YETILKSLRWVRKTMYTSNNQVKEEKNVTAIAITSERGLCGAYNSEVFVEIDQLIESLG
FT                   EQVTINWVVVGEQGHRYLTKLGQNITSYLQFSLENIDLETTTAVTADFIDLIHSEQMDA
FT                   LYVIFTKYLNAVQSEAMCEKIYPEIPEDSNTEEIEVDYVLDFETDDEQVEQLLLENYLC
FT                   GLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLEEAIFNARKQALQQKTGELLDIISGA
FT                   QTIRKDEE"
FT   CDS_pept        101887..103257
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00095"
FT                   /product="Putative ATP synthase beta chain"
FT                   /note="Similar to ATP synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00095"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03886"
FT                   /protein_id="CAS03886.1"
FT                   /translation="MKKNTGTIISISGFVLKIEFNESELPEIGFALEYHTHQGTYLAEV
FT                   VQHTGINTVSAIAIGEVSGLARGTEVVNLGHPIEVPVGETVQGRMLNVYGKAIDGKPEP
FT                   AAEVKWPIFRDQPLLRELDTNKEILYTGIKVIDLICPILKGGKTGLFGGAGVGKSVLMQ
FT                   ELINNISMLGGNSVFTGVGERVREGIGLYKELEASGVLPQTTVVLGQMNESPGVRMRVA
FT                   LTGLTIAEYLRDEEKKDVLLFIDNVFRFIQAGSEVSSLQGKIPITGGYQSTLSKEVGDF
FT                   QDRIASTKNGSITSIQCVFLPADDIDDPSAVATFSHLDSTIVLERSIAALGIFPAVNPL
FT                   QSFSRALNPTFVGERHYQLAAQVKFILQRYMELQEIINVLGMAELSDEDRKLVHRARKI
FT                   RNFLSQPFYVSEKFTGTEGTFVEIEDLLGSIERILNGDYDERSERDFLFIGSYKDLK"
FT   CDS_pept        103270..103602
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00096"
FT                   /product="Putative ATP synthase epsilon chain"
FT                   /note="Similar to ATP synthase epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00096"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03887"
FT                   /protein_id="CAS03887.1"
FT                   /translation="MKLKIVSPMGQFFEGEVEGFVINTKEGQQTVLEEHIDCLSFFDYS
FT                   EISILDAVASDPIFVALGYLHLVQNEANIMAQFASTDAKQAERIFERLNKRKQTESRRS
FT                   DDKRIF"
FT   regulatory      103570..103575
FT                   /locus_tag="Lm4b_00097"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        103583..104143
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00097"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00097"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03888"
FT                   /protein_id="CAS03888.1"
FT                   /translation="MTSEFFSTLLLIIGLLLGFFLAILLILVGIRRFLCSAEEPLKRIQ
FT                   RYQLWHNRYQLNAEVTSFLIVIGASLSVSLITLQITAIPFQYTVLIFWSSWLFHLLSFW
FT                   KKIRVPKKMKNEMKQLAGFLLITVLYFVGFFAMKSVHFSIIQVADFPGVIQFGIRTYLT
FT                   ICSFFVACGALIVWQRIYVKLLK"
FT   regulatory      104180..104198
FT                   /locus_tag="Lm4b_00097"
FT                   /regulatory_class="terminator"
FT   CDS_pept        104318..104950
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00098"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00098"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03889"
FT                   /protein_id="CAS03889.1"
FT                   /translation="MTFLEFHQLVKEDLLIYSWIIKNFHLTRQKLMAGGEITMNREQVI
FT                   VMEKGLLVQVNEEGKDDLYRVFIDQRIIFTTKGDITLTALEDTSYSIIRAEELIGKLED
FT                   QHLLPTFFLEIAEDFEKGLDWQRTLISVDPAERAEMILAKIIERYQINSENKPEFPRWL
FT                   RINVLARFAKCSVSTMSSVVNELVNEGDLNIKGTPWLLTRPYQATCA"
FT   regulatory      104968..104992
FT                   /locus_tag="Lm4b_00098"
FT                   /regulatory_class="terminator"
FT   CDS_pept        105248..106213
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00099"
FT                   /product="Putative PTS system mannose-specific, IIAB
FT                   component"
FT                   /note="Similar to PTS system mannose-specific, IIAB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00099"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03890"
FT                   /protein_id="CAS03890.1"
FT                   /translation="MVGIILATHGEFAEGILQSGTMIFGEQENVKAITLMPSEGPEDIK
FT                   AKMEAAIASFDSQDEVLFLVDLWGGTPFNQANGLYELHKDKWAIVAGLNLPMLIEAFSS
FT                   RFTMESAHEIAANILAPAQEGVRVKPEELQPQVTATEQPQAEIAAVGDGKIEFVLTRVD
FT                   SRLLHGQVATAWTKATHPTRIIVVSDAVAKDDLRKKLIEQAAPPGVKANVIPVQKMIEI
FT                   SKDPRFGNTKALLLFENPQDVLRAIEGGVEIEQVNVGSMAHSVGKVVVSKVLSMGKDDV
FT                   ETFEKLKEKGVKFDVRKVPNDSSANMEDIIKKAKHELKTQ"
FT   CDS_pept        106237..107043
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00100"
FT                   /product="Putative PTS system mannose-specific, IIC
FT                   component"
FT                   /note="Similar to PTS system mannose-specific, IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03891"
FT                   /protein_id="CAS03891.1"
FT                   /translation="MSVISIILVVLIAFLAGIEGILDEFQFHQPLIACTLIGLVTGNLT
FT                   ACIILGGTLQMIALGWANIGAAVAPDAALASVASAIILVLGGQGVAGIPSAIAIAIPLA
FT                   VAGLFLTMIVRTLAVPIVHLMDRAAEKGNIRSVEWLHISAICMQGIRIAIPAAALLFIP
FT                   ADSVQSFLEAMPAWLTDGMAIGGGMVVAVGYALVINMMATKEVWPFFVIGFVVAAISQL
FT                   TLIAIGALGVALALIYLNLSKMGGGNSNGGGGGNSRDPLGDILNDY"
FT   CDS_pept        107065..107976
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00101"
FT                   /product="Putative PTS system mannose-specific, IID
FT                   component"
FT                   /note="Similar to PTS system mannose-specific, IID
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03892"
FT                   /protein_id="CAS03892.1"
FT                   /translation="MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKTKEDRSQALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
FT   CDS_pept        108104..108493
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00102"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03893"
FT                   /protein_id="CAS03893.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKRPKEVLRKIRVYVDPANMV
FT                   SSLSFFDVMKRSFRSIFSKKKNKNK"
FT   regulatory      108512..108539
FT                   /locus_tag="Lm4b_00102"
FT                   /regulatory_class="terminator"
FT   CDS_pept        108615..108965
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00103"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00103"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03894"
FT                   /protein_id="CAS03894.1"
FT                   /translation="MKKPRIYTMSFASVYPLYIQKAEKKDRTKEEVDEIIFWLTGYDQD
FT                   SLQQAIDQAIDFETFFAEAPKMNPNASLITGVICGYRVEEIEDKLMQQIRYLDKLVDEL
FT                   AKGKKMEKILRK"
FT   regulatory      108973..108994
FT                   /locus_tag="Lm4b_00103"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(108973..108994)
FT                   /locus_tag="Lm4b_00104"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(109006..110523)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00104"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00104"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03895"
FT                   /protein_id="CAS03895.1"
FT                   /translation="MRPTNVYTPEDIYLKDRTGFNNGNLAYQYSIYRALWNDDVEIHAD
FT                   GLSSNPNLAEKINENYDLYVMPLADAFRDDFRPVLRNYTQLIRKLKIPVIVTGVGLRAN
FT                   YEPQLDEGFSFDEDVTNFVKAVLEKSAQIGVRGQITADYLKKLGFNAELDFRVIGCPSL
FT                   YTFGREIKIRDFHLTDQSTIAINASPTSSEIAINFLNNMITTYKDYHFIPQHLDEFHLM
FT                   YAGGPDISSDINGYPTNIQHKYYQEGRVKYFTSMPSWFDFVKKVDFSIGSRLHGNVIPT
FT                   IVGTPNISFVQDARMRELASYHALPHVTIDELEKTNNLQELLTKVDLKSAEKVQARNFD
FT                   NYIDFLDTNGLNHIYKYDKNRKSAPMDELINSITFPTSPDPISILNPQEMLNRVKISTN
FT                   LLKERHDFSTRYRVNLVNNQLTQLKKTTSEQNKKYQQKITETQEKNQQLEKQLTDTKQK
FT                   LQLTINKNHELTNKIRHYQGTLNRKSVKTTLKVANSLANLKKKVSRS"
FT   CDS_pept        complement(110638..110931)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00105"
FT                   /product="Putative transcription regulator (ArsR family)"
FT                   /note="Similar to transcription regulator (ArsR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00105"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03896"
FT                   /protein_id="CAS03896.1"
FT                   /translation="MKKLNELSKSDLLLIFQALSDPIRLDIFLCLLKSKEKRFSGTTYN
FT                   ISKSTMSHHIKLLKEAKLINLRKEGTTHIYSVNEALVEEIGYFFDACKHNHK"
FT   CDS_pept        111043..111333
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00106"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00106"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03897"
FT                   /protein_id="CAS03897.1"
FT                   /translation="MLHIEAQITVKKEQTEAFLQATKEVIAASRAEAGNHGYELVQSTE
FT                   NETVFYMLEKWADMEAIQQHNDSEHFKKFQKLAADFVAKELEISVLTPLAR"
FT   CDS_pept        111347..111979
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00107"
FT                   /product="Putative NADH oxidase"
FT                   /note="Similar to NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00107"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03898"
FT                   /protein_id="CAS03898.1"
FT                   /translation="MTYVNNDFEDLMKNRRSIREYDETVKISQEEMKAILEDAVTAPSS
FT                   VNMQPWRFVVVESDAGKEKLSSLVRFNTRQNESSSAMILVFGDLENFENGEKIYGESVE
FT                   RGLMPAEVKEQQMAKLSQYFASIPRTEAERVVLIDGGIVAMQLMLVARAHGYDTNPIGG
FT                   FERTEVAEAFNMDPERYVPVMIVSIGKAKNSGYQSYRLPITDVTTFA"
FT   regulatory      111986..112012
FT                   /locus_tag="Lm4b_00107"
FT                   /regulatory_class="terminator"
FT   CDS_pept        112075..112446
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00108"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03899"
FT                   /protein_id="CAS03899.1"
FT                   /translation="MTIKITRKTGIGSGITPVKIRIENEEIVKLDNHQSHFFMPKMEKT
FT                   KVCVTNWFYGSQEAVLENNNDVIVRINRKALILNYSMFPFLFFGLLATSWESTVIALIL
FT                   CLASFFYSRKHWFEFVKIK"
FT   regulatory      112460..112480
FT                   /locus_tag="Lm4b_00108"
FT                   /regulatory_class="terminator"
FT   CDS_pept        112737..115007
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00109"
FT                   /product="Putative chitinase B"
FT                   /note="Highly similar to chitinase B"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00109"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03900"
FT                   /protein_id="CAS03900.1"
FT                   /translation="MKKLFSITSVVLLVLSLVVVSIGAEPKRAKAAENVPQYRNVMYYG
FT                   DWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGVQWGG
FT                   ANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFVKYTN
FT                   MDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGVDINK
FT                   KYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGNPKDP
FT                   NYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAEKTNK
FT                   DADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPYLYSK
FT                   ETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKSGLFGT
FT                   NAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFETVKLP
FT                   KFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSSASSV
FT                   DVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALASSNVTDKSAT
FT                   LTWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYSYTVKAYDAAGNFSAA
FT                   SSVLTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQWGPWL
FT                   LIN"
FT   regulatory      115018..115043
FT                   /locus_tag="Lm4b_00109"
FT                   /regulatory_class="terminator"
FT   CDS_pept        115110..116012
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00110"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03901"
FT                   /protein_id="CAS03901.1"
FT                   /translation="MYFVYDIGGTFVKFALMENNGTVKMKDKFPTTAKSAEELVAQMVE
FT                   KWRPYSTEVKGIAVSCPGVVDTEKGVIYQGGSLLFMHEKNLAEMLARECHVPVVLQNDA
FT                   KSAALAELWLGVAKNVHSAAILTLGSGVGGGIIMDGKLQSGYHLMAGEVSFMETSFDTK
FT                   KLRGTFFGRTGSAVELIKRIASKKNLPNKKDGEQVFELINQGDEEANAIFDVYIYELTS
FT                   QILNIQYLIDPEIIAIGGGISAQPVVVDRLNEAVAEIKDANPYHAAQPKIVTCHFQNDA
FT                   NLYGALYNFFLQMDAQNKR"
FT   regulatory      116008..116030
FT                   /locus_tag="Lm4b_00110"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(116008..116030)
FT                   /locus_tag="Lm4b_00111"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(116037..117818)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00111"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03902"
FT                   /protein_id="CAS03902.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPNKNMTQLFWIAIIFIVSVVVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDVPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLRSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
FT   CDS_pept        complement(117811..119553)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00112"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00112"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03903"
FT                   /protein_id="CAS03903.1"
FT                   /translation="MESMKWIWQYVRKYRLLMIGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYQNKTNLLIPLLLIMIISTIIRTICRYTYQIMCERIGQNSLFRIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENVFLFSFAIIIMAAIDWKLTLALV
FT                   IVTPLIAILTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKKRNLDSADVSRTYLPVLDSLAGMLVVITLIFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFIASSFKIQDMMATDAKIPIHAEKPAPSLQGHVEFKNVS
FT                   FHFEDDPNTDVLKNISLKASPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILIDGVD
FT                   ARKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRCMARIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKK
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHSSLLAEKGYYFDIYNKQLGTEA
FT                   NVNG"
FT   regulatory      119683..119688
FT                   /locus_tag="Lm4b_00113"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119696..120529
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00113"
FT                   /product="Putative transcriptional regulatory protein, AraC
FT                   family"
FT                   /note="Similar to transcriptional regulatory proteins, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00113"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03904"
FT                   /protein_id="CAS03904.1"
FT                   /translation="MLKINTTTFNPQILYIANCYTNEVRVGENHHHDFLEISIICEGNV
FT                   IYDIEGERVKLGKGDMLIFNPGVNHYDITEPGMTNAQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKKEEESAILSISKQIIEEKDAEKPGYDLILKAFVMQLIIHVLREATPEQLENNGV
FT                   KLSTDEQQKQILVNEIIHYMEKHHTEDVSLSTLSQTMYISPAYISKVFKEETGESPINY
FT                   LIKIRLTRAEELLKNKDVTVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
FT   CDS_pept        120564..121679
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00114"
FT                   /product="Putative lipase"
FT                   /note="Similar to lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00114"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03905"
FT                   /protein_id="CAS03905.1"
FT                   /translation="MEYKKALAFIKSNSILEQEEGTEVIFKQAQETVRGNLDPFLLKDL
FT                   KQHLGGTNDAIKEAPQEIQMPDFSNLEIATAAALQMRATMGSPNIDLSNGVTTEYRVVE
FT                   GDYGDIPVRIYRHEEATKPVPAFIFYHGGGFVGGTPAVVENFCKGIAEKLPAVVINVDY
FT                   HLAPEFPAPAAPKDCYRALEWVVEQSDELGIDASKIGVSGDSAGGTLAAAVSYMDYEAE
FT                   TNYVGFQALLYPALTLVDEDNDKYQWDISKFGASEETLPLVAPGIIGMNSSGELLRTAY
FT                   VRDENPASPIYSPLSAVDKSIYPPTLIASAEFDALRAFADIFAKELRASGVQTKAIVYQ
FT                   GMCHAFIDKYGIFPQAEDVADEIVQMMKEIF"
FT   regulatory      121691..121712
FT                   /locus_tag="Lm4b_00114"
FT                   /regulatory_class="terminator"
FT   regulatory      121780..121785
FT                   /locus_tag="Lm4b_00115"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        121795..122493
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00115"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00115"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03906"
FT                   /protein_id="CAS03906.1"
FT                   /translation="MKFQLFIQPKLDVLQGNIVEYEILLRDDSAVPRFPLSELEAVLAD
FT                   EELYLAFSEWFSEAFLDVLKKYPNDRFAINIAPQQLFYIETLHWLDKLKSESHRITVEM
FT                   TEDIFDVPGHKRHLNANDKNAFILNKIKVIHGLGYHIAIDDVSCGLNSLERVMSYLPYI
FT                   IEIKFSLIHFKNIPLEDLLLFIKAWANFAQKNKLDFVVEGIETKETMTLLESHGVSIFQ
FT                   GYLVNKPFPV"
FT   CDS_pept        complement(122463..123158)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00116"
FT                   /product="Putative transcription regulator, Fnr/Crp family"
FT                   /note="Weakly similar to transcription regulators, Fnr/Crp
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00116"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03907"
FT                   /protein_id="CAS03907.1"
FT                   /translation="MFHTIDFSDIFSSDYSNKISFKKGEIIHSYRDYEEKTPQIGAILE
FT                   GTAVLEGPTNEGRWMINALIGQHSLFGMESLLETKTAPELTEYRVRALENGTVLFIDRE
FT                   FLLNYLYANPQFFHLILDEVIVRYLFTSKNYKNINQAPIVKVTRILVEIIELLHLHQTE
FT                   GAIELPVYVTQTFLADYCRSSRARVTEVLEELRESGLLLSKKPITISSHENLLNQIDSF
FT                   QTGNGLLTR"
FT   regulatory      complement(123352..123374)
FT                   /locus_tag="Lm4b_00117"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(123377..123829)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00117"
FT                   /product="Putative protein gp35 from Bacteriophage A118"
FT                   /note="Similar to protein gp35 from Bacteriophage A118"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00117"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03908"
FT                   /protein_id="CAS03908.1"
FT                   /translation="MYEKLVNKYQDEVTIREEKMPYKLPGLYLNGTIFISKDQSSIEKG
FT                   CVLVEELMHYKYTVGNITKQETIMDKKQEIFARRKGYEELIPLDDIIACFYLGLREYFE
FT                   VAEFLEVTEEFLRHTVTHYAEKYGPMYDYGGYFINFGNSIDVYKKF"
FT   CDS_pept        complement(123835..124170)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00118"
FT                   /product="Putative repressor C1 from lactococcal
FT                   bacteriophage Tuc2009"
FT                   /note="Similar to putative repressor C1 from lactococcal
FT                   bacteriophage Tuc2009"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00118"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03909"
FT                   /protein_id="CAS03909.1"
FT                   /translation="MELNKFVGNKIKQYREERGLNQEALAEKLHTTRQTISRYENGDRK
FT                   ANQDVLFELAKIFNKRLDDFFPERNLPPVDERLVTIAAHIDDDVTEEEMRDILAYIEMK
FT                   KKLHRGM"
FT   regulatory      complement(123838..123843)
FT                   /locus_tag="Lm4b_00117"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124387..124815
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /locus_tag="Lm4b_00119"
FT                   /product="Putative Antigen D"
FT                   /note="Similar to Antigen D"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00119"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03910"
FT                   /protein_id="CAS03910.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEQEENRFIRKRLIEELEFFEALGDREKG
FT                   LLTAEQKLLILTPSEYREYKRTKSDVQISRLIGVSRSSLAEWKRKKGLNRKKPQPVQQE
FT                   MIDVLAFHLDKTKDEIGALPASAIECQYEAFVINEAHN"
FT   CDS_pept        124827..125243
FT                   /transl_table=11
FT                   /gene="lmaC"
FT                   /locus_tag="Lm4b_00120"
FT                   /product="Putative Antigen C"
FT                   /note="Similar to Antigen C"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03911"
FT                   /protein_id="CAS03911.1"
FT                   /translation="MQVLVLPENKDINYIKTVQEVKRFFADFERFRMITGLSKKPQLLR
FT                   NGFLEEPQFAPVAFSARHNKEVILEARWLVEKYTEMLNQMDDLYRTILMECYVERKQDV
FT                   AVMMDLPYEIAQFKRIKKRAVLEIATLMGILVRK"
FT   CDS_pept        125523..125912
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /locus_tag="Lm4b_00121"
FT                   /product="antigen B"
FT                   /function="antigen B"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03912"
FT                   /protein_id="CAS03912.1"
FT                   /translation="MKSLSFMRVLEAVRTMLQEKGGLDVSIVMRDQVEMPTTMIEMIDQ
FT                   EEEESQTAWKEKYRFAIHHYTNETDLAGVEMIDTLIQTGFTLPEGYKLIAVRHYGKQNL
FT                   VKENTLIHAKTSFEVSICRELKVKI"
FT   CDS_pept        125925..126437
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /locus_tag="Lm4b_00122"
FT                   /product="antigen A"
FT                   /function="antigen A"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00122"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03913"
FT                   /protein_id="CAS03913.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
FT   CDS_pept        126485..126787
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00123"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00123"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03914"
FT                   /protein_id="CAS03914.1"
FT                   /translation="MFEVNDTTYILRFNKQKVKTVELTSGISLVAALTANKGILSYQVI
FT                   ETLFVSGLVEEKGLVPVKQKEALEIFDKLVEEQGLISLNVAVIEKLQEDMGFLFR"
FT   regulatory      126815..126820
FT                   /locus_tag="Lm4b_00124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126829..127233
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00124"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00124"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03915"
FT                   /protein_id="CAS03915.1"
FT                   /translation="MDSEMNHDFDLEKQFAFFVVNFQMSKHDFEELTEVEKNFIMKEWE
FT                   NKVIFESTMLRNAVLNAEQNLNRKRNSRFIDLHKKRQKKADVNYTVNALQAISDNEAKE
FT                   GKAWIDRIYGANGLRRPKNKEERGKVNGGF"
FT   CDS_pept        127220..129088
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00125"
FT                   /product="Putative bacteriophage minor tail proteins"
FT                   /note="Similar to bacteriophage minor tail proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00125"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03916"
FT                   /protein_id="CAS03916.1"
FT                   /translation="MADSKSFTFELNESVLTAQVGRLDEMAMVVERRFSELKMTIEDVG
FT                   NADPGSKISESLGGLQSGLGTISSAFGQLGSSSEAITSGFGTAVGSVGGITDAFKNLGS
FT                   SVQNGTLFSSLATGIGGMSTMLGGVSGGVQGITNLASGFMELKKHLGGLMSSIGGVGGI
FT                   MGKLTSPMGLVIIGIVALVAAFAYLMTTNESFRNTVMSVVTQVAQLFGQLVASLMPIIM
FT                   QIVTAVMQIGAALMPMVMQFISFFAQLLAQLMPFINMLISMLMPVIMQIVQVVMSLVSA
FT                   LLPSIMTVIQGIMSVIQFLIPIIMQIATVVVQIVVTIISYISKIMPIVMTIIGVIVSII
FT                   TTIISYVVIIATTIASVIGKIISFIASVITAVIGIVQPIIGFITNIFTTIVTIIGAAFQ
FT                   MVFTVASKIWNAIMTTISGIIEGIKAVITGISTTVSSVFNGVKRIITGVFDGIKSAWGG
FT                   LTDFVGNIFDGVSSAIQTVVDNVKGFVNVVIRGINGAIGLINKIPGVEIGKIPQLISGT
FT                   TNFQGGFARMNEGGRGEMVVLPSGSQVIPHDATMKYARESARGNKSMLYTSQGADLARV
FT                   ENLLERLLQKNPVIKMDDKVVAEVVSRNQANSFDQYNYTMGGAAYS"
FT   CDS_pept        129085..129903
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00126"
FT                   /product="Putative phage protein"
FT                   /note="Similar to phage proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00126"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03917"
FT                   /protein_id="CAS03917.1"
FT                   /translation="MSDLFLELNGKVHSLSETFPGLSVQEVSRQSPQLSMETAEIAGTD
FT                   GVIPGMTQFKPFIFSAKCNLQALDIPDYHLAVREIYEFLFQRDSYYIWSDQMPGIRYEV
FT                   HPKPVDFSRESDRVGLLTIEFDVFKGYAESRGTSLDPMTFEVDLWQMGMNLSNRDDLFY
FT                   IFKENTFRVYNAGSDRVNPLMRHELDIAMTANGTPTIHNLTTGESFEYRKALQKTDVLL
FT                   LNNIYPLVNNRRVGKDTNHGIITLEKGWNDFEIKGVTDVTIAFNFPFIYR"
FT   CDS_pept        129913..131049
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00127"
FT                   /product="Putative protein gp18 from Bacteriophage A118"
FT                   /note="Similar to protein gp18 from Bacteriophage A118"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00127"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03918"
FT                   /protein_id="CAS03918.1"
FT                   /translation="MDYVIIQSMDKEVEEILTDIDYGSFSYDYEKNTSRAISFTVNKTK
FT                   QNAAIFDLVGNEAILTYQGQQFVIKKCTPKSIGGTISKQITAQHICYTVQDHVQYNVKS
FT                   GRKKYSIQTVLEFALQDNVLGFSYEIQGSFPLVELEDLGNKNGLELVNLCLEEFGAILF
FT                   ADNKKLYFYDEKSWYVRTEKQFRYLYNTEEVSVDTNTDNLKTEIKCYGKQKENADKLTG
FT                   DNKYMAVVTYTSPNEAIYGKRMANAKSDDKITNNDDLLIFAKKQILDVPETALTISYKG
FT                   KEPVLERDVWYFIHEPMGFETEVKVTKIKSSHPWSKKFQEIGFSNSRRDMVRIQTQIAN
FT                   QVKKTSVDTNKINSFSSIAMNAYDSRILTEVVGVVDGD"
FT   CDS_pept        131039..131338
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00128"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00128"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03919"
FT                   /protein_id="CAS03919.1"
FT                   /translation="MATEIRVLKNVDDTVFYPKTHVTAVEGLDSATTTTSGLMPASDKT
FT                   KLNGIEANAEKNNVTAIDIANWNKKQDAILVSENGSNFKITVTNAGELKATKVE"
FT   CDS_pept        131353..131928
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00129"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00129"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03920"
FT                   /protein_id="CAS03920.1"
FT                   /translation="MKLDLWKWEMLLQGREFRNKTNDNWQKLMDWSDFISTGLSAIYVY
FT                   VNKADATLNNKIDTVDKAVNARVNELISGTEQLSEVVDARVDAFGARFPVLRERLNQEQ
FT                   VIYNKKSTVQFDVNTIINMEKQDIGLLTSKTISEAQTVCFLNISSLNEDADIVLEKTGE
FT                   TSFSENLTSLVFAKIGTNERYQMEPVGA"
FT   CDS_pept        131943..132422
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00130"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03921"
FT                   /protein_id="CAS03921.1"
FT                   /translation="MTEIKRMLQTKEDNSKEQFYPETHVAGIVGLTEYVSGQLPTGVVS
FT                   VNGKAGRVLLDAEDVHAAKKSHNHEVATYTTDGFMSSFDKQKIDQLVSPEAGVTSINGK
FT                   TGIVDLFAADLDAAEINHTHAEATTTESGFLAKEDKEKLDAMQIIALETIKEVIE"
FT   CDS_pept        132419..132955
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00131"
FT                   /product="Putative protein gp20 from Bacteriophage A118"
FT                   /note="Weakly similar to protein gp20 from Bacteriophage
FT                   A118"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03922"
FT                   /protein_id="CAS03922.1"
FT                   /translation="MTKIVKMSEKNEHGTLEQFYPETHAEAVKGLVSVSEEEKATWNEK
FT                   ETTAGAEQKANTALNSVKDYVDTIGKGTVIFKGANIMAAGQKYTWNSSKLKFGITLLFS
FT                   RYDSANNTPLDYYYHSVFLSKAQLAELAGKGLLVPMPSATYGERKYLYVSETEVAGHND
FT                   NTNNASWALRQLTVM"
FT   CDS_pept        132974..133396
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00132"
FT                   /product="Putative a protein from Bacteriophage phi-105
FT                   (ORF 45)"
FT                   /note="Similar to a protein from Bacteriophage phi-105 (ORF
FT                   45)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00132"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03923"
FT                   /protein_id="CAS03923.1"
FT                   /translation="MEVILKIGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDAKSGEDEEKHDKDMD"
FT   CDS_pept        133377..134105
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00133"
FT                   /product="Putative autolysin: N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /note="Similar to autolysin: N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00133"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03924"
FT                   /protein_id="CAS03924.1"
FT                   /translation="MTKIWIDAGHGGKDSGASGNGLVEKNWVLTVAKQLQTELVKAGFE
FT                   VGMTRTNDTFYELSDRAKKANSFKADLFISLHFNAGGGKGYEDYIYTSVPAATVEIQKI
FT                   IHKNIIAKVTKHGMNDRGMKKANFAVLRETAMDAILLEAGFCDSTDALILEKKAYQTDY
FT                   CLGIVAAVQEIFGAMVTKYRAGKYLTSDDAISGTNIKGYLEAGTKVFVYKETEKTLNLT
FT                   TTKGVPGSWVLKTEVNTGKR"
FT   regulatory      134110..134132
FT                   /locus_tag="Lm4b_00133"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(134110..134132)
FT                   /locus_tag="Lm4b_00134"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(134143..136497)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00134"
FT                   /product="Putative 5'-nucleotidase, putative peptidoglycan
FT                   bound protein (LPXTG motif)"
FT                   /note="Similar to 5'-nucleotidase, putative peptidoglycan
FT                   bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00134"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03925"
FT                   /protein_id="CAS03925.1"
FT                   /translation="MKVNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILG
FT                   INDFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVG
FT                   ASPAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAY
FT                   PRVKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIK
FT                   DYDFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMITKA
FT                   NELDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVTPPD
FT                   AKITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKES
FT                   ELGNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGN
FT                   ILQVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVTSVTTEDGTP
FT                   LKADQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQK
FT                   EGRKVYKSQAEIDKETEDAAIKAIKDATKINKLAEKDKTLTGTTLPGATVSVQKATANA
FT                   RMALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPP
FT                   DNGNGGTDNGNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTPNTSTTGTSANT
FT                   SLPTTGDTAGFATVFGIVLTTTALYVLRKRS"
FT   CDS_pept        136685..137434
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00135"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00135"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03926"
FT                   /protein_id="CAS03926.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLIRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEDIKEKYSFV"
FT   regulatory      137453..137495
FT                   /locus_tag="Lm4b_00135"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(137453..137495)
FT                   /locus_tag="Lm4b_00136"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(137504..139012)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00136"
FT                   /product="Putative inosine monophosphate dehydrogenase"
FT                   /note="Similar to inosine monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00136"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03927"
FT                   /protein_id="CAS03927.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILDLKEKTGHSTVAVTEDGTAHGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
FT   CDS_pept        139179..139412
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00137"
FT                   /product="Putative YjdI protein"
FT                   /note="Similar to E. coli YjdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00137"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03928"
FT                   /protein_id="CAS03928.1"
FT                   /translation="MDEETLLERGYRKYRGAEVDIYFNTNICEHSGNCVKGNAELFNLD
FT                   RKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK"
FT   CDS_pept        139424..139702
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00138"
FT                   /product="Putative YjdJ protein"
FT                   /note="Similar to E. coli YjdJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00138"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03929"
FT                   /protein_id="CAS03929.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKTEGKKIVPLCPFAKAEFAKKPEYQEVQAAK"
FT   regulatory      139709..139733
FT                   /locus_tag="Lm4b_00138"
FT                   /regulatory_class="terminator"
FT   CDS_pept        140028..141602
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00139"
FT                   /product="Putative oligopeptide ABC transport system
FT                   substrate-binding proteins"
FT                   /note="Similar to oligopeptide ABC transport system
FT                   substrate-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00139"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03930"
FT                   /protein_id="CAS03930.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSLIIG
FT                   VTGDPEVINPNYASDRVTLTIQQAVYAPLFWEVDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVNSILDTKQNSPNRGNFVFDDKPVKVEAVDDTTVKFTLPTVA
FT                   PAFENTIKTFFPIPKHIFEGVENIEKSDKNKNPIGSGPYKFVEYKTGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YATFNENQPALKSKELRQALSYALDREEIIDAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKKLVKESGFDTSQKLTVYYLNNSKSQESIALYLQQQYKEIGVTLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLYLSDAPYNYSNYHNKDLDALWEKG
FT                   AVTADDKERQEIYEKIQNTIADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
FT   CDS_pept        141704..142654
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00140"
FT                   /product="Putative oligopeptide ABC transporter, permease
FT                   protein"
FT                   /note="Similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03931"
FT                   /protein_id="CAS03931.1"
FT                   /translation="MLKTIIKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYVQYFIWLGNLLQGNLGYSIVNSQPVLQQILERIPATLGLVGT
FT                   SLVLTLLLSIPLGLVAANYENTWIDKVLNGISYIGISIPIFWFGMILIDVFSIQLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQIMGHHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIVDPRIREMG"
FT   regulatory      142651..142656
FT                   /locus_tag="Lm4b_00141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142665..143558
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00141"
FT                   /product="Putative oligopeptide ABC transporter, permease
FT                   protein"
FT                   /note="Similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03932"
FT                   /protein_id="CAS03932.1"
FT                   /translation="MRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSVL
FT                   ILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLVG
FT                   VFAMMIAVVVGTLAGTVSGYFGGFIDNMVMRFLDIFMSIPSFFLLMILNAYLKPGISNI
FT                   IIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVAA
FT                   SLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTILS
FT                   FNVLGDVLRKGLSRRY"
FT   regulatory      143568..143592
FT                   /locus_tag="Lm4b_00141"
FT                   /regulatory_class="terminator"
FT   CDS_pept        143759..144043
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00142"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00142"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03933"
FT                   /protein_id="CAS03933.1"
FT                   /translation="MSEIKVKEATLKKHATKLESKGKSTEYLPMKGGNMAYSQANSINH
FT                   FRTALFDLVDAVDNFQGVVGTDAKRLKELGVSFTRKDQELERGMGLGGK"
FT   CDS_pept        144044..144412
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00143"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00143"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03934"
FT                   /protein_id="CAS03934.1"
FT                   /translation="MDAKSQQMETQLQLLKKEQSAAEDFLQDLQRQQNEQEWLAEDFAR
FT                   VHQEERESLELLREVWQGAESRSFGYYLADLQEEEKQKWHKKIQANQEEHQQKITACQK
FT                   NIYQLENQQQDLQKELLQ"
FT   regulatory      144396..144401
FT                   /locus_tag="Lm4b_00144"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144409..145713
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00144"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00144"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03935"
FT                   /protein_id="CAS03935.1"
FT                   /translation="MSRIDIGEIQTFAHQLHTANEAGRKSIKDIKKAVKNYTEDGSLKG
FT                   KAIDASKNYYQMTYFPLCDAIIEAMNESEERLSQYIADFHAQVDGSADARIDADGLYEL
FT                   GKMIDRIEAKKEALAQRMNTGTEGQMQSYRSQLSIAYKQENILEKYLAFEQSHGGFFDN
FT                   LTDLVQGIQQTIRELQSNIQFNSKTGTYDMSKLNFTTVTRMQNALGKALKNNETTFNFD
FT                   EYQKTYRGQMWVLMKNGIVDVEATNAYNAAVLNGELPHESNEAQEEAELLQAVIQSVKK
FT                   GRDPVTGQEISKAQGFSIISGLVFRYTAGGYKGKKFKVSKDWLHRRKKNNGVEVGTDFG
FT                   KIGKLVNHPNIKINWSEHSEHGMSRLKQRGLSKSQVDDFVERGKALSQNGGEKFAFITE
FT                   NGVAIVSKDGKLVTAWGKKDFDEGMEKIIEKLYGK"
FT   regulatory      145709..145714
FT                   /locus_tag="Lm4b_00145"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145723..145965
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00145"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00145"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03936"
FT                   /protein_id="CAS03936.1"
FT                   /translation="MYEKVEKIINDWDPIELFPLAPKDEYSQEINKIISIVQENHNIDM
FT                   NVLAKGIRKIFIDSFGENLIFKNNEDEIAEKILAL"
FT   CDS_pept        145986..146429
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00146"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00146"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03937"
FT                   /protein_id="CAS03937.1"
FT                   /translation="MEEQEIIGKIESLPNNFSENDSIYISQENIKNLVLFSKENQTVLE
FT                   LLITPFLICVNSGLKYELHYYEISTEISKNDTEIIGFPFGNKLPKEITDNISPKLFVRR
FT                   EDYSAFENFLSQYFNAMKSMEFADDKQAIGMIEHGATLFYEVL"
FT   regulatory      146464..146497
FT                   /locus_tag="Lm4b_00146"
FT                   /regulatory_class="terminator"
FT   CDS_pept        146661..146897
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00147"
FT                   /product="Putative Hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00147"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03938"
FT                   /protein_id="CAS03938.1"
FT                   /translation="MPDWDFNNPESMKAWDLASGSYAEQVSGEVRAVVGSDLRKGNIWE
FT                   NVELPRLKNNPNVTKITTIDPKTGLEKIIFERK"
FT   CDS_pept        146930..147136
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00148"
FT                   /product="Putative Hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00148"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03939"
FT                   /protein_id="CAS03939.1"
FT                   /translation="MKFDLENGYVVKADGEMLVGGEFVVFKDSMKNWEPPYENKKLSES
FT                   EVQEIIQQVKQSTNENTVQISFE"
FT   regulatory      147211..147216
FT                   /locus_tag="Lm4b_00149"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147224..147571
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00149"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00149"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03940"
FT                   /protein_id="CAS03940.1"
FT                   /translation="MDNFYKGFEGYPEIDFYTYINGEKTGIEMWEGYFDSIMNELSPVD
FT                   GRWVSLAYYYHLYEGWYDESPWVIPDNKKALEQFETIDVKILDNVTQEVMMKLIKLLKD
FT                   NLDSEIFIEYS"
FT   regulatory      147581..147609
FT                   /locus_tag="Lm4b_00149"
FT                   /regulatory_class="terminator"
FT   CDS_pept        147717..148514
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00150"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT   regulatory      148504..148509
FT                   /locus_tag="Lm4b_00151"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148520..148876
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00151"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03942"
FT                   /protein_id="CAS03942.1"
FT                   /translation="MINSRFYEGFEGEAEISFVAGDNKLVIWNGYFETILDNLLDCNVE
FT                   REGVLKEFFNHEGWYDDSPWMIEDNSLTITQLKCFDISKINQTSMKDDLEEVVKTIISF
FT                   FENNRFSKIYIEYE"
FT   regulatory      complement(149119..149143)
FT                   /locus_tag="Lm4b_00152"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(149162..150817)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00152"
FT                   /product="Putative oligopeptide ABC transporter-binding
FT                   protein"
FT                   /note="Similar to oligopeptide ABC transporter-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00152"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03943"
FT                   /protein_id="CAS03943.1"
FT                   /translation="MHFLKKTLPIFAILTVLLLTACGNDNEKSTTKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPEISADQTKYTIKLKKN
FT                   AKWSDGSQVTADDFVYAWRRVVDPKTAPGYSALFKDSIKNATEINEGKLPVTDLGVVAT
FT                   DPTTLEITLKKPVPYFISLLSFETFFPQKESFVKKQGDKYGTDSAHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDQYWDKDNVKVNEIDVQVAKDINAGVNLYNTNEADRVPLSGDFAKQY
FT                   KDKKDFQTEKDALISYLRMNQKRDGKATPLANNSLRHALNLAVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGDHLVYNKEEALKYWKQAQKELGTDKVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTSDGNYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYFNNHMSYNSPAYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIRVEK"
FT   CDS_pept        151040..151981
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00153"
FT                   /product="Putative a probable high-affinity zinc ABC
FT                   transporter (Zn(II)-binding lipoprotein)"
FT                   /note="Similar to a probable high-affinity zinc ABC
FT                   transporter (Zn(II)-binding lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00153"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03944"
FT                   /protein_id="CAS03944.1"
FT                   /translation="MKKWSFLVVTVLAFVLVLAGCGASNNKVSGDKDKLKVVTTFYPMY
FT                   DFTKNVAGDNASIEMLIDAGTEPHDYEPSAKDIAKIEAADVFVYNSEDMETWVPSVLKS
FT                   LDSKKLTVIDASKGIELVEGTEEEDHDHEHEEGHHHEHDPHVWLSPVLAEQEVTNIQNG
FT                   LTKADKTNADTYKKNAETYKEKLKTLDNKFKTAFEGAKQRDFVTQHAAFQYLAKEYDLH
FT                   QVAIAGLSPDQEPSPARLAELQKYVKENNISTIYFEEVASPKVAETLANETGAKLEVLS
FT                   PIEGITDKEQKKGMDYIAYMEQNLQALQKTIK"
FT   CDS_pept        151994..152698
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00154"
FT                   /product="Putative high-affinity zinc ABC transporter
FT                   (ATP-binding protein)"
FT                   /note="Similar to high-affinity zinc ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00154"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03945"
FT                   /protein_id="CAS03945.1"
FT                   /translation="MKYIDIANIGFKYESEPVLENISFQVSAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVTFAKKNADGGRLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTTKDHAHVEKALKSVEMWDYRHKRIGELSGGQKQRICLARMFATDPDILILDE
FT                   PQTAMDKQSKIRFYDLLRHEAQVHGKAILMVTHDSEEMEDFVDKHIRLIRKEDVSWKCF
FT                   SMDLCKEPSKHQ"
FT   CDS_pept        152647..153453
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00155"
FT                   /product="Putative high-affinity zinc ABC transporter
FT                   (membrane protein)"
FT                   /note="Similar to high-affinity zinc ABC transporter
FT                   (membrane protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00155"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03946"
FT                   /protein_id="CAS03946.1"
FT                   /translation="MEMFLYGFMQRAFQASMIIAIIAPLLGVFLIIRRQSLMADTLSHV
FT                   SLAGVAFGLVLNVNPSVTTLIVVVIAALGIEYLRGVYATYSELSIAILMAGGLAVALVL
FT                   MSLDQGGITTSVQQYLFGSIVTISKAQVQLLVILGVAIVVLFLVFKRFMFVLTFSEDVA
FT                   VAEGVPVRLISLLFSVVTGIAIAVIMPIAGALLVSALIILPAAIGMRISKGFLMCVISA
FT                   ILIGLVGMFSGLVSSYQLGTPPGATITLMFIILFIISTVVLKMARK"
FT   CDS_pept        complement(153457..154137)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00156"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00156"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03947"
FT                   /protein_id="CAS03947.1"
FT                   /translation="MPKNLYNYQEFIRLSHEGKIAFEQIDVPKNASLLTEKIDIDNHIY
FT                   LVVDGYIALILNDGSQNPKIYSIQGKGTFLNYFTLLDRSNNHFNFKTLSGCSLYKYSKA
FT                   DMEYFLSMFPENFGFQFFIMKNQTTHIYFKSLMASSPASEKLKTTFSNMALLHGVLSDD
FT                   DTVILPQAIKTSHLLSYSNLSKSCFYKDLQHLKTTNQIEKKEKSWIIHDQELYAMIQNG
FT                   QTSF"
FT   regulatory      154402..154407
FT                   /locus_tag="Lm4b_00157"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154415..156754
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00157"
FT                   /product="Putative ATP dependent helicase"
FT                   /note="Similar to ATP dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00157"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03948"
FT                   /protein_id="CAS03948.1"
FT                   /translation="MRRVRISVRRLVEFVRRSGSIDNRMTNSDRALEGTKIHQLLQKEA
FT                   GEEYAAEVRLNLERIVDGIAFSLDGRADGIINSRMIDEIKTTETPMDEITEDFRPLHWA
FT                   QLICYGFMLAEKSDLAEVTLQLTYYQVVDKEVKQFQHVMSREELSVFVDDLLSQYAIWA
FT                   KASAAWEMKRNKTIQELTFPYDNYRSGQRELAIAVYRTISSEESLFCEAPTGIGKTMST
FT                   LFPGIKAMGEGKTDKLFYFTAKTITRQVAEDALDEMRRKGLAARSVTITAKDKICFLDE
FT                   RKCEPDHCQFARGYYDRLNEALFDMLQSEEAITRQVVEGYARKYTLCPFELSLDVALFC
FT                   DVIVCDYNYLFDPVVYLKRFFAEGPGKYTFLVDEVHNLVDRARSMYSATLKKSTVMQVK
FT                   RGLDSKKNKRLLNAINVMNKEMIVLNKKLKDLEKTTYVQKSELVDWNAAVLKFTFVAKE
FT                   WLPQNTQSELQVDVLDLYFESLRYTAIAEFYDERYVTQVTRNHRDLEIKQLCLDPAFLL
FT                   SERLKLGSSSVLFSATLRPIDYYTNVLGGQEDTSRMIFSSPFKQKNMHLLVADYISTKY
FT                   QMRENSMEAVVDALYALVSGKNGNYIFFFPSFLYLQKVYDLFKEKYPNIRLQKQETAMD
FT                   EKQREHFLEDFHAENVETLIGFCVLGGVFSEGVDLRGNRLVGAAVVGVGLAQLNHESDL
FT                   IKDYYNETIGRGFDYAYQIPGMNKVLQAVGRVIRGESDRGVVLLIEERFSADRYRALFP
FT                   THWNHAKTVKTTDDISREVAGFWRNS"
FT   CDS_pept        156799..157611
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00158"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00158"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03949"
FT                   /protein_id="CAS03949.1"
FT                   /translation="MYKIIAIDIDGTLLNDAHEITLAVRDSIKAAKAKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDEGDYVITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKIT
FT                   DVIKKLPESIKEKFYVVRSVPYNLEFLQKGVNKGSALASLAEKLGVSQSEVMSIGDQEN
FT                   DITMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLILDR"
FT   regulatory      157693..157721
FT                   /locus_tag="Lm4b_00158"
FT                   /regulatory_class="terminator"
FT   regulatory      157882..157887
FT                   /locus_tag="Lm4b_00159"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157896..159995
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00159"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /function="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00159"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03950"
FT                   /protein_id="CAS03950.1"
FT                   /translation="MSKNGNFLKKVGLAFLSILIVASTIFQTTVVKAATSYGSQFLNTV
FT                   ELLDKDGVPQTDFGYYDNMDVHYTWSIPNSTNVKAGDTMDFTLPSQLALATDLAFDVKD
FT                   SNGQVVGTATVKRATNQVTLVFSDYVEKHSDIKGELDFWTTFNQKVITGNETVDLEFPL
FT                   ENGTTQIDVKVGEKTPVSPTETLFKYGWVDASNPSLIHWVIRVNYAKVNIPNAVFTDII
FT                   GSKQTLNFDSIKAFHGTYSADRIFTAGAAISSTNFSATSDGFSVALGDLTDSVQISYTT
FT                   TATDGGKSTQYDNTAKLAGTDFVPKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKAT
FT                   LEGAEFKLVDSKGTVLQENITTNASGQLSIADLKFDTYQLIETKAPTGYKLDTTPVEFT
FT                   IGENNQAITVTKENTLNTGSVELTKLDSATKATLAGATFELQDKEGNTLQTGLTTDENG
FT                   VLKVTDLVPGSYQFIETSAPTGYKLDNSPVSFEIIASETDQIVKVTKENTLEVGSVELT
FT                   KLDSATKATLAGATFELQNKEGNTLQTGLTTDENGVLNVTDLVPGTYQFVETKAPIGYE
FT                   LDTTPVVFEIIAGETDQPVKVTKENTLVPPTPVPPTPVPPTPVPPTPIPPTPLPPVPYE
FT                   PTVPPTKPAVPVTPKKSENSEDSPKTTQIRITKSLPKTGDTNSFAGLGVILIALSLSGL
FT                   LLKRK"
FT   regulatory      160002..160027
FT                   /locus_tag="Lm4b_00159"
FT                   /regulatory_class="terminator"
FT   regulatory      160174..160179
FT                   /locus_tag="Lm4b_00160"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        160186..160644
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00160"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /function="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="PSEUDO:CAS03951.1"
FT   CDS_pept        160587..161945
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00161"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /function="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT   regulatory      161954..161981
FT                   /locus_tag="Lm4b_00161"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(161954..161981)
FT                   /locus_tag="Lm4b_00162"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(161988..162824)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00162"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00162"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03953"
FT                   /protein_id="CAS03953.1"
FT                   /translation="MNESNGSMELYLREHTEEIINKWLSKIYENENTYTSFVYSPRYKD
FT                   ELRADSEQTADLIISYFAGKKAFFEKLDKWLDNMYARRMENEVPLPEVITTLDKLRREF
FT                   VSAVGDFCIHNDEVSKCDFSSSLSMVNHGFDRINEAFSAMYYNDIVKHLEQQHRLIEEI
FT                   STPVISITDKLAILPLMGSVDRERAEKLSEITANKCVHLGVEQLCIDLSGITYFDDALG
FT                   EMLTNLVTMLKLLGVEAFISGIQPKMAQQINRVELNLSIPAYHSLKAVLQDQTRTI"
FT   CDS_pept        163041..164033
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00163"
FT                   /product="Putative DNA polymerase III (delta' subunit)"
FT                   /note="Similar to B. subtilis DNA polymerase III (delta'
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00163"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03954"
FT                   /protein_id="CAS03954.1"
FT                   /translation="MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLFEGARGTGKKRTA
FT                   LWLAQSLFCLESTETELACGKCANCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
FT   CDS_pept        164039..164872
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00164"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00164"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03955"
FT                   /protein_id="CAS03955.1"
FT                   /translation="MLKIVGVRFKDVGKIYYFSPGELEITENQGVIVENAQGIEFGKTV
FT                   IEPRYVDEEDVVLPLKKVLRIATEADYKCVAENGDSCQKAFLLCDEKIRERELEMSLVD
FT                   VDYTFDRNKVIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYEQAKREMPDV
FT                   GVKVKTPEGIEARVSGINLLSRILQVSLPEEETVIEYELDELRPYNEFLKQPAKS"
FT   CDS_pept        164883..165272
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00165"
FT                   /product="Putative YabA protein"
FT                   /note="Similar to B. subtilis YabA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00165"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03956"
FT                   /db_xref="GOA:C1KXY3"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KXY3"
FT                   /protein_id="CAS03956.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAEIEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
FT   regulatory      165298..165303
FT                   /locus_tag="Lm4b_00166"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165309..166082
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00166"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00166"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03957"
FT                   /protein_id="CAS03957.1"
FT                   /translation="MLEKVNHLEKLELIGDERLDYLLAENLRIIQSPSVFSFSIDAVLL
FT                   AKFSYLPIRKGKIIDLCSGNGIIPLLLSTRTKAKIVGVEIQERLADMAKRSVAYNQLED
FT                   QIEIIEYDLKKITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDT
FT                   IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLVEGI
FT                   KDGKPGVKYVPPVIVYDELGEYTPVIKEILYGESE"
FT   CDS_pept        166066..166335
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00167"
FT                   /product="Putative YazA protein"
FT                   /note="Similar to B. subtilis YazA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00167"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03958"
FT                   /protein_id="CAS03958.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVIRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLIQREESE"
FT   CDS_pept        166332..167213
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00168"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00168"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03959"
FT                   /protein_id="CAS03959.1"
FT                   /translation="MIKSQKSFSGASQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPG
FT                   YELVQSALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKMVMKARNLP
FT                   KREVYSAYHEIK"
FT   regulatory      167216..167251
FT                   /locus_tag="Lm4b_00168"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(167216..167251)
FT                   /locus_tag="Lm4b_00169"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(167258..167542)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00169"
FT                   /product="Putative transcription regulatory protein AbrB"
FT                   /note="Similar to B. subtilis transcription regulatory
FT                   protein AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00169"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03960"
FT                   /protein_id="CAS03960.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIVL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAELMEEIKRRFGDTL"
FT   CDS_pept        167656..168513
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00170"
FT                   /product="Putative a glucose uptake protein"
FT                   /note="Similar to a glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03961"
FT                   /protein_id="CAS03961.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTATIIIASFISGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
FT   regulatory      168564..168569
FT                   /locus_tag="Lm4b_00171"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        168575..169843
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00171"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03962"
FT                   /protein_id="CAS03962.1"
FT                   /translation="MIMNANLEVNAEVVKESYVYLLSRYLVLRQENFDTKEDKIPYNTL
FT                   KHNSISPADANFVNPNFDVVYSEAWIAVDDENAVILEVPEIKNRYYTVQLLDGWGEVVT
FT                   NINERNYPEHPHGKFAFVKKGTNPSVPSDAVKIELPSEKVKVLLRVEQKDDPEGAVKLQ
FT                   KAFKFDAPDNIKIKEPLEIPHFTNAEFLLEEIYSNLEELLATYPDKMPRATEFQDKARQ
FT                   VAAYIELGDEQKAEVRNLIVKEAIPYFTNGAKGFGTQKGGWSVTYVAGAFENDILARAI
FT                   INYGGIWANSIQEALYFIGQKGTDNELLTGDKVYKIHFPADELPSELADAFWSVTLYSV
FT                   PDYHVIPNKLNKFCINNYSGPKLSEDGSLTLYIASEKPADVDPGNWLPSKAGKEFSLNF
FT                   RLYVPKKEVLEGKVFLPPLEVIK"
FT   regulatory      169858..169884
FT                   /locus_tag="Lm4b_00171"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(169991..171256)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00172"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /note="Putative peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00172"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03963"
FT                   /protein_id="CAS03963.1"
FT                   /translation="MFNKKKTIASLIVLSSLASQIALTPIAALADTHDTNNIALLQNTN
FT                   ENVPYKYTSTLTFPTLTNQTQEDYKLEIKLALPTGMNYTGLQVSVGGEDITNQVGTTSF
FT                   DNSTNTVTFKFDKVTSWDSLSKAKVKFDWKTSYSGEGGEAKIDSLVATATATSEDKAGN
FT                   KSTSTGSLKPKDISAPVVKADKTEVTYNLGSNVTEEQFLTDINASVTDNYDSTISLTSN
FT                   FTSIVNLAVSGDYSVNVQATDKAGNVSNTVNVTVHVATPAPVAGANITVNYLDSDGNKL
FT                   AESDTLTGTIDSNYQSTSKKISGYTLETTPKNATGTFTDTPQTVDYIYKKDTVTPTPIV
FT                   DPVNPVDPVDPVNPVDPVDPVVNKPVIVTPNTDQVTTSNSVEKTTYNSLPKTGDTDQST
FT                   ATTIFGALLLLISAPLLLFKKK"
FT   regulatory      171520..171525
FT                   /locus_tag="Lm4b_00173"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171534..172394
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00173"
FT                   /product="Putative glucose uptake protein"
FT                   /note="Similar to glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00173"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03964"
FT                   /protein_id="CAS03964.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAVGMVLSALIMTHSGGTEKRFNKRTLLLTIPGIIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIVLLKEKKTQKEMFFVIVGVVLVVLGGILIG
FT                   VAKGA"
FT   regulatory      172452..172457
FT                   /gene="metS"
FT                   /locus_tag="Lm4b_00174"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172466..174460
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="Lm4b_00174"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00174"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03965"
FT                   /protein_id="CAS03965.1"
FT                   /translation="MPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYD
FT                   VFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHK
FT                   TSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNE
FT                   VELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTF
FT                   DWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTI
FT                   YWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLRE
FT                   VPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQTL
FT                   VDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWTLAKDEDKRTELASV
FT                   MTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKG
FT                   TPIFPRLEAEVEVTYIQDEMKGSAPAPAKEAAEVEALETPQIGIEDFDKIDLRVAEVKQ
FT                   VDKVKKADKLLCFQLDLGEGKLRQVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLMS
FT                   EGMILSGEKDGKLSVIEASSALPNGAKVK"
FT   regulatory      174468..174495
FT                   /gene="metS"
FT                   /locus_tag="Lm4b_00174"
FT                   /regulatory_class="terminator"
FT   CDS_pept        174624..175838
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00175"
FT                   /product="Putative xylose repressor"
FT                   /note="Similar to xylose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03966"
FT                   /protein_id="CAS03966.1"
FT                   /translation="MDILRKGNKDLIKDINRYTVLNLIREKGEITRTEIAKKCDFGMST
FT                   LTYILDDLQQEGIILEGAETSSTGGRRAKLVRFNKDYGFVVSVKVEEEQLLFALTDLNA
FT                   EIMENTSIPFSSEKKPEEAIELIAKNVKKMCENRDMNHLLGVGIAISGLVNRRKGTVIR
FT                   STMLGWENVALEAMLHAYFPDIPVYVDKNINCYTLAELWLGEGKQSNNFATVSVGAGLG
FT                   LSVVINRQIYYGAQGGAGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKEA
FT                   YPTSELKDFHFDKVAKSARAGDEMATELMGKMGEYLGYGIRNIINTFNPEKVIIVGEGL
FT                   HHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQGAALLVIHQLFQVPIYEEE
FT                   QTLLR"
FT   CDS_pept        175874..176752
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00176"
FT                   /product="Putative sugar ABC transporter, permease
FT                   proteins"
FT                   /note="Similar to sugar ABC transporter, permease proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00176"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03967"
FT                   /protein_id="CAS03967.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFENYKRLFNDPEFWKSFRNTITFIIGYLPSVMILGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPSYGLINYFLSLIGIAGPNWLTDPQTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
FT   CDS_pept        176752..177600
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00177"
FT                   /product="Putative sugar ABC transporter, permease protein"
FT                   /note="Similar to sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00177"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03968"
FT                   /protein_id="CAS03968.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVVVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
FT   CDS_pept        177628..178884
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00178"
FT                   /product="Putative sugar ABC transporter, sugar-binding
FT                   protein"
FT                   /note="Similar to sugar ABC transporter, sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00178"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03969"
FT                   /protein_id="CAS03969.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTKTTIN
FT                   SPENVAALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
FT   CDS_pept        178967..182269
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00179"
FT                   /product="Putative alpha-xylosidase and alpha-glucosidase"
FT                   /note="Similar to alpha-xylosidase and alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00179"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03970"
FT                   /protein_id="CAS03970.1"
FT                   /translation="MSKFTKLMQGYLHLIEGKNEKIKPILLETKPNFTTDSVLETASWL
FT                   WLSSKINHYDREEVEPVIAFLVENWNRPEKSIWGSAENDIYLATISSVYSALLDVKNTF
FT                   PKPELQQTITIIRDYCFDNLLKGDSILTGFNTRKVSTDQLLSVLPFGLFSPEDLVMVAA
FT                   VGKMEQQLVQDDGVLPYSGAPRVNSFATALMALYFLEKSDQDKALHYLNMAMKMEDNDE
FT                   LGAIFIEINQAFRAMESEVTAHISHDPFGHENRYEQQLTERTPHYPETEMHFSAACEVI
FT                   SEVEPIQVELVLKEKDWTILCEKKEKNDVQIWEALVPPLEEVGEYTYYFRATMKDQTTL
FT                   TSDDYTVEPIWKHWSEEAAVCETEQGLMVLFKENPSSIIPVEFTAKSDELVIGLKPSFE
FT                   ASNVKTKSSGQLKKDDLEIIVSNNPVRLEVHFKGNLILESHKIYPALQWYTDKTGAINK
FT                   VKLHLDAPKEEEYYGFGERYNALGQRGNVLDCFVYNQYRDQGTRTYIPMPFYHTNRDYS
FT                   VFVDTARYTSFDLGNQLADKHTITVEINGCDTDIYLLMGDIRSAVANYMKKTGKPAMVP
FT                   VWALGPWMSSNNWDRESVVRTEVETTQELQIPSTVVVLEQWSDEATYYMFNDAEYDEKA
FT                   PSEAYNYDEIRFPSWGRWPDPKGMVDYIHDNKMKLILWQIPIQKYLNRQQHPLKDREEA
FT                   YMIEKGYVVKNPDGSPYRIPENWFTESLIMDFSNEEGKKWWFDKRQYLIDIGVDGFKTD
FT                   GGEFVFGEGLQFADGRRGDEMRNLYPNDYVEAYYQFAQQNDGMTFSRAGYTGAQNFPAH
FT                   WAGDERSTFDAFRRSLIAGLSAGFSGIPFWSFDFAGFNGDIPTAELFIRSAEMATFCPI
FT                   MQYHAESKAEFNQDRTPWNIASRTGDDSVIPIYRHFANVRMNILPYIYNESLKCVETGL
FT                   PMMRALLLDYKEDPRVSDMYDQYLFGEAMLIAPVIEDGVRSREVYLPEGTWYDFWNGTK
FT                   VNGPTLRKCKADKEEIPVFIRGGKAVLCNVDATLKLGSWVGNTVEEYDTPLLKIYVDGD
FT                   FTEEMTDHLSEKWLVKVTENADEVVVSVQTNTPAYEVEVIGTTKKVQIKKGR"
FT   CDS_pept        182272..184563
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00180"
FT                   /product="Putative alpha-glucosidase"
FT                   /note="Similar to alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03971"
FT                   /protein_id="CAS03971.1"
FT                   /translation="MDASTSFAILPSNVKQKTAFERKVNQVKTASWANNCLTGTLDIGQ
FT                   FSCYFVNEKIARVTVNPFGEVDLTPSIAAIHDTEKQAAKFTETTDGYELHFADKEIIIC
FT                   KNPFQIIMKQAGKRIFQTEGLAINRYKEHQISIQSEPGTAIFGLGEKTGALNKAGSIIS
FT                   MWNTDVYSPHNKDTVELYQSIPFMIADTAETTYGLFYDNSHRTEFDFQSFEEMYTILAE
FT                   GGQANLYVIFGEDTKEVVANYTDLTGKTPLPPKWSLGYHQSRYSYTSEEEVERIANTFK
FT                   EKEIPLDCVFMDIHYMDDFRVFTFNPDTFPNGPELIARLREQNIDVVPIVDPGIKKDVD
FT                   YSVYQEGIKHNYFCTKLEGSIYYGDVWPGVSAFPDFLSTTVQHWWGGLHKFYTDLGIRG
FT                   IWNDMNEPSVFNESKTMDLDVVHNLDGKNVTHKEAHNLYGLYMSKATFEGLKRLVPNER
FT                   PFSLTRAGYAGVQRYSAVWTGDNRSHWEHLEMSLPMIMNLGLSGVAFTGADVGGFSSDC
FT                   TKEMLIRWTQAGAFLPYFRNHCVQDSIYQEPWAFGADAEKIVKQYIELRYAFLPYIYTE
FT                   FQKTAESGLPLVRPLYMEFKDERDLIQVNDQFMLGENILVAPIVREGQVKRLVRLPRGL
FT                   WFNYWTKEQFVGGDYIIADAPIDTMPIYIKAGTILPVGSSVQNTKETQDLTLEVYLDGD
FT                   VASGYVYNDDGKSYHYESGAASKTTLTATFKNGEVLINATHQGEANLQHKVTTIQVFGE
FT                   KTDKITRAGI"
FT   CDS_pept        184567..186228
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00181"
FT                   /product="Putative oligo-1,6-glucosidase"
FT                   /note="Similar to oligo-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03972"
FT                   /protein_id="CAS03972.1"
FT                   /translation="MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELG
FT                   VDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDQLLQGLHDREMKLVMDLVVNH
FT                   TSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSK
FT                   KQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDA
FT                   GNDFCNGPRIHEFLQEMNQEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFE
FT                   HMNLDSDGDNKWDLKPIYLPDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDN
FT                   RFRVRSAKMLATCLHMMKGTPYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGH
FT                   SHESIMQSIYTKGRDNARTPYQWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSI
FT                   FYYYQNLIKLRKTTEIITTGNYRLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISD
FT                   ENILNEIQKGSVLVNNVPNIIEGTLRPYEAIVYQIK"
FT   regulatory      186240..186259
FT                   /locus_tag="Lm4b_00181"
FT                   /regulatory_class="terminator"
FT   CDS_pept        186325..187098
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00182"
FT                   /note="Similar to conserved hypothetical proteins"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00182"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03973"
FT                   /protein_id="CAS03973.1"
FT                   /translation="MLFDTHVHLNDEAFDDDIEEVIKRAQENDVTRMAVVGFNKETIDR
FT                   ALELAEKYDFISLIVGWHPTDAITFTDEDLEWLRDLALTHPKVVALGEMGLDYHWDTSP
FT                   KETQFEVFRKQIRLAKEVNLPIVIHNREATEDVVRILQEEHAEEVGGIMHCFGETVEVM
FT                   EACLAMNFYISFGGTVTFKNAKLPKIAAQAIPIDRLLIETDAPYLAPTPNRGKRNEPGY
FT                   VKLVAEKIAELKEMKYSEIATHSTENAKKLFKIKD"
FT   CDS_pept        187390..188604
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00183"
FT                   /product="Putative YabE protein"
FT                   /note="Similar to B. subtilis YabE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00183"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03974"
FT                   /protein_id="CAS03974.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGEKVVEYKVTFENGKEKKRDVIKENVTSKKTDKV
FT                   VVRGTKEKVVATPVSNVSTPSTTSSSSSTPSGGKTYRMESTAYSGGGTTAYGINLSANP
FT                   GLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGRRMVT
FT                   VKVLN"
FT   regulatory      188618..188640
FT                   /locus_tag="Lm4b_00183"
FT                   /regulatory_class="terminator"
FT   CDS_pept        188706..189281
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00184"
FT                   /product="Putative YabF protein"
FT                   /note="Similar to B. subtilis YabF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00184"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03975"
FT                   /protein_id="CAS03975.1"
FT                   /translation="MNGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGTPAEKQFISKDILIHLGLLGGAGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEDQLVAACQKIMQEEENE"
FT   CDS_pept        189274..190161
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="Lm4b_00185"
FT                   /product="dimethyladenosine transferase (16S rRNA
FT                   dimethylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00185"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03976"
FT                   /db_xref="GOA:C1KYC1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYC1"
FT                   /protein_id="CAS03976.1"
FT                   /translation="MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDSNILTRITDTAE
FT                   ITKETNVIEIGPGIGALTEQLAKTANEVVAFEIDQRLLPILDDTLSAYNNIQVVHGDVL
FT                   KADVEEVIAEQFAKPDLPLKIVANLPYYVTTPIILKLLHDNIPADSMTFMLQKEVADRI
FT                   SAVPSTKSYGSLTIAIQFYMEAELAFIVPKTVFMPQPNVDSAVIHLKRRKEPLAEVNDE
FT                   EFFFEVTRASFAQRRKTLWNNLASKFPALKPRKDELVEGLNAIGIDLIRRGETLDIPEF
FT                   AKLSNFLGDFLKEK"
FT   CDS_pept        190281..190538
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00186"
FT                   /product="Putative Veg protein"
FT                   /note="Highly similar to B. subtilis Veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00186"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03977"
FT                   /protein_id="CAS03977.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
FT   regulatory      190553..190575
FT                   /locus_tag="Lm4b_00186"
FT                   /regulatory_class="terminator"
FT   CDS_pept        190677..191558
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00187"
FT                   /product="Putative YabH protein"
FT                   /note="Similar to B. subtilis YabH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00187"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03978"
FT                   /db_xref="GOA:C1KYC3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYC3"
FT                   /protein_id="CAS03978.1"
FT                   /translation="MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLER
FT                   LDEDKIVLDVKAHFIPEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNVIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPG
FT                   CWIVLAKPSISVSTPTIYKELQVDNVEHPDTQKMIESIKNGDLDGIFASTGNVLESVTL
FT                   EKNPQVKRIKDRMLAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSEGENDTNINN"
FT   CDS_pept        191580..192317
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00188"
FT                   /product="Putative phospho-beta-glucosidase"
FT                   /note="Similar to a putative phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00188"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03979"
FT                   /db_xref="GOA:C1KYC4"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYC4"
FT                   /protein_id="CAS03979.1"
FT                   /translation="MKIIFNADDFGISPGAVYGILESYKRGVVKSTTLLANSPAFDLAV
FT                   EVAKENPGLDIGAHLTLTFGSPVLQGLETLTDDDGRFRRNYTSLENGLADVDMNEVERE
FT                   LTAQIEKILDAGITISHFDTHHSIEPLIYPVQHKLAEKYGVSIRRHSDVSDFGAIKTPD
FT                   LFATEFYADGVSFETIKKLVQKHIGTNDVVEVMTHPAFIDETLREISSYVEPRIKEVSI
FT                   LTSRELQAYLGQQEVEIISFRDL"
FT   CDS_pept        192481..193299
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00189"
FT                   /product="Putative PurR, transcription repressor of purine
FT                   operon of B. subtilis"
FT                   /note="Similar to PurR, transcription repressor of purine
FT                   operon of B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00189"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03980"
FT                   /protein_id="CAS03980.1"
FT                   /translation="MKIRRSERLIDMTQFLLSHPRKLVPLTMFAERYGSAKSSISEDLV
FT                   IIKKTFEDRGIGTLETVPGAAGGVQYISIAGNDDVLDFVHTLCNRIAEPNRLLPGGYLY
FT                   LSDLLGEPVTLKAIGKILATKFNNQKIDAIMTVATKGIPIAQAVAEHLSVPFVIVRRDS
FT                   KVTEGSTVSINYVSGSSKRIEKMELSKRSLAEGSNVVIVDDFMKAGGTINGMKNLLEEF
FT                   NAHLVGIGVLVESEYAEERLVDDYVSLVKIKNVNMKEKQIEVVDGNYFNS"
FT   regulatory      193307..193326
FT                   /locus_tag="Lm4b_00189"
FT                   /regulatory_class="terminator"
FT   CDS_pept        193476..194153
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00190"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03981"
FT                   /protein_id="CAS03981.1"
FT                   /translation="MKKWVKWLIVIVIIAVVAVGAVFLLSKNSGSVTQEKLVTAKVKQG
FT                   DMKINATGTGAISPVNTQVPDYDELQLVAQMDELDIPNIKKDQEVKVTVTALPDKTYTG
FT                   KVKEIAEQGQVQNGVSSFSVIISLDKTDDLKAGMTADASILVNEKKDALYVPIEAVQKD
FT                   SDDKYYVLVPEEKDNGKTKKVKKFVETGLHNEDNIEITKGVKKGEKVILPTQETSTVPG
FT                   APS"
FT   CDS_pept        194202..194894
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00191"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03982"
FT                   /protein_id="CAS03982.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVEQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDEGSYHLDDVDVFKLSDNKLSEIRNKKIGFIFQQFNLLPKLSA
FT                   FENVELPLIYAGLSVSAREKAAIECLEKVGLLEKRRNLPTQLSGGQQQRVAIARALAGK
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEEATQA"
FT   CDS_pept        194891..196099
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00192"
FT                   /product="Putative membrane protein (putative ABC
FT                   transporter component)"
FT                   /note="Similar to membrane protein (putative ABC
FT                   transporter component)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00192"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03983"
FT                   /protein_id="CAS03983.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKNSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGI
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
FT   regulatory      196109..196131
FT                   /locus_tag="Lm4b_00192"
FT                   /regulatory_class="terminator"
FT   CDS_pept        196780..197088
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00193"
FT                   /product="Putative SpoVG protein"
FT                   /note="Similar to B. subtilis SpoVG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00193"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03984"
FT                   /protein_id="CAS03984.1"
FT                   /translation="MEITDVRLRRVETDGRMKAISSITIDGEFVIHDIRVIDGNEGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRAKIQEAVLAAYEVADEPAVNEESSADESIVEEN"
FT   CDS_pept        197207..197515
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00194"
FT                   /product="Putative SpoVG protein"
FT                   /note="Similar to B. subtilis SpoVG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00194"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03985"
FT                   /protein_id="CAS03985.1"
FT                   /translation="MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFV
FT                   AMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYERVGEEEATAVTEEESESVSAE"
FT   regulatory      197530..197550
FT                   /locus_tag="Lm4b_00194"
FT                   /regulatory_class="terminator"
FT   CDS_pept        197902..199275
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="Lm4b_00195"
FT                   /product="Putative UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /note="Highly similar to UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00195"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03986"
FT                   /db_xref="GOA:C1KYD1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYD1"
FT                   /protein_id="CAS03986.1"
FT                   /translation="MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLN
FT                   VDKVVTIVGHGAEKVQEHLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDGVTLVVCGDT
FT                   PLIEASTMEALLKYHHEKRAKATILTTVIEDPTGYGRIIRDDLGIVEKIVEHKDATEKE
FT                   QRISEINTGTYCFDNKALFEALENVSNDNVQGEYYLPDVIKILKDSDEVVAAYRMESFE
FT                   ESLGVNDRIALAEASRLMQRRINENHMRNGVTLVNPENTYIDIDVKIGQDTVIEPGVML
FT                   RGETVIGDDCVVTSGSEIVNSVIGERVHVKTSSIFESKVGDDVQIGPYAHLRPESDIHD
FT                   HVKIGNYVETKKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKNKAKTIIGD
FT                   NVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPDDALGIARAKQDNKLGYAKHLNHGK"
FT   CDS_pept        199326..200282
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="Lm4b_00196"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00196"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03987"
FT                   /protein_id="CAS03987.1"
FT                   /translation="MSNEYFDPKLKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSDGE
FT                   IQINIEESIRGCHVYVIQSTSNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQD
FT                   RKARSREPITAKLVANLIETAGATRMITLDMHAPQIQGFFDIPIDHLNAVRLLSDYFSE
FT                   RHLGDDLVVVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVAEVMNIVGNVEGKVCI
FT                   IIDDIIDTAGTITLAAKALREAGATKVYACCSHPVLSGPAMKRIEESPIEKLVVTNSIA
FT                   LPEEKWIDKMEQLSVAALLGEAIVRVHENASVSSLFE"
FT   regulatory      200292..200316
FT                   /gene="prs"
FT                   /locus_tag="Lm4b_00196"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(200292..200316)
FT                   /gene="prfA"
FT                   /locus_tag="Lm4b_00197"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(200326..201039)
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="Lm4b_00197"
FT                   /product="listeriolysin positive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00197"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03988"
FT                   /protein_id="CAS03988.1"
FT                   /translation="MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGI
FT                   TKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKE
FT                   LLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIK
FT                   ITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLD
FT                   EWFYLACPATWGKLN"
FT   CDS_pept        complement(201312..202265)
FT                   /transl_table=11
FT                   /gene="plcA"
FT                   /locus_tag="Lm4b_00198"
FT                   /product="phosphatidylinositol-specific phospholipase c"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00198"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03989"
FT                   /protein_id="CAS03989.1"
FT                   /translation="MYKNYLQRTLVLVLCFILCFFTFPLGGKAYSLNNWNKPIKNSVTT
FT                   KQWMSALPDTTSLAALSIPGTHDTMSYNGDMTWTLTKPLAQTQTMSLYQQLEAGIRYID
FT                   IRAKDNLKIYHGPIFLNASLSGVLETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQP
FT                   LINIYKDYFYTTPRTDTSNKIPTLKDVRGKILLLSENHTKKPLVINSHKFGMQFGASNQ
FT                   VIQDDYNGPSVKTKFKEIVQTAYQASKADNKLFLNHISATSLTFTPRQYAAALNNKVEQ
FT                   FVLNLTSEKVRGLGILIMDFPEKQTIKNIIKNNKFN"
FT   regulatory      202493..202498
FT                   /gene="hly"
FT                   /locus_tag="Lm4b_00200"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202508..204097
FT                   /transl_table=11
FT                   /gene="hly"
FT                   /locus_tag="Lm4b_00200"
FT                   /product="listeriolysin O precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03990"
FT                   /db_xref="GOA:C1KYD5"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYD5"
FT                   /protein_id="CAS03990.1"
FT                   /translation="MKKIMLVFITLILVSLPIAQQTEAKDASAFHKENLISSMAPPASP
FT                   PASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKK
FT                   KKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTN
FT                   QDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFG
FT                   TAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQA
FT                   LGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKN
FT                   SSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAV
FT                   IKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEINYDPEGNEIVQHKNWSENNK
FT                   SKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLY
FT                   PKYSNSVDNPIE"
FT   CDS_pept        204432..205964
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="Lm4b_00201"
FT                   /product="Zinc metalloproteinase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03991"
FT                   /protein_id="CAS03991.1"
FT                   /translation="MKSKLICIIMVIAFQAHFNMAVKADSVGEERLRNDIQAKRNPADL
FT                   KALPDSCEAKDFYKNFKILDMTKDKLGVTHYTLALSSDGYLTDNDEIKVHVTPDNKITF
FT                   INGDLQQGQLRITNQIKITEKNAIEKAFEAIGQSEAHVKSYIGNPVKEKEIIINSRTKR
FT                   LVYNIKLIFAEPEVASWIIQVDAETGAILKKQNMLSEVERADTHKDFQALGKGANRLLQ
FT                   RPLHVMKINDLFYLVDRTHKGLIRTFDLNHKTDASFGKVVSNKTNMFTDPEFSSAVDAH
FT                   FYASEVYDYYKNVHQLESLDGKGGEIDSFVHYGLNCNNAFWDGREILYGDGDKKNFKPF
FT                   SCAKTIVGHELTHAVIQYSAGLEYEGQSGALNESFADVFGYFIAPNHWLIGEDVCVRGL
FT                   RDGRIRSIKDPDKYNQAAHMKDYESLPITEEGDWGGVHFNSGIPNKAAYNTITKLGKEK
FT                   TEQLYFRALKYYLTKKAQFTDAKKALQQAAKDLYGEDASKKVAEAWEAVGVN"
FT   CDS_pept        206164..207978
FT                   /transl_table=11
FT                   /gene="actA"
FT                   /locus_tag="Lm4b_00202"
FT                   /product="actin-assembly inducing protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00202"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03992"
FT                   /protein_id="CAS03992.1"
FT                   /translation="MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEE
FT                   EKTEEQPSEVNTGPRYETAREVSSRDIEELEKSNKVKNTNKADLIAMLKAKAEKGPNIN
FT                   NNNSEQSENVAINEEASGSDRPAIQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLT
FT                   YPDKPTKATKKKVAKASVTDTSESDLDSSMQSADESTPQPLKANQQPFFPKVFKKIKDA
FT                   GKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKNEEVNASDFPPPPTDEELRLALPET
FT                   PMLLGFNAPATSEPSSFEFPPPPTEDELEIMRETAPSLDSSFTSGDLASLRSAINRHSQ
FT                   NFSDFPPMPTEEELNGRGGIPTSEEFSSLNSGDFTDDENSETTEEEIDRLADLRDRGTG
FT                   KHSRNAGFLPLNPFTSSPVPSLSPKVSKISAPALITDVTKKAPFKNPPQPLNVFNKKTT
FT                   TKTAPKKITPVNTAPKLAALPITKAQETELGENKAPFIEKQAETNNRPIDMPSLPVIQK
FT                   EVTERNKEEMKPQTEEKVVGESEPANNVNGKKRSAGIEEGKLIAKSAEDEKAKEEPVNH
FT                   TTLILAMLAIGVFSLGAVIKIIQLRKNS"
FT   regulatory      208000..208005
FT                   /gene="plcB"
FT                   /locus_tag="Lm4b_00203"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208014..208883
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="Lm4b_00203"
FT                   /product="phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00203"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03993"
FT                   /protein_id="CAS03993.1"
FT                   /translation="MKFKKVVLGMCLTASVLVFPVTIKASACCDEYLKPPAAPHDIDSK
FT                   LPHKLSWSADNPTNTDVNTHYWLFKQAEKILAKDVDHMRANLMNELKNFDKQIAQGIYD
FT                   ADHKNPYYDTSTFLSHFYNPDKDNTYLPGFANAKITGAKYFNQSVADYREGKFDTAFYK
FT                   LGLAIHYYTDISQPMHANNFTAISYPPGYHCAYENYVDTIKHNYQATEDMVVQRFCSND
FT                   VKEWLYENAKRAKADYPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFLE
FT                   FWSKKTNE"
FT   regulatory      208941..208946
FT                   /locus_tag="Lm4b_00204"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208955..209278
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00204"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00204"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03994"
FT                   /protein_id="CAS03994.1"
FT                   /translation="MYIKGRLIFFFVMFVIALCSVLILLIIKMSVWKEEPFNLSDAKEI
FT                   ECLGSCKIKNTNQKIHFFSIKKNLFEEKGNMAGILNEHERKGADKSIFIVILDDEKGIA
FT                   NEE"
FT   CDS_pept        209411..209872
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00205"
FT                   /product="Putative Hypothetical lipoprotein"
FT                   /note="Hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00205"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03995"
FT                   /protein_id="CAS03995.1"
FT                   /translation="MKMLKKGTTVLFVMIMAVMLVACGDKEETKTYSLSQNGVDSKLTY
FT                   TYKGDKVTKQTAENTMSYASLGVASKEDAEKMLKATSDKFQGIDGLKEKIEYKDDKAIE
FT                   TLEVDYTKISSEDMNKIPGMSSNGDTSKGISMEESAKMLESQGYKEVSK"
FT   regulatory      complement(209889..209915)
FT                   /locus_tag="Lm4b_00206"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(209925..210257)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00206"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00206"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03996"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYE1"
FT                   /protein_id="CAS03996.1"
FT                   /translation="MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
FT                   RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGADNGMLMVTASGTAVV
FT                   IEAQDY"
FT   CDS_pept        complement(210324..>210998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00207"
FT                   /note="hypothetical start"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00207"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03997"
FT                   /protein_id="CAS03997.1"
FT                   /translation="TITFDQLNTELQALENPNTIKIFRNHGCPDSLDLYGLKIGDLKKI
FT                   IRREKLTKNHELAVELIESNNSDLIYLGLLAINPDKITTEQIEKWNIIFRETWSQLTFG
FT                   LASIVSKRDDALLFAKTWIESDYDLTKSMGWQIYSEHINNLPEAEALLQRAKETLQTET
FT                   NRTRYSMNGFIITCGIYKDDLHEKAMEAAKSVGKVHVNLGNTACKVPDAISYIEKARNR
FT                   TK"
FT   regulatory      complement(211040..211057)
FT                   /gene="ldh"
FT                   /locus_tag="Lm4b_00208"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(211076..212017)
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="Lm4b_00208"
FT                   /product="Putative L-lactate dehydrogenase"
FT                   /note="Similar to L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00208"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03998"
FT                   /protein_id="CAS03998.1"
FT                   /translation="MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGD
FT                   AMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIV
FT                   DEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKV
FT                   DARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIIN
FT                   KKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHI
FT                   VEMNLNDKEKEQMKNSADTLKKVLDDAMKQID"
FT   CDS_pept        212311..212934
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="Lm4b_00209"
FT                   /product="Putative general stress protein"
FT                   /note="Similar to B. subtilis general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00209"
FT                   /db_xref="EnsemblGenomes-Tr:CAS03999"
FT                   /protein_id="CAS03999.1"
FT                   /translation="MATTLEVQKRETTQHSEVTRLRSEGKVPGIIYGYKSENVPVSVDS
FT                   LELIKAVRDNGRNAVFSVTVDGKKLNVLLHEYQVDPLKDVLVHVDLLAVDMNEEVETDV
FT                   RVVLVGDAPGVKAGGVLQQIIHDVKVSATPEKLPETIELDISSLEIGDVLTTNDLPENK
FT                   DYVVQAEEEETVVTVSAPRAEEEPTTTEAPEPEAVHGKDEEPVE"
FT   regulatory      212952..212984
FT                   /gene="ctc"
FT                   /locus_tag="Lm4b_00209"
FT                   /regulatory_class="terminator"
FT   CDS_pept        213024..213608
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00210"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04000"
FT                   /protein_id="CAS04000.1"
FT                   /translation="MLDKSVPHISAIMVNHDATNYPEFHLPEGYSFCFYKDGLEEDWCR
FT                   LQLETGQVLSMDSIRARFETEFGNEKEKLAKRCVFVEAPNGEIIGTAMLWDGNTFGEMA
FT                   SRIHWVAVLDSHGGKGIAKALLSKILGLNKSSFVYLTTQTGSYQAIYLYQKFGFEKYVG
FT                   KTPENWKTVNFQEEKEAAWQIIENKIAEHQA"
FT   CDS_pept        213715..214275
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="Lm4b_00211"
FT                   /product="Putative peptidyl-tRNA hydrolase"
FT                   /note="Similar to peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04001"
FT                   /db_xref="GOA:C1KYE6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYE6"
FT                   /protein_id="CAS04001.1"
FT                   /translation="MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGM
FT                   TSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQ
FT                   KGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVIHYVLGDFPKAEQPDIIAAIQK
FT                   SADAIEDFAQTPFIEVMNKYNQK"
FT   regulatory      214374..214379
FT                   /gene="mfd"
FT                   /locus_tag="Lm4b_00212"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214389..217928
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="Lm4b_00212"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00212"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04002"
FT                   /protein_id="CAS04002.1"
FT                   /translation="MKGLQQLIYEQKDIRAVLNALDEKEKAQLVTGLTGSSRALFASVV
FT                   EGASKRPVVFVTHNLYHAQKLYDDLLSLMDVDRLFLYPADELISSELSISSPELRGQRV
FT                   EALDFLLSGKPGIVIVPVAGLRKMLPPVSLWKHFNISIVEGEEIDPDVLRQKLVTMGYT
FT                   MSGMVNTPGEFSVRGGIIDIYPITEEFPIRIELFDTEVDSLRFFDVETQRSTTRVEEFR
FT                   LLPATEIILDQSYYPDIVKRLEKKMTHTLNELKENEDKQALVENLEEDLEMLRSGVKPD
FT                   MFFKYIGLAYPDPASLFDYFPKNTAILLDEFGRILETEESLEREEAEWQTETLSRMETV
FT                   RDVQVSHSFKKLLEANHSPKIYLSLFQKQMASMRVSKTTNIVYKQMQQFHGQMNVLKTE
FT                   LESWHKNNYAVVILAPNLERAEKMQQTLTDYDMESTILKKESDVPKYGMVQFVIGTFQN
FT                   GFELPLAKVAIISETELFNKKIKKVKKRQKLSNAERIQSYSELKVGDYVVHVNHGIARY
FT                   VGMETLDINGVHKDYLLLVYQGEDKLFIPVDQLDLVQKYVGAEGKSPRLNKLGGAEWKR
FT                   VKKKVQASVQDIADDLIKLYAEREAEKGYAFSADDEMQREFEEAFPYQETEDQLRSISE
FT                   IKKDMERPRPMDRLLVGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHFETMK
FT                   ERFQGFPIEIGLLSRFRTKKQQTETLKGMKNGTVDVVVGTHRLLSKDVEYQDLGLLIVD
FT                   EEQRFGVTHKEKIKQMRSKIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQT
FT                   YVAEQNNVLVREAIERELARDGQVYYLYNRVESITQKADEISAMVPDARVATAHGQMGE
FT                   SELESVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDADRMGLSQLYQLRGRVGRW
FT                   NRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNILGAQQHG
FT                   FIDSVGFDLYSQMLKEAIEAKKPKEEQKQIVPVEIDIQADAYIPEYYITDGRQKIEMYK
FT                   RFRNIETLSELEDLQSDMIDRFGEYPEEVEYLFTMTELKVHALEVGIESVKQEQNKITM
FT                   LFSESGTAGIRGDIVMQIIGEFGRMVGVGMEGTQLKITINVQNKPLKEWLYQVKSLAEK
FT                   LRGAMKERASAEN"
FT   CDS_pept        217959..219548
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00213"
FT                   /product="Putative Conserved membrane-spanning protein"
FT                   /note="Conserved membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04003"
FT                   /protein_id="CAS04003.1"
FT                   /translation="MPERSMKRLMKGAAWLTAASLISKILSAVYRVPFQNMVGDVGFYI
FT                   FQQVYPIYGIAMTLALGGFPVVISKMLAEAEGDVRRQQIIMRAVSRMLRIVSIVIFAFL
FT                   FLFANPIAIMMGDPALSELIRVISFVFLLMPQLAFMRGFFQGEGDMIPTAISQTVEQIV
FT                   RVAIILIGAGLALHFNFDLYDAGSMAMSGAFFGGVSGIFILRHFYNKKVRLGEGIQPAV
FT                   FTNKEEKVGIGRTFLRQSVAICVVSSMLILFQLVDSFQVYRLMSDSGIPDFIAKSLKGV
FT                   YDRGQPILQLGLVISTGLALALVPMITAARVQNQQKELKRSVLLAIKITLILAGAETIG
FT                   LIVIMRPLNQMLFQTPDGTFVLQLFMPAVFLSSLIIMLSSILQGFGKITVPAVGVGIGL
FT                   IVKWVTGGILIPRLATVGASVSTCVGLLVILLICYVSLKQTIRVPFVEKTMLFRLIAAL
FT                   ALMAVFPCLFEWLAPLNTRLGSAFQAIVSALVGGGIFLVFSLRYKLLGPKDFVFLPFGS
FT                   KLLALSKLVARK"
FT   CDS_pept        219572..219850
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00214"
FT                   /product="Putative YabO protein"
FT                   /note="Highly similar to B. subtilis YabO protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00214"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04004"
FT                   /protein_id="CAS04004.1"
FT                   /translation="MATTMRLDKYLKVSRLIKRRTVAKEVAEKGRIAVNGVTAKPGTNV
FT                   KSGDELVIRFGPKIVTAKIERLEENAKKEQATEMYTIIKEERTDESR"
FT   regulatory      219858..219894
FT                   /locus_tag="Lm4b_00214"
FT                   /regulatory_class="terminator"
FT   CDS_pept        220079..220465
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00215"
FT                   /product="Putative DivIC protein"
FT                   /note="Similar to B. subtilis DivIC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00215"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04005"
FT                   /protein_id="CAS04005.1"
FT                   /translation="MKKAKSKVARIENRYIKDTATMKKTRSRRRIALFRRLAFMAIIFA
FT                   VVGGLLTITYTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKLHNDDYIAKLAR
FT                   SEYYLSKDGEIIFNIPEENSKQKE"
FT   regulatory      220598..220603
FT                   /locus_tag="Lm4b_00216"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220616..221044
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00216"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00216"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04006"
FT                   /protein_id="CAS04006.1"
FT                   /translation="MSIEVGNKLQGKVTGITNFGAFVELEGGKTGLVHISEVADNYVKD
FT                   INDILTVGDEVTVKVMNIGDDGKIGLSIRKAVDRPDRPEKSYDRKPKYSKKPAGNYVKP
FT                   AESFEDIMSKFLKDSDERLTTIKRQTESKRGGRGAKRG"
FT   regulatory      221071..221100
FT                   /locus_tag="Lm4b_00216"
FT                   /regulatory_class="terminator"
FT   regulatory      221136..221141
FT                   /locus_tag="Lm4b_00217"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        221151..223097
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00217"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00217"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04007"
FT                   /protein_id="CAS04007.1"
FT                   /translation="MDDTDKRVHKYIEKHDLIRSDDKLLVAVSGGPDSLALLHFLWNSN
FT                   LVPKEAISVAHINHHLRENAANEQNVVEAFCESQGIPFYIEEVDVKSRAESLQKGIEET
FT                   ARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGG
FT                   QAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSH
FT                   FERFSEETSEDFQFLEALASDLLKKNLIKNGKRTTLLLTNFKNEANPLQRRAIHLLLRY
FT                   LYNEDASFITVNHIYQIIQMIQSDNPSSSIDLPNKLVANRAYDKLHFQFGEREAPSEFY
FT                   HQLELNDRIELDNKASIRLKLKSSVVQTNGLNGMLLDAEEITLPLIVRNRVNGDRMTMK
FT                   GQAGSKKLKDIFIDAKIPRQERDKLPVITDYTGKILWVPGVKKSAYDREFSRSKKQYII
FT                   RYTRNIGGNESMHNDIQKVLISEDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFM
FT                   TDLLKRVDTYLEMDFMDVSSYGNGTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTL
FT                   SYLVDLIKYRKAKSVKLVTLLDKPAGRNVEIEADYVGFVVPNEFVVGYGLDYAERYRNL
FT                   PYIGILKPEIYSE"
FT   CDS_pept        223443..225530
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="Lm4b_00218"
FT                   /product="Putative cell division protein ftsH"
FT                   /note="Highly similar to cell division protein ftsH"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00218"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04008"
FT                   /protein_id="CAS04008.1"
FT                   /translation="MNRFFRNAIFYVIIFLVIIGIVASFNSNKEAAKDISYSEFVSKLE
FT                   DGKVKSVEIQPDRSVYTINGEFKSSDKSSDDKKTGLGQSKTSSTAFTTYALNSDTSLGD
FT                   LQKTLDKEDVKTTIVPAKQNSGWVTFLTSIVPFVIIFILFFFLMSQSQGGGGGKVMSFG
FT                   KSKAKLYNDDKKKVRFTDVAGADEEKQELVEVVEFLKDPRKFADLGARIPKGVLLVGPP
FT                   GTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEI
FT                   DAVGRQRGAGMGGGHDEREQTLNQLLVEMDGFGGNEGIIIIAATNRADVLDPALLRPGR
FT                   FDRQIMVDRPDVKGREAVLRVHARNKPLAKSVDLKAIAQRTPGFSGADLENLLNEAALV
FT                   AARSDKKEIDMSDLDEASDRVIAGPAKKNRVISEKERRTVAYHEGGHVIVGMVLDEAEV
FT                   VHKVTIVPRGQAGGYAVMLPKEDRFLMTKAELMDRITGLLGGRVAEEVTFGEVTTGASN
FT                   DFERATELARRMVTEWGMSDKIGPLQFTSGNGQVFMGRDFGSDKGYSDKIAYEIDTEVQ
FT                   SLIRYCYDRAKTIITEHQEQHKLIAETLLKVETLDARQIRSLFDDGVMPPDIDTIDVEA
FT                   EYPSEKDEEVAGKSFEEEKEELKEEEKIEEPKEEPKEEPKEVTSEDAPNIEQTPNDKKD
FT                   E"
FT   regulatory      225538..225559
FT                   /gene="ftsH"
FT                   /locus_tag="Lm4b_00218"
FT                   /regulatory_class="terminator"
FT   CDS_pept        225646..226425
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00219"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00219"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04009"
FT                   /db_xref="GOA:C1KYF4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYF4"
FT                   /protein_id="CAS04009.1"
FT                   /translation="MILVIDVGNTNCTVGVYEKQKLLKHWRMTTDRHRTSDELGMTVLN
FT                   FFSYANLTPSDIQGIIISSVVPPIMHAMETMCVRYFNIRPLIVGPGIKTGLNLKVDNPR
FT                   EIGSDRIVNAVAASEEYGTPVIVVDFGTATTFCYIDESGVYQGGAIAPGIMISTEALYN
FT                   RAAKLPRVDIAESNQIIGKSTVASMQAGIFYGFVGQCEGIIAEIKKQSNASPVVVATGG
FT                   LARMITEKSSAVDILDPFLTLKGLELLYRRNKPTTEK"
FT   CDS_pept        226441..227325
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00220"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04010"
FT                   /db_xref="GOA:C1KYF5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYF5"
FT                   /protein_id="CAS04010.1"
FT                   /translation="MSDYLVKALAYDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGR
FT                   TMTGTLFLGAMQKEDQKITVKIEGDGPIGPIVADSNAQGQIRGYVTNPHVHFSELNEAG
FT                   KLDVRRGVGTSGMLSVVKDLGFGENFTGQTPIISGEIGEDFTYYLATSEQINSSVGVGV
FT                   LVNPDDTIEAAGGFMLQLLPGATDEIIDEIEKNLTALPTVSRMIEAGETPESILAKLAG
FT                   GEDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNAYDF
FT                   SEEELEKLYDEAK"
FT   CDS_pept        227441..228367
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="Lm4b_00221"
FT                   /product="Putative cysteine synthase"
FT                   /note="Highly similar to cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04011"
FT                   /protein_id="CAS04011.1"
FT                   /translation="MTIANSITDLIGKTPIVKLNRLPEAGSADVYVKLEFQNPGGSVKD
FT                   RIANAMIESAEKSGALKPGDTIIEPTSGNTGIGLAMVAAAKGYQAIFVMPETMSLERRK
FT                   LLQAYGAKLVLTPGPDGMKGAIAKAEELAKENNYFVPQQFHNPANPAVHEETTGPEIVE
FT                   AFGKDGLDAFIAGVGTGGTVTGVGHVLKKNYPDVKIYALEPEESPVLSGGSPSPHKIQG
FT                   IGAGFVPDTLDTKVYDGILKVSSEDALETAREVAKKEGILVGISSGATVKAALDLAKEL
FT                   GAGKKVLAIVASNGERYLSTPLYNFED"
FT   regulatory      228376..228396
FT                   /gene="cysK"
FT                   /locus_tag="Lm4b_00221"
FT                   /regulatory_class="terminator"
FT   regulatory      229256..229261
FT                   /gene="sul"
FT                   /locus_tag="Lm4b_00222"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        229271..230086
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="Lm4b_00222"
FT                   /product="Putative dihydropteroate synthase"
FT                   /note="Highly similar to dihydropteroate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00222"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04012"
FT                   /protein_id="CAS04012.1"
FT                   /translation="MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAED
FT                   GAAIIDVGGISTRPGFSEVTPEEELNRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAIL
FT                   AGANMINDQWGAKKEPKIAEVAAKYNVPICLMHNRENTQYDNFLEDVKKDLLESVAIAK
FT                   AASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTP
FT                   EDRMEGTGATTVYGFSKGCTITRVHDVLPIARMVRMTDAITGKLDITKL"
FT   CDS_pept        230100..230474
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="Lm4b_00223"
FT                   /product="Putative dihydroneopterin aldolase"
FT                   /note="Highly similar to dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00223"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04013"
FT                   /protein_id="CAS04013.1"
FT                   /translation="MDKIYLNELVFYGYHGVLAEETKLGQTFRVSLILGLSTKKAGISD
FT                   SVDDTVSYAEVYETVKEIVEGTPFKLIEALAEKIATEVLTGYPLLEEVTVKLIKPNPPI
FT                   PGHYDSVAVEIERKRSDLNG"
FT   CDS_pept        230467..230946
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="Lm4b_00224"
FT                   /product="Putative 7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase"
FT                   /note="Similar to 7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00224"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04014"
FT                   /protein_id="CAS04014.1"
FT                   /translation="MAKVFLSIGTNLGERLENLNDALSGLAASDKIKITNVSSVYETDA
FT                   VGYEDQAAFLNIAVEIETDFPPVDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDV
FT                   KIDTEKLKIPHPYMKERAFVLIPLIEISPEKSNLVDNPAILEEQGVRKIKNQVNW"
FT   CDS_pept        231022..232017
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00225"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00225"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04015"
FT                   /protein_id="CAS04015.1"
FT                   /translation="MFKIGNVEIKNQVVVAPMAGISNSAFRLTVKEFGAGLVCCEMISD
FT                   KGIAYRNAKTLDMLYIDEKEKPLSLQIFGGEKETLVEAAKFVAENTTADIIDINMGCPV
FT                   NKIIKCEAGAKWLLDPNKVYDMVAAVVDAVDKPVTVKMRIGWDEEHVFAIENALAAERA
FT                   GAAAVAMHGRTRVQMYEGSANWDVLRDVKRELKIPFMANGDVRTPEDAKRILEHTGADG
FT                   VMIGRAALGNPWMIYRTVKFLETGELLPEPEPREKMQTAMLHLNRLVELKGENIAVREF
FT                   RQHAAYYLKGARGSTRAKVAANQATKQSEMEAILNEFVLQYEEKALAKQD"
FT   regulatory      232025..232044
FT                   /locus_tag="Lm4b_00225"
FT                   /regulatory_class="terminator"
FT   CDS_pept        232132..233628
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="Lm4b_00226"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00226"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04016"
FT                   /protein_id="CAS04016.1"
FT                   /translation="MSNENHEELNDQLIVRREKVDTLREEGIDPFGEKFIRSISPEEIE
FT                   TKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAY
FT                   AVFKLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHN
FT                   ALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDY
FT                   EDVMDLVEGLVSTVCKQVNGTTEITYGEYNVDLTPNWRRIHMADAVKEYVGVDFWNVTS
FT                   DEEARELAKKHNVPVTEHMTYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKE
FT                   DDRFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEAL
FT                   EYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHRD"
FT   regulatory      233636..233662
FT                   /gene="lysS"
FT                   /locus_tag="Lm4b_00226"
FT                   /regulatory_class="terminator"
FT   rRNA            234080..235590
FT                   /gene="rRNA-16s"
FT                   /locus_tag="Lm4b_r00001"
FT                   /product="16S ribosomal RNA"
FT   rRNA            235872..238803
FT                   /gene="rRNA-23s"
FT                   /locus_tag="Lm4b_r00002"
FT                   /product="23S ribosomal RNA"
FT   rRNA            238881..238996
FT                   /gene="rRNA-5s"
FT                   /locus_tag="Lm4b_r00003"
FT                   /product="5S ribosomal RNA"
FT   tRNA            239006..239078
FT                   /locus_tag="Lm4b_t00002"
FT                   /product="transfert RNA-Val"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 86.53"
FT   tRNA            239087..239162
FT                   /locus_tag="Lm4b_t00003"
FT                   /product="transfert RNA-Thr"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 95.38"
FT   tRNA            239203..239275
FT                   /locus_tag="Lm4b_t00004"
FT                   /product="transfert RNA-Lys"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 88.37"
FT   tRNA            239281..239362
FT                   /locus_tag="Lm4b_t00005"
FT                   /product="transfert RNA-Leu"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 69.82"
FT   tRNA            239377..239448
FT                   /locus_tag="Lm4b_t00006"
FT                   /product="transfert RNA-Gly"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 79.58"
FT   tRNA            239470..239555
FT                   /locus_tag="Lm4b_t00007"
FT                   /product="transfert RNA-Leu"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 66.88"
FT   tRNA            239568..239641
FT                   /locus_tag="Lm4b_t00008"
FT                   /product="transfert RNA-Arg"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 74.21"
FT   tRNA            239652..239725
FT                   /locus_tag="Lm4b_t00009"
FT                   /product="transfert RNA-Pro"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 86.85"
FT   tRNA            239744..239819
FT                   /locus_tag="Lm4b_t00010"
FT                   /product="transfert RNA-Ala"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 92.94"
FT   rRNA            240099..241609
FT                   /gene="rRNA-16s"
FT                   /locus_tag="Lm4b_r00004"
FT                   /product="16S ribosomal RNA"
FT   rRNA            241891..244822
FT                   /gene="rRNA-23s"
FT                   /locus_tag="Lm4b_r00005"
FT                   /product="23S ribosomal RNA"
FT   rRNA            244900..245015
FT                   /gene="rRNA-5s"
FT                   /locus_tag="Lm4b_r00006"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        245160..245618
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00249"
FT                   /product="Putative transcription repressor of class III
FT                   stress genes (CtsR)"
FT                   /note="Highly similar to transcription repressor of class
FT                   III stress genes (CtsR)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00249"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04017"
FT                   /protein_id="CAS04017.1"
FT                   /translation="MKNISDVIEAYLKQVLESSEAVEIKRSEIADKFECVPSQINYVIN
FT                   TRFTMERGYIVESKRGGGGYIRIIKVKMNDKLQLLEAIISMVHDKKVSQSFSEDVILRL
FT                   LEEEVITKKEARLMVAALDREVLILPLPDRDILRSRILEAMLVALKYD"
FT   regulatory      245618..245623
FT                   /locus_tag="Lm4b_00250"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        245631..246149
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00250"
FT                   /product="Putative YacH protein"
FT                   /note="Similar to B. subtilis YacH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04018"
FT                   /protein_id="CAS04018.1"
FT                   /translation="MICQRCGENKAVIALQQLNELGKVESLYLCENCATDEALSSEKDL
FT                   VKAMDTFSEVALDFLTLLQKEENAQKEVVCENCHLSFEEFLKTNRVGCPECYSAFEAQL
FT                   VPIIGRVQNGYKKHVGKVPAEVERAEGVQNEISRLQEKLAQLVENEEFEEAAVVRDEIK
FT                   ALKAGGEDK"
FT   CDS_pept        246146..247168
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00251"
FT                   /product="Putative arginine kinase"
FT                   /note="Similar to arginine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04019"
FT                   /db_xref="GOA:C1KYG4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYG4"
FT                   /protein_id="CAS04019.1"
FT                   /translation="MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPVYEQKE
FT                   EIVDNIAEVFDDNFTLIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSI
FT                   MLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGM
FT                   RASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTET
FT                   EIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMKEASDAIS
FT                   DIRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK
FT                   "
FT   CDS_pept        247197..249659
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="Lm4b_00252"
FT                   /product="endopeptidase Clp ATP-binding chain C"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00252"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04020"
FT                   /protein_id="CAS04020.1"
FT                   /translation="MMFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGI
FT                   AAKALYELGISSEKVQQEVEGLIGHGEKAVTTIQYTPRAKKVIELSMDEARKLGHTYVG
FT                   TEHILLGLIREGEGVAARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNTQATPTLD
FT                   SLARDLTVIAREDNLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQ
FT                   QIVRNEVPETLRGKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELH
FT                   TLIGAGGAEGAIDASNILKPPLARGELQCIGATTLDEYRKYIEKDAALERRFQPIKVDE
FT                   PTVEESIQILHGLRDRYEAHHRVAITDEALEAAVRLSDRYISDRFLPDKAIDVIDESGS
FT                   KVRLKSFTTPKNVKEMENNLSDLKKEKDAAVQGQEFEKAASLRDKEQKLKKSLEETKAN
FT                   WQEKQGLDHSEVTEEIVAEVVASWTGIPVAKLAETETNKLLNMEKLLHERVIGQDAAVK
FT                   AVSLAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDSMIRIDMSEY
FT                   MEKFSTARLVGAPPGYVGYEEGGQLTEKVRQKPYSVVLLDEIEKAHPDVFNMLLQVLDD
FT                   GRLTDSKGRVVDFRNTVIIMTSNIGAQEMKQDKSMGFNVIDPLKDHKAMEHRVLQDLKQ
FT                   AFRPEFINRIDETIVFHSLQEKELKQIVTLLTAQLTKRLAERDIHVKLTEGAKSKIAKD
FT                   GYDPEYGARPLKRAIQKEVEDMLSEELLRGNIKVGDYVEIGVKDGKLEVRKKDAPKKKT
FT                   TAKKVKTK"
FT   regulatory      249668..249694
FT                   /gene="clpC"
FT                   /locus_tag="Lm4b_00252"
FT                   /regulatory_class="terminator"
FT   regulatory      249791..249796
FT                   /locus_tag="Lm4b_00253"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        249806..251179
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00253"
FT                   /product="Putative DNA repair protein Sms"
FT                   /note="Similar to DNA repair protein Sms"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00253"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04021"
FT                   /protein_id="CAS04021.1"
FT                   /translation="MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEPSKATPITQIASETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTATLMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGNWKIPKDVQVVGVETIGEALKKALPD"
FT   CDS_pept        251312..252385
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00254"
FT                   /product="Putative YacL protein"
FT                   /note="Highly similar to B. subtilis YacL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00254"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04022"
FT                   /protein_id="CAS04022.1"
FT                   /translation="MLTWVIRVCFLILGGTTGVFSLPALWVKLGIGHILLINNPYTDAL
FT                   IGALIFYLITFWAVKYVEAALNWLEEKLAKIAIATLVYGGLGLFVGLVIAFFASNALSQ
FT                   TNIPLLNSVVPVILTLVLGYLGFRIGISRRNEFGNFVNNRNAKKRTPEEEKTEEKSKKT
FT                   YKILDTSVIIDGRIADILTTGFLDGTVVIPLFVLAELQHIADSSDTLKRTRGRRGLDIL
FT                   NRIQKEEAIQVEMYEGDFEDTPEVDSKLVKLAKVMGGIVVTNDYNLNKVCEFQNVPVLN
FT                   INDLANAVKPVVLPGEKMTVLMVKDGKEHNQGVAYLDDGTMIVVEDGRKFINETIQVEV
FT                   TSVLQTSAGRMIFAKPS"
FT   CDS_pept        252405..253103
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00255"
FT                   /product="Putative 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="Similar to 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00255"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04023"
FT                   /protein_id="CAS04023.1"
FT                   /translation="MNYELVFLAAGQGKRMNAQKNKMWLELVGEPIFIHALRPFLADNR
FT                   CSKVIVVSQEEERKHVKELMSQLNVAESRIEIVKGGSERQYSVAAGLERCGTERVVLVH
FT                   DGARPFITLDIIDRLLIGVEQSKAAICAVKVKDTVKRVVKGVVQETVDRENLWQVQTPQ
FT                   AFELPILRKAHQLARKEQFLGTDEASLVERLPCPVAIVQGSYYNIKLTTPEDMPLAKAI
FT                   LGELGGIAND"
FT   CDS_pept        253096..253569
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00256"
FT                   /product="Putative YacN protein"
FT                   /note="Similar to B. subtilis YacN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00256"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04024"
FT                   /db_xref="GOA:C1KYG9"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYG9"
FT                   /protein_id="CAS04024.1"
FT                   /translation="MIRIGQGYDVHKLAYDRELIVGGIKIPYEKGLLGHSDADVLLHAI
FT                   TDAIIGAIGAGDIGHFFPDTDMAFKDADSAELLEEIWQKVEADGFRLGNLDATIIAEKP
FT                   KMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGRKEGIASLAVVLLEK"
FT   regulatory      253133..253174
FT                   /locus_tag="Lm4b_00255"
FT                   /regulatory_class="terminator"
FT   CDS_pept        253588..255063
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="Lm4b_00257"
FT                   /product="Putative glutamyl-tRNA synthetase"
FT                   /note="Highly similar to glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00257"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04025"
FT                   /protein_id="CAS04025.1"
FT                   /translation="MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRI
FT                   EDTDAKRNIADGEESQMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDE
FT                   GLAYKCYCTEEELDAEREKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPA
FT                   NETITFNDMVKDDVSFESNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHIS
FT                   NTPKQILIYNAFGWEPPIFGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFN
FT                   FIAMLGWSPEGEEEIFSKEEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVV
FT                   ELSLPHLQKAGVVSAELDQAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFD
FT                   EEETAVLAEETVPTVISAFKKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIV
FT                   TTGEMHGPELPLAIEVLGREKVLNRLDTWLKNN"
FT   regulatory      255076..255099
FT                   /gene="gltX"
FT                   /locus_tag="Lm4b_00257"
FT                   /regulatory_class="terminator"
FT   CDS_pept        255462..256076
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="Lm4b_00258"
FT                   /product="Putative serine O-acetyltransferase"
FT                   /note="Similar to serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00258"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04026"
FT                   /protein_id="CAS04026.1"
FT                   /translation="MPTRLKEDIATIIKNDPATKSFFDAFLTNPGLHALWWHRVANFFY
FT                   RHKMVLFGKVLSQNARFWTNIEIHPGATIGRRLFIDHGAGIVIGETAEIGDDVTIFHGV
FT                   TLGGTGKDCGKRHPTVGDGALVSAGAKVLGPVEIGAGARIGAGAVVLKDVPPGATVVGI
FT                   PAKVVRLNGRTVGHAVPKMDELTLRIAELENIVEKLLKEKE"
FT   CDS_pept        256083..257498
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="Lm4b_00259"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00259"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04027"
FT                   /db_xref="GOA:C1KYH2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYH2"
FT                   /protein_id="CAS04027.1"
FT                   /translation="MSIQIFNTLKREKEPFKPLKDGEVKMYVCGPTVYNYIHIGNARPI
FT                   IVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQL
FT                   NVAKATVNPRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSEL
FT                   QHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTID
FT                   IHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVL
FT                   KDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEE
FT                   AHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLAKETVSINVLREFL
FT                   SMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII
FT                   LEDTAQGTRFRRG"
FT   CDS_pept        257502..257912
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00260"
FT                   /product="Putative YazC protein"
FT                   /note="Highly similar to B. subtilis YazC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04028"
FT                   /protein_id="CAS04028.1"
FT                   /translation="MAEVKEYKQLNGLALAYMGDAVYEKFIREYLLAAGKTKPNQLHKT
FT                   ATKFVSAKGQAVALKAMIAEGFLTEEEDRIAKRGRNAKSYTVPKNTDPGTYSMSTSFEA
FT                   VLGYLYLAGELDRLQEWMEKALEIVEKGVETN"
FT   CDS_pept        257912..258667
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00261"
FT                   /product="Conserved hypothetical proteins like to B.
FT                   subtilis YacO protein"
FT                   /note="Similar to conserved hypothetical proteins like to
FT                   B. subtilis YacO protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04029"
FT                   /protein_id="CAS04029.1"
FT                   /translation="MEQENEQEWIGGRNPVLEVLRSDRDIHKIYVQEGSQKGVLKQVLT
FT                   LAKERKIQVQFVPKQKIEKVVSGAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIIL
FT                   DELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVR
FT                   TMEELQKRGLWIFGTDAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPM
FT                   RGKVTSLNASVAASLLLYEVYRKRFPLEK"
FT   CDS_pept        258670..259182
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00262"
FT                   /product="Putative Yacp protein"
FT                   /note="Similar to B. subtilis Yacp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00262"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04030"
FT                   /protein_id="CAS04030.1"
FT                   /translation="MEQILLVDGYNVIGAWPELSFLKDRDLEAARDKLVEWMAEYQSYT
FT                   GYRVVVVFDAQFVRGVKRKSKKYQVEVVFTHEDETADEYIEQKAIEWKNVRTQIMVATS
FT                   DYTEQWAIFGQGALRISSRELLFEIQEMSKQIGQKIKRIQEEMPKSNLNLDSDVISQLE
FT                   KWRRGEE"
FT   regulatory      259246..259251
FT                   /gene="sigH"
FT                   /locus_tag="Lm4b_00263"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        259263..259868
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="Lm4b_00263"
FT                   /product="RNA polymerase sigma-30 factor (sigma-H)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00263"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04031"
FT                   /protein_id="CAS04031.1"
FT                   /translation="MDNSVNQEELAMLELARSGDTEALEYFFSKYQSVIYWKSTQYFLQ
FT                   GAERDDLIQEAMIGLFKAIRDYDKTKEASFRSFAEMCINRQLLSAVKRASRQKNIPLNN
FT                   SVSLDTPIAEDDMDWTLLDVISEKAAETPEDFLIKNEDLTHVARQLEQVTSEFEKEVLK
FT                   QYLEGKSYQEMALFFNKKEKAIDNALQRVKKKMMKQLE"
FT   regulatory      260128..260133
FT                   /gene="secE"
FT                   /locus_tag="Lm4b_00265"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260141..260320
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="Lm4b_00265"
FT                   /product="Putative preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00265"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04032"
FT                   /protein_id="CAS04032.1"
FT                   /translation="MSAIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFM
FT                   LIDFGIEQIIKLIV"
FT   regulatory      260368..260386
FT                   /gene="secE"
FT                   /locus_tag="Lm4b_00265"
FT                   /regulatory_class="terminator"
FT   CDS_pept        260450..260983
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="Lm4b_00266"
FT                   /product="transcription antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00266"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04033"
FT                   /protein_id="CAS04033.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMSDKIFRVIVPEEEE
FT                   TEVKNGKTKTIKRKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPE
FT                   EADRILKSMGMVEKRAEADFEIGETVMVKEGPFADFSGKVDEMDNDKGKAKVMVNMFGR
FT                   ETPVEVDFNQIEKL"
FT   regulatory      260990..261016
FT                   /gene="nusG"
FT                   /locus_tag="Lm4b_00266"
FT                   /regulatory_class="terminator"
FT   CDS_pept        261038..261508
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00267"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00267"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04034"
FT                   /protein_id="CAS04034.1"
FT                   /translation="MDKAKQIYLEFKREADFLELDFPLFLGDGPGFGELCMDYSEQDGY
FT                   MLYGYERGKRNSEFKTTDFDEFKYEVFLHICWYMGMEFELRHRKEDMRHDDNILEADTR
FT                   KIAFEKTLQLLKMVNPAWIDKAAQGYTAYLNLWRENKNVYFDKEAMEFKVNS"
FT   CDS_pept        261635..262060
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="Lm4b_00268"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00268"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04035"
FT                   /db_xref="GOA:C1KYI0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYI0"
FT                   /protein_id="CAS04035.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
FT   CDS_pept        262100..262789
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="Lm4b_00269"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00269"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04036"
FT                   /db_xref="GOA:C1KYI1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYI1"
FT                   /protein_id="CAS04036.1"
FT                   /translation="MAKKGKKYQDALKQIDANKVYTAEEAVELAKKIDFAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKI
FT                   NQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEY
FT                   RVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGI
FT                   KVDPASL"
FT   regulatory      262842..262866
FT                   /gene="rplA"
FT                   /locus_tag="Lm4b_00269"
FT                   /regulatory_class="terminator"
FT   CDS_pept        263037..263537
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="Lm4b_00270"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04037"
FT                   /db_xref="GOA:C1KYI2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYI2"
FT                   /protein_id="CAS04037.1"
FT                   /translation="MSKVLEAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITELRKQL
FT                   RDAGIEFKVYKNSLTRRAVEANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHE
FT                   ALEIKAGVIEGKVASLEEIKALATLPSREGLLSMLCNVLQAPVRGLAIATKAVADQKEG
FT                   QEA"
FT   CDS_pept        263616..263978
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="Lm4b_00271"
FT                   /product="ribosomal protein L12"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04038"
FT                   /db_xref="GOA:C1KYI3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYI3"
FT                   /protein_id="CAS04038.1"
FT                   /translation="MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GAAAEQTEFTVELASAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKEEAE
FT                   EIKAKLEEVGANVEVK"
FT   regulatory      263989..264015
FT                   /gene="rplL"
FT                   /locus_tag="Lm4b_00271"
FT                   /regulatory_class="terminator"
FT   regulatory      264107..264112
FT                   /locus_tag="Lm4b_00272"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        264121..264726
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00272"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00272"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04039"
FT                   /protein_id="CAS04039.1"
FT                   /translation="MTNNHYYTNDETIKHNRKTWQVMLKGFNMSFTSDNGVFSKNTVDF
FT                   GSKLLIESFELETKIGKILDVGCGYGPMGLTVAKVFPDSQIEMVDVNLRALELAKENAE
FT                   INKITNTHIYESSVYDSVTANDYQAIISNPPIRAGKRIVHAILEGAYDHLQETGELWIV
FT                   IQKKQGGPSAEKKMEEVFGNVETVAKDKGYFIFKSVKN"
FT   CDS_pept        265073..266251
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00273"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00273"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04040"
FT                   /protein_id="CAS04040.1"
FT                   /translation="MLTLKGKYNEAKVFTDNVDDNTIGQIITLCNQPFAKDSKIRIMPD
FT                   THGGKGCVIGKTMTIQDKIVPNLVGVDIGCGLYVVKLKPGKLKMDFDKLDKVIRERVPS
FT                   GSKTHDKPVDEFDLEGIVAPIHHGWAARSIGTLGGGNHFIEVNQGSDGIYLVIHSGSRV
FT                   LGKEIAEYHQEVAYKRLDILRKELKLDATAAKKRGNLEMANNLNGEREQVKLDYDLSYV
FT                   TGSDLNNYLNDMEIAQKFAARNRYVMAETILKAMKWDKAVVSAFDCVHNYIDIDNHMLR
FT                   KGATSAQLGEQIIVPLNMRDGSILATGKGNADWNYSAPHGAGRMLSRSKAKAQISLESY
FT                   QAAMKDVWTTSVSKKTIDEAPKAYKSAKQLLADVEDTMEIQEIIKPLYNFKA"
FT   regulatory      266258..266289
FT                   /locus_tag="Lm4b_00273"
FT                   /regulatory_class="terminator"
FT   regulatory      266385..266390
FT                   /locus_tag="Lm4b_00274"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        266396..267391
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00274"
FT                   /product="Putative transcription regulator, lacI family"
FT                   /note="similar to transcription regulator, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00274"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04041"
FT                   /protein_id="CAS04041.1"
FT                   /translation="MNKVTKIGDVAEKTGYSITTISRAINGNPNVSDKTKKKIFAAMKE
FT                   LNYYPNNIAQQFRGQGTKMIGVVISFITNPFFAYLVDAIERYLSHRGYQVVMLQTLENP
FT                   AKELQFIEMLQKKQLDGLIMANLENDTEEIKSLVESGKIVLCNRYLGNENLTIINIDET
FT                   KAAYQATNYLIKCGYKRLAYCTGGIKNKNDYRFKGFMQAVTENGLSFDESLYFEKLLTI
FT                   KDGEELLVNILEEKSTLPDAIFSNGDTVAAGILYAAKKYGIAVPEELGIIGFDNQPIAE
FT                   VLNPALTTIEQPIKELGEYSAQVLLANLQGTSVPVAPDLETKLIIRETTK"
FT   regulatory      267513..267518
FT                   /locus_tag="Lm4b_00275"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        267529..268755
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00275"
FT                   /product="Putative maltose/maltodextrin ABC transporter
FT                   (binding protein)"
FT                   /function="Unknown, similar to maltose/maltodextrin
FT                   ABC-transporter (binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00275"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04042"
FT                   /protein_id="CAS04042.1"
FT                   /translation="MKKLLLSISIIVGLSLLASCGLEKEYKPDIKVNEKNVSLKVWVDL
FT                   NQGDFYRKVVEDFKKEHPDKDYDITVIESESGRAQEYVQKDPEAAADVFITPNDRLGQL
FT                   VESGAVYQLTKYTDDIKKNNTPTSIQAATYQDKMYGFPVTAEAMFMYYDKRVFSEDDIK
FT                   TFSGITSKGKLGINLAEAGADYRETPWFIANGTYLYGENGEDPYGTTFNTPEGVQVLNW
FT                   IGELKNNPNIVAVNADEISALRSGKINAVFSGVWNKDAIREVLGENMGVAVYPKADFGS
FT                   GQVDMMAFQGSGIYCVNAFTKSPLDAMELADYITNADVQEKAFKELGKIPSNLEARTSS
FT                   TVEKDDVAKAVIDMTSGKHSVLMPKIPEMNVFWQHMNPLLVDTYKGKIKKEDYPEALDK
FT                   LVKDITPAK"
FT   regulatory      268759..268764
FT                   /locus_tag="Lm4b_00276"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        268773..270110
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00276"
FT                   /product="Putative maltose/maltodextrin ABC transport
FT                   system (permease)"
FT                   /function="putative maltose/maltodextrin ABC transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00276"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04043"
FT                   /protein_id="CAS04043.1"
FT                   /translation="MMVKKNYFNIFKNGSVSTRLSYVIMGAGNLAHKQIAKGLLFLFSE
FT                   LAFLFFLVFYGITLIQGMATLGTVNQSWNFDKSLGIMVRTPGDNSMLMLIYGIMTVVIC
FT                   VLFLFLYLANIRSACQVEGFQRENKKIPTFKEDLKSLLDNKFHVTLLTIPMIGVVVFTI
FT                   MPLVYMISLAFTNYDHEHLPPRNLFGWVGFVNFKNVLNGDISSTFFPVLGWTLIWALLA
FT                   TATCFFFGVLLALLINHKGVKFKKFWRTIFVITMAVPPFVSLLVMQNLLHAAGPLNTML
FT                   LNWGIIAEPIPFLTDALLAKVSVIFVNMWIGIPVTMLIATGILMNLPKDQLEAARMDGG
FT                   NSFHLFRYITFPQILTVMLPSLIQQFIGNINNFNVIYLLTGGGPSNSNFYGAGDTDLLV
FT                   TWLYKLTVEAADYNLASVIGIVTFILSAAFSLFAYTRTNSYKEGSN"
FT   regulatory      270098..270103
FT                   /locus_tag="Lm4b_00277"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        270112..270942
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00277"
FT                   /product="putative maltose/maltodextrin ABC transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00277"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04044"
FT                   /protein_id="CAS04044.1"
FT                   /translation="MKRATVWPNLLLIVLGCIWIFPIIWIVLTAFRAESGQFVSYIFPK
FT                   EYTLDHFAYLFENHENFPFMLWVKNTMIVAVCSCLLSTFITVSMAYVLSRLRFRFKKTM
FT                   LKTALVLNMFPAFMSMIAVYYILKAFGLTQSLTALVLIYSSTAALTFYIAKGFFDTIPK
FT                   SLDESAMMDGATKLSIFTKITLPMSKPIIVYTALMAFMLPWMDFIFAKVIMGDNVPKYT
FT                   VSIGLYSMLNQTTANTMYTTFAAGCILIAVPITILFIYLQKYYVEGITSGAVKG"
FT   regulatory      270941..270946
FT                   /locus_tag="Lm4b_00278"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        270957..272654
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00278"
FT                   /product="Putative exo-alpha-1,4-glucosidase"
FT                   /function="exo-alpha-1,4-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00278"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04045"
FT                   /protein_id="CAS04045.1"
FT                   /translation="MEITETKEWWKESVVYQIYPRSFQDSNGDGIGDIRGIIERLPYLK
FT                   DLGINVIWLCPVYKSPMDDGGYDISDYYEIDPMFGTMSDMDELIEKAEKLGIKILMDLV
FT                   VNHTSDEHEWFEKAIADPKSKYRDYYIFREGVNGNPPNNWRSYFGGSAWEAVPGEENMF
FT                   YLHAFSKKQPDLNWENIVVRNECIQMINWWLEKGLGGFRIDAILNLKKRIEYGTFPADG
FT                   EDGLVFIGHWILNQPGIEEWLKEIDERTFKKHNAFTVAEADVPEERLSEFIGENGHFRM
FT                   VFDFSYTDIDTPETGEWFKNSEWTVKELKEKIITNELVTQRNGWGAKYLENHDQPRSIN
FT                   KYLPQEYQDDRSKKMLGTLFMMLHGTPFIYQGQEIGMSNTRMESIDDYNDIATHDQYHR
FT                   AILSGMSPEEALEGMYRRSRDNSRTPMQWNNQKNAGFSDSDEIWLKANPNYLDINVEQE
FT                   QIDDNSVLNFYKKLIHLRSDSSKYKEVAVYGELLPVESSDEVIAYKRKTDDAELLIIVN
FT                   FSDSENQLCIEGTYEQVLANVALPEMVENVLEIPAYTGAVFSRVLEVD"
FT   regulatory      272641..272646
FT                   /locus_tag="Lm4b_00279"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        272655..274097
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00279"
FT                   /product="Putative Sucrose phosphorylase"
FT                   /function="Unknown, similar to Sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00279"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04046"
FT                   /protein_id="CAS04046.1"
FT                   /translation="MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAVGGIHLLPFFP
FT                   STGDRGFAPSDYTTVDSDLGSWEIIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLN
FT                   SKYKDMFIRINDFFPPGRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQID
FT                   LDVTAEVTKEFIRQTIKNMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKA
FT                   EAAKYDMELLPEIHEHYSIQMKIANHDYYIYDFALPMVMLYSLYSGRVERLANWLEMSP
FT                   MKQFTTLDTHDGIGVVDARDLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQIN
FT                   STYYSALGDDDKSYLLARVIQCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYY
FT                   TIDEIKNEVKRPVVKALCNLLRFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITA
FT                   TLKANLSTKTFQISENERNILI"
FT   CDS_pept        274163..274408
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00280"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="unknown"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04047"
FT                   /protein_id="CAS04047.1"
FT                   /translation="MVIVLLYNAKRIETVFLCLLLSENAVGNQAFAIDFGKIEDIDVAF
FT                   KNTKRYKLFPSCTDTFKENYFLGSFSNMKSAFFLSK"
FT   regulatory      274641..274646
FT                   /gene="rpoB"
FT                   /locus_tag="Lm4b_00281"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        274654..278208
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="Lm4b_00281"
FT                   /product="RNA polymerase (beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04048"
FT                   /db_xref="GOA:C1KYJ3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KYJ3"
FT                   /protein_id="CAS04048.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPTDGV
FT                   MEDSVLVQSIKIYAPNDEEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPETNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEQGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
FT   CDS_pept        278379..281984
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="Lm4b_00282"
FT                   /product="RNA polymerase (beta' subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00282"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04049"
FT                   /protein_id="CAS04049.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMAPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIGVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEA
FT                   IATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAI
FT                   LSGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
FT   regulatory      281994..282022
FT                   /gene="rpoC"
FT                   /locus_tag="Lm4b_00282"
FT                   /regulatory_class="terminator"
FT   CDS_pept        282060..282605
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00283"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00283"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04050"
FT                   /protein_id="CAS04050.1"
FT                   /translation="MITHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKV
FT                   KQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDF
FT                   TLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPV
FT                   WDLADVPEALLLLKKISA"
FT   CDS_pept        282671..284131
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00284"
FT                   /product="Putative phospho-beta-glucosidase"
FT                   /note="Similar to phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00284"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04051"
FT                   /protein_id="CAS04051.1"
FT                   /translation="MTEVKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVKFIPK
FT                   EERTQDHALDVSKAEIEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSL
FT                   NWARIFPNGDDKEPNEKGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADR
FT                   RVIGFFTNYAETVFKRYKNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAG
FT                   HHQFVASALATKLAHEIIPGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVH
FT                   ARGEYPSFMNRFFQENDIHIVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAG
FT                   NLMGGVKNEYLESSDWGWQIDPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKI
FT                   HDDYRIDYLRKHIEQMKEAIADGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDW
FT                   GKGTLERSRKDSFFWYKKVIETNGEDLV"
FT   regulatory      284143..284164
FT                   /locus_tag="Lm4b_00284"
FT                   /regulatory_class="terminator"
FT   regulatory      284334..284339
FT                   /locus_tag="Lm4b_00285"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        284347..284619
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00285"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00285"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04052"
FT                   /protein_id="CAS04052.1"
FT                   /translation="MKKTRVTWAIVIAIAGLLVSVISLSVNITQNRYNVRGVDSSSQWK
FT                   TGFQKNQTVCAIETKKHWTKGSVKYGVNQTSGTVKTKYSIYSKKK"
FT   CDS_pept        284636..284791
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00286"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00286"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04053"
FT                   /protein_id="CAS04053.1"
FT                   /translation="MYKDGYTSRNNTYYGEFYGHYAGGKDKFSYKLEKKNNKNVKSQLI
FT                   VDLFVI"
FT   regulatory      284651..284656
FT                   /locus_tag="Lm4b_00286"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      284830..284835
FT                   /locus_tag="Lm4b_00287"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        284843..286504
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00287"
FT                   /product="Putative ABC transporter (ATP-binding protein)"
FT                   /note="similar to ABC transporters (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00287"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04054"
FT                   /protein_id="CAS04054.1"
FT                   /translation="MNITKNGLYIIIGANGVGKTTLAKKILQANRSISCMMKQDDNQIL
FT                   EYETVLTNISMNEIAEKTVINFLEEHQLDYLITKKSKFLSGGEKRLVNLLRAILSNQEV
FT                   LILDEPSNDLDIDVFEKAKQIIYQAAKSKIILLITHDDRFTEYDKKIEIMKNQSYEADS
FT                   FSFNKESSKARIIKIKPRRTYFLYIFYLICMMIFAIFLVILLKTNAEETSPSNEKGTYQ
FT                   LATIYSTNASSYDNNEAINTMLIQSATKFNKAKFFTEETRINEDEYYEEAINLKKDTYQ
FT                   ELIYLELYDPKTEEFINIKAVMMEALRGDLKLNAETEFISNDENYYKNSDSPSFHVPKS
FT                   LTLTEIKKAKIKQLGFELHYSNTLQSNQVEIEFNPSVYAQILKKVNQQDVLITEAYVQL
FT                   KAQESFYDFLAENKLYAKKIFIKGYEPELLNAEVNQYSNAVMLIKKVALLICLLLLVLL
FT                   ILLIMYEVSYKNSYSTLTYYGYNEKELLQFRKKTYLITNFKIFSVISTVIFLLIMWSIV
FT                   HSVLITAIIGVVMIFFFFAYIVIPLIIKNNIRKAII"
FT   regulatory      286491..286496
FT                   /locus_tag="Lm4b_00288"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        286501..288276
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00288"
FT                   /product="Putative ABC transporter"
FT                   /note="similar to ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04055"
FT                   /protein_id="CAS04055.1"
FT                   /translation="MNKINKFSIFSITKPGIYTITGSNGSGKTTFIENELKNNTNKVKD
FT                   VAYFAQKNWKYKTNVEKYLHFPKTNPSLVQKYCELFSVDNYYLEKDIQLLSGGEFVKVE
FT                   LVRTLALDSSIIILDEPTNNLDNKSSEILANILSELAKTKIIYLVSHDTRLEHFFDKTI
FT                   FVDKDRIEVSSNVEIEQNEIQVNSKRVVSNGRILKYLLSSKFNFLMFAFIIVLTILLTN
FT                   ITSTIILRSVPIEENLTSDYNFELMDIAENYSRYFNIEMTESEIEAEFQEPNHLTTNEL
FT                   IELQDKDYIKQIYVVDESYINEFVLDNSKFEVLALPEIITDSPNYVNAFPVTKMHLTKG
FT                   RFPKDDAKEIALSFAQLKKFFHDDISEESAIGNKLEFEDELYEIVGIVNSPVAAISYSK
FT                   QVSKGTVEVEDKTSEKLNNILLKLEKENYDNPNFSIISIKLASKNQHELLNYLKVHGPS
FT                   YQYASNYVDSISQVAFYKQNLAKILLISVIFSLIVSVLIFIFGRKSFSLINGFLNDMSN
FT                   LNFTPRKNKRFIYVIMILDFLLSMPACLLVSRVIIGDNIGMLMILPTLGGSAIIFMLTL
FT                   LLMSYRDKKNDFRNL"
FT   CDS_pept        289067..290713
FT                   /transl_table=11
FT                   /gene="inlH"
FT                   /locus_tag="Lm4b_00289"
FT                   /product="internalin H (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00289"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04056"
FT                   /protein_id="CAS04056.1"
FT                   /translation="MKKRWNSVFKLVLMVAAILGISLYVTTSQGAEVRAESIAQPTPIN
FT                   VIFPDPALANAVKTATGKSNVTDAVTQADLDGIATLSAFNTGVTTIEGIQYLNNLIGLE
FT                   LKDNQITDLTPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGL
FT                   SNLQVLYLDLNQITNISPLAGLTNLQYLSIGNNQVNDLTPLANLSKLTTLRADDNKISD
FT                   ISPLASLPNLIEVHLKDNQISDVSPLANLSNLFIVTLTNQTITNQPVYYQNNLVVPNVV
FT                   KGSSGAPIAPATISDNGTYASPNLTWNLTSFINNVSYTFNQSVAFKNTTVPFSGTVTQP
FT                   LTEAYTAVFDVDGKQTSVTVGANELIKEPTAPTKEGYTFTGWYDAKTGGNKWDFSTDKM
FT                   PAENITLYAQFTINSYTATFDNDGKITTQKVTYQSLLEEPAAPTKAGYTFKGWYDAKTG
FT                   GTKWDFATGKMPAGNITLYAQFTKNDSPNPNDPTPNTPTGNGDGTSNPSDSGGNTTLPT
FT                   AGDENTMLPIFIGVFLLGTATLILRKTIKVK"
FT   regulatory      290723..290759
FT                   /gene="inlH"
FT                   /locus_tag="Lm4b_00289"
FT                   /regulatory_class="terminator"
FT   regulatory      290909..290914
FT                   /gene="inlD"
FT                   /locus_tag="Lm4b_00290"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        290922..292628
FT                   /transl_table=11
FT                   /gene="inlD"
FT                   /locus_tag="Lm4b_00290"
FT                   /product="internalin D"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04057"
FT                   /protein_id="CAS04057.1"
FT                   /translation="MKRKKTALRILVTLAVVMAISFWVGTSSKEEVQAAVIDQPTPINE
FT                   IFTDENLANAIKATLNKPSTTSDVSQAELDSISEVTAESSNIASLEGAQYLNNIDTLIL
FT                   NNNKITDLNSLAGLSKLRILEANDNQLSDISALANVTSLHQLRLAGNQIKQLNGVSNLI
FT                   NLETIELSNNQITDISPVSGLKNLIGLGIDYNDISDLSPIAGLAKLSHLTADNNQISDL
FT                   SPISSLGAMEIMRLDKNQISDVTPIANLANLSYVFLAENQISDISSLQPLFNSPNFFGI
FT                   TLDNQKITSEPVLYQQELVVPNNIKDEMGALISPDTISDNGVYASPNIKWNLANYTNQV
FT                   SYTFNKQLAQGSFSGTVTQPLHNAYTATFDVDGVKTNEVVEETKLLQEPTAPTKEGYTF
FT                   TGWYDAKTGGNKWDFATDKMPAEDITLYAQFTINSYTATFDIDGKLTTQKVTYQSLLEE
FT                   PAAPTKDGYTFKGWYDAKTGGTKWDFATGKMPAGNITLYAQFTKNATPDSNDPTTVTPT
FT                   GNGNGTSTPSNSGGNTTLPTAGDENTMLPIFVGVFLLGTATLILRKTIKVK"
FT   regulatory      292640..292676
FT                   /gene="inlD"
FT                   /locus_tag="Lm4b_00290"
FT                   /regulatory_class="terminator"
FT   CDS_pept        292840..294339
FT                   /transl_table=11
FT                   /gene="inlE"
FT                   /locus_tag="Lm4b_00291"
FT                   /product="internalin E"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04058"
FT                   /protein_id="CAS04058.1"
FT                   /translation="MKRNKVILRIVVTLAAVLAITFWVGMSSKEVQAAVIEQPTPINEI
FT                   FTDPVVADNVKTLLEKADVTDEVTQTDLDSITQLSAKSAGITTIEGMQYLTNLSELELT
FT                   DNQITDVSPLANLTKITELGLSGNPLKDVSALAGLKSLKMLHLIYTDITDVTSLAGLTN
FT                   LQELNLDINQITDISPLAALSNLQTLSLGYTQVSDLTPIANLSKLTILNAENCKVSDIS
FT                   PLASLSSLTEVYLRENQISDVSPLANIPNLSIIELTDQIITNQPVYYQNKIIVPNVIKG
FT                   LSGELIAPDTISDNGTYTSPDLTWDLNSYINSVSYTFNQSVVFKNATVPFSGTVTQPLT
FT                   EAYTAVFDVDGEQTSLTVVVNELIEEPTVPTKEGYTFDGWYDAETNGNKWDFAVDKMPA
FT                   SDITLYAKFTENEEPNASSSINVEPNDDNSINVEPDASNSITVKPTENNDGTNNPNSSS
FT                   DDKVNIKLPITGDEWNVLPIFVGAVLIGMGLVLFRKKRQTK"
FT   regulatory      294349..294385
FT                   /gene="inlE"
FT                   /locus_tag="Lm4b_00291"
FT                   /regulatory_class="terminator"
FT   CDS_pept        294473..295612
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00292"
FT                   /product="Putative succinyldiaminopimelate desuccinylase"
FT                   /note="Similar to succinyldiaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00292"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04059"
FT                   /protein_id="CAS04059.1"
FT                   /translation="MERQRKIQILKDIVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQ
FT                   YDVDRASLVSEIGSSDEKVLAFSGHMDVVDAGDVSKWKFPPFEAAEHEGKIYGRGATDM
FT                   KSGLAAMIIAMIELHEEKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGE
FT                   PSGHRIVYAHKGSINYTVKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNE
FT                   ILGDFIHNVTVIDGGNQVNSIPEKAQLKGNIRSIPEMDNETVKQVLVKIINKLNKQENM
FT                   NLELIFDYDKQPVFSDKNSDLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFP
FT                   VIIFGPGNETPHQVNENVSIENYLEMVDVYKRIATEFLS"
FT   regulatory      295665..295696
FT                   /locus_tag="Lm4b_00292"
FT                   /regulatory_class="terminator"
FT   CDS_pept        295759..296175
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00293"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00293"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04060"
FT                   /protein_id="CAS04060.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAVGISTAQFDCIA
FT                   QIGLDKEITQQQLAEKLVVTKGNVTQLLAKLEQLGYITRTKTGREKHITLTEKGQACYR
FT                   ENVPKQEAFQQAQFDKLTRDEQKELLKLLKKLGE"
FT   CDS_pept        296182..297141
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00294"
FT                   /product="Putative hypothetical protein"
FT                   /note="Similar to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00294"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04061"
FT                   /protein_id="CAS04061.1"
FT                   /translation="MKLTGIHHVSIFTANARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNHPSRNAISSLSLRVPSDEALHYWDKRLDEHRIFH
FT                   SKPIDQFGRKIIRLKDTDGLPVNLISDETSTQVTEVSPWEDSPVPAEYAIRGLGPVRFS
FT                   VFKKEKTDRLLTKILGFERIGAYEDDDKLVTVFKTGDVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDGDLIGWTEMIQDLGYKNSGYVDRFYFHSLYFRESNGILIELATDEP
FT                   GFQTDFTKEHGTYVDLPPHLEERREDILAHLKPLDTDK"
FT   CDS_pept        297213..297848
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00295"
FT                   /product="Putative phosphoglycerate mutase"
FT                   /note="Similar to phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00295"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04062"
FT                   /protein_id="CAS04062.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIDGAKAVGE
FT                   VLKDTPIDAVYTSTSKRTQDTAAYILGDREIEIQPLEELKEMGFGTWEGIRVTEIDEQH
FT                   PEERAKILHSPETYKAEVNGGETYYELAERLLEGVEKIIAENLSGNILVVSHGMSLTLL
FT                   LYLLQGGTVEDHRKEAPRILNTSISIVEYQNGEFSLKKINEIGHLDLK"
FT   CDS_pept        297932..299818
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00296"
FT                   /product="Putative transporter"
FT                   /note="Similar to transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00296"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04063"
FT                   /protein_id="CAS04063.1"
FT                   /translation="MKRIVKIFLHYLLGILGIILISCVPAIFSKVTSWSSSTYWEALKS
FT                   IFTAIFHPTKWEISYQGSAEVFHVSLADFITGPYFYSMKIIVASLLISAIIAYLLVIAT
FT                   FRGPKWLRQGLSGFLSILQAFPDFSFIFLIQMAVVYIYQQTGVFTLNFYSLNGEQIYAA
FT                   PIVCLSIIPTVLFYKMMMLLMENEWQADYIQLARGKGLTDRAILLRHATPNMMQSLFYQ
FT                   SKTIVWFILSAYLIVEFLFGIEGVLYYLLAGFSPLNIFLVLALVFTPFYFFYALIDLWI
FT                   SRGKNTESANVTRIPLHWNSFQKTFTEKVNLKSKWRNFVVTTGQLLKRPSFSIPLATLS
FT                   ILLIASLIYGLMGDKINSLKFISDATGRVTDMAPFKPNAQVWLGTDQAGNSILDQLLVG
FT                   IKYTLLIAVIIATLRVVIGYILAVPLAFFSKPRTRNFVQSIADGMHYLPLSLLVFIIMV
FT                   NEFISYSGVFETSLFTRITFQILIMVVIVLPITTNRISSEISQVLKKEFVLSALVFGGN
FT                   ARWILTKHINPQIWSKLILIWIEQLIQTLQMFVHLAIFGIFIGGAIMGADDGMLNPVIP
FT                   ELSGLIANAKFVFANHQFWIILPPLVVFMILILCFQMMANSLLKREEESKKA"
FT   regulatory      complement(299813..299837)
FT                   /locus_tag="Lm4b_00297"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(299847..300932)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00297"
FT                   /product="Putative internalin"
FT                   /note="similar to internalins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00297"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04064"
FT                   /protein_id="CAS04064.1"
FT                   /translation="MKKFILASLACTTLISFSPLVGQVEVSAATTNIATAPEKNLQEAP
FT                   PATVDQIFPDDALAFKVAQELGVSEDTVVTQEQLDTIETMVYVDFGVEDLTGMEYLHNL
FT                   KFVDLSQNKISNLENLANLTELETVSLNYNQITDITPLMNSPKLYNLELGVNQISTLPS
FT                   FENLTNLRILNLSSNQLKDISALKDTPQLTNLSISANNISDISVLSECDNLRVFYAESN
FT                   QLTSIESLRNKTKLEYFDANFNQIKDVTPLSTIPTIRSIKIEENQISDFSSLAGHRLEL
FT                   FDATGQNIYLPDVALGDSTNIVMKDNLGVTLHDWVWYTPGTYQNDTLTWENAGDNSAYF
FT                   LNNQYPTYPSVTVTVYQTVTP"
FT   regulatory      complement(300941..300946)
FT                   /locus_tag="Lm4b_00297"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(301027..301057)
FT                   /locus_tag="Lm4b_00298"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(301066..301692)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00298"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00298"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04065"
FT                   /protein_id="CAS04065.1"
FT                   /translation="MMADLQDWLARIQAKITALKEKDPDLNLFGSESHAYKLNQPLSNQ
FT                   TLTEFENEHQITLPQDYRAFLEQIGNGGMGPYYGLETLADGLCASLDYKDEKYGVQTLS
FT                   EPFPHTDDWTAPGYKEGMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPS
FT                   YGEIWVDDRNNDNGVYPDFYFGNEERLGFLEWYELWLDKSIEEIE"
FT   CDS_pept        complement(301693..303129)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00299"
FT                   /product="Putative phospho-beta-glucosidase"
FT                   /note="Highly similar to phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00299"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04066"
FT                   /protein_id="CAS04066.1"
FT                   /translation="MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIP
FT                   GTTFKGTNGDVAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFY
FT                   DNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVK
FT                   YWVSLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIG
FT                   PSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIE
FT                   DGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKK
FT                   VVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRI
FT                   DYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTR
FT                   IPKKSYYWYKQVIETNGADL"
FT   regulatory      complement(301703..301708)
FT                   /locus_tag="Lm4b_00298"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(303217..303240)
FT                   /locus_tag="Lm4b_00300"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(303249..304061)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00300"
FT                   /product="Hypothetical protein"
FT                   /note="Conserved hypothetical protein similar to B.
FT                   subtilis YxeH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04067"
FT                   /protein_id="CAS04067.1"
FT                   /translation="MYKLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRP
FT                   LVGVENYLTDLELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNL
FT                   HMHFFDDKALYTPNREIGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELE
FT                   VGIAKIPESFREKYHLVRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQEN
FT                   DVTMLEFAGLGIAMGNAPERIKQLADYTTASNNDSGVAKAIQKFVLDK"
FT   CDS_pept        304197..304700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00301"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04068"
FT                   /protein_id="CAS04068.1"
FT                   /translation="MKRNYHVKFLNEKDVELAEAVCAASEDYYLMEQDKPASKSDALKI
FT                   ITEIPNGKTRFDKFVLAVLDENEKPIGLVDIVSDYPRKGRWFIGLLLLTPDARHNGLGK
FT                   VLHQTIKEWANDGGADSLALGVLAENEKGRGFFEYLGYTKEETKQANYGGKEQEVSIFT
FT                   LAIK"
FT   regulatory      304706..304730
FT                   /locus_tag="Lm4b_00301"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(304706..304730)
FT                   /locus_tag="Lm4b_00302"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(304737..305399)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00302"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00302"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04069"
FT                   /protein_id="CAS04069.1"
FT                   /translation="MAYPFNHKEFVAMMEQYNLKSNSITIPEHTILNDLVTENRDCVYL
FT                   LKSGILAGYIDFDNDKIYSIFTSNFFMGYYTIFDNASLVLTYQTLTECELIIYKKKDIE
FT                   YSLSLFPENFSFQYTIMRTIAKHGYYKSLLQYRDKKDQLAFVFEMLVKILDIPVEDGVA
FT                   VLPKSISPTVIKNYCTLSKAFFYSQLKELKEAGIISKVKLQWRINMEALSEKNNSIN"
FT   regulatory      complement(305411..305416)
FT                   /locus_tag="Lm4b_00302"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(305657..306499)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00303"
FT                   /note="C-terminal part similar to B. subtilis ComEC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00303"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04070"
FT                   /protein_id="CAS04070.1"
FT                   /translation="MKKGILNVLLVFALIAGLSVPSSMQVEAAAPTIKVHFIDVGQGDA
FT                   IYIKAPSGEDILIDAGNKGKGKTVVNYLKKLKVKDIEIMIASHSDADNIGGLPEVMNNI
FT                   KVKSLYAPKSTNTTAAYKNFVNTAKKKKLTIKTAKAGVKLPVKGVNAQFVGPVKTYGKT
FT                   DRNNWSAVLHVAYKKNTFLFTGDAQTKAENDMIKAKKTLRADVLKVSTQGSKAATSKAF
FT                   VNVVKPKYAIISVGKNGYGHPTSQTVNTLTKAKAKVYRTDRNKTVVVTGNGSSYSIGK"
FT   CDS_pept        complement(306516..307337)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00304"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00304"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04071"
FT                   /protein_id="CAS04071.1"
FT                   /translation="MTKKYLICSDIDGTLLRQDQTVSKKTRDLIQTLEKDGHIFSISTG
FT                   RMYRSAREVGFQVSNSGHVIASNGSYAAIRDEQLLKTTLEEKAIRSTYDIMSDFDLPLF
FT                   FFSTNTLFYTKEPPAFFQNLADKSRLDTGHNSFSLVSINEKGVFDENMHQFLNAIVVAE
FT                   DDASKLTEVRAALNEANGIRVLSSHHNNLEILPANSDKKTAVEALGKHYNIPRERIITF
FT                   GDGENDIGMLQYAGTGVAMANASDNVKAAADHLTDTNEADGVYKFLKEFIS"
FT   CDS_pept        307453..308424
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00305"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00305"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04072"
FT                   /protein_id="CAS04072.1"
FT                   /translation="MGNLNWAILGPGSIAHEFAEGMRGMNREIYAVGARSIEKGQAFAS
FT                   QYGIEKVYDDFDKMLADPAIDVVYIATPHSNHYEFIMKSLHNGKHVLAEKAITVSSEEL
FT                   NEINVLAKEKGLIVKEAMTIFHMPLYKKLREIVESGAIGKLKIIQVAFGSAKEKDPKNR
FT                   FYNMDLAGGALLDIGTYALSFARYFLSETPDEVLTTMKKFETGVDEQSGILLKNKEEEL
FT                   AVVSLSFRAKMPKRGVIACEEGFITVDEYPRASRATVTHTATGKVEEIEVGETSKALEY
FT                   EIIAMEESIATGENTTYQLTNDVITIMSDVRTQWGIKFPFEK"
FT   regulatory      308430..308447
FT                   /locus_tag="Lm4b_00305"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(308430..308447)
FT                   /locus_tag="Lm4b_00306"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(308462..309562)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00306"
FT                   /product="Putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /note="Similar to sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00306"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04073"
FT                   /protein_id="CAS04073.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDEIKKRVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLEGSNFIGDDFTIEVPEGKLKLLKDRGFDGKDIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
FT   CDS_pept        309853..312003
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00307"
FT                   /product="Putative anaerobic ribonucleoside-triphosphate
FT                   reductase"
FT                   /note="Highly similar to anaerobic
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00307"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04074"
FT                   /protein_id="CAS04074.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKANFDLIKIRNAVEASMKAINLEDETFL
FT                   EEILLEVVSELPNKADMTIDEIQHCVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHKKDAMEWVVPEKQEGYAAEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWEN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGENVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDKE
FT                   AKNFTLDILKELKGYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKDYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECNFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
FT   regulatory      309867..309873
FT                   /locus_tag="Lm4b_00307"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        311996..312547
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00308"
FT                   /product="Putative anaerobic ribonucleotide reductase
FT                   activator protein"
FT                   /note="Highly similar to anaerobic ribonucleotide reductase
FT                   activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00308"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04075"
FT                   /protein_id="CAS04075.1"
FT                   /translation="MNNPKPCEWKSNELSRGYIADYKAFNFVDGEGVRCSLYVSGCPFH
FT                   CEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESVQGLTLLGGEPFLNTATCLSVVKRI
FT                   RATYGETKDIWSWTGYTWDEMMQETADKLELLSLIDVLVDGRFEQKLFDPNLAFRGSSN
FT                   QRIIDVQKSLATGEVVLYEL"
FT   regulatory      312553..312571
FT                   /locus_tag="Lm4b_00308"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(312664..312686)
FT                   /locus_tag="Lm4b_00309"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(312691..313362)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00309"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00309"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04076"
FT                   /protein_id="CAS04076.1"
FT                   /translation="MDALFNYKEFVRLSHEGNIKYEKLKVPKHTDLVNTASQRNNHVYL
FT                   IVEGFVSISMNPQSSSIYTVLGKGSFVNYYSLFQGNVDDFLFTTISPCTIYKYSFKDLE
FT                   YFLSMFPENFGFQFFIMRDLARHAFFKSLFAETSSSDKLELSFSNMGKLHGTLYEKDSV
FT                   ILPKEMRTSTIAAYSNLSKSSFYKQLTLLKEQGKIWKNGREWVVRNKELYDYVKARQFV
FT                   D"
FT   CDS_pept        complement(313527..314306)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00310"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04077"
FT                   /protein_id="CAS04077.1"
FT                   /translation="MWKLALCQTDVVFKYPDANYARIEKAIVEAAKNGADIAVLPEMWN
FT                   TGYALNELAGVADLNGERTKEFLATLSEKHQIAIIGGSVSISEGTKFSNTMYAFDKYGG
FT                   LLSSYKKVHLFQLMNEHLYLEAGNDKNLFRLDGVSCAGFICYDIRFPEWIRKHTSEGSE
FT                   VIFVSAQWPAERVTQWEQLLIARAIENQAFVVAVNRVGDDPNNHFNGHSLVIDPLGNIV
FT                   AHGGEDEGNIYAEIDLKLVAETRGIIPVFTDRRPELY"
FT   CDS_pept        complement(314396..315058)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00311"
FT                   /product="Putative ABC transporter permease protein"
FT                   /note="Similar to ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04078"
FT                   /protein_id="CAS04078.1"
FT                   /translation="MSLFFEEWGPILWQGFLETLTMTGITLVISLAIGLPLGVFLTLTR
FT                   KGGQSENLVAYSILNWVINILRSLPFIILLFLMIPVTRFVVGTTIGIQGVIMPLVVFTA
FT                   PYIARLMESALLEVDRGVVEAYQAMGISTPKIIWSVVIREARSGIVLGLTIATIGLIGA
FT                   TAMAGLVGAGGLGTIAYQYGFQRFEPTVMYTTIIILIIMVQALQSFGNFLSRRLKKD"
FT   CDS_pept        complement(315055..316071)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00312"
FT                   /product="Putative ABC transporter (ATP-binding protein)"
FT                   /note="Similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00312"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04079"
FT                   /protein_id="CAS04079.1"
FT                   /translation="MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKS
FT                   TLVRCINLLERPDAGQVVIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDNIA
FT                   KPLKLEGVSKDEIETRVNKYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILL
FT                   SDEATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQ
FT                   GTVLDIFTKAKHATTKRFVGSEASFDIPQDLLEKYVATGKLVSLHFIGDEADEPALALV
FT                   SRKFDVLPSILAGGIDHLKNGTLGKLLVHLKGDEVEYSKAISYLKESGVVVEEVELL"
FT   CDS_pept        complement(316086..316907)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00313"
FT                   /product="Putative lipoprotein"
FT                   /note="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00313"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04080"
FT                   /protein_id="CAS04080.1"
FT                   /translation="MRKLTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   KLDVAFKTVAFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEYRGLKLFEDAGVIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTKDNPYPNVFVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPAF"
FT   CDS_pept        317288..318469
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00314"
FT                   /product="Putative aminotransferase"
FT                   /note="Similar to aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00314"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04081"
FT                   /protein_id="CAS04081.1"
FT                   /translation="MKISKRLQNLPDQFFSSLVEKVGKKVAEGHDVINLGQGNPDQPTP
FT                   KHIVEAMKTASEKPLNHKYSLFRGKHELKQAAADFYAREYNVTIDPNTEVAILFGTKTG
FT                   LVELPMCLMDPGDTMLLPDPGYPDYLSGVVLGEVQFEKMPLIAANNFLPDFTKIPEDIA
FT                   EKAELMYLNYPNNPTGAVATADFFEETVAFAKNHNIVVAHDFAYGGIGFDGKKPISFLE
FT                   TNGAKEVGIELYTLSKTYNMAGWRVGFAVGNSEVIEAINLIQDHMYVSLFPGIQDAAIE
FT                   ALTGDQTCVGELTARYESRRDAFISACKKIGWEAVAPAGSFFAWMPVPENFTSSEFADY
FT                   LLEEVSVAVADGSGFGEFGEGYVRVGLLMDEERLEEAVTRVSKLHLFDKVTQQ"
FT   CDS_pept        318682..319395
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00315"
FT                   /product="Putative two-component response regulator"
FT                   /note="Similar to two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00315"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04082"
FT                   /protein_id="CAS04082.1"
FT                   /translation="MAEKKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEE
FT                   VQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKP
FT                   FSNRELIARVKANLRRHSQVSSNAAEEEENSELEIGSLIIHPDAYVASKRGETIELTHR
FT                   EFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLV
FT                   TRRGVGYYLRNPEQE"
FT   regulatory      319406..319439
FT                   /locus_tag="Lm4b_00315"
FT                   /regulatory_class="terminator"
FT   CDS_pept        319580..321412
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00316"
FT                   /product="Putative two-component sensor histidine kinase"
FT                   /note="Similar to two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00316"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04083"
FT                   /protein_id="CAS04083.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEIIKNSDNSVKLQNDIRELLVDYSRASSNLIEVRIVDDKGKI
FT                   LGTSNLNNQGIVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGQV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIIEMKRQAYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTEGERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDTYQFEDLMEVDGSLTMDRSTL
FT                   DKPYVLRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPREPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKFEDEIEVSIADEGLGVPDEDLANVFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKTKGTIIKFTLPYSDLPEDDWE"
FT   regulatory      321393..321398
FT                   /locus_tag="Lm4b_00317"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        321403..322731
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00317"
FT                   /product="Putative YycH protein"
FT                   /note="Similar to B. subtilis YycH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00317"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04084"
FT                   /protein_id="CAS04084.1"
FT                   /translation="MGMMKKTGFRSFILTILVVLSIVLSYFIWKGQPDYEAINVKEVEK
FT                   TTIDKTMTTSQVFKPYKLAVNANENNYQSLDADLLNELMAQGKAFSFSEVVLASKKSSE
FT                   DYEKLIHKNGTIEIIFPNNIPFSIFAQIFQVEGEGLESAFFNRIVFDINKTDTGLHSVY
FT                   FTNDDQENIYQSSLQNKDIDKIEKIVKKNESKLTQNDKLISNKRNLFLSSEKTKLNRKK
FT                   YIIDSLEINLFTSALFQDSGTVKSEGNTYTDGSSVIEMDTDNKVLEYVNPSQERTNPED
FT                   LSSVKRAGLIQDSFNFVNDHAGWTGDGAYYFTGYAAESATTNFSLFIDNLQVYNENGMA
FT                   DISVTEGLEAVYKYMRPFFRLDTDVPGEKKEVTLPSSYSVYSALAQNPNVKAEEIEDIV
FT                   PGYHMTRSESSGMNRLVTLEPTWLYKYHDKWFIFQPDAEKAGE"
FT   CDS_pept        322734..323573
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00318"
FT                   /product="Putative YycI protein"
FT                   /note="Similar to B. subtilis YycI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00318"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04085"
FT                   /protein_id="CAS04085.1"
FT                   /translation="MDWRKTQMIFIVTLLILNVFLAVIFFNKQLSDDPDTLGNETLEER
FT                   LKADNISHPDLSTKPTSGSIFTTERAAFTTKDVSDLTGQAITLKDNNKQIYSVLQTPVK
FT                   AGKKGSNPEFQKFMESDVYRGESYQFWNYDKDARTLTFNQLINNNMVLFDEAGQITFYL
FT                   DQDDRVISYEQTWMSKQDDLKDKTNLMSATDALEAVYQHGELKQDSDVVSATFGYYTTV
FT                   QLPSGNVYFPVWCFEVKHSGETNYVLVNAKDEQVINQSDNKSATEPGTELSSRQKTK"
FT   CDS_pept        323693..324523
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00319"
FT                   /product="Unknown"
FT                   /note="Conserved hypothetical protein similar to B.
FT                   subtilis YycJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00319"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04086"
FT                   /protein_id="CAS04086.1"
FT                   /translation="MFANKILTEKDTDQIRFSILASGSSGNATLVETGDQKILIDCGLS
FT                   GKKMEGLFAQVGRDMNDLDAILITHEHSDHIKGLGVLARKYKLPIYANAKTWKAMDNMI
FT                   GEVSSDQKFQFDMETVKTFGSMQVESFGVSHDAIEPMFYIFHKGNKKFVMITDTGYVSD
FT                   RMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRRILGDEGHVSNEDAAIAMSEVITDQ
FT                   TKRIYLGHLSKDNNMKELARMSVTQTLMAEGIDVGGKLEIFDTDPDNATSIFTI"
FT   CDS_pept        324621..326123
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00320"
FT                   /product="Putative heat-shock protein htrA serine protease"
FT                   /note="Similar to heat-shock protein htrA serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04087"
FT                   /protein_id="CAS04087.1"
FT                   /translation="MDEKEKNLNENSENESTPKREVEDTLHTPESAQPVQETPIVEGVT
FT                   PEGEKFAGATEDAAEASSTNAFFEEASNKEPEPARPAPGPRRAGTTGGGAVPPNRVNNG
FT                   GSGNGNGEPPKRGKHFIGYFLTALIGVIIGGLIIFFVAWDNGDNADTTSNSNNKATKVE
FT                   KVSVDTTSDVTKAVDKVQDAVVSVLNYQSSSSLDGTTTSEQEASSGSGVIYKKANGKAY
FT                   IVTNNHVVADANKLEVTFTNGKKSEAKLLGTDEWNDLAVLEIDDKNVTTVAAFGDSDSL
FT                   KLGEPAIAIGSPLGTEFSGSVTQGIISGLNRAVPVDTNGDGTEDWEADVIQTDAAINPG
FT                   NSGGALINIEGQVIGINSMKISMENVEGISFAIPSNTVEPIIEQLETKGEVERPSLGVS
FT                   LRDVDTIPETQQKNILKLPDSVDYGAMVQQVVSGSAADKAGLKQYDVIVELNGQKVTNS
FT                   MTLRKILYGNDVKIGDKVKVKYYRDGKEKSTDIKLEAAKTTT"
FT   regulatory      326133..326158
FT                   /locus_tag="Lm4b_00320"
FT                   /regulatory_class="terminator"
FT   CDS_pept        326811..327290
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00321"
FT                   /product="Unknown"
FT                   /note="Conserved hypothetical protein, highly similar to B.
FT                   subtilis YydA proteinYyd"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04088"
FT                   /db_xref="GOA:C1KZ18"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZ18"
FT                   /protein_id="CAS04088.1"
FT                   /translation="MNIQIVTVGKLKEKYLVQGIAEYLKRLSAYAKVTIVEVPDEKAPE
FT                   VLSDAEMKQVKDKEGARILAKIPDDAHVIALAIDGKMKSSEEFAADLDKLATYGKSKVT
FT                   FVIGGSLGLSEAVLKRSNERISFGRLTLPHQLMRLVLVEQVYRAFRIVRGEPYHK"
FT   CDS_pept        complement(327322..328185)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00322"
FT                   /product="Putative transcription regulator LysR-gltR
FT                   family"
FT                   /note="Similar to transcription regulator LysR-gltR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00322"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04089"
FT                   /protein_id="CAS04089.1"
FT                   /translation="MDIENMKAFNKVAELKSISAAANELHHLQSNMSNKIKNIEKQFQT
FT                   QLFFRHSNGVEPTKEGEKIYQQFKKMILLWEETIDIINNEEETISIGITQSSLPMEFNT
FT                   IIKEFYQQFPNKKLSIVSGSTSELIPKIANRELTIAYVAELEKENLFQDSQIISQTLSW
FT                   DKLVFAGNTAGKSVQKILAEERLYVFSKQCYSYRALAALINDINIPNVSISEINIPETL
FT                   VEICNNELGIGIIPESIALNYHFLNYETLPTEYASLRKTLIYHADHTISNGEKWLIEKS
FT                   KPAFKS"
FT   CDS_pept        328304..329041
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00323"
FT                   /product="Putative FMN-containing NADPH-linked nitro/flavin
FT                   reductase"
FT                   /note="Similar to FMN-containing NADPH-linked nitro/flavin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00323"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04090"
FT                   /protein_id="CAS04090.1"
FT                   /translation="MNTTIQQLVKHVSVREFKNERLSDEIKQHLLTAARSASSSHFVQS
FT                   FSILEITDEKLRKELAEITNSASYVNQTGTFYVFVGDLYRQSKLLLENNRTLDGLRNME
FT                   SLLVSVIDATIAAQNMVIAAESLDLGICYIGGIRNDIEKVAELLNLPPFTIPVFGLTVG
FT                   VPEYKNQVKPRLLLENQVGENQYPHEQFTDLKAYEELTKDYYALREKNQHQTSWGDKNV
FT                   AFFEEIRRPEIAGFLKKQGFTLD"
FT   regulatory      329094..329116
FT                   /locus_tag="Lm4b_00323"
FT                   /regulatory_class="terminator"
FT   regulatory      329240..329245
FT                   /locus_tag="Lm4b_00324"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        329252..329890
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00324"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00324"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04091"
FT                   /protein_id="CAS04091.1"
FT                   /translation="MKFLKKYGFYFLLLGVLSDFLTPYILGIFYPELNQMTRVMSVFGD
FT                   VASPVRGAFLVWSVVSGVFFVLALPAIYQSVVKTSRTLAILLASAIGLYGIGDCIFTGL
FT                   FSIDTEQASWTFSTWVHNIGSGLGYAGFLIFPLFLVILYRKTGDKTRSNIYLVLLIVSL
FT                   LSAGVYGLARIPAVNDLPVLDKIGFCQRISFFFNYLPIVVFGIDRIRKP"
FT   regulatory      329885..329909
FT                   /locus_tag="Lm4b_00324"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(329896..331767)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00325"
FT                   /product="Putative transcriptional antiterminator (BglG
FT                   family)"
FT                   /note="Similar to transcriptional antiterminator (BglG
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00325"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04092"
FT                   /protein_id="CAS04092.1"
FT                   /translation="MTISERQRSLLEKLNDSQKTVTAKALSEMLGVSSKTVRNDIMQIN
FT                   QSFSSTIIASKAGKGYFLTPNEQLSQINLTKNSENLHFELLRHIIEQDHTNFYDLADQF
FT                   FISESTLARIIKELNAVIAEKDTSLCIIRKNNELLTEGGEEEKRRIFNLFLNQEIENHQ
FT                   LSLDKYADYFDYCNLKQLSELIIAYHKKNDFFMNDFSTISFILHIAVLIERISMGSYIE
FT                   RTALLEQDKTSLEMAEHLAETLENELQINIPTQELSYIARLYSGKLTTTSTIDAQVFGS
FT                   VVTRLLEAVDQNFHIDFSADEKIATYLVAHISALYKRANHKQYLTNPLTEELKNKFPFI
FT                   YNVSVYASAFIQKELAITFPDDEIAYIALHFLSASETINHGKKRKILLVSPYGAGSQRL
FT                   IHNQLKKIADFSIDLLVSQSIFDIKQFTLDKEIHLIITAEPLNLTTDIPVYHYDLLLTE
FT                   TDLQKIKHILETKPKADSISRKFFKKELFFPKQNFKSKEEVITFLCEQLTAFDYCDSDY
FT                   VSKVFEREQLSSTCYGNYYAIPHAIQRSAKKNAVAVCALDKPIDWGGNRVKLVLLLTMK
FT                   EERDNSFEELFGQLVTILNERSFVKKLAKQEDFQQFIELCEQKTLDS"
FT   regulatory      complement(331774..331779)
FT                   /locus_tag="Lm4b_00325"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(331866..333179)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00326"
FT                   /product="Putative PTS beta-glucoside-specific enzyme IIC
FT                   component"
FT                   /note="Similar to PTS beta-glucoside-specific enzyme IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00326"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04093"
FT                   /protein_id="CAS04093.1"
FT                   /translation="MRFNTISEKMDQYISPLANKLSQQRHLKATRDAFMSMLPITLFGS
FT                   IPIILKAAPVTDDTKNGFLLAWANFAEKYDLILNWISGITLGAMSLYICVGITYYLCKH
FT                   YHEDFLRPLMFSIAGFFMLVLNPIKMGWDGKEVDISFLDGRGILLSIFVAIVTVEGYHW
FT                   MRKKNVGRITMPDSVPASLSETFAALVPGIILMTFFSIIFIIFNLLDTTAIQFLYEKMA
FT                   PSFKAADSLPFTILSIFLVHLFWFFGVHDAALAGILGPIRDGNLSINAAEKMAGQDLTN
FT                   IFTTPFWTYFVIIGGSGSVLALAFLMMRSKSKQLSTVGKVGFLPSIFGISEPLIFGTPL
FT                   MLNPIFFFPFIFTSVFNGVITYLCMYFGIVGKTFAVFSWQMPAPIGAFLSTMDWRAIVL
FT                   VFILIFLNGLMYYPFLKVYEKNLVALEKEAEEENIAAN"
FT   CDS_pept        complement(333184..333474)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00327"
FT                   /product="Putative PTS beta-glucoside-specific enzyme IIB
FT                   component"
FT                   /note="Similar to PTS beta-glucoside-specific enzyme IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00327"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04094"
FT                   /protein_id="CAS04094.1"
FT                   /translation="MKNIMLVCNAGMSTGMLAKKIEAASGNTLNVTAYSESEYTDYLDG
FT                   VDLVLIGPQIRFLMPQIKQAVSVPVHAISPVKYGIMDGKGVYEDIQKLIGG"
FT   CDS_pept        complement(333491..334882)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00328"
FT                   /product="Putative phospho-beta-glucosidase and
FT                   phospho-beta-galactosidase"
FT                   /note="Similar to phospho-beta-glucosidase and
FT                   phospho-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00328"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04095"
FT                   /protein_id="CAS04095.1"
FT                   /translation="MNNNFLWGGATASYQCEGAWDVDGKAESMWDYYLHEAGLENGDVA
FT                   SDHYHRYEEDIRMMKEGGQNSYRFSLSWPRIIKNRQGDINLKGIEFYQNLLDTCKKYDI
FT                   EPFVTLYHWDLPQYWEETGGWLDHDVCAAFEHYAKVCYDHFGDKITNWTTFNEPKWFVA
FT                   NGYKIGNYPPGYQDTQKTMIAAYNVMYASALGVKAFKEGGYSGQIGIVHSYTPVNGVDE
FT                   SIETKIAMRYADNYCNNWILDTAALGEFPVDLIAELAKSHDISFMKTDELQTIKQNTVD
FT                   FIGLNYYSRTLVKPYTGGETQLQFNHSGKKGESKVLIKNWFEQVKDPANETTEWDTEIY
FT                   PKGLQDGLIEAYERYQLPLYVTENGIGVREDVSVAKVDDAYRIAFMNDHINAIFNAIDA
FT                   GCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFENNQIRKPKASYYWFKEMIESQGKLI
FT                   KRREF"
FT   CDS_pept        complement(334875..335216)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00329"
FT                   /product="Putative PTS beta-glucoside-specific enzyme IIA
FT                   component"
FT                   /note="Similar to PTS beta-glucoside-specific enzyme IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00329"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04096"
FT                   /protein_id="CAS04096.1"
FT                   /translation="MTDSNELTTELDSMAIILHAGNAKSCAFEALKEVKLQNIEAFTQK
FT                   ITEAKDEIKLAHRAHAELLRKLSSENRMREVDLLLVHAEGHLSSTDIAVEMIRELGEIY
FT                   QWKWSLSNE"
FT   regulatory      335367..335372
FT                   /locus_tag="Lm4b_00330"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        335380..335667
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00330"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04097"
FT                   /protein_id="CAS04097.1"
FT                   /translation="MMKKTVHGWEIISNLDIRLYQDEAGGVVILLDKDGFGDQVPVLLN
FT                   FDDDGVDIKALSHLTKSVRVLLDKKVRIEWHDEYFEERTQAMEYIEVERD"
FT   CDS_pept        335703..336257
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00331"
FT                   /product="Putative secreted, lysin rich protein"
FT                   /note="Putative secreted, lysin rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04098"
FT                   /protein_id="CAS04098.1"
FT                   /translation="MSKKLVSIIFLGICLLLVGCGKEVVDSKYTGKWKLESSGIGMSDG
FT                   SNYKETDAAGKVSLDLDIDAEGNVKELYIDDAVAITNSYKLKKKGDDEYQYDGTLISKK
FT                   VYSYETESDKENVETMLKFLKSKDNVKITKNEQKGDEYHIDVKADEKDFVFSLEMQSGK
FT                   LIFKKVDTKEKVLIKETYKKN"
FT   regulatory      336323..336352
FT                   /locus_tag="Lm4b_00331"
FT                   /regulatory_class="terminator"
FT   CDS_pept        336448..337536
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00332"
FT                   /product="Putative low specificity L-allo-threonine
FT                   aldolase"
FT                   /note="Similar to low specificity L-allo-threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00332"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04099"
FT                   /protein_id="CAS04099.1"
FT                   /translation="MINTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGN
FT                   GAVIENFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRCVAYHPLSHLEIHEQ
FT                   DGLKELQQITPILLGTANRLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEEIS
FT                   EYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDD
FT                   FVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKT
FT                   VPEVPVSNMFHVYFEKSADEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFA
FT                   EIPVEILDVVFKQLEVDLPCQN"
FT   CDS_pept        337524..338309
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00333"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04100"
FT                   /protein_id="CAS04100.1"
FT                   /translation="MPKLIIDADDFGLSKAINHGIIESYKTGITTSTLLMPNLETAEHA
FT                   ITLAKDHTDLFIGQHTNFLLGKPCADPAEIPSLVDENGEFHRSKYYRANPELKFQYEDV
FT                   RTETIAQMERFKALTGHYPEHIDCHSIGDETVDQAFFDIAREFGIHTTLKYSGDKKWPD
FT                   QEGYLPITKLLESGALPYTNGGVSVENFLNDDFGLLKLAPNEIAEMHFDVGFLDQFVLD
FT                   NSSYTLMRCRELATICDVRVRDWLLENGFELITFGDLQR"
FT   regulatory      338360..338401
FT                   /locus_tag="Lm4b_00333"
FT                   /regulatory_class="terminator"
FT   CDS_pept        338532..339206
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00334"
FT                   /product="Putative thiamin biosynthesis protein"
FT                   /note="Similar to thiamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00334"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04101"
FT                   /protein_id="CAS04101.1"
FT                   /translation="MFVHGFQEEVGDLWQETLQHPFVQSLADGTLEKEAFYYYLLQDDY
FT                   YLSHFEKVIEKSVAQAGTAEIAAEMREVQVRLQQSELLMREQFYPRVGLTERDFSVRKP
FT                   APTAYHYTSHLYRMADFGSFGVTIAALLPCYALYADMGKMYEGARSSEPFYQELLDSYV
FT                   DENYQKVVLQQKRLVEQAASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVN
FT                   YV"
FT   CDS_pept        339199..340008
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00335"
FT                   /product="Putative hydroxyethylthiazole kinase (ThiM)"
FT                   /note="Similar to hydroxyethylthiazole kinase (ThiM)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00335"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04102"
FT                   /db_xref="GOA:C1KZ32"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZ32"
FT                   /protein_id="CAS04102.1"
FT                   /translation="MFDFMTLEKVWEKGPLVHNITNIVVANDSANGLLAIGASPIMASA
FT                   KEEMDELAKMADVLVINIGTLDGELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKV
FT                   VQELLAEIQFTAIRGNAGELAAIAGEAWEAKGVDAGVGSADVLSIAEKVANEWSTVVII
FT                   SGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVCGSFMAVQDDAFRASVEACASYA
FT                   VASEYAEIELERKLPGSFRPQFLDALASWSVEKTRAKAKIQESGEHK"
FT   CDS_pept        340005..340808
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00336"
FT                   /product="Putative phosphomethylpyrimidine kinase (ThiD)"
FT                   /note="Similar to phosphomethylpyrimidine kinase (ThiD)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00336"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04103"
FT                   /protein_id="CAS04103.1"
FT                   /translation="MIFKQVLTIAGSDSGGGAGIQADIKTFQERKTFGMSVITAITAQN
FT                   TLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVARNIRLHNFPNIVI
FT                   DPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKITTKAEIEQAAKK
FT                   IFDLGVKAVVIKGGHSEMSEAADFYYDGETTKWLTSERFDTPHTHGTGCTFSACIAAEL
FT                   AKGNSLLDSVMVAKEFITSAIKYPLGIGHGHGPTNHFAYRLEDGK"
FT   CDS_pept        340805..341449
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00337"
FT                   /product="Putative thiamin-phosphate pyrophosphorylase
FT                   (ThiE)"
FT                   /note="Similar to thiamin-phosphate pyrophosphorylase
FT                   (ThiE)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00337"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04104"
FT                   /db_xref="GOA:C1KZ34"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZ34"
FT                   /protein_id="CAS04104.1"
FT                   /translation="MRAELAVYFIAGTQDIVRGTLPGVLEEALKAGITCFQYREKGAGS
FT                   LQTASERKEMALECQQLCAKYQVPFIINDDVALALEIGADGIHVGQNDEEIRQVIASCA
FT                   GKMKIGLSVHSVSEAEEAERLGAVDYIGVGPIFPTISKADAEPVSGTAILEEIRRAGIK
FT                   LPIVGIGGINETNSAEVLTAGADGVSVISAITRSDDCYSVIKQLKNPGYPS"
FT   regulatory      complement(341431..341465)
FT                   /locus_tag="Lm4b_00338"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(341476..342891)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00338"
FT                   /product="Putative phospho-beta-glucosidase"
FT                   /note="Similar to phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00338"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04105"
FT                   /protein_id="CAS04105.1"
FT                   /translation="MHTNTGFPANFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFG
FT                   HITDGPTPDNLKLEGIDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAG
FT                   LQFYDDLFDELLAHNIEPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYK
FT                   GKVKYWLTFNEINSILHAPFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIM
FT                   PEAQIGCMVLAMPTYPLTSNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNI
FT                   ELDVTEEDLEILKNTVDFISFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGW
FT                   QIDPQGLRVVLNEFWDRYQKPLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLS
FT                   QVKEAIKDGVDLMGYTSWGCIDLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFD
FT                   WYKNVIATNGEDL"
FT   regulatory      complement(343074..343099)
FT                   /locus_tag="Lm4b_00339"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(343105..344349)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00339"
FT                   /product="Putative peptidoglycan linked protein (LPXTG
FT                   motif)"
FT                   /note="Putative peptidoglycan linked protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00339"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04106"
FT                   /protein_id="CAS04106.1"
FT                   /translation="MNKYFKNLATVLFTVSLLTTSITALPAMASAYEETHNASTIYISP
FT                   LDAPHVGDTKITGKTTALSSFAIAIYTPEGRLTGTFFGTTNAAGTYAVDLSDFTYYDPL
FT                   GYEASGNVILEKGAMVRSMTETNSDLIKTVTINYNYIQTAINELFLNNDPTGTILAATD
FT                   QNAINAVQEQINTVTSSEKETFQEQLNNAQQQLDARIAQEQAAIQAVNQLFLEDNPANS
FT                   IKAETTQDLIDQAQTLVDVLPASELKDTLQANIVKAQTELDERSKPVTPPKNDPETDNP
FT                   EEPVTPVDPATPTPDEPSTPTDPATPTPDEPSTPTDPATPEKPEITTPENPESTVVESD
FT                   SSENEPEKSADSKIVNNPIQITSQATKTATKQAKSSVTKTTTLPIPKTGDTETTSSILF
FT                   GTLMLASLALFRRKK"
FT   CDS_pept        344678..345337
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00340"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04107"
FT                   /protein_id="CAS04107.1"
FT                   /translation="MGSAFSAILSPAVGILISPFPIVGLILILLSNKARINSIFYTVGW
FT                   IVGNIAIFFIGLFLMSSAVSSSGDQSTLVKVVLIVLGALLILLGAHDFTKRPKNGEQAA
FT                   TPKWFEKMSNIKPGGAMMFAFVLSAVNPKNMLLSLTAGVSVGALNLSGGQETTATIIFG
FT                   IIACCSIYIPTIAFLLAGSKLNNALDSTRKWLIQNNSVIMAVLFLFIGLSVISKAF"
FT   regulatory      345345..345378
FT                   /locus_tag="Lm4b_00340"
FT                   /regulatory_class="terminator"
FT   CDS_pept        345635..346027
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00341"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04108"
FT                   /protein_id="CAS04108.1"
FT                   /translation="MLDKLLGKAAVVTESSYGIERFLGEDETIIQIFKFVRDEVIITSK
FT                   GIFNVDAQGITGKKVEYKFFPKKALKYVSIETAGTLDRDFDLKIGVDGNTVVTQNTSFS
FT                   APISLKVHKNDTEMGFALYKMIKEML"
FT   regulatory      346034..346056
FT                   /locus_tag="Lm4b_00341"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(346062..346835)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00342"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00342"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04109"
FT                   /protein_id="CAS04109.1"
FT                   /translation="MFSVTTFNIRFDDTSERKKSWELRKTLTKSLLDKYQWDFMGVEEP
FT                   LLPQMCDMKEMQDWDYFGVGRDDGFEKGEFTAVFYNSTRFILLQEGHFWLSETPEVPSI
FT                   HSTAMFPRICVWGKLEDSTDGKQFYIFNTHLDHISEEARLFASQLLLHKASLIQEDLPV
FT                   ILLGDFNTEPSTPTYNLITQRYQDAQLLSKTPVKGPLGSFHDFQPLRPESELEKIDYIF
FT                   VSNEFHICSYETSTDEIDGCSASDHFPVMAVVGWT"
FT   regulatory      complement(346843..346848)
FT                   /locus_tag="Lm4b_00342"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      346977..346982
FT                   /locus_tag="Lm4b_00343"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        346990..347457
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00343"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00343"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04110"
FT                   /protein_id="CAS04110.1"
FT                   /translation="MLRKSRWLLILLLLIVLVAFSACVDSGNGDVSGVPAKREKQHFPP
FT                   NDTKKGWIELLATDGISSQGDLPCVYEEAESVEKLEVHMKELSTVSLTYIYIDGYIVQM
FT                   EQGGGELSFQIQLSKAELKRGIHELTAVQYQENNPDTNKVELLKRANYEVK"
FT   CDS_pept        347725..348627
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00344"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00344"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04111"
FT                   /protein_id="CAS04111.1"
FT                   /translation="MGSYGELIREIRLSKGLTQKEVYTGIISRSYAIGFEKGKHEITLS
FT                   LFEEILKRIMVPLDEFFFIYRDFSSTEDDSFWIDFVELSGKNDVVGMQALLDKITLERT
FT                   EQTEVRKAILHTRIQTINHYLRTNVFDESNISDEYKKIIHDYLWKMQTWTLEEVRIFSN
FT                   GISFFEEEVQIHFYQIMLKSYEKYRYYDRGRLLFCHLFANLTDELIIQNKINYANLVLE
FT                   KLKEASETSGSFNSAFYRIVANYYQGAIWMKEGEVEKGYRQAKRAIQTWKELHYEAIAD
FT                   LYSVVLKQFLEKENIQVED"
FT   regulatory      348655..348678
FT                   /locus_tag="Lm4b_00344"
FT                   /regulatory_class="terminator"
FT   regulatory      348778..348783
FT                   /locus_tag="Lm4b_00345"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        348791..349663
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00345"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00345"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04112"
FT                   /protein_id="CAS04112.1"
FT                   /translation="MISYGELIRQIRQSKKISQKEVYTGVISKSYAIEFEKGTHAISSL
FT                   LLEKIVAKLMVSMEEFFLMYHQEELPEKEDFWETYARTCKTDEASAWESLYQKISLEKG
FT                   KVNQVKSAAIKLELDHIKGKQVADKKAVQILENYLIEAVFWTLQDIFLFTRMMHYLPLK
FT                   SRVPFYYKLLNTLDRYRHFERGRSILQSALASIMDDFIERNEIEHMELMIKSLEKISED
FT                   CDGTYFKILCMYYRGIVRWGEGEEREGGEEIEQAVAILRALGYENKAIEYETMYRQFAR
FT                   ENNDIKTME"
FT   regulatory      349662..349694
FT                   /locus_tag="Lm4b_00345"
FT                   /regulatory_class="terminator"
FT   CDS_pept        <349862..353911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00346"
FT                   /note="Putative peptidoglycan linked protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00346"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04113"
FT                   /protein_id="CAS04113.1"
FT                   /translation="VILKKIFIALIALVVIINTVSFTAVSASTPTWLEQTMNSNEPFIK
FT                   EIEKETGKTRANITQTDLEAITALRVTGASDIPTNIDMLTHLTTLEVKNGTLSSVSNSV
FT                   GNLKELKILVLNDNNLSTFPMIAFQLPKLEELQVSGGTIEEIPATITNMASHLKFLGIL
FT                   NNHLVKVPDAIFTTNWTNATGGDLDLMAAGNQIVTNIPANYISQFNNGDNLLEFYDNNY
FT                   QKQDQLTTTPGYTIDVPVGTDFNQLTPDKTKLALTSGRTLLAQHEFEYYDDGSSSLIHN
FT                   GVAAAPGQATIFIKSKFSTQSNKFARTQVTVNITALNGGPITVKHEDTTGQELAPPVIL
FT                   NGKDGDPYTTTQKTFPGYTLVATPANQNGTFTMNPATVNYVYSANDYKLTSTFKDAQGQ
FT                   ELKAPVVDTKDYHIQDNYTTTAATIPGYSLVATPANQNGTFGAGNVTVNYVYKKDDYTL
FT                   TSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFPGYTLVATPTNATGTFGSSNITVH
FT                   YVYQANGYQLTSTFKDQQGKTISPDDVDTKTYHVNDPYTTTAKTIPGYTLVTTPTNNQG
FT                   NFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKQPVVDSKKYHIQDNYSTSAATIPGYT
FT                   LVSTPANETGTFHTSDVTVNYVYKLTDLKLTSTYKDAQGTELKPPVVDSKTYHIQDNYA
FT                   TTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAVAYKLTSTYKDQQGNDLALPKVDS
FT                   KTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASDVTVNYVYKANDYTLTSTYKDAQG
FT                   KELKTPVIDSQKYHINDTYTTTGATIPGYTLVAAPANQSGTFGAANVTVNYVYKADDYT
FT                   LTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATIPGYTLVAAPANQTGIFNTSNVTV
FT                   NYVYKANEYTLTSTFKNVQGTELKPAIVKKGFIIKDGYATSGVTIPGYTLVATPSNKKG
FT                   TFGASNVTVNYVYKANGYALITTYKDTQGKDLKPLAIDTKTYNINDPYTAKALNIPGYT
FT                   LTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKDANGKELQAPKVDAKTYHIQDTYK
FT                   TTAAIIPGYTLVATPKNDQGTFGASNVTVNYVYQTNDYTLTSTFKDAQGNELKAAEVDA
FT                   QKYHIHDTYTSKAAVIPGYSLEKTPTNETGTFNASDIQVNYVYKANDYQLTSTFKDQQG
FT                   NEIALPTVDAKTYHIHDAYTTKAHLIPGYSLVAAPKNQIGAFGTSDVTVNYVYKKDAII
FT                   KPITPAKPTILTIKTPASKVVKTKVVKQTLPKTGDDDAGLLNLLRLIGLVLILGVFLAV
FT                   GSKKLR"
FT   regulatory      353930..353955
FT                   /locus_tag="Lm4b_00346"
FT                   /regulatory_class="terminator"
FT   CDS_pept        354049..354729
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00347"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00347"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04114"
FT                   /protein_id="CAS04114.1"
FT                   /translation="MLEKKYQIHLQNHYDATSRQVQKKEIKVLKKSKNLLNGEVFPYQI
FT                   CLESTMEYSRFMLWFEKEVQKIVKELWNQHFIIKLTLSQLHFRETILFLEHLKDFSKRI
FT                   TIEFIGEDTPEIKKHFSVQEQEAFFIGKLRMLKKWKFIISKHIEGCSVEQTLAFTPCLH
FT                   EIKYTMSQQARMEENIIDLHMFIDFWEYWATHKKLKFVVEVKEKDFITKSLMHKKVHVQ
FT                   FENA"
FT   regulatory      complement(354849..354872)
FT                   /locus_tag="Lm4b_00348"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(354884..356740)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00348"
FT                   /product="Putative internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /note="Similar to internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00348"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04115"
FT                   /protein_id="CAS04115.1"
FT                   /translation="MKLSKFFTIIALSATVTSSLPIPMVKAESTTANETKIENQLPKTD
FT                   LKETPKEKTTNNNLKNQLVQAGTKTYNDYFPDDNLAKAVAEKMNKNVDESVTVEELAKI
FT                   TKLDARSQGIEDSTGIEYLTGLEILYLEDNQLKSIDVSKNLNLKDLACSNNPLANLDVS
FT                   KNLALEELTCENNELTQLDVSKNTALEYLYCPRNQLTKLDVSKNSALRYLACDVNQLTS
FT                   LDVSQNPALTNLGCTKNQLTDLDVSQNPNLSTLVCSDNQLTNLDVSQNQALAYLTCDNN
FT                   GLKNIDIDQNLALIELSCENNQLTNLDTTQNLALEILYCDDNQLTNLDVRKNVNLLILS
FT                   CNNNQLTNLAVGETILDVSCNNNQLKDISSLPDYLTAENGEYQAMDQTLVGPIQTTQNN
FT                   TLVYAVPTDLLDKDGNIVSIIKPENGGVYDAATRTITWENLPDSGEVSYTFESNDYGVF
FT                   SGRVTVPYTGKETVSISSDDEISYKEGTTKTEEAFLTDIHASVTPATETITSNFADVVD
FT                   LQTPGKYVVTLSVAESDITKDVIVYVTEEPSKDNPVAPVPPKDPDNKVADNDQNTEKPQ
FT                   VKVDEKTLPKTGDITSLSLSLAGIICLSFGILFFIKRKKKTV"
FT   regulatory      357297..357302
FT                   /locus_tag="Lm4b_00349"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        357309..360020
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00349"
FT                   /product="Putative internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /note="Similar to internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00349"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04116"
FT                   /protein_id="CAS04116.1"
FT                   /translation="MKSKTKQIIMIGVVLFQSLFAYPLITMAEENESKSVNTETTLEPK
FT                   VALEEKTPQKPTLTNNLKQEKTVLQAGETYETVFPDAALATVIAKAATGSEDITQEVSQ
FT                   TDLNKITSLTATSKGIVDLTGIDLLSKLTSLSISGNQITDISALNGLVNLSNLNVSNNK
FT                   ITSFNLNANSNLPMLSAVDIRSNNLKNINVQDQPKLRTIECDTGSSSELTEVTLKNLPI
FT                   LIVAGNGSSAYQNDIVFSSTPGLSKVILENLPSISSSVRLDRCAIEELVINNLPKVSMV
FT                   NISNNKITTLEGLENLSAVNTLYVSENLVTEIENLHAFPKLQTLTVDNNHISVLPTSLK
FT                   TENPVLTTLSAMNQTITLKQKVIVSDLVLDNEVKNFGQITTAKSISNKGTYQNNQIKWL
FT                   FEDIKSVNAVDYQFSEPVQEATIQGTFSGKVTQPIKASKVPVISADAEMNYPKNETVSE
FT                   AAFFKDISASVTDDATLTSDFESVVDFAKAGTYEVTLNAVNEDGVKATSVTVLVHIAKS
FT                   PAPVITADKEITYTKNAEVSITEYLAAIHAKTNDGSPIESDFATAVNWGTAGDYTVTLR
FT                   STNEDGVEAIPVEVTVHIAKSPAPVITADKEITYAKNAEVSITEYLAAIHAKTSDGSSI
FT                   EADLDTAVTWGTVGGYTVTLRSTNEDGVEAIPVEVTVHIAKSPAPVITADKEITYAKNA
FT                   EVSITEFLAAIHAKTSDGSPIESDFATAVIWSTAGDYTVTLKSTNEDGVEAIPVEVKVH
FT                   IVEPLAPTISNVTFDVDDVQTTESLEAGELISEPLSPTKEGYTFIGWYDSKTGGNKWDF
FT                   TTDKMPAYNIILYAQFSKDTNKAEAAGGDKPSTPSSIKVSPTGQSESGNLENRSNIKLP
FT                   ATGDDNATVLLVGFGLLMLGLFIRLTQKKRAK"
FT   regulatory      360092..360115
FT                   /locus_tag="Lm4b_00349"
FT                   /regulatory_class="terminator"
FT   CDS_pept        360411..365738
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00350"
FT                   /product="Putative internalin proteins, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /note="Similar to internalin proteins, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04117"
FT                   /protein_id="CAS04117.1"
FT                   /translation="MKKKFSIVIISVLLLGYLAPFDTLLVGADETTVTEDTTVKTAETE
FT                   TATEATESESGSDNEKAEEPKEAEASKETTEKEEKAKTKEPASNIKTEINTDKSQLKQT
FT                   NLKAVVPAGSTFNSLFPDDNLAKKLAVIITGNAAATGNESVDSAALLAISQLDLSGETG
FT                   NDPTDISNIEGLQYLENLTSLNLSENNISDLAPIKDLVNLVSLNLSSNRTLVNLSGVEG
FT                   LVNLQELNVSANKALEDISQVAALPVLKEISAQGCNIKTLELDNPAGAILPELETFYLQ
FT                   ENDLTDLTSLAKLPKLKNLYIKGNASLKSLATLKGATKLQLIDASNCTDLETLGDISGL
FT                   SELEMIQLSGCSKLKEITSLKDLPNLVNITADSCAIEDLGTLNNLPKLQTLILSDNKDL
FT                   TNINAITDMPQLKTLALDGCGITSIGTLDNLPKLEKLDLKENQLTSISEINDLPRLSYL
FT                   DVSVNYLTTIGELKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINVSNNVIRTVGKMTE
FT                   LPSLKEFYAQNNNISDISMIHDMPNLRKVDASNNLITNIGTFDNLPKLQNLDVHSNRIT
FT                   NTSVIHDLPSLETFYAQNNLITNIGTMDNLPELTYVDLSFNRIPSLAPIGDLPKLEILK
FT                   VTDNYSYLRSLGTMDGVSKLRNLELQNNYLNYTGTEGNLSALSDLTNLTELNLRDNGYI
FT                   SDISGLSTLSRLIYLNLDSNKIKDISALSNLTTLQELTLENNQIEDISALSDLDNLNKL
FT                   ALSKNKIIDISPAANMVNRGASVTASNQTYTLPTVLSYQSSFTIDNPVVWYDGTPLAPS
FT                   SIAHSGTYKDGEITWTNMTAASSSTEFNFNRLKDGLTFSGTITQPYKSAVKVTANAEQT
FT                   YTIGDTISEEQFLKDVNAKSSDGAPVTSDFATVVDLNTFGEYEVTLTSEKDGIQGDSCK
FT                   VIVKVLHGAPVISADQTINYDKHATITEKQFLEDVHASTDLNTAITTNFSTAVNLNKGG
FT                   DYTVALNSENEDGVKAETVYVTVTVDKDPAPIISAKTDITYDKFSKKTEAAFLDDIDAD
FT                   TNDGSIITSNFATAVNLDKAGDYTVTLNSINSDGVASTPTAIIVHVEKEKIATISANTA
FT                   QQYEKYAEINETQFLKDVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNEDGG
FT                   VSAPKEVSVIVKKLPAPEITADKEITYPKFDEVSEAEFLSDIHATINEKNVTITSNFSA
FT                   DVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADATISYDKFANITEAK
FT                   FLEDIHATSSDGQSSTVITSNFETATNFKTAMSYTVTLNAVNEDGISAEPVAVTVTINK
FT                   EPAATLKADAEVSYAKNEAVTESDFFKDVHLEGAEAPSTAKATSNFDSVVDRSKTGDYT
FT                   VTINATNEDGAVSTPIEVIVHIGAESAPVITANAEVKYNKHEQTDERRFLYDSDAKIDE
FT                   ANVEIKTDFAEKVDINKVGTYTVTLTATNEDGQAANPVEVSVIVSDAAAEKVNVKYVDE
FT                   NGAEISAAETLTGNLDDAFSIDAKSIAGYKCDATLSGVFSTVEQTVVFHYKAIEPGVVT
FT                   IKYEDAKGKAVAEDKQITGEVGDDFEAEAQTVSGYSCRAIASGKITEEPQTITFTYTTA
FT                   TPSKKSGEITVQYVDESGKKLADSKKVTGDIDDSYSVEAKAIDGYSVVGDDSAKGVFTE
FT                   KSQTVTFKYKKNTQVSKDEPKVKGKTNQPPSADTKLKVDNNTLPATGDTENMALAVLIG
FT                   FNMLLVASIFLFRKPKTNQ"
FT   CDS_pept        365962..366486
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00351"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04118"
FT                   /protein_id="CAS04118.1"
FT                   /translation="MNKMIIYSSQYGTSKKYATELSQKKEIPMYSVESIPESIVEADEI
FT                   IYVGAIYMGKVLGFDKFSKKYKTLSSKLIVISAGMYDPTRKENTDNIELTVKENLQKTN
FT                   FLLKDIFCLKGRLDTQQLRLKHKMLVNAFYKSAKRKKESDLNDNERDIVRAYEDDSQID
FT                   LNKLDGILDRV"
FT   CDS_pept        366699..366983
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00352"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00352"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04119"
FT                   /protein_id="CAS04119.1"
FT                   /translation="MREIKVSEVTFQQHATKLASESTGSYLPLKNGNMAYSRANSIDQL
FT                   RSALIDLVGVVEDFQHVTKQDAGRLKKMGIAYAKQDQVMGQKINQLEVR"
FT   CDS_pept        366984..367352
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00353"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00353"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04120"
FT                   /protein_id="CAS04120.1"
FT                   /translation="MDSAHRQLEQQLQQIKKAKIMAETDVDQTRRKQNEQDWLEEDSHQ
FT                   LTQEKLVLLDFLRSGWQGEEASGFHRFLEEQQHEESQAWRRDLQDKRSDLDTELQENKA
FT                   RLHTLETKQATLQKEWSK"
FT   regulatory      367336..367341
FT                   /locus_tag="Lm4b_00354"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        367349..368785
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00354"
FT                   /product="Putative truncated gene"
FT                   /note="probable truncated gene"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00354"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04121"
FT                   /protein_id="CAS04121.1"
FT                   /translation="MSRIDIAELNDFLHGLRSSNAEAKAMIRKIKEAAMDYAQDNRLKG
FT                   EAVSTSKRYFSSTYTSICQSIIEALDESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVSQLQRKEEDLHRQLTAPNTKPDMQQVYAVKSRSVHTQLLKAIEKENILERYLAFE
FT                   QSHGQFFSALDELIQATGRAVQELLQHVTFNDKTGTYSVPKSAVNSLLLMKKALDNART
FT                   ENDQDPFPKAFEDYTVLAYTYVNDQGETVTMWLLEKDGKRVENKELQDFLEKHGQELDP
FT                   LLYTNLSGEELERKVNDSWKEGINYLNGQKVSGFSGATLRSSAYVASLKDWTDDAGLTD
FT                   MALGLGFGIAAARNKAIIPKKSSGLKFDDIEKLENHFTKHGGEFKGAYSNINEYLKGAN
FT                   NVIKNGEKVQYNYTLKDGTTELRTGYVKFMGNTSKGKAKFEFVGTNLSGDITTYHVKRG
FT                   EDVYKLLNGNKHINVINPIE"
FT   regulatory      368784..368789
FT                   /locus_tag="Lm4b_00355"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        368797..369192
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00355"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00355"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04122"
FT                   /protein_id="CAS04122.1"
FT                   /translation="MRYEAKIISENPNIEEELKIKIKDIELLCFVEEYKCSVEVGQEYI
FT                   VELETVVFDDLDIEKSTLQAKEITQVADSFAYFIRGVFHPSSKKIDSGIEIDLADEDIS
FT                   DFWYLENQFVALNVDRFNIDVIEKVNK"
FT   regulatory      369540..369545
FT                   /locus_tag="Lm4b_00356"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        369553..369783
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00356"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00356"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04123"
FT                   /protein_id="CAS04123.1"
FT                   /translation="MKQCPVCENYTIEANYDICEVCYWEYDVVAQEYPDEIIGANNISL
FT                   KQAKINYAKFCAVEEKYITLVRKPRQDELLE"
FT   regulatory      369848..369853
FT                   /locus_tag="Lm4b_00357"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        369862..370089
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00357"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00357"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04124"
FT                   /protein_id="CAS04124.1"
FT                   /translation="MEYEQMADSLAYGEEYNFYYKNEEYWLSKNREGHYLTKVSDGETQ
FT                   EFRTSEDLLGTARINGKLIIEIWENIQSQF"
FT   regulatory      370244..370249
FT                   /locus_tag="Lm4b_00358"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        370258..370518
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00358"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00358"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04125"
FT                   /protein_id="CAS04125.1"
FT                   /translation="MKKLTTEQSFEYYLSSLCMLGLHTINLSDEEIEYEIFEELAIDYP
FT                   AALSPYTRELLVDNDIIDRELSLLSKQLQTKLFELDGGILW"
FT   regulatory      370879..370884
FT                   /locus_tag="Lm4b_00359"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        370894..371082
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00359"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00359"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04126"
FT                   /protein_id="CAS04126.1"
FT                   /translation="MEERFEKIYTQGKLNIMEIWVDKETGVQYVYHLSGYAGGMSPLLD
FT                   ADGKPLLADLSKLNGAE"
FT   regulatory      371114..371148
FT                   /locus_tag="Lm4b_00359"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(371202..373199)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00360"
FT                   /product="Putative transketolase"
FT                   /note="Similar to transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04127"
FT                   /protein_id="CAS04127.1"
FT                   /translation="MSRIDEQMVNSIRVLSMDMIEKANSGHPGLPMGAAPMAFSLWKNH
FT                   LKFNPEHPTWFNRDRFVLSAGHGSAMLYSLLHLFGYDLPMSELKNFRQTGSKTPGHPEF
FT                   GHTVGVDATTGPLGQGFAMGVGMAMAEAHLGAKFNQPEFPVVDHNTYVLCGDGCLMEGI
FT                   SYEAASLAGHLKLGKLVVLYDSNDISLDGDLNESFSEDIELRFRAAGWQTLRVDDGNDL
FT                   DALDAAIHLAKTEKSRPTLIEVKTVIGYGSPGKAGKSAAHGSPLGEKELKLAKEAYDWQ
FT                   MPPFELPKTVENQKEFYHSKGRASESSWLRTFNAYKQKFPALAESLQQLMDDNLDTDWD
FT                   AELPVFDENADKAVATREVSGIVLQELEKKLPNLFGGAADLASSNKTHLKASERFAPGN
FT                   YAAKNISFGVREFAMGAAVNGMTLHGGVQAFGATFFVFSDYLRSAIRSAALMGIPSTFI
FT                   MTHDSIAVGEDGPTHEPIEHLASFRAMPGLHVIRPADGNETVEAYRYAFTQKEQPTMLV
FT                   LSRQNLPILPNSAAKAQTGLAKGAYILADSPLDKLDIILLASGSEVHLMTAVRDNLAKK
FT                   GFGARVVSMPSFDLFDKQSPEYKESVLPKAVKNRFAAEMGASYGWHKYLGDTGQILAID
FT                   SFGMSGPGDELARRFGFTVENLTELALKQL"
FT   CDS_pept        complement(373201..373857)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00361"
FT                   /product="Putative transaldolase"
FT                   /note="Similar to transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04128"
FT                   /protein_id="CAS04128.1"
FT                   /translation="MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKE
FT                   ICSIVEGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKT
FT                   NVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISA
FT                   SIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN"
FT   CDS_pept        complement(373904..374668)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00362"
FT                   /product="Putative dehydrogenase/reductase"
FT                   /note="Similar to dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00362"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04129"
FT                   /protein_id="CAS04129.1"
FT                   /translation="MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD
FT                   IKEDVKDVAAKINPSRTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKA
FT                   EDLPEEYWDKTMELNLKGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCAS
FT                   KAAIVSMTQVLAMEWAPYNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYP
FT                   EEVAACALFLVSDAASLITGENLIIDGGYTIK"
FT   CDS_pept        complement(374693..375139)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00363"
FT                   /product="Putative sugar-phosphate isomerase"
FT                   /note="Similar to sugar-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00363"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04130"
FT                   /protein_id="CAS04130.1"
FT                   /translation="MKIAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFENEKVLYPSI
FT                   AEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIM
FT                   TMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQKNR"
FT   CDS_pept        complement(375146..375910)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00364"
FT                   /product="Putative triosephosphate isomerase"
FT                   /note="Similar to triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00364"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04131"
FT                   /protein_id="CAS04131.1"
FT                   /translation="MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSM
FT                   GTLETTANLLAGTLFGFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFH
FT                   EKTSEIAKKIKLALDEKITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENV
FT                   VLAYEPEWAIGKASSAETNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIV
FT                   RQKNVDGLFVGRFGHKPQNFADIVSIVSKTKG"
FT   CDS_pept        complement(375914..376564)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00365"
FT                   /product="Putative dihydroxyacetone kinase"
FT                   /note="Similar to dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00365"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04132"
FT                   /protein_id="CAS04132.1"
FT                   /translation="MSELVMDSAFFGHVLQDMGALIEKERDYLTGLDSDIGDGDHGINL
FT                   SIGFREVNKQLDELLTASPDIATLLKKSGMILLGKVGGASGPLYGSFFMKCGADVPGKT
FT                   EVNFDELCGMIINGAAAVQHRGKAELGDKTMMDAFLPGVEVLQNRDTNAAPIETFSAFV
FT                   DAMHAGAQSTIPLIAKKGRALRLGERAIGHLDPGSESSWMLMNVILENLKKAV"
FT   CDS_pept        complement(376586..377581)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00366"
FT                   /product="Putative dihydroxyacetone kinase"
FT                   /note="Similar to dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00366"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04133"
FT                   /protein_id="CAS04133.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAENVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPG
FT                   IKRTSIEPADKVVDQIMGYLIEEMKLTADEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHNPLVGNYATSMDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD"
FT   CDS_pept        complement(377603..377944)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00367"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00367"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04134"
FT                   /protein_id="CAS04134.1"
FT                   /translation="MSIGIALATIAGGFLFPFAIRMMWGKMVDEWGAIGGWMAAAFIVG
FT                   TVWTINHGIPKSMIYQSGTVWVDMAVAAGIGVFTASLLTGGKFSKSIVNLAAAVVGGVV
FT                   GGFLLSLFL"
FT   CDS_pept        complement(377960..378391)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00368"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00368"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04135"
FT                   /protein_id="CAS04135.1"
FT                   /translation="MKFFRGMIGFCIAGMIVMSVWTPLAENYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGGELVSSLPTIGLVAIGAVLAG
FT                   IVAAAIEKDMAKKQEAKQEKTEPGMNMKEEERLNENQLV"
FT   CDS_pept        complement(378476..378853)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00369"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00369"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04136"
FT                   /protein_id="CAS04136.1"
FT                   /translation="MISIVLVSHSQKITEGLQEMIVEMVGDTVHIISSGGTGDGRLGTN
FT                   AIMIADNIATCTNSEHIYIFCDIGSAILSAETALELLETDLLEKTTIIDAPLVEGAFTA
FT                   AVQSLVNPSKEAILQELTNVH"
FT   CDS_pept        379036..379800
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00370"
FT                   /product="Putative regulatory protein (DeoR family)"
FT                   /note="Highly similar to regulatory proteins (DeoR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04137"
FT                   /protein_id="CAS04137.1"
FT                   /translation="MFPFERQNKIIHLLDQNSKITVPELSRILDVSISTIRNDLSSLEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFSRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGANLIEN
FT                   IHADLCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLIALLDHTKMGVISTASITA
FT                   AENIDLLITDNKINKALYKKFQDAGLPVKIAE"
FT   regulatory      379815..379842
FT                   /locus_tag="Lm4b_00370"
FT                   /regulatory_class="terminator"
FT   regulatory      379854..379859
FT                   /locus_tag="Lm4b_00371"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        379866..380276
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00371"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04138"
FT                   /protein_id="CAS04138.1"
FT                   /translation="MDYIITTDLPNAEEFVKLRVDAGLSFRSIEVSRQALLKSVYFVGL
FT                   RSKEDNALIGMGRLVGDGIMFIVSDIAVLPEFQGNGYGKLIMTHIKNYIDSNLDKTACV
FT                   TLLADVPADGLYKQFGFRESAPASIGMIYQMK"
FT   regulatory      380280..380303
FT                   /locus_tag="Lm4b_00371"
FT                   /regulatory_class="terminator"
FT   regulatory      380362..380367
FT                   /locus_tag="Lm4b_00372"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        380374..382143
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00372"
FT                   /product="Putative internalin, peptidoglycan bound protein
FT                   (LPxTG motif)"
FT                   /note="similar to internalin, peptidoglycan bound protein
FT                   (LPxTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00372"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04139"
FT                   /protein_id="CAS04139.1"
FT                   /translation="MKSKGRLFLYVVLALSIVIGTNVFIKIDAHAAAAPPAAISQIFPD
FT                   DALATEIQTTLGKSSTAEVVTQTDLDTINSLTLTSKGISSLEGMNYLTNLGTLILTGNQ
FT                   VSDISPLKGLTNLTMLQLSGNPISDISALSNLKNLQALDINDAQVTDITPLSGLTNLKG
FT                   LGLYNNQLENLSGVNSLHQLRSLNVSNNKLTNLDELQALSNLSVLYANENQINNLQGLS
FT                   NLNNLFLLDLSANQIVDTTPLAGLTKVQTLYVSNNQISDVTGLSSLINLDWLDISQNKI
FT                   SNIRPLNSLTKLTIIQMTNQLIVNEPISFESTVTIPNLIKNIAEQTIDPDTISDNGVYA
FT                   NEAVTWNLPTYIPKVSYTFIERDTIGNATGNFSGTVEQPLVQYFKATFNIDGQETTENV
FT                   ETGTLLQEPPTPVKEGYTFNGWYDAETGGTKWDFTADTMPANDITLYAQFSINSYTATF
FT                   DVDGVISTQAVEYQGLLEEPPAPTKDGYTFKGWYDAKTGGTKWDFTNNQMPANDITLYA
FT                   QFSKDASSGGDGGGTDEGGGNSENSTEGAPNTSDIDTINHIVLPATGDDHVLFPIFIGT
FT                   FLTSLALLTLRRK"
FT   regulatory      382152..382172
FT                   /locus_tag="Lm4b_00372"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(382152..382172)
FT                   /locus_tag="Lm4b_00373"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(382184..383710)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00373"
FT                   /product="Putative fatty-acid--CoA ligase"
FT                   /note="Similar to fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00373"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04140"
FT                   /protein_id="CAS04140.1"
FT                   /translation="MTIKKYEPLNLYTNFKKSAERYPEMPIHFDEELVTFPELGLHTTY
FT                   KKCEEAIIQKAAHLHKFGVRKEEKVIVYKSAKFDSYILAVAISYIGAVPIMVSPHLPAS
FT                   TIDIFVNRLDQPWLLFDSETSEKSHQLNNLPDSRLINAEQLFKAPLDGYTCEQEELPKD
FT                   MIAYMTHTSGTTGVPKLIAHSANSMGWRTKYQRRILNFIKPRGLVAFHISPVHSRFNIG
FT                   VSSLMSLGFPLLPIANPTKANVEKVLREYKPYVLETHPNHFVQWASLAREKPDVFQSIK
FT                   FYHSTFDAINKETMAVFLRTSEYKKPIFLQIYGQSECGPMILRGHTLQSIETLNARDMG
FT                   IGVPGLTEVRIVDQDGNPVPAGVSGNIQMLSKGRALTYYKEEARFEENVYGPWWDSGDY
FT                   GMKDEQGRLFLQDRQVDLVETIDSTLAIEDKLLDTLTFLDEVVIIRGENGSPQPIIAVH
FT                   DDKEMNWDAWWDAVSDLPHMNEPIVMKYDEIPRTATMKVQRLQMERELKK"
FT   CDS_pept        383947..385467
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00374"
FT                   /product="Putative Flavocytochrome C Fumarate Reductase
FT                   chain A"
FT                   /note="Similar to Flavocytochrome C Fumarate Reductase
FT                   chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00374"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04141"
FT                   /protein_id="CAS04141.1"
FT                   /translation="MKKRLATTFIMLLSLALIIAGCGSNNTSKSDTEKTKEKEKTEVTS
FT                   GASKTSYTDPSELKDKYDIVIVGAGGAGMSAALEAKAKGMNPVILEKMPLAGGNTMKAS
FT                   SGMNASETKFQKEEGINDSNDKFYEETLKGGHGTNDKAMLRFFVDNSASAIDWLDSMDI
FT                   KLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEQKIPVFVNADVKEITQKDGK
FT                   VTGVKVKLNNKDEKTISSDAVVVTTGGYGANKDMIEKERPDLKGYVTTNQEGSTGDGIK
FT                   MIEKLGGTTVDMDQIQVHPTVQQDKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVT
FT                   ASINKLPEKSAYLVFDSGVKDRVKAIAQYEEMGFVEEGKTIDELAGKINVPKEELTKTL
FT                   DTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDG
FT                   KPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKAQ"
FT   regulatory      385510..385544
FT                   /locus_tag="Lm4b_00374"
FT                   /regulatory_class="terminator"
FT   CDS_pept        385671..386687
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00375"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00375"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04142"
FT                   /protein_id="CAS04142.1"
FT                   /translation="MLKMGFIGNGKSTNRYHLPFILERDNIEVKTIYNRNPKTATWDKI
FT                   EGVHYTTDLDELLKDPEIQLITISTTQSSHFDYAKMVLENGKNVLVEKPFMMTYAEAKE
FT                   IFELAKERDLLVQCYQNRRFDSDFLTAQKVIESGKLGDLLEVEMHYDYFRPEIPESVHE
FT                   FKFYDSYLYGHGCHTIDQVLSYFGKPDNIHYDVRQLLGEGRMNDYFDLDLYYGVTKVSV
FT                   KSSYFRIKARPSFVLYGKKGMFTKETKDRQEEHLKLFYMPSNPDFGIDLPEHYGTLTYV
FT                   DDAGVWHEEKVISEVGDYGRVYDGLYDAIINGKPKQVTDEETLLQMEILEKGVEACK"
FT   regulatory      386696..386721
FT                   /locus_tag="Lm4b_00375"
FT                   /regulatory_class="terminator"
FT   CDS_pept        386888..387334
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00376"
FT                   /product="Putative PTS system, enzyme IIA component"
FT                   /note="Similar to PTS system, enzyme IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00376"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04143"
FT                   /protein_id="CAS04143.1"
FT                   /translation="MNISNLINEDRIIFDNRIQTKQLLFEKVAEVLSEEGSITNPKKFI
FT                   RDLYKREEETSTGIEDGFGIPHAKSKYVKEPLIVFVHSGIINDYFGLDDSPIECSFLIG
FT                   VPKKATDVHLQILSELSRKLMNKEFREKLKNSKNKTEIITILSN"
FT   CDS_pept        387348..388742
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00377"
FT                   /product="Putative PTS system, fructose-specific enzyme
FT                   IIBC component"
FT                   /note="Similar to PTS system, fructose-specific enzyme IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00377"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04144"
FT                   /protein_id="CAS04144.1"
FT                   /translation="MKIVGVTACPTGIAHTYMSAEKLTITAEALGYEVKIETQGAKVEN
FT                   VLTKEDIATADYVILAVDKEIDTSRFAGKKIKKVSTSRAIKEADVVIEETISGKGLISL
FT                   EAKSSDISSEQPSKASLYNHFMNGVNYMLPFVIAGGILIAISFAFGIDASNPDSDSYNA
FT                   LAAAFSKIGGDTAFGLMVPALAAGIAVSVAGRAGFAPGLVAGTLATVGGSGFLGGMIGG
FT                   ILAGYVAHFFANKVNVTKSLASIYQLIVVPLLGITIVGLAMVFIIDTPIAWVLNALTGW
FT                   LNGLGETSGVVFGLLIGVMMAADMGGPINKSISTFSIGLMSAGVTAPIAACMAAGMVPP
FT                   LGLALATLLFKNKFTKEEKTAGNSCWVLGASYITEGAIPFAVADPLRVIPSLMLGSATA
FT                   AAISMGAGVTSMAPHGGIWVMFIPNVINHLFIYLLAIAAGTVVTAISVGLLKTPLNKRK
FT                   NKEEMI"
FT   CDS_pept        388742..389602
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00378"
FT                   /product="Putative D-fructose-1,6-biphosphate aldolase"
FT                   /note="Similar to D-fructose-1,6-biphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00378"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04145"
FT                   /protein_id="CAS04145.1"
FT                   /translation="MLYTMKDLLAVGKEHQFAVPAFNICSFDMLKAIMEEVEANNAPVI
FT                   LEIHPDEIEYLGDNFVATVREYAHKSKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDAS
FT                   RASYEENVALTKQVVELAHKVGVSVEAELGTIGNNGSAEGGADTIIYTDPDQAEDFVQR
FT                   TGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVSESVQ
FT                   YGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKEVVRHKLHILNTTG
FT                   QRDKY"
FT   CDS_pept        389659..390429
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00379"
FT                   /product="Putative transcriptional regulator (DeoR family)"
FT                   /note="Similar to transcriptional regulator (DeoR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00379"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04146"
FT                   /protein_id="CAS04146.1"
FT                   /translation="MLSTAKERQLKIVNRLKVEQFMRIIDLVELVNYSEATVKRDLVEL
FT                   EKEGLVRRTRGGAMIIDNKKIDLPYLMKMNERSNETSKIRIADIAKSLIRDDMVIFLDS
FT                   SSTSLHLIDVLSKFDGLQIITNGVMTASMLSEFTNARVSILGGSILTKRYTVNGAKAYN
FT                   DALTYNADIAFVSCRGIDYDKGATETHEGEALIKQAFRRQSSSLVLLVTEEKVGHKFMH
FT                   QSLACHDIDYLITDFKLDPDVEEQFKTHQITCLY"
FT   CDS_pept        complement(390769..391503)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00380"
FT                   /product="Putative conserved hypothetical integral membrane
FT                   protein"
FT                   /note="Similar to conserved hypothetical integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04147"
FT                   /protein_id="CAS04147.1"
FT                   /translation="MTEVSMSLTGHLKELRTRLLIILLSFFLAFFVGLFVSKPLILFLQ
FT                   KDDLPKEVILHVFKVTDAFQIYIEMAFVIGLVLVFPVILYQLWAFVKPGLHASEQRITL
FT                   RYIPITFLLFLCGVVFSYVITFPFILKFMFQFAAELGVETTIGLATYFQFLLQIVLSFG
FT                   VLFELPMVIMLLTRLSLITPNGMRRARKYAYFCLLIIAAFIAPPEILSHLMVTIPLIGL
FT                   YEISIVVSGFTVRRMDKEMKTV"
FT   CDS_pept        complement(391500..391679)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00381"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04148"
FT                   /protein_id="CAS04148.1"
FT                   /translation="MIGPGSIALIVGAALVIFGPKKLPELGRAAGDTLREFKNATKGMM
FT                   DDSKEETKKEDSRP"
FT   regulatory      complement(391688..391693)
FT                   /locus_tag="Lm4b_00381"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(391753..392382)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00382"
FT                   /product="Putative peptidase E"
FT                   /note="Similar to Salmonella typhimurium peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00382"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04149"
FT                   /protein_id="CAS04149.1"
FT                   /translation="MKNLFLTSSFKDVVPLFNEFESNLQGKTVTFIPTASTVEEVVFYV
FT                   EAGKKALEKLGLFVVELDVATESLDHIAATLRKNDFIYVTGGNTFFLLQELKRTGADKL
FT                   ILEEIAAGKLYIGESAGAVITSPNIAYIQSMDSPKKAEQLTNYDALNLVDFCTLPHYNN
FT                   IPFKKITQKIVADYTKSLKMHLISNHEAILVRDEEVITKLATGKTD"
FT   CDS_pept        392480..393427
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00383"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00383"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04150"
FT                   /protein_id="CAS04150.1"
FT                   /translation="MNKSERLNDMMLFLNDKNTFQLSDIMTKYDISRSTAIRDIKSLEE
FT                   IGMPIYSERGRNGHYQVLRNRLLSPIVFNIDEVFALYFSMLTLKTYETTPFHLSVEKLK
FT                   TKFERCLSAEKIEMLRKTEEVFSLGYIKHNNQCEFLDIILQFTMEEKVCQINYDKNGTE
FT                   KTYIVQFYNISSAYGQWYVTSYNFETKRMQVFRCDRILGLEENDAFEAKKLVDFKRAAE
FT                   NFYKKEDATNFEVEIASNGVDLFFKENYPSMRLRQEQGKNFIRGYYNKGEERFIINYLL
FT                   GYGDKIIAIQPDSLREMLLNELGSLQNHFLKLSL"
FT   regulatory      393432..393451
FT                   /locus_tag="Lm4b_00383"
FT                   /regulatory_class="terminator"
FT   regulatory      393543..393548
FT                   /locus_tag="Lm4b_00384"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        393556..395040
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00384"
FT                   /note="Conserved hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00384"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04151"
FT                   /protein_id="CAS04151.1"
FT                   /translation="MGQKLLGRFMLLLSVLAVVLTVNFSETFAAEKPNIDKPVKALEQT
FT                   ETAVEALDYPKAKEAFQEDKLWWSENKQVVKEKSYDLAGQIDRQIAEISLGILNNDKQQ
FT                   AMDGITSLHNLLKTYQEGTYTDNEGNTNITLSSYIAKLTATKKLIDEKEWAKASTQIQD
FT                   LKTEWLAVEGDVVSQSQAAYDNTERDLMLLDAYINDTSKQAKTADVLDGMTEELKPFAD
FT                   VTYTWFDAALIPFREGLEALLIIATLLTYTKRTKTRAAKRWIIGGTAAGLVVSLALGMV
FT                   VAFWLSALAFGDNNNLINGWAGLIASIMMLYVSYWLHRNSDITRWNNYMEGKSNQALSN
FT                   GKMISFAFLAFLAILREGLETVVFLIGMVGRMSNFELLMGILAGLGVLLIIAFVMLRYS
FT                   VHIPVKPFFMISSAIVFYLCFKFMGSGIHSLQLAGVIPTSVEDYLPSIPALSIYPSWYS
FT                   FLPQVLLVIFGLIILIKQQIKKRVDSKKEFAQGGKS"
FT   CDS_pept        395037..396197
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00385"
FT                   /product="Conserved hypothetical protein, putative
FT                   lipoprotein"
FT                   /note="Conserved hypothetical protein, putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00385"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04152"
FT                   /protein_id="CAS04152.1"
FT                   /translation="MKKWIIVMLTILTAVLVVGCGGTGTEDKAETKKETTKESKQANAV
FT                   KKEVKEMKSNLDDVKKAIADKDKSALQSSAAELHKHWLEFENNVRGLYPLQYTDVEKYE
FT                   TPIFYESKNDSPNFDTLNDNATGLDGALDTLAKAKETKAKTSEVLDKAVDNYYKYVTDQ
FT                   VDEFVAQTEIFTNAVKSGDIEKAKATYVSPRLNYERIEPIAESFGDLDPKIDARINDVE
FT                   NEADWTGFHVIERALWEKKSLDGMDVYADKLLTDAKALQAEVKNLKLEPKPMVAGAMEL
FT                   LNEAATTKITGEEEAYSHTDLDDLNANVEGSKVVYQAIIPALNAQDKDLADQIDAAFNK
FT                   MEDTLANYKNGDSFVLYTTLTKDQIREISDQLSHLSELMAQTGKIF"
FT   CDS_pept        396215..397480
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00386"
FT                   /product="Unknown"
FT                   /note="Conserved hypothetical protein similar to B.
FT                   subtilis YwbN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00386"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04153"
FT                   /protein_id="CAS04153.1"
FT                   /translation="MTDKKSDNQTEKTEAKENKGMTRREMLKLSAVAGTGIAVGATGLG
FT                   TILNVVDHVDKALTPKEKAETGVPFYATNQAGIITAQQTYCYIASFDIQTDSRQILKDL
FT                   LGKWTKFADLTASGGVLRDVDNDMLPPNDTGEADGLGISNFTVTLGYGPTFFEKDGKDR
FT                   FGVRAKKPKYLEKIPHMAHDSLDEAYSDGDLCIQVCADDQQVAFHGIRNFIRLASGVAV
FT                   VRWIEEGFLSAPKNETPRNLFGFKDGTANVDHDSNKGYKDVVWAENDEPEWMRNGSYLG
FT                   YRKIQMLIEIWDRSSLLDQEDTFGRKKASGAPYHKKHEHDKVDPSKLPADSHVRLAKDT
FT                   KQQMHRRAYSYTNGIDKSTGTIDAGLLFICFTQNPSKQFLPMLSIMGKMDKLNEYTVPI
FT                   GSAMFACQGGLAPGEIFGEKLL"
FT   regulatory      397480..397503
FT                   /locus_tag="Lm4b_00386"
FT                   /regulatory_class="terminator"
FT   CDS_pept        397553..398062
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00387"
FT                   /product="Putative different proteins"
FT                   /note="Similar to different proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00387"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04154"
FT                   /protein_id="CAS04154.1"
FT                   /translation="MEEWDLLNENRELTGKTHIRGEKLAPGELHLVVHVCIFNEKGQLL
FT                   IQKRQKDKEGWPNYWDLSAAGSALKGETSRQAAEREVQEELGITIDLSNTRAKFSYHFE
FT                   AGFDDYWFITKDVELSDLTLQKEEVADARFVTKEELEALRSSGEFIPYFFLNQLFDLKN
FT                   ATSIHF"
FT   CDS_pept        398158..398877
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00388"
FT                   /product="Unknown"
FT                   /note="Conserved hypothetical protein, highly similar to B.
FT                   subtilis YeeI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00388"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04155"
FT                   /protein_id="CAS04155.1"
FT                   /translation="MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQ
FT                   KLRFVIERAKTYNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVN
FT                   RTASDVRAAYSKNGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDILD
FT                   EDGQAIIYAEPEDFHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFEKLIDAL
FT                   EDLEDVQKVYHNVELED"
FT   CDS_pept        398914..399249
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00389"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00389"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04156"
FT                   /protein_id="CAS04156.1"
FT                   /translation="MPKLPNCPECNSEYAYEDRGLLICPECGHEWSAVAEEATEEKVFK
FT                   DANGNVLTDGDSVTVIKDLKVKGASNPIKMGTKVKNIRLVDGDHDIDCKIDGFGPMKLK
FT                   SEFVKKI"
FT   regulatory      399254..399281
FT                   /locus_tag="Lm4b_00389"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(399254..399281)
FT                   /locus_tag="Lm4b_00390"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(399288..400001)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00390"
FT                   /product="Putative transcription regulator (GntR family)"
FT                   /note="Similar to transcription regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04157"
FT                   /protein_id="CAS04157.1"
FT                   /translation="MSGMAKYMEIYIDIRDKINQNKYEINEKLPDGDSMARTYDCSKLT
FT                   VKKALDMLVQEGMIIRRRGAGTFVKSHSTNGGEFALGPMSGLVNTFGKDNIKSKVILFS
FT                   IEKPSKEVAEKLEMKDDYIYRIIRMREVGHKAYSIEHTYMPLAIIPGLEPRHLEDSIYN
FT                   YIRDDLKLKMQSAHVWVRGDKSNQEDSKLLDLEEPTFMMEIEKLAHLEDGRVFEYSITR
FT                   HTYESFVFETVFVQN"
FT   CDS_pept        400158..401600
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00391"
FT                   /product="Putative beta-glucosidase"
FT                   /note="Similar to beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04158"
FT                   /protein_id="CAS04158.1"
FT                   /translation="MKELLTFPKDFWWGSAWSAEQAEGRGDTGKAKTVWEHWFETEPNR
FT                   FYEGVGSEITTDHFNRYKEDVQWMKKTGQNSFRISISWARMFPNDGVGEVNPKAIAFYR
FT                   DLLTEMNENGIKPFANLYHFDMPVALQDAGGWESREVVDAYVHFADTCFKEFGDLVYHW
FT                   FTFNEPLGPILGGYLEDFHYPNQIDFKRGAQASFNTILAHALAIKAFKKLNLSSKIGVI
FT                   LNLSPTYPRSQNEYDLEAAEICDAFYTRSFLDPMVKGTFPEKLVEIMREYDQMPEYTEE
FT                   DLTIIKENTAQILGLNYYEPRRVKARLTAINEKSPFLPDWFFEPHNMPGKRMNIYRGWE
FT                   IYERGIYDLCIDIRDNYGNIESFISENGMGVANEERFLNEEGQIQDDYRIQFVKDHLAY
FT                   VHQAIAEGCDIKGYHLWTFIDCWSWINAYKNRYGLVSLDVETGKRTMKKSGELYKKMSD
FT                   MNGFEYDTSKLVGTKREETTNG"
FT   CDS_pept        401593..402927
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00392"
FT                   /product="Putative PTS betaglucoside-specific enzyme IIC
FT                   component"
FT                   /note="Similar to PTS betaglucoside-specific enzyme IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00392"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04159"
FT                   /protein_id="CAS04159.1"
FT                   /translation="MAETKKKSIVNGFINVAQRLGGQIHLRSLRDAFASIMPFMILAGF
FT                   VTLINYVILEPTGFMGKIVNPDTLKTWQEIGISIGNGTLSVITLLVTVAISYHLCLNRG
FT                   YKNVIAPILVALSSFIVVTPIATTFLPEGASKSIEVPNVIPVSYTGASGMFVGIIVGLI
FT                   ATDLFIKLSKNKRMQINLTGNIPPAVIKSFNVLIPIMITVIIFSVMSFAVNQIFSMDFN
FT                   TLVTTIITKPLSYVTTSLPGFLLITSIANLFFGLGIHQAVISGPLLDPFLLQNMQENMV
FT                   AYANHQEIPHIINMAFKDTFAVMGGSGNTIGLLIAIFIFGKRKDYKDISKLSAAPSLFN
FT                   ISEPIIFGLPIVFNPLLIIPFVLAPIFSLTTAYFATAAGWINHVVVQTPWTTPPIISGF
FT                   LATGGDWRASVLQVIIIVVTVFIYLPFLRMDEKVAFATAQKTEAK"
FT   CDS_pept        402945..403247
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00393"
FT                   /product="Putative PTS betaglucoside-specific enzyme IIB
FT                   component"
FT                   /note="Similar to PTS betaglucoside-specific enzyme IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00393"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04160"
FT                   /protein_id="CAS04160.1"
FT                   /translation="MKNILLVCNAGMSTSFLVEKMKAAGAEQGVEANIWAVSDAELHEN
FT                   WEKADVILLGPQVGYLKGNTEKVVGGKIPVEVINMLDYGRVNGAAVLERAIELIG"
FT   regulatory      403257..403281
FT                   /locus_tag="Lm4b_00393"
FT                   /regulatory_class="terminator"
FT   CDS_pept        403334..403528
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00394"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00394"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04161"
FT                   /protein_id="CAS04161.1"
FT                   /translation="MKYVKSQMKELVKDSVDLQERLQKLMKEMDLEKTFALKALYHSEV
FT                   ADGGPYQTAYQDLDYKYKD"
FT   regulatory      403536..403563
FT                   /locus_tag="Lm4b_00394"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(403536..403563)
FT                   /locus_tag="Lm4b_00395"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(403567..404487)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00395"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00395"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04162"
FT                   /protein_id="CAS04162.1"
FT                   /translation="MKIERLIGIIMLLLQRELVSASEMATMFEVSKRTIFRDIDTLAMA
FT                   NIPIYTIAGTKGGIGIMPTYKVDKKLLTADDLTAIIASLDGMEQLLSSAETKKTLQKMK
FT                   NMLDHSSEPPKSSISLDFSNLSMKNELNAKVESLYLAIKKHQLVELSYIDRTGNQTIRK
FT                   TEPYHLLFRNRSWYLQGYSLERSDFRTFKMSRIVELKTLEETFEARPFSVKPFGAPPDR
FT                   PMFLMHEVNLIVDKIAREQIIERFDLVEISQQDDAHFLAKVTLPDHEAGYRFLLQLGTH
FT                   VTIQNRDDFYDNFVDYLKEIQGKYI"
FT   CDS_pept        404590..405009
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00396"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00396"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04163"
FT                   /protein_id="CAS04163.1"
FT                   /translation="MAFEIVELKKETFTGNKVEIPEFDPQKGFGPMSEIKESAHTKFAK
FT                   NEKDYVGINASLDDLQYYIVASANSENGDTTFDIPAGKYAKFVTSETDRPALDGFIGAA
FT                   YGEVSQSDTVGIAGSFNLEDLREAEFTLYIPVVSK"
FT   regulatory      405018..405041
FT                   /locus_tag="Lm4b_00396"
FT                   /regulatory_class="terminator"
FT   CDS_pept        405228..405674
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00397"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00397"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04164"
FT                   /protein_id="CAS04164.1"
FT                   /translation="MKKLDFNCNDANYNAEFLMKILTTLKDITKVKQFTIEMIDAVPND
FT                   QEQFKEEKGLFSEEVFDFNNLVKESHGINVDFKEIINILKQCRTVWELSILVVTSENEL
FT                   NDSGKVLCEVELIEGDLFTILYSEDFPIDLFLEEFSTDEITIED"
FT   regulatory      405754..405759
FT                   /locus_tag="Lm4b_00398a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        405766..406017
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00398a"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="PSEUDO:CAS04165.1"
FT   CDS_pept        406018..406395
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00398b"
FT                   /function="Unknown"
FT                   /db_xref="PSEUDO:CAS04166.1"
FT   CDS_pept        406632..407018
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00399"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00399"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04167"
FT                   /protein_id="CAS04167.1"
FT                   /translation="MINELQKKIDEINYWDLLVLDIQSKYFGDEVYIYIEKDEEICWKL
FT                   SFTSCYKVSYETDAKWRGDFKVRNTGPKSGYYAQDISLNRYAENEDFIECSFDASIMTM
FT                   NIICKEIIVEEVSVIENSFFWKNY"
FT   regulatory      complement(407049..407076)
FT                   /locus_tag="Lm4b_00400"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(407091..407852)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00400"
FT                   /product="Putative transcription repressor of myo-inositol
FT                   catabolism operon IolR"
FT                   /note="Similar to B. subtilis transcription repressor of
FT                   myo-inositol catabolism operon IolR"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04168"
FT                   /protein_id="CAS04168.1"
FT                   /translation="MKVQRIQAIENLIHEKGSISLDDLCEQFNVSKNTVRRDIAKLLQK
FT                   NTIQKVYGGVVSVYNNPEEIRPFENRDTENHTEKQLIGKAAADFIEENDLIFIDSGTTT
FT                   SCLAAALPTDKDITIITNSLDVINFASEMDNVKLIVIGSTFKTSTKSFVGVENWGFFEK
FT                   YNITKAFMAATALSTTHGVMNSDILEYEIKRHMMEKATEKFLLVDHTKVDKSALLTYGE
FT                   LAEFDWLVTSKDMAGGCLGYCEDVGVLVRLV"
FT   CDS_pept        408047..409513
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00401"
FT                   /product="Putative methylmalonate-semialdehyde
FT                   dehydrogenase IolA"
FT                   /note="Highly similar to B. subtilis
FT                   methylmalonate-semialdehyde dehydrogenase IolA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04169"
FT                   /db_xref="GOA:C1KZ99"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR023510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZ99"
FT                   /protein_id="CAS04169.1"
FT                   /translation="MADVRKLKNYINGEWVESRADKYEDVINPATGEVLCQVPISTRAE
FT                   LDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEELARLITLENGKNLSEARGE
FT                   VQRGIENVEFAAGAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMF
FT                   PMAIALGNSFILKPSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIK
FT                   AVSFVGSKPVGEYVYKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAG
FT                   ERCMACAVVTVEEGIADEFLAALRTAAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIE
FT                   KGLEEGAKLTVDGRETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEA
FT                   VRVANQSEFANGACIFTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYG
FT                   TLHANGKDSVDFYTHKKVVTARYSLKGYEE"
FT   CDS_pept        409526..410347
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00402"
FT                   /product="Putative IolB protein"
FT                   /note="Similar to B. subtilis IolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00402"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04170"
FT                   /db_xref="GOA:C1KZA0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR023770"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZA0"
FT                   /protein_id="CAS04170.1"
FT                   /translation="MGKLLRKPLNERIAPGITFVQDINQANSPLSYVGFRLIEMEKGAI
FT                   YQEELTDLECCIVALTGKITVSEGDNIFAEIGTRANVFEKIPTDSVFISGGRTFQVKAD
FT                   TEKARVALCYSQANRDLPTTLIKASDNSIEQRGKYQNKRLVHNILPDVSEVASSLLVVE
FT                   VYTDGGNFSSYPPHKHDRDNLPAESLLEESYYHEINPEQGFIFQRVYTDDRTLDETMAV
FT                   EHQNAVIVPEGYHPVGVPDGYDSYYLNVMAGPKRVWKFHNDPDHEWILERD"
FT   CDS_pept        410364..411341
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00403"
FT                   /product="Putative IolC protein and to fructokinase"
FT                   /note="Similar to B. subtilis IolC protein and to
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00403"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04171"
FT                   /db_xref="GOA:C1KZA1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022841"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZA1"
FT                   /protein_id="CAS04171.1"
FT                   /translation="MNLNKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGS
FT                   PANIAIGTAKLGLKVGFIGKISADQHGRFIEKYMRDLSINTDGMVKDTEGRKVGLAFTE
FT                   IKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLISGTALAQSPSREAVLKAVSL
FT                   ARKNDVAVAFELDYRPYTWTNTEETAVYYSLVAEQADVIIGTRDEFDMMENQVGGKNEA
FT                   TKAHLFQHQAEIVVIKHGVEGSFAYTKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGL
FT                   FSGESIETALKYGSAAASIVVSKHSSSDAMPTADEIKALIAQAE"
FT   regulatory      411340..411345
FT                   /locus_tag="Lm4b_00404"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        411351..413270
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00404"
FT                   /product="Putative IolD protein, to acetolactate synthase"
FT                   /note="Similar to B. subtilis IolD protein, to acetolactate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00404"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04172"
FT                   /protein_id="CAS04172.1"
FT                   /translation="MVTEKTIRLTTAQALVKFLNQQYIEVDGEMAPFVDGIFTLFGHGN
FT                   VVGIGQALEEAPGHLKVYQGKNEQGMAHAAIAYAKQKNRQRIYACSTSAGPGSANLITA
FT                   AGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSTAITTNDGFQAVSRYFDRVQRPE
FT                   QLMSALIRAFEVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKREL
FT                   TEAARLIQASKTPVIIVGGGARYSRAREELIALSEQTNIPLVETHAGKSTLEFDFKNNL
FT                   GGTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFDPTTKFININVSRMQTYKLD
FT                   AFQVVGDARATLAELAPLLQDYQTQFGNKIAAYKTEWLDERARLQTTKFNREAFTPEIK
FT                   DQFDQATLNEYADRLQTEFTQTEALITINDNVAPDSIVVCSAGSLPGDLQRLWNPAVPD
FT                   TYHLEYGYSCMGYEINGALGAKMAAAKKQEVYAIVGDGSFCMSHSELLTSLQYGKKINI
FT                   MLFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRANTKEDL
FT                   ISALEDAKTQSKTTLIEMKVLPKTMSEGYLNWWNVGVSEVSNKESIKQAYEEKQANLKN
FT                   ARLY"
FT   regulatory      413283..413302
FT                   /locus_tag="Lm4b_00404"
FT                   /regulatory_class="terminator"
FT   CDS_pept        413402..413773
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00405"
FT                   /product="Putative YhdG protein"
FT                   /note="Similar to B. subtilis YhdG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00405"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04173"
FT                   /protein_id="CAS04173.1"
FT                   /translation="MEVFAEYLAEIENPDHRARTQEVLTWVAETFPDLKPEIKWNTPMF
FT                   TNNGTFIIGFSIAKQHMSVSPEVAGIERFEADIKEAGYSHTKGIFRITWAKPVDYDLLA
FT                   KIIEFNIQDKANYTSFWRV"
FT   CDS_pept        413867..414235
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00406"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00406"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04174"
FT                   /protein_id="CAS04174.1"
FT                   /translation="MRIFCGIMSIQAGFIGALAEILSPDSKKNNLFMIPEDLAASSGYL
FT                   MSLAMVLAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPIVCLISFLM
FT                   GLFIFTDYTRHQDTGEER"
FT   regulatory      414231..414249
FT                   /locus_tag="Lm4b_00406"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(414259..415374)
FT                   /transl_table=11
FT                   /gene="ltrA"
FT                   /locus_tag="Lm4b_00407"
FT                   /product="Putative low temperature requirement protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00407"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04175"
FT                   /protein_id="CAS04175.1"
FT                   /translation="MAERKVSWLELFFDLIFVTAVASTTHLLLSVDNHPDKTAVYFGEY
FT                   LLMVTPMFWAWVGQTMFFNRFGEKIKLPELYMLPQMFFLILMTASFDLTFSNTYYTFLI
FT                   GYLGIRLITVIQYFVISKQLTGNARKVAILLGSVFLLGVLTTATSVFFEGFARYLVMYL
FT                   GIAVDIILPLFLAKTLRKVPVDFPHLAERFGLFVIITFGESIVAITTILVGHTLDPYTI
FT                   GYTLLGFLIICTLWASYFHSFEKIVDHHKETHGQYLIYGHFFIIISVMLLAANVHLLFE
FT                   GHLERNVLLLMLFGSVAVFFVSKQFVFAAHKKAEVTFSFWKDALLLLLLVGLFFVNLYS
FT                   DFPLFVSFVSIWVCALVDLGLQFGTSRSARM"
FT   regulatory      415492..415497
FT                   /locus_tag="Lm4b_00408"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        415505..416170
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00408"
FT                   /product="Putative uracil-DNA glycosylase"
FT                   /note="Similar to uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00408"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04176"
FT                   /protein_id="CAS04176.1"
FT                   /translation="MVKTWEEFLKQEAKQPYFIELMEAVKDARAKGNVYPTEEDMFSCF
FT                   RLCPYDQVKVVILGQDPYHGPGQAHGLSFSVQKGVRIPPSLRNIYKELKTDLDIEPADH
FT                   GYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNH
FT                   AIKAASGITNPKHLLIKGVHPSPLAASRGFFESKPFSKTNAFLEEHGRKPIDWDLNEQ"
FT   CDS_pept        416338..416637
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00409"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00409"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04177"
FT                   /protein_id="CAS04177.1"
FT                   /translation="MKHNFTEDDFVYGESWGLVHRGVLEDKEVERMKALRDKVVGKKGV
FT                   AQTTLKPIGSVRIDGEVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK"
FT   CDS_pept        416634..417578
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00410"
FT                   /product="Putative YqfA protein"
FT                   /note="Highly similar to B. subtilis YqfA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04178"
FT                   /protein_id="CAS04178.1"
FT                   /translation="MTMIGPIIIAVLIIIFLIVFFTLVPVGLWISALSARVPVGLGTLI
FT                   GMRLRRVVPSRVVKPLIKAVKAGLDLEVNQLESHYLAGGDVDNTVDALIAAHRANIELD
FT                   FSRAAAIDLAGRDVLEAVQTSVTPKVIRTPEFTGVAQNGVEVKVITQITVQSNIERIVG
FT                   GAGEDTVIARVGEAVVSTVGETREHTDVLENPNSISKKVQEQGLGDGTAYTILSIDIAE
FT                   MRIGDNIKAKLDIEKANADMEVAQAAASKRKAEAIALEQENRAAVVAAEAEVPRALSRA
FT                   LEEGNLGVMDYYKMENVQSDTAMRESIAHEDEK"
FT   CDS_pept        417613..418062
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00411"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04179"
FT                   /protein_id="CAS04179.1"
FT                   /translation="MDLSDFLNSGWESVLVVLGIVGVIINFLSKAGKGTEEENKKAPQP
FT                   RPNLRSMHQASRTQTTKKPEKRKVSQGTFTQNKEQDKVIAEQKAAQQKMLREIRRESDV
FT                   AKGKNIIKSTSSHHKKARKLRGRLQEAIITKEILDKPVSLRKNHL"
FT   regulatory      418070..418090
FT                   /locus_tag="Lm4b_00411"
FT                   /regulatory_class="terminator"
FT   regulatory      418192..418197
FT                   /locus_tag="Lm4b_00412"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        418206..418889
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00412"
FT                   /product="Putative extracellular P60 protein"
FT                   /note="Unknown, similar to L. monocytogenes extracellular
FT                   P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00412"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04180"
FT                   /protein_id="CAS04180.1"
FT                   /translation="MKIIATRRKIFFAFIALMISFSVLFLPTTNASAATTYKMTTTADV
FT                   NVRAADNTKGKVIGFYKKGTTVTFTAKTKNNWYKTTYKGKVGYVSGKCVTTYKAPVATT
FT                   QSFTALNNEARKHIGKRYKIGATGPSCFDCSGYTQYVYSKGVKKSIPRTAKQQYASAKK
FT                   IKAQELKKGDLIFFNYGKGVAHVGIYVGNGKMLNAQNNGVKYDTITSGYWKKYIAGYGR
FT                   VANLK"
FT   regulatory      418899..418918
FT                   /locus_tag="Lm4b_00412"
FT                   /regulatory_class="terminator"
FT   regulatory      418931..418936
FT                   /locus_tag="Lm4b_00413a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        418945..419103
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00413a"
FT                   /function="Unknown"
FT                   /note="possibly truncated gene (N-terminal part)"
FT                   /db_xref="PSEUDO:CAS04181.1"
FT   CDS_pept        419104..419370
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00413b"
FT                   /function="weakly similar to S-acetyltransferase"
FT                   /note="possibly truncated protein, C-terminal part"
FT   CDS_pept        complement(419373..420173)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00414"
FT                   /product="Putative 1-pyrroline-5-carboxylate reductase
FT                   (ProC)"
FT                   /note="Similar to 1-pyrroline-5-carboxylate reductase
FT                   (ProC)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00414"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04183"
FT                   /protein_id="CAS04183.1"
FT                   /translation="MKKIGFIGAGNMGTAMIRGLAQANLDNSEAIIVGGRNLEKLKPLE
FT                   AAFTGLQITTDTEKLVEQADIIILAVKPYTIPEILTSVKEQLTPDKIVISVAAGVTIQD
FT                   LEELTSAKTKIVRVMPNTPALVGEAMSSISPNINVSSEEINEVTAIFTSFGEAEVVSEN
FT                   LMDAVIGVSGSSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLENDGFRSAVINAVQAAAKKNSSM"
FT   regulatory      421094..421099
FT                   /locus_tag="Lm4b_00415"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        421111..422334
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00415"
FT                   /product="Putative cell surface protein (LPXTG motif)"
FT                   /function="Unknown, probable cell surface protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00415"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04184"
FT                   /protein_id="CAS04184.1"
FT                   /translation="MKKIIALITAVALLSMIGFAFIPGTVANAANSSESSLTYKDVRSG
FT                   FYFVGYENVQLETGKTYKYTVAYEANVDMKMTDTITGQSAKAGLFTPKSSGAELNTSYV
FT                   SRTKNNVIDVADAGNKVFKHTFEFTAKENTKADIGVFLGAGSVLPTTPETTSLWKNVTV
FT                   TNETPLVQAEAPVISAEDKTINQNESFNPLNEVTASDEKDGDITKDIHVTKNTVDTTKS
FT                   GKYDVDYSVTNSSNLTTTKSIKVTVTPAAISKNTAPVINAKDQTIKVGDVFNVLKGVTA
FT                   KDNEDGDLTAKIKVTKDTVNNSKKGVYQVTYTVTDSGNLSASLTIKVTVTQDGKLIVNP
FT                   SDPTKPSITKTPVEPTKIEKDPENRATSVLKASKIPKTGDSSMIWLVFVGLGLTAIGIS
FT                   SYQKKANK"
FT   regulatory      422438..422443
FT                   /locus_tag="Lm4b_00416"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        422451..423101
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00416"
FT                   /product="Putative transcription regulator"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00416"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04185"
FT                   /protein_id="CAS04185.1"
FT                   /translation="MPKIAKGNRLENVAFEYIKNKITTGEYPTGYRVVEAKLSQELNMS
FT                   RTPIRRAIINLCHSGFLVHQYNRGAFVQNTEVTITEFFSRMKLVELLMYESTEKLILRE
FT                   DYIVVDDIIEIAEKVIQYEKNKEYELMRDTFEDFIVAFIGKLNNDYFNRIIQELWNGIN
FT                   DNATKEVRLIIVSASDRIAEELANIIEILKSWNYGELKKCFQHIMNAMILIAF"
FT   regulatory      423103..423108
FT                   /locus_tag="Lm4b_00417"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        423119..423745
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00417"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown, similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00417"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04186"
FT                   /protein_id="CAS04186.1"
FT                   /translation="MKKISWVIIMLVIVAASVGYYFIKENERKTPQTIDYKTVETKRTD
FT                   LSVYVSAEGHIVKKVNEWPDYEDFAVKIMVDELEINQIKEKQTADVYVEAVNNKVYKGK
FT                   VVDINEKGIINGSVTSYAVTIDLEDETKVKENMSVSADVLVALEKKILTIPIEAVNTDK
FT                   ADKHYVYTVDANKQKKKIWIEVGKHNTKSIQVVKGLTEKQLVIIP"
FT   regulatory      423747..423752
FT                   /locus_tag="Lm4b_00418"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        423763..424437
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00418"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /function="Unknown, similar to ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00418"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04187"
FT                   /protein_id="CAS04187.1"
FT                   /translation="MIQLFNISKSYQMGECTIKALDNVSLQIDQGEFLAIIGPSGSGKS
FT                   TLMNILGILDRATIGEYYLNKTNLMRISDKKISRIRNRKIGFIFQQFNLMPRLTAFENV
FT                   ELPLVYRGVGKATRKKVVLKSLERVGLLDKEKHIPAQLSGGQQQRIAIARAIAGSPELI
FT                   LADEPTGALDSKTGEEVMTLLREIHREGNTLIMITHDKEIANQAERIIEIKDGKLREWN
FT                   KL"
FT   regulatory      424405..424409
FT                   /locus_tag="Lm4b_00419"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        424422..425600
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00419"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /function="Unknown, similar to ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00419"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04188"
FT                   /protein_id="CAS04188.1"
FT                   /translation="MEQIMTLLQSIKLALKQLLSTKFRTFLTMLGIIIGVFSVILLVSI
FT                   GEAISKNVSTQLGDMGSNLLTVNFYSDNPNDKFTYKDAKKLLNEDEIGSPEVMQTKEVR
FT                   TSEKTASNQVAGINEYYASIKNLELASGRFCSNVDVIYAQKVTIIGSEIAKTYFKEQNP
FT                   IGEYLQIAGARYMVIGVLKEKGESLFGSADKKLFIPISSAERLFKTDTVDLYYIQTKKV
FT                   EQVPAAVKVVKKKMRQFFPNNEDAYTVVNQQQALDTFDSITGTLTIGLGAIAGISLLVG
FT                   GIGIMNIMLVSVSERTREIGIRKAIGASSGNILMQFLIEAVVLSLVGGCIGILLGIFSA
FT                   QIVTTTSSFEMYVSASTILLAVGFSMCIGIVFGVIPAQKASKKKPIDALRAD"
FT   regulatory      425605..425610
FT                   /locus_tag="Lm4b_00420"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        425619..425762
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00420"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04189"
FT                   /protein_id="CAS04189.1"
FT                   /translation="MEKEQQTDDTWVLVEIVSLITNVERQRLRELSYTELEEFYERVVV
FT                   EQ"
FT   regulatory      425820..425825
FT                   /locus_tag="Lm4b_00421"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        425833..426315
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00421"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04190"
FT                   /protein_id="CAS04190.1"
FT                   /translation="MNESICKRDNGGAVVNFELEINATKAEVFALLTTNAGLAKWFNEL
FT                   EVGELGADGYLLFVMTPEEKITMPIRAFETNQKLAFEWDQDEVDFELNEITTNKTRLTF
FT                   REQLTTITEHSPRDISGWHICLKKLQASAEGKIYDFNKTEFETLFAKYQKELNIEK"
FT   regulatory      426329..426363
FT                   /locus_tag="Lm4b_00421"
FT                   /regulatory_class="terminator"
FT   CDS_pept        426484..426942
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00422"
FT                   /product="Putative phosphotransferase system enzyme IIA"
FT                   /note="Similar to phosphotransferase system enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00422"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04191"
FT                   /protein_id="CAS04191.1"
FT                   /translation="MIVSEEQLFLNQHLRTKEEVLAFIADKAEEIGITTNSAQVESDLW
FT                   AREKEYATAVQQLIAIPHAKTEAISEAKLLFIRLTEPIDWESKEGFKAQAIFAILVPAS
FT                   EASQQHLKILSSVAVNLLEEAFQEQILTIKTEHELMDYLKDNLEGELI"
FT   CDS_pept        426939..427271
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00423"
FT                   /product="Putative fructose-specific phosphotransferase
FT                   enzyme IIB"
FT                   /note="Similar to fructose-specific phosphotransferase
FT                   enzyme IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00423"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04192"
FT                   /protein_id="CAS04192.1"
FT                   /translation="MKVVGVTSCIAGLAHTPMAAKALEKAGVKLGHDVKIEQQGAMGTI
FT                   DEITPAEVSAADVVIIAADKVIDGEERFKGKPVVRVKIGQCVANGEAVLSKVVAAIEAR
FT                   KQKEAN"
FT   CDS_pept        427275..428387
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00424"
FT                   /product="Putative fructose-specific phosphotransferase
FT                   enzyme IIC"
FT                   /note="Similar to fructose-specific phosphotransferase
FT                   enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04193"
FT                   /protein_id="CAS04193.1"
FT                   /translation="MKGKLNEAKDHLMSGISYALPVIIAGSLVVAVAKLIGIIGGVTNL
FT                   DAYADASGFYHYVYLFQNVGWAAIGLLNLVLAGYIAYSIAGKPALAAGFVGGVLATSTN
FT                   AGFLGAVVAGFFAGWLTNWVKKHVRITGPAASSLPLIILPLITVGATGILMSLILGGPL
FT                   GWLNQTLLDWVTEMCKNDTNVIILALILGAMIGFDLGGPVNKAAWMAGNALFMSGIYLP
FT                   SIMINVAICIPPLGYGIATLLRKKNYSTTFKEAGNGALIMGLIGVTEGAIPFTLRSPGK
FT                   LIPLNVIACAIGSAVTMGLGAYVKMPPIGGMYGFFTIGNGWAYLVGGLVGAFIIGICAN
FT                   LFVNFTEEETAAADDAVDDIDISFDEIEIK"
FT   regulatory      428392..428397
FT                   /locus_tag="Lm4b_00425"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        428403..431036
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00425"
FT                   /product="Putative sugar hydrolase"
FT                   /note="Highly similar to E. col YbgG protein, a putative
FT                   sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00425"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04194"
FT                   /protein_id="CAS04194.1"
FT                   /translation="MKMAKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAK
FT                   DDYHFYLMDAQSSLIEDYLRYCPEDKTRLEKLIAEKRLITGPWYTQTDQLVISQESIVR
FT                   NLLYGTRIAREMGHSMAVGYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEF
FT                   IWRGDDGTEMLAEQIPFGYYYGANIPENEAELKTYLDDQIGALEEKASTRNVYFPNGLD
FT                   QAPVRKNLPELVAKFNELDSTREYQIASPETFFADLEKDVTNLPVIAGELTEGKHSRLH
FT                   KSIFSTRADLKQANNEIENFLSNVLEPVLSISYSLGNRYPHNELAEIWKLMFENAAHDS
FT                   IGGCNSDTTNRDVKHRYKLASDLATNLLDLNMRLISEKIEQKQPFQFTVFNPLPYEKSG
FT                   VIKMTAYIPEDNFEIEDTQGNTLEYTILEKTDLTDYVLNQHIDLNPSKSIYLPEKVFLA
FT                   TMLVNVNSLPALGYDTIYFNLEKETAEQEPTQSTMTKIENEFYEIQLAANNSLTIHDKK
FT                   AGRTYTDQMLFVENGDDGDSYNYSPPRKDLVISSEEAVVESLESSISSVNQTLTISFKL
FT                   NVPYNLEERANGEKNNEMTIKTVISLRKNEELIRFDVQVANQVLSHRLCVTFATEIASK
FT                   FSTADQLFAPIQRPVRLPEMDVWEAEEWQEAPISIEAMQSFVSLHDEAHGVAVMTEGVR
FT                   EYEIIGENYDTISLTLFRTFSHMGKTDLLYRPGRASGESIVATPDAQLLGEINATFALT
FT                   LFESSFDEADIAKKAKEYLSNPPVYQMSDFLNGRLIYVYRDEEKTLDATYSLALPTIDG
FT                   AIISAVKKAEDADAFITRFFNPYLQKEITIPEVFQGKERHLDESESNEKQTRLKHAKVQ
FT                   SYLFEK"
FT   CDS_pept        431069..433003
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00426"
FT                   /product="Putative transcriptional antiterminator (BglG
FT                   family)"
FT                   /note="Similar to transcriptional antiterminator (BglG
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04195"
FT                   /protein_id="CAS04195.1"
FT                   /translation="MGYFAYKRLETLYGMLLDAGSHLSAQKLSQDLHISERTIRTDIAK
FT                   LTEFLESYGATITLTRGAGYKIEILDSLVFQAFQAEKNKPKNAGYFDLDNPEERVKYEI
FT                   FMLLSSGDYIKLEDLADTIFASRATISNDMKQVRKVIAVYDLTLVSKPGSGVKIIGEEE
FT                   KMRYALTALIASKNAPESYLETFFEWHKQKDKLQKLMTAVTDYFFATNIRFTDEALQNL
FT                   LLHMMILVERIELGHTLEKFELTDVSEEEIAIATKLSTIIESLFEIDIADADKNYLLLQ
FT                   IASKRILNVEDKEISEFDDYAYIEGMLNRIESHYFYHLQDDMQLKKDLVAHIHSMLYRV
FT                   KYHMTVKNPMTEHIKRYYPLAYEITLDAVESLKKDYPYDINQNELAYLALHIGASLERN
FT                   YQISYYRHKSALIVCGSGFGTARIVEAKVKSAVSNLDITKVVSIQEYNRFIHIEEDIIL
FT                   STVRIPEKNKPVIKISNIPTNEELKMLGAIIQEQTDPNRGFLSNFFTADFFARSSMTNK
FT                   TAILEEMVDSLRQQNIVGEGFLQSVLEREKLGSTVLGTGIAIPHPLGLMAKETKIVIRI
FT                   LDKPIKWDQKQSVRAVFLLCISKNDYEEAINIYELLVELVREEYGEKLSRLSDFHAFTA
FT                   LANDILKKK"
FT   regulatory      433007..433029
FT                   /locus_tag="Lm4b_00426"
FT                   /regulatory_class="terminator"
FT   CDS_pept        433130..433546
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00427"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04196"
FT                   /protein_id="CAS04196.1"
FT                   /translation="MNRQTEFTLLIVGASLSILTFLGAMLYTIIFGLNTLMVADTFGYY
FT                   SSSEETIVLGIITFFSVVAAFFALGSAVFGFIGAFKVKSDGPKVKTLGVCFIVLGGLQV
FT                   FTIHGILFLIAGILTITKKEYKTNSKEDEGTKWE"
FT   CDS_pept        433537..433935
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00428"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00428"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04197"
FT                   /protein_id="CAS04197.1"
FT                   /translation="MGMITFLPIFFIFAIFLGLAAKVLLAIWIYKDAEQRGMNAILWCL
FT                   LMVFINVIIILVIYLIVRNKGEVMKQNLGLLISGIGIAVLNTLMAIMAFIFIIFFAVND
FT                   GGMHNMMDGYNYDYDDGYEYDMDNFEDF"
FT   regulatory      433948..433977
FT                   /locus_tag="Lm4b_00428"
FT                   /regulatory_class="terminator"
FT   CDS_pept        434044..435051
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00429"
FT                   /product="Putative phosphate transport protein"
FT                   /note="Similar to phosphate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00429"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04198"
FT                   /protein_id="CAS04198.1"
FT                   /translation="MDTVILITVIIVIMGLAFDFINGFHDIANAVATSISTRALKPRVA
FT                   IGIAAVMNFLGAISFTGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMP
FT                   SSSSHALIGAIAGASIASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLF
FT                   HDKKLGKMNRRFRFIQIGTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWV
FT                   QVSCAASMAIGSSVGGYRIIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTT
FT                   QVIDSSIMGVGTANHKKEVNWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL"
FT   CDS_pept        435067..435447
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00430"
FT                   /product="Putative YyaH protein"
FT                   /note="Similar to B. subtilis YyaH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04199"
FT                   /protein_id="CAS04199.1"
FT                   /translation="MKIEHVALWTTNLEQMKQFYVTYFGATANDLYENKTKGFNSYFLS
FT                   FEDGARLEIMSRTDVTGKTTGENLGWAHIAISTGTKEAVDELTEKLRQDGFAIAGEPRM
FT                   TGDGYYESVVLDPEGNRIEITW"
FT   CDS_pept        435516..435908
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00431"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04200"
FT                   /protein_id="CAS04200.1"
FT                   /translation="MDIVTNKIVVEKYNFETIMEENEQFENKIELEVHEVEPVNGNVEL
FT                   MSKGKIFKITIPFLLVLENFRIDGRISRIIQLKDFFGDFSDLEAVDVEGLSNPLIDYIK
FT                   RLTYDVTEIAFDEPGVSLDFNANHNS"
FT   CDS_pept        435921..436343
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00432"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00432"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04201"
FT                   /protein_id="CAS04201.1"
FT                   /translation="MRQYMKMVRPFDFVIIILLILGSFLPLILFSVAEAKHVGDDVVAV
FT                   ISQDGKVVREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWK
FT                   SKAGDTIVCLPHKVFVEIKSTNKKSKDPDTDLIVPN"
FT   regulatory      436346..436365
FT                   /locus_tag="Lm4b_00432"
FT                   /regulatory_class="terminator"
FT   regulatory      436558..436563
FT                   /gene="inlF"
FT                   /locus_tag="Lm4b_00433"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        436571..439042
FT                   /transl_table=11
FT                   /gene="inlF"
FT                   /locus_tag="Lm4b_00433"
FT                   /product="Putative internalin, peptidoglycan bound protein
FT                   (LPXTG motif)"
FT                   /note="Similar to internalin, peptidoglycan bound protein
FT                   (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00433"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04202"
FT                   /protein_id="CAS04202.1"
FT                   /translation="MKAKNNFFKQLISIMTVLSLLFMVLGIQGNNEVKAATLATLPAPI
FT                   NQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYL
FT                   NLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLAN
FT                   LTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQI
FT                   EDISPLASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWL
FT                   EIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNEDMEVI
FT                   GGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQVIKKPARNFSKTLSVPNNITSID
FT                   GTLVTPKTISNNGTYDAPNVNWSSPSYLPEVRYTFKQDVVVGSTTSSYTGIIIQPLNEP
FT                   VDYNVTFNIDGNTSEVKTVTEEDLIPEPANPTKQGYTFDGWYDAETGGTKWDFTTGQMP
FT                   ANDLMLYAHFSVNSYQVNFDIDGAVMNEAVVYDTLLNEPTAPTKQGYTFDGWYDAETGG
FT                   NKWDFKTMKMPANDVTLYAHFTVSSYQVNFDIDGAVTNEAIVYDTLLNEPATPTKQGYT
FT                   FDGWYDAETGGNKWDFKTMKMPANDVTLYAHFTINNYQANFDIDGSVTNETITYDTLLN
FT                   EPTAPTKQGFLFDGWYDAEVGGTKWDFNTMKMPANDINLYAHFSKETPLIPSPSDESDS
FT                   KPTNGSITINEPSATSMPAQNNNITVTAGENTPELTTAKLPKTGDNNPWQTLFAGILLS
FT                   SSAFYIWRKKA"
FT   regulatory      439051..439081
FT                   /gene="inlF"
FT                   /locus_tag="Lm4b_00433"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(439051..439081)
FT                   /locus_tag="Lm4b_00434"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(439090..441693)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00434"
FT                   /product="Putative phosphoenolpyruvate synthase"
FT                   /function="Unknown, similar to phosphoenolpyruvate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00434"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04203"
FT                   /protein_id="CAS04203.1"
FT                   /translation="MKPYVLKFQEIRPHSEALVGGKGMNLGACSYIEGVHVPAGFCLTT
FT                   EAYKRTLAENNEFTQLLQRLSSLKTSDMDAIREISETIRTLIQHTQIPSEIASYMDATL
FT                   LDVGGYEMPFAVRSSATAEDLPHASFAGQHDTYLNIIGKDALLQHISMCWASLFTERAI
FT                   IYRIQNQFDHRKVQLAVVIQQMISPEASGILFTADPITSNRKSLSIDASFGLGEALVSG
FT                   LVSADSYTVRENTITNKIIATKKLAIYSLKEGGTETRILEKSQQTKQTLTDQQIIQLAK
FT                   LGRKIEAYFGKPQDIEWCLAEGAFYIVQSRPITTLYPIPEVNEPGNRVYISVAHQQMMT
FT                   DAMKPLGLSFYLMTTPATMYTAGGRLFVDITQSLSAKVSRDMMVNSLGQSDPLIKDALL
FT                   TVINKKGFLPPLPTEENPSQAPVSGKPPVRSIPDSSSVFELVRNSENSIKHLKQSIETK
FT                   NGSDLFDFIVEDLEELKRVLFNPTSIDAIMAGMDASAWLNEHIYQWLGEKNVADKLSES
FT                   APNNITSQMGLELLDVADVIRPYPAVRAYLEQTKNPDFMNELATLEGGAETKKALEDYL
FT                   QKYGMRCAGEIDLTKTRWIENPLTLIPLILSNIKNFDSGASMHKFAQGEKEAFHKEQEI
FT                   LRRLQELPDGEQKAMETKEKIDILRHFIGYREYPKYGMINRYFIYKLALLRAGEQLVKD
FT                   GILQEQEDIYFLYFEELREVVRTGQVDYELINVRKRDFATFEKLTPPRILTSDGEMING
FT                   EYKRENLPKDAILGLPVSSGTVEGRARVILDMEKADLEDGDILVTAYTDPSWTPAFVSI
FT                   KGLVTEVGGLMTHGAVIAREYGLPAVVGVENATTIIKDGQQIRINGTEGYIEILD"
FT   regulatory      complement(441701..441706)
FT                   /locus_tag="Lm4b_00434"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(441857..441885)
FT                   /locus_tag="Lm4b_00435"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(441893..442765)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00435"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00435"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04204"
FT                   /protein_id="CAS04204.1"
FT                   /translation="MTGLGTLLFLVGIGVLIFGLVSFRRKNWPRKKTQIIIISSILAII
FT                   IGVGIIPTTDEEASTEEPTKQEEKTEKVDNTPILKAETTFTTDDEGTLVVEGKTNPGAE
FT                   VTLDFVAIPDAVTTADENGAFSLSVNQLDKAQDAVLSIVIDGQTKEQTLKLALTPAYET
FT                   KLTAKAEAERVAAEKAEAERVERERVAAEEKRAADAKIAAEKKAEEARVAAEKKAAEEK
FT                   RVAAERSKAAAAQPDTSNEQGQMVYITATGKRYHYDQNCRGLNNSNGETAVTVAQAKAQ
FT                   GLTLCKFEQ"
FT   CDS_pept        443108..443299
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00436"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00436"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04205"
FT                   /protein_id="CAS04205.1"
FT                   /translation="MAKPIEEIGEEIGAKVEKVARKTGNVAGTAAKLSVYSSIWAVKTG
FT                   VNKTRAFAQGFKQGWSGK"
FT   CDS_pept        443326..444135
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00437"
FT                   /product="Putative Conserved membrane protein"
FT                   /note="Conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00437"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04206"
FT                   /protein_id="CAS04206.1"
FT                   /translation="MLNYLSSLNPVLLALLAGIFTWACTAAGASLVFFFKNLNKKWGNV
FT                   MLGFAAGVMLAASFWSLLAPAIEMSKDLGKFSFVPALVGFLLGGIFLRVIDRIIPHLHF
FT                   GFPEQAKEGPKTSLRKSILLVLSITIHNIPEGAAVGVAFGAVITGDTETLITAIVLALG
FT                   IGIQNFPEGAAVSIPLRGEGLSRGKSFWYGQLSAVVEPIFAVIGAVLVVFVTPILPFAL
FT                   AFAAGAMIFVIVEELIPESQVEGSTDLATAATMAGFAVMMVLDVALG"
FT   regulatory      444159..444190
FT                   /locus_tag="Lm4b_00437"
FT                   /regulatory_class="terminator"
FT   regulatory      444417..444422
FT                   /locus_tag="Lm4b_00438"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        444428..445828
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00438"
FT                   /product="Putative endo-1,4-beta-xylanase"
FT                   /function="Unknown, similar to endo-1,4-beta-xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00438"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04207"
FT                   /protein_id="CAS04207.1"
FT                   /translation="MKIRWIRLSLVTVLIIAVVFVGVIGFQKYQFSKSRNKVIMQMDRL
FT                   MKDQDGGNFRRLDKKENGVEIISYIPKTTEKKDNEIIQKEIEKATDAEVKKLNRDKETQ
FT                   GIIFYTYQKHRMAEQAISYKAVQSEYVKEGRTKFVLKDKKDICKNIVTDAETGALLTLG
FT                   EVLIKSNQTKLNLKTAVEEELIKTGGFSLKDVGNLGEIKSLVKWNQTDFEITNSELILP
FT                   VKIPGAPEPNKVKVKLADIASSVNKRYLPSSVKVPEVPKAKTNKRIALTFDDGPSASVT
FT                   PGVLDTLKRHNVKATFFVLGSSVIQNPGLVKRELEEGHQVGSHSWDHPQLTKQSTQEVY
FT                   NQILKTQKAVFDQTGYFPTTMRPPYGAVNKQVAEEIGLPIIQWSVDTEDWKNKNAGIVT
FT                   KKVLAGATDGAIVLMHDIHKTTAASLDATLTKLKNQGYEFVTIDELYGEKLQIGKQYFD
FT                   KTDSRMVK"
FT   regulatory      445835..445865
FT                   /locus_tag="Lm4b_00438"
FT                   /regulatory_class="terminator"
FT   CDS_pept        445955..446158
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00439"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00439"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04208"
FT                   /protein_id="CAS04208.1"
FT                   /translation="MKVRNKVKQLREERGIGQNELALALEVSRQTIHAIEKGKYNPSLE
FT                   LSLKMARYFRLTIEEIFQLEEN"
FT   CDS_pept        446160..446570
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00440"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04209"
FT                   /protein_id="CAS04209.1"
FT                   /translation="MKRYIINRGIMVAVVIIYMYPLLGIIKGEKIFGDIGTPIVMIIAA
FT                   LIGTLSSVFLSEEKTKREYEKEKLEKDERYINNRKTFSHYLLIVLALTIPIVLIVLNLN
FT                   GIEQISISSLTIIFLIFCFAYMIVLEIIRKKV"
FT   CDS_pept        complement(446623..446922)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00441"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04210"
FT                   /protein_id="CAS04210.1"
FT                   /translation="MRSLDAVEILRRGETIERYKEGGNSMLPLIKSMQPVRLEPIGMRE
FT                   LKVNDIVFCKVRGSFFTHKISKIRGKQYQISNNHKHVNGWITRNSIYGIVTKIW"
FT   CDS_pept        complement(447003..447557)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00442"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00442"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04211"
FT                   /protein_id="CAS04211.1"
FT                   /translation="MSKGRLEAFSDGVFAIIITIIVLGMTLPDVFTAASTQAFLWEIFI
FT                   FIEGGLIIGQFWYSHSRLFDQVTFISTSAVLFNILFLLVLSLIPLFTRAIMQHPDMTAP
FT                   IIGFVITILITSVIFQLLHHAVNGKDSGIDNWKFRISSFIFVIMLGIISFFAPQISTIL
FT                   FIIFPIAGWIIQLTNRRQPPK"
FT   CDS_pept        447704..448516
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00443"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00443"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04212"
FT                   /protein_id="CAS04212.1"
FT                   /translation="MIRAISVDMDGTFLDGNGEYDRARFEKIYVELMKRGIKFIVASGN
FT                   QYYQLKSFFPGKDEELFYVAENGAVIFHQGELRSVNRFEERLVQKILRTLIQEYQDLQV
FT                   ILCGVKSAYLLKAADPDFKAFAKKYYFELQELDSFDVFPDDTFIKFALDVEVAKTGQIV
FT                   EDLNQTFAGEIRAVSSGHGSIDIIIPGVTKGSAIQQLLNEWQVAPDDLLAFGDANNDIE
FT                   MLQLTSHSYAMQESSPEVLAAAKHVAPSNKEAGVLQVIEEYMKKSQRP"
FT   regulatory      448501..448527
FT                   /locus_tag="Lm4b_00443"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(448503..448529)
FT                   /locus_tag="Lm4b_00444"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(448535..449392)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00444"
FT                   /product="Putative glucose uptake protein"
FT                   /note="Similar to Staphylococcus xylosus glucose uptake
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00444"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04213"
FT                   /protein_id="CAS04213.1"
FT                   /translation="MSIYLIALLPVLGWGFMPIIANLRKSTPEEQLLGTSISALLFAFI
FT                   LFWILSPEITVLSFIVSFVSGIFWSFGQLLQFKGIAASSVAKAMPISNGTQLVGATLFA
FT                   VLVFREWQTVTAVIIGVVAVILILIGVVMTGFQKRGNHITESVSFHVYGIVILSSFFLT
FT                   LYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKKTAISRKNVTFNLMTGLSWSIANL
FT                   GMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLEWTFILSGILLIMVGVVFL
FT                   SLLK"
FT   CDS_pept        449554..451515
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00445"
FT                   /product="Putative transcription antiterminator BglG
FT                   family"
FT                   /note="Similar to transcription antiterminator BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00445"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04214"
FT                   /protein_id="CAS04214.1"
FT                   /translation="MKAVTKMIANREKNIIQFLMKTGQTRVGTIANHLGLSEKTVSNSL
FT                   KEIDVFLKDFDMTVVRKPKIGVYIEGDNKAFAEVSRFLDNQVSPIPSTKEERVIYIFSK
FT                   LLKADDYITIHQLADELYISRSTIEKNMVEVTKMLEKEGITLYKKPSKGMKLLISEREK
FT                   RALTSKFINNFWGNNWYLKQEGEKVLQAFDTIKADVTGIFPEEGLKEIIAIVQAFSERH
FT                   DFAFTDYAFQSIVIHLAIAVERIRTGEYIENVESDPMKDVFDSQRNNTEILVSMLEDRL
FT                   DIKIPAFEVGYIQLHLTAAYNQQHDELLVSVRPKEDDVAEFVSTCLAEGNYDKSLLDDL
FT                   TTHMKSAINRLKLGMHFKNPYLSKIKQNFPQAFEEALYFKAKFEQKYDVQVNEDETAYI
FT                   ALHFEAYKERSRSFPDQIRVVLVCSTGLGSSRLLAARIKKYFPMITIEKILSVQALMET
FT                   EVDVDLVISTIYLELEDIPSIVVSPMMSKADLQQVESQIERTRRKKKKRSQPFVDLIEP
FT                   KTIFAKLDVATMEDAITQIGDKLVNLGIAQSGIVESALKREALSFTSFEEMATPHADPA
FT                   LINESHIAIATLKNPVKWGLVEVDKIFFIALTEQNGINLDAMYEQFYKYIDNKKWLEKL
FT                   TQLKSAAEIYEHLLKDGM"
FT   CDS_pept        451515..451979
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00446"
FT                   /product="Putative PTS fructose-specific enzyme IIA
FT                   component"
FT                   /note="Similar to PTS fructose-specific enzyme IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00446"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04215"
FT                   /protein_id="CAS04215.1"
FT                   /translation="MEVKDILTKELVVFDLEATTKEAAIEEMAEMLDEHGILADKATYV
FT                   RAVLDREAHSTTGIGNNIAIPHGKSESVTKSAIVFARTKEMIEWESLDDEPVNMIFLLA
FT                   ITDSDKTDGHLKILAEIATKLMDDDIVENLKNTRDEEEVIRILNGGVVEI"
FT   CDS_pept        451976..452296
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00447"
FT                   /product="Putative PTS fructose-specific enzyme IIB
FT                   component"
FT                   /note="Similar to PTS fructose-specific enzyme IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04216"
FT                   /protein_id="CAS04216.1"
FT                   /translation="MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATG
FT                   IENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALID
FT                   EK"
FT   CDS_pept        452309..453415
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00448"
FT                   /product="Putative PTS fructose-specific enzyme IIC
FT                   component"
FT                   /note="Similar to PTS fructose-specific enzyme IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00448"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04217"
FT                   /protein_id="CAS04217.1"
FT                   /translation="MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITD
FT                   IWDAKYADSANSLISLLHSLDGFGGLALGMMFPVIAAFIGYSIADKLALAPGLVGGLLA
FT                   RDIGAGFLGALAAGLIAGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVV
FT                   GIPFADLNTALENWLNGMSGSNQILMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIY
FT                   APNTAAQVAIIIPPLGLGLATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESP
FT                   LKVIPATVLGSAVGGALAVGLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMS
FT                   VALRKASAGEEMAGSSYDDEIDEAEWEA"
FT   CDS_pept        453431..456013
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00449"
FT                   /product="Putative sugar hydrolase"
FT                   /note="Similar to sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00449"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04218"
FT                   /protein_id="CAS04218.1"
FT                   /translation="MVKAHIVNHTHWDREWYFTSADALVLSEQLFTEVIDELKKHPEAN
FT                   FVLDGQLSILDDYVALYPEKLADIKQLIADKQLFIGPWFTQTDAFFAHGESILRNAMIG
FT                   IFDSKKYGDYMEIGYLPDTFGFNAQMPTLLEHAGFDNVIFWRGIHLGEHVASPYFKWQG
FT                   LGEEASIYAINMPQGYGTGMLLEPTSAYVDGRLDPAIDFIEKYSKTTEVLIPSGNDQLN
FT                   IISNFAEKLVEINKMGRHDYQLSTYQDFIQYVRELPDLEEYRGEFRSPVLARVHKTIGS
FT                   SRMNIKLKSASLEQKLLTRIEPLLVIAKASGISISERLLMHTWKKLLEGQAHDSLAGCV
FT                   SDPVAEDILHRMKEADELCDSIENTIVKKIADDLSLAANEIIVFNTDSHDFDGCKEIQV
FT                   VTEHKNIHFPAFPDATIVQEEFIPSRENVLEETPAGNRFIEEPGYYVLQVRVKVELPGL
FT                   GYRVIAFEENDRELDSMIASNDVAITNDFYKITFENGEIALEKPNGERITSFITLEDDV
FT                   NAGDTYDYSPLAGDIAELFTFSEAKTEKSSEVERLILTGKSDFPLDRLAKEGHGDLQIK
FT                   LILEVKKGSELLVVNVEVDNQIKSHRLRLKVNTGVKTDYNIASLPFGYIERKPVVPVNW
FT                   RETYSEMPIDIEPLEQSVTLTNEAESCTIFTQGIKEYQQLDQYLALTLLATTGQLGKPD
FT                   LAYRPGRASGDTTKKGHVLIETEGAQLLGKHEFSLAIYLGDQAFDEHKTAERTKAFNQA
FT                   NVSYQRQPFNHFLHRLDNKIQKTERKLGAKQTLGMLNLPKEYLVSACHPSYYSADKYII
FT                   RLENPTNTPQKLALSDMSFEYVNAIEEVVANDNNTIPAYGAVTLRLEI"
FT   regulatory      456022..456049
FT                   /locus_tag="Lm4b_00449"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(456024..456051)
FT                   /locus_tag="Lm4b_00450"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(456036..456911)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00450"
FT                   /product="Putative transcriptional regulator (LysR family)"
FT                   /note="Similar to transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04219"
FT                   /protein_id="CAS04219.1"
FT                   /translation="MELRVLNYFLTVAREKTISQAAEVLHLSQPTLSKQLKELEEELGV
FT                   TLFIRGNRSITLTEDGLYLANRGKEILSLVELTTSNLLQNETISGKIMIGAAETRGFEF
FT                   IGSMLHELREKHSDITFQLHSGNADDVLEKIEHGLLDFGLVINPVEKLQYEYLPLNIED
FT                   TWGILVNTKHSLAKKAVVTPSDIEANPIVVSNQSFIDNQLASWLGEHFEQLNVIGRYNL
FT                   LYNASLLAKENIASILCIDGIINTENTNLKFIPFSPPLIAGISIVWKKNQTFSSASKEF
FT                   LRLIQKTCSK"
FT   CDS_pept        457029..457598
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00451"
FT                   /product="Putative acetyltransferase"
FT                   /note="Similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04220"
FT                   /protein_id="CAS04220.1"
FT                   /translation="MIEQDLQKRLVDQEILQGSDLLDEIHEVKQNNEQLIIELNTKYHS
FT                   KKEVTKYLSDITGKPVDPSVDVSLPFYSDFGKHITFGKNIFINLNVTFVDLGGITIEDN
FT                   VLIGPGARLVTVNHLVSPKKRRGLRVAPICVKKNAWIGANATILSGVTIGENAIVAADA
FT                   TVTRDVPANVIVAGSPAKQIRKIIEE"
FT   CDS_pept        457612..458358
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00452"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00452"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04221"
FT                   /protein_id="CAS04221.1"
FT                   /translation="MTIKNKVIIITGASSGIGEATALLLAEKGAKVVLAARRVEKLEKI
FT                   VQTIKASSGEAIFAKTDVTKREDNKKLVELAIETYGKVDAIFLNAGIMPNSPLSALKED
FT                   EWEQMVDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVAGLKAYPGGAVYGATKWAVRD
FT                   LMEVLRMESAQEGTNIRTATIYPAAINTELLETITDKETEQGMTSLYKQYGITPDRIAS
FT                   IVAYAIDQPEDVNVNEFTVGPTSQPW"
FT   regulatory      458367..458397
FT                   /locus_tag="Lm4b_00452"
FT                   /regulatory_class="terminator"
FT   CDS_pept        458473..458979
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00453"
FT                   /product="Hypothetical protein of unknown function"
FT   regulatory      459000..459030
FT                   /locus_tag="Lm4b_00453"
FT                   /regulatory_class="terminator"
FT   regulatory      459220..459225
FT                   /locus_tag="Lm4b_00454"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        459235..465822
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00454"
FT                   /product="Putative cell wall-associated protein precursor
FT                   wapA"
FT                   /function="similar to cell wall-associated protein
FT                   precursor wapA (B. subtilis)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00454"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04223"
FT                   /protein_id="CAS04223.1"
FT                   /translation="MKIHAKAKKILVSLIAIMLFLSLIPGYAPMAEETSTGVEVPEKKA
FT                   GEQAPTEVKEERTENEVVFNNHDGSFTKQIFADSINMEVDGEMKRIDANVEKEADSDMI
FT                   VPKQTPLELGFLDKMEDGAYQKLTKAGAEVTFRLKGARTGENEQAVTDQPATYKENEVT
FT                   YENVFPKTDLRHLTFPQSVKEDIVLHEPNQVDTYVYQIETKLGLELAKNGDVLFKNKSG
FT                   ETMYTLPKPVMTDSNVGAETGEAALSENVSFEVKQLTKTVYELQLKVDTAWLNDVAREY
FT                   PVYIDPSVRLDEVYNANINSAKPTETNIGSKLWDSGQNAYTLKLGKWDNSTGNNAAYLK
FT                   MDTSTLNKATISKATLKVYNIWHMSPTVKNDLWYYESNANWSPWQVTWNTAPATTRIGS
FT                   VNVGRGEWANLDVTKTVQAWASGVRPNNGFRLATNIDQNYWKKLVASENNKNYPYLEVN
FT                   YTYAQPEKPTVKTNSNGVGTGTGYMDLSWKAVPGATSYNIVISNGYNYEYINTKSTATT
FT                   WSTKGKKIFPTNDEIANGEFEFHHDGKGTEFALDPRAQYENAFQAGSTFGLRNLTRYLF
FT                   RVQAVFPGGESPNSDLVFAYMPIEKPQPPAAKAYSNLAHKETGYVELNWEKSPMADGYK
FT                   VLVFNGKAYEEYDVGAETKWTTQNKGIWPTKEEIAEGKFALHHDGKGDELAKDPSPVYT
FT                   NSGGNYKERTNYWFRIVAYQKAGNNATSIQSEPATPSLPEVVNKQLGMVDYWTSVPVRG
FT                   GEVNATNGNFLFHETDFNLEGHGPSINVDRTFNSQDDATGIFGKGWTSTLEEKLIEEEN
FT                   GNIVWVESDKKVHRFTKKGDKYVAPPGIYSEITKNADGYLKIEEDKSETRFLADGRLKS
FT                   EKDTKGNELTYEYTDGKLTNMRDASGRTVTLAYEGELVKELVGPEDRKISYTYNDKQEL
FT                   ISSSTARGKIYCYGYTDGLLTSIYDPKHTEEKPYETTFAYEEEKLTEITDPVGKKTTLS
FT                   YDMEEQQTTLTNEKKKKTIYSYNDAGNPKKEIVDADGLKLTTTYTYESNNLVKEVNPKG
FT                   QEETYSYDADGNITQATDAYGTESYTYNGNNDVTSATDTEGRKTTVTYDGADAVSETLA
FT                   TESQVSSVTQYDAYGNPIRGSGELSSAGNLLQNSGFEKGAGVSNWTLIQSDAKGSMTFD
FT                   STQSAPGTLGGSGSVKLTSEANSTVKGYSSVTQRVDVEPETTYTFSAWIKTSGMTNADA
FT                   ILIGRLQDANAKDITDAGVWQSNRATSIKKNGGWVKRQLTFKTSKNTRQVLLYLDNEQP
FT                   APHKGKGTIWYDNVQFEKGSVASSYNPVVNSSFEEHNGTLPTGWARSGNTALTQAKVVD
FT                   NESHSGDSAVYFERKATSEAYTHIVQDVPVNQKEAKALTISALSKSEDAKANGSVATMS
FT                   NDYSIWGTIYYQDGTTSSVQGQFPLGTNDWNRSAVVVKPTKPVKMIKVYTMFRNGLTGK
FT                   AWFDDVRVIEGEVLTKNEYDASGNYVTASYDEEGRKISFTYDIYGNTTSETDEKGNKKT
FT                   LTYDADNALIDTKLANGTSVAYKYDDNGNTTEKNVTASGKTQKNIYEYDVDNKITAFTD
FT                   ALNRTIKYEYDAAGNETKAIMPNGRVTESTYDSADRLDGIKWNDKLAFKFQYDPNGNQT
FT                   KVTDEINSIVTDKTYDDANRITKVAERGGDVSYTYKDKPTKDNKGKTDKVGEVAINHGD
FT                   YTAKTSYTYNDLDRNTRVNDGSKNAYFEFDEFGNINVYTAGNGTAANYTYDSTQKVTNA
FT                   AISSASGTQILDENYTYDAASNRTSIDNKQDGKTTYEYDAVNQLTKETLPDGTVKAYTY
FT                   DGFGNRTQVAISGSETKTIAASYNDGNQLVSWNGEALTYDANGNRTSDGKYTYTWDTGD
FT                   RLSSITKKGESKPFTSYTYDDDNRRLSKTVDGVTTNYHYDGDSIDVLYETDGDGKVVRQ
FT                   YVYSDDNVRLAMKMNGKTLYYHYNAHGDVIALTDEAGKIVAEYAYDAWGNVLKNTASTE
FT                   EAKANPYGYAGYTYDKEIEQYYLMARYYEPEQGVFTAYDPDPGDEDDPQTMNGYNYANN
FT                   NPVMMVDPDGNWAWLIPAAMAAGKFIYKFRKPIAKYGKKGAKWVGKTAKKGAKWVGKTA
FT                   KKGAKWARSRYNSKKKEFTVTKNWKVGLPKKSQGGRIFAIINRKKGRLFALDYGKVGGN
FT                   QKKYLHVHWNYKPKHYIIYPRKGRGK"
FT   regulatory      465811..465816
FT                   /locus_tag="Lm4b_00455"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        465822..466304
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00455"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00455"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04224"
FT                   /protein_id="CAS04224.1"
FT                   /translation="MLDKQQLYIVENKDIPNYEVDSGITGAEQNYIYNFKNPIPISEQE
FT                   LQDICDTFGEFMVSAYFLVDIFGPYEELPGDKKNGYKKVVLADESMEIKKKMFHLFLEG
FT                   DAYPDANKIFLFKEKKELNARKNMEIEDGMIVISPVLDVTAIGIFSKGIDLAQFFK"
FT   CDS_pept        466443..466688
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00456"
FT                   /product="Putative truncated protein, C-terminal"
FT                   /note="possibly truncated protein, C-terminal"
FT   regulatory      467327..467332
FT                   /locus_tag="Lm4b_00457"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        467338..467694
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00457"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00457"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04226"
FT                   /protein_id="CAS04226.1"
FT                   /translation="MIEFIIDVSINFITFAICFIPLLLSEKTKGILEIVGASILFAGIM
FT                   IVGTGIFISSSETLKSYIYVILVVQIIILCSELILVLWSKSKGKSTILSILSAILGIVA
FT                   LGIYIYYVIASFIY"
FT   regulatory      467893..467898
FT                   /locus_tag="Lm4b_00458"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        467909..468172
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00458"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00458"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04227"
FT                   /protein_id="CAS04227.1"
FT                   /translation="MAFIRKNSFLLFLILFLMSSILIHMFFYNFLTDIIVTVFLGLETI
FT                   FIVIISLEIMDVKKIRKRTKRIIEIYFLTLLGITVITSYLFY"
FT   regulatory      468411..468416
FT                   /locus_tag="Lm4b_00459"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        468422..469009
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00459"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00459"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04228"
FT                   /protein_id="CAS04228.1"
FT                   /translation="MINLEWKELDQLEIEEKVQEVLDYSYNTWMSDKKNIRYFVRAFYI
FT                   RWDMLVDMYEVEDDETEGDKLKYMYDFGISELGNITEVDWIMGYCMLINPIYFEENDNY
FT                   LELEEKGQEMLRNVAINNPDDVFLTSFGIPEKDYLKWKIANREQLIQYGEDNFSYDSEF
FT                   SRYFKHIINCRANEEVEKESFLKKIVRRWKQR"
FT   regulatory      469019..469024
FT                   /locus_tag="Lm4b_00460"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        469034..469732
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00460"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04229"
FT                   /protein_id="CAS04229.1"
FT                   /translation="MLKKTKKNLNEIKTIIQQKPFDYEKAENLISELNLEEALLELENI
FT                   LLASINNSDENARIFAYEYLYYFDSEAVFQAALIGTTDDDDLVQMCSIEILGNLVKVES
FT                   LPYLKKALGDNNPDVRCFAAESIGFVGTDEAKAILQEQLNRETDSFAKVGIYYALYLLG
FT                   REEMLPKLLSLLDDNYHLTVIRSLDVLRDVVNQTNKENILLNIEKLLKRDIPISVKEKA
FT                   EVVLQEIKGS"
FT   CDS_pept        470439..472841
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="Lm4b_00461"
FT                   /product="Internalin A"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04230"
FT                   /protein_id="CAS04230.1"
FT                   /translation="MRRKRYVWLKSILVAILVFGSGVWINTSNGTNAQAATITQDTPVN
FT                   QIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQIN
FT                   FSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNL
FT                   TNLNRLELSSNTISDISALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI
FT                   SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA
FT                   NNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKN
FT                   LTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLT
FT                   PLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGSYAEPDI
FT                   TWNLPSYTNEVSYTFNQSVTIGKGTTTFSGTVTQPLKAIFNAKFHVDGKETTKEVEAGN
FT                   LLTEPAKPVKEGYTFVGWFDAQTGGTKWNFSTDKMPTNDIDLYAQFSINSYTATFDNDG
FT                   VTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSA
FT                   NSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPA
FT                   NDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTST
FT                   MNAYDPYNSKEASLPTTGDSYNALYLLIGLLAVGTAVALTKKARASK"
FT   regulatory      472856..472885
FT                   /gene="inlA"
FT                   /locus_tag="Lm4b_00461"
FT                   /regulatory_class="terminator"
FT   CDS_pept        472926..474818
FT                   /transl_table=11
FT                   /gene="inlB"
FT                   /locus_tag="Lm4b_00462"
FT                   /product="Internalin B"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00462"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04231"
FT                   /protein_id="CAS04231.1"
FT                   /translation="MKEKHNPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVSTPIK
FT                   QIFPDDAFAETIKDNLKKKSVTDLVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLF
FT                   LNGNKLTDIKPLANLKNLGWLFLDENKIKDLSSIKDLKKLKSLSLEHNGISDINGLVHL
FT                   PQLESLYLGNNKLTDITILSRLTKLDTLSLEDNEISDIVPLSGLTKLQNLYLSKNHISD
FT                   LRALAGLKNLDVLELFSQECLNKSINHQTNLVVPNTVKNIDGSLVTPEIISDDGDYEKP
FT                   NVKWHLPEFINEVSFIFYQPVTVGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEA
FT                   GTRITAPKPPTKQGYVFKGWYTEKNGGHEWDFSTDYMSGNDFTLYAMFKAETTEKAVNL
FT                   TRYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDREARNGGELWYRLKNIGWTK
FT                   AENLSLDRYDKIEYDKGVTAYARVKNAPGNAVWTKPYNTAGATLVNKLSVYQGKNMRIL
FT                   REAKTPITTWYQFSIDGKVIGWVDTRALNTFYKQSMEIPIQLTRYVSANKGNEAYYKVP
FT                   VVDSPIKWGTLAKYKNQTLIVDRTATVEGQLWYRIRTSSTFIGWTKAANLRAQK"
FT   regulatory      474884..474912
FT                   /gene="inlB"
FT                   /locus_tag="Lm4b_00462"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(474884..474912)
FT                   /locus_tag="Lm4b_00463"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(474933..475418)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00463"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00463"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04232"
FT                   /protein_id="CAS04232.1"
FT                   /translation="MKGLKKMKYSIQFSDAIHILAYIEIFKNTNLLSSEIIAGSVKTNP
FT                   ANIRKIMSNLKKSNLITTQTGKANPILARPPEEISLLDVYKSIEGNTNLIHVDPKTNPD
FT                   CIVGANIQQVLASKYDLLQQKIEFEMEKIKLDSIVRDISVLESKDRPQNMEIIEKYL"
FT   CDS_pept        475517..476362
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00464"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00464"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04233"
FT                   /protein_id="CAS04233.1"
FT                   /translation="MTYLVTGATGGLGGYALNYLKELVPMSDIYALVRSEEKGADLKAA
FT                   GFNIRVGDYSDAESMKQAFVGIDRVLFVSGAPGNRQVEHENVVNAAKAAGVSYIAYTSF
FT                   AGADKSTSALAEDHFFTEKVIEKSGIAHTFLRNNWYFENEMPMIGGALSAGKFVYAAEN
FT                   GKVGWALKREYAEVAAKAVAGADFPEILELSGPLMTYEELTKALKEATGKDFDVISSDD
FT                   KGFVENLVSAGLPQPVAEMFLSFQHDIKNNQLDVTSDDFEKALGKPLTNRVDALRELLK
FT                   "
FT   regulatory      476370..476396
FT                   /locus_tag="Lm4b_00464"
FT                   /regulatory_class="terminator"
FT   CDS_pept        476518..477135
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00465"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00465"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04234"
FT                   /protein_id="CAS04234.1"
FT                   /translation="MKKLVAWFNGLSKMWKVVVIIGAVFVVIIALTTGENEGEQTKTKT
FT                   NSDKIVKTTSKPKLSTKDLALIKADLAEFEGRELSSEKILKDTIKEESWSDLDFANDNI
FT                   NQMIDTMKRYQQEILSIDAIKRSSEASADTEAFKKVFKEWSDFKIERIQVTIDLLNGKK
FT                   DSEAAFKKSYPNQIIFKKVRTNKLQTALNNLKVGYELLDSQK"
FT   regulatory      477142..477161
FT                   /locus_tag="Lm4b_00465"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(477142..477161)
FT                   /locus_tag="Lm4b_00466"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(477168..478436)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00466"
FT                   /product="Putative module of peptide synthetase"
FT                   /note="Weakly similar to a module of peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00466"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04235"
FT                   /protein_id="CAS04235.1"
FT                   /translation="MVKITSYPAEPSDVKHYISGEKMKNDHHLHTVLKFDNHLNIDVLK
FT                   KAVMQSTKKLPLLLCHFKETKKGAFWQESVFSAEDLVFLVETQAPETEVDRALVTKLST
FT                   ENGPQICFTVVRADTSDQLVVIMNHMLADGAGFKEYLYLLSELYSNLLENPDYAANLSL
FT                   GSRSLKQIFDQLSRKDIKSIFTEKTKQKAVHNPTFPLKGDPKNPKVIWTKLPKEDFSEI
FT                   IHFAKEHEATVNDVLFAAMARTVQQTTGQQEMSIDCPVDLRKYLPSKTSSGITNLTANI
FT                   TCQISANDDLTSFESTLQAVKNSLNPQKNSFAPLRIYYLLELIFKKKNYSVAKKASEKM
FT                   YSIPKTSFTNIGIIDEEKLVFEGSTLTDCFICGSLKYAPFFQVAATTFRGELTLSTNLH
FT                   GTTQDHAWQKDFLEQMISEFPSK"
FT   CDS_pept        478574..479077
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00467"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00467"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04236"
FT                   /protein_id="CAS04236.1"
FT                   /translation="MTNRTLTTKLLGTLSYTQENGTMMDAVIPLDGKEVKVDYSIFEKL
FT                   TSEDYFKDIVTLTDQIPELHLEAKKTILEQFDGNDTLTIYFDFHTDELPEAVLEVTECD
FT                   ALENITKEILIDKLVLSGVWFSENANNELDLTFDFKLLPEVSDELLVVRFNTKGEITEL
FT                   THES"
FT   regulatory      479085..479114
FT                   /locus_tag="Lm4b_00467"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(479085..479114)
FT                   /locus_tag="Lm4b_00468"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(479119..481155)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00468"
FT                   /product="Putative penicillin-binding protein
FT                   (D-alanyl-D-alanine carboxypeptidase)"
FT                   /note="Similar to penicillin-binding protein
FT                   (D-alanyl-D-alanine carboxypeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00468"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04237"
FT                   /protein_id="CAS04237.1"
FT                   /translation="MASYGGKKRNNKKAIIIGSIAAVVVLAGIAIYFFIQNQHKDEKNA
FT                   LAAAETFTSNIAKEKYDKLGSSVSSESLKKVEFTKKEMEDKYQAVYDGIGAKDIKVKNL
FT                   KSVYDDKENKFNLTYELEMRTSLGKLATQKYKTTISKQDDDWKIDWKPALIFPGMVKTD
FT                   KVRITEDEVERGQIVDRNGNPLATTGQFAEAGVVPSKLGEGDEKVKNIADISKKLEVST
FT                   DYINKQLDQKWVQADSFVPLVTLNKDNLPEATGLTYAQKEMRTYPLNEATSHLIGYVGE
FT                   VSAEDIEKNPKLSVGDVIGKSGLERYYDKQLRGKNGGAIKIINDQTKQEDTLQKIDKKD
FT                   GEEIKLTIDAAVQKKAFDSLGSETGAVTMINPTNGELLALVSTPSYDANQMVLGITSED
FT                   YAKYNDDKRLPFLARYANRYAPGSTFKTITATIGLDTGVTKPDKVREISGLQWQKDASW
FT                   GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFDKEYNLPFTM
FT                   KPAQISNDGLNSEILLADTSYGQGELLMSPIQQAIAYSAIASDGKMPYPKLDTKEKAGK
FT                   ETQATEAASANQVKAALVKTVSDPAGTAHALQIQGHSIAAKTGTAELKEKQGEDGLENG
FT                   FVYAFDADNPNYLMVGMIENVKGRGGSGLVIDKLKPVIESMYK"
FT   CDS_pept        481327..481641
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00469"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00469"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04238"
FT                   /protein_id="CAS04238.1"
FT                   /translation="MEEMEQPEKKVIIRGKGIHNKWKWSTIIVSILSVIIISVLSYQLY
FT                   SVSQNTPENNTNGTMQGPGGGEMPSGTPPSGEPGQAPNSSDDSSDSGTSDSTTSSDGTL
FT                   "
FT   CDS_pept        481778..482707
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00470"
FT                   /product="Putative transcription regulator LytR"
FT                   /note="Similar to B. subtilis transcription regulator LytR"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04239"
FT                   /protein_id="CAS04239.1"
FT                   /translation="MARHAQKRKARKGRIFVTILVALLILVGVVAVIGYFQYQSSLKEA
FT                   QNESKLKDYKFNGAKAVGDEINVLLIGSDSRGEDQGRSDSLMIAHYNTKTNTPKLVSIM
FT                   RDTYVDIPGHGKNKINAAYSYGGPELVRQTIKENFGVDVQYYVVANFEGFPKIVDTLAP
FT                   EGIKINAEKDMSKNIDANIKKGEQVMDGKTLLQYARFRKDAEGDFGRIRRQQQVLEALK
FT                   EQAIDVGDVAKIPDVIGKLQGYSSTNIPTGTLMSIGADFLLGKTETMEKFAIPVEGKWH
FT                   NERIDGAGAVLRLDDMAANAKALQDFLK"
FT   regulatory      482716..482746
FT                   /locus_tag="Lm4b_00470"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(482716..482746)
FT                   /locus_tag="Lm4b_00471"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(482755..483303)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00471"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04240"
FT                   /protein_id="CAS04240.1"
FT                   /translation="MKKVSSLLTQDQFWGIIDNSDKGSKLEELLEKLSEDELFGYDYWW
FT                   NYFHKKSYNQSLWAVAYVVLGGCSDDGFDYFRYWLITRGKAVFTSAVENADTLCGEFDL
FT                   LTEDEYPENEEVAYLVMDIFENKLGKDFDDAENEAESRIEFEEVSMPPIDFEWDEDDED
FT                   SIKKVCPNTFAKWWNNDKF"
FT   regulatory      complement(483312..483317)
FT                   /locus_tag="Lm4b_00471"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        483537..484262
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00472"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00472"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04241"
FT                   /protein_id="CAS04241.1"
FT                   /translation="MKDKTKKRKWNWAQILAIFVLVTLVVSMVYATVNLITAPSGNVPE
FT                   GQQTKGDYSLMLMQCVLGVVVLFLPSIISKKMKFVIPNAMYIVFIVFLYCAIYLGEVRS
FT                   FYYLIPNWDTILHTFSGAMLGGLGFSIVSLLNNDERITLSMSPVFVALFACSFAVFLGV
FT                   FWEFYEFAADSFGMNMQKTMLEDGTMLQGHAAVADTMGDLFVDFLGAFVISIIGYFSIR
FT                   KNKKWMKNFEFKKVDEEVK"
FT   regulatory      484268..484299
FT                   /locus_tag="Lm4b_00472"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(484268..484299)
FT                   /locus_tag="Lm4b_00473"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(484306..484971)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00473"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00473"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04242"
FT                   /protein_id="CAS04242.1"
FT                   /translation="MARSRQISESIGLGLLLALAGGFMDAYSYIERGQVFANAQTGNIL
FT                   LFGINISEGNWAIAIQYFWPVVSFTVGIAISEVIHRRDIRRLHWRQLSVLIEVVILIGV
FT                   AFISLDHNLIANSLISFVCGIQVESFRKMHGRGIATTMCIGNLRSATQNLCDYFEYKEK
FT                   QYLRNSLLYFTVILSFIIGAVVGNFFIQLFAQYAILVCAFLQFIAFMMMFIDRESKII"
FT   CDS_pept        complement(484992..485747)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00474"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00474"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04243"
FT                   /protein_id="CAS04243.1"
FT                   /translation="MTTIFPKEQNVAPLFEQILANPTACRRFKDVFLDNLESYQETRGF
FT                   EKDDTLFAKIILSAYRQSDVSALLLGVCGRTLFELLRQAFLIPKKLTVDNPFFLTDKEG
FT                   NFIAKKDDISNREQEKFQEIYQSDLHHSETTIFLVDDDDIIHSYEPDFSISTKRINKKR
FT                   GILVLYSLPDTLKLGMTESEVYAFIWKTFLHIQEIIPSSRIFYGQETSENADELGVFLP
FT                   IHHFEKKMLQNIEQVNELVDALREQMVNK"
FT   regulatory      complement(485828..485852)
FT                   /locus_tag="Lm4b_00475"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(485864..488023)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00475"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00475"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04244"
FT                   /protein_id="CAS04244.1"
FT                   /translation="MKRYLTLVMLFILSVLLISEWIYPFAELTELSTANWIILFITLSL
FT                   GSFFLRLKYYWTIPLHIVMIIFVSGIYYAKGGILAGNWFVSFFQITFNGFRDMVQFRSS
FT                   DISMDFILIVFLIALWLLSYITTYSILRKQRVMSVLVLTVAYLAVINTFTDYNSNWAIV
FT                   RTVLEGFLLLHLALASRIAAPNRISADSLKRNGLFYHIFVILLLAVFVFSSLMLPKKAP
FT                   IFPDPVPTIKNALGINTTRTVGYSEDDTTLGGALKKDNATVFTARAEKGHYWRVESKTV
FT                   YTGTGWANANSADVISFSSGDNFPIQLTEQTTGATNTAEISFASSNDYMPYPYGTQTVN
FT                   GAVDSFSANLTIERVGPVDTIKNYTVQLKTPVYNIEKMQNADFSTLSNAFVSQYTQTPK
FT                   DLPDRVTKLANKVTKDADSIYDKTKAIERYLSASGTFTYSTEDAKETPRGADYVDQFLF
FT                   ETQIGYCDNFSTSMVVMLRSLGIPARWAKGYTPGEGEKKENDAKTTYTITNNNAHSWPE
FT                   VFFPGTGWVPFEPTATFSNPENFQEPTTETANKPETPNDSTSTPETPNTADKTPEQDNG
FT                   SSSTGETPKKEEPKTETAASNFEIPSWVWWIPAGLVVTLLALAIIFRRRIRRYLLLRSL
FT                   RNSPEFGKTYHRLMKLLASYGYVRESSETLRHFSTRVDAELTTTEFSRLTKMYEAQIYS
FT                   NNLTEKVITAEETQLVQQVIARLTK"
FT   CDS_pept        complement(488020..489168)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00476"
FT                   /product="Conserved hypothetical proteins"
FT                   /note="Conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00476"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04245"
FT                   /protein_id="CAS04245.1"
FT                   /translation="MLKKRLLLAFRWIIMLIIYAGLWTYTLFQGDTASWFLTYFFSFIL
FT                   LLLFLSSIYPLKAWKVNRRFVKNTYHDGDLVDMQVSFTRKSRYPVGYLLFQQKIPASFG
FT                   NVSARQQVVYPLFKKHFTVTLAGFVGVRGIHSFPPVDVETSDAFGLLERSRQLSSEKSL
FT                   TIYPTYFPDVLEKISEASPENERNAAYWTLKKNSNLHSLREFSSGDRISLIDWKSSAKS
FT                   DQLMTREFENSATSRLSVIFYGASHPNFELSLRAAYSFIRKISEDNGEIRVTLLGDQTS
FT                   KFAPAKGTSRLQDISTAFAEIAPVDSLTLQESLDSNLHSGEKILLFTPCIDTMLMQKVT
FT                   RLTDNKQLQIITFQSEHSKAMDAPAIFLEPASLLSRWEREAK"
FT   CDS_pept        complement(489173..490120)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00477"
FT                   /note="Conserved hypothetical protein similar to B.
FT                   subtilis YeaC"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00477"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04246"
FT                   /protein_id="CAS04246.1"
FT                   /translation="MSIEPSIKIEEIINEVEKVIVGKRHVVKLSLTALLAGGHVLLEDV
FT                   PGVGKTMMVRTLSKTIGVSFKRIQFTPDLLPADVTGVSIFNPETRDFEFRPGPVMGNIV
FT                   LADEINRTAPRTQAALLEGMAENSVTVDGITRKLANPFFVMATQNPIEYEGTYALPEAQ
FT                   LDRFLLKINIGYPTVEEEMQLLTLKQYQDPLDQTQQVVTLSELLDLKNKAKQVFIDDVL
FT                   KNYIIRLVDATRKHPSVALGISPRGSLAFMQAAQAFALIEGRDYVIPDDIQYLAPYIFT
FT                   HRLILKSEAYYNEETAESIIASILKNTSVPVEKR"
FT   regulatory      complement(489176..489181)
FT                   /locus_tag="Lm4b_00476"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        490276..491871
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00478"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00478"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04247"
FT                   /protein_id="CAS04247.1"
FT                   /translation="MSVKLADLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLE
FT                   DDLFDNDEFYGSEIVVSAFVNIRDDVEAQCRTIERLHKVGEVALILYYVGIFVPKMDQK
FT                   LIDFANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVTESLEQISSVRPP
FT                   QRNIDTTLKILSDRTHTSLVLTDNSFQVINSITWPRTRHWDFERIIEASKQIGEHELVQ
FT                   LTLDERDFYTARKPIFQDGMQAMHLFMMKEKGVLTADVVMQITEVVQVFMNLWGRNYVE
FT                   ISTAELMKAILNDESVKMRRLGKILNVDVSSIKWMWLVKTEEIRDNEQVLAELKSFVAS
FT                   HFQVSLIDLFEDNIVVLLDNSVAQRDRTHTANEFAMMMKEHGIDLKITVCQGMEQTSDV
FT                   QSAYSLVNEYKNAANAIYANKSIYSLQEIDFAAKCVEIVDRGELAIAEQMRPLKPLEDN
FT                   DELIETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPATKIPESYNLYLA
FT                   VAIRRILGGNNNNK"
FT   regulatory      491875..491912
FT                   /locus_tag="Lm4b_00478"
FT                   /regulatory_class="terminator"
FT   CDS_pept        492005..493288
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00480"
FT                   /product="Putative permease"
FT                   /note="Similar to permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04248"
FT                   /protein_id="CAS04248.1"
FT                   /translation="MTEKKSVEQTQSWQSLAFVWTGAMICVPSLLVGGTLISGMPLWEA
FT                   ILIALLGYGVIVLFMIYQGMQSSDLGIPAVSVASQVFGEQGSKKIISILLAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPVSSLIWGVIMLLSAIYGIRILSILNYIAVPVLLFV
FT                   CIYGLVVSLNDGGLAIVENYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGVLMITVGAVLALTAGTADISVVFTNLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAVAGGLGTILAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVSGVNWLGVSSWLVGAVIAGIPVILTFFPELPQLPNQPLIG
FT                   IILSLAVYLIGAKVLSGKTNNVENLEGK"
FT   CDS_pept        493289..494389
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00481"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04249"
FT                   /protein_id="CAS04249.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKHGPIK
FT                   LLSPEEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYVGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPMVDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERLARVTTVEMGASSLVSLYPCNGAQIKQSSIKNIVTLSEEIGKVIRETSMD
FT                   EAEKLQKLLDVTHGYHLFEGKITDVVRETRAGFNFGRVKIDGLNKDTGSEVIVHFQNEN
FT                   LVAEKNGEPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMALPADDAWRTDKGIETV
FT                   GPRYFGYDVDFEPLEELVKKEERRHV"
FT   CDS_pept        494382..495932
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00482"
FT                   /product="Putative hydantoinase"
FT                   /note="Similar to hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00482"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04250"
FT                   /protein_id="CAS04250.1"
FT                   /translation="MYKIGIDVGGTNTDAVILDENQQLIHSVKMPTSEDIETGITESLH
FT                   RVLSETGIDRSKVTHAMLGTTQCTNAIVERKKLAKVGVLRLGYPATASVLPYTAWPEDM
FT                   VGFLSGKYKLTGGGYEYDGQVLSEINEAEIRETLASWKGEVESVAVVGVFSSLKNDQEL
FT                   AVQKIIEEELGADIPVSISSSVGSVGLIERENATILNAALFKVIAATSDGFEKALEQEG
FT                   IAHAEIYLCQNDGTLMSLNYARQFPILTIACGPTNSIRGASYLAGLKDAMVLDVGGTTS
FT                   DIGVLTDGFPRESSLAVDVGGVRTNFRMPDIISIGLGGGSIVREKDGDITIGPDSVGYR
FT                   ISEEALVFGGKTMTTTDIAVRLGRAEIGNPELVAHIPTDFAEKAYKKIAEMTEDAIDKM
FT                   KTSSGSVSLVLVGGGSVIIPDEISGVAQIFRDKNGPVANAIGASISQISGQYEQIYIYS
FT                   QIEREEALQDAEQKAREQATLAGAVTDSIEVVEVEEIPLAYHPGNATRLRVKVVGNLV"
FT   regulatory      495971..496010
FT                   /locus_tag="Lm4b_00482"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(496106..496333)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00483"
FT                   /note="Highly similar to LMOf2365_0492 hypothetical
FT                   protein). identified by similarity."
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04251"
FT                   /protein_id="CAS04251.1"
FT                   /translation="MFFARYSGTYALSIITSFGLLPNPKKSCEKYGTNGNISIDLEVND
FT                   ARQAFVRFLYSFIYPTRIFLVSVWVVFLDN"
FT   regulatory      496554..496559
FT                   /locus_tag="Lm4b_00484"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        496568..498142
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00484"
FT                   /product="Putative transcription regulator (VirR from
FT                   Streptococcus pyogenes)"
FT                   /note="Similar to transcription regulator (VirR from
FT                   Streptococcus pyogenes)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00484"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04252"
FT                   /protein_id="CAS04252.1"
FT                   /translation="MREYLDSKSQKKVALLEKIFYAENHTSTQEELLNDLNITYPTLIS
FT                   TIKTINFDIERFGYKAFSIVHSAPNLSYTLKISDNCSIQLIINAYIRESPKFQILETLL
FT                   LASFPNLQALAKKVHVSYSGIKKEIKELNEELSERNLYISTGNQVEITGDEFSLRIFYA
FT                   FLFLVAYSGDRWPFSFVRYDEITDLLESCPKEIYRANSIDKAMMIHYYVAMHLLRDRMN
FT                   CQIDTTRQFKVALYKACTEESKKSESAFIKKVAKQLPNRNYKEMTYTTQIILSTIVAFG
FT                   SYSSIEKMPSFFYMDEQLEEMGFMKLVDFASERVNDNLSIPFSEKEMELLRYSFASINY
FT                   RYFLLDNLINKFNNIVPGYTDLDRNIRKIHKVNHLEPLISQLVNLKEMDPLKPFEERLT
FT                   SDYLIILDKRIDFSIHTLPIKVTILSTISNETAVFDFMRYFSSYYNLEIINQVDPVVDL
FT                   YISDFSVSPEVLTSLRINQPIIYVNTRWLESDYVKINDNLAKIARKNLSLIKKIRETLV
FT                   GMDMENV"
FT   regulatory      498162..498185
FT                   /locus_tag="Lm4b_00484"
FT                   /regulatory_class="terminator"
FT   regulatory      498355..498360
FT                   /locus_tag="Lm4b_00485"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        498368..500449
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00485"
FT                   /product="Putative membrane associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00485"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04253"
FT                   /protein_id="CAS04253.1"
FT                   /translation="MKKFSMRVVLIISVLFIALGNANVSIAQERDTTNKLPEEELGSLD
FT                   TSNLIAEEVAQDKPAEVENLEEIPTTDELMQNPDVREQSVADSDDPDLTAVSSGDYWTI
FT                   YYNSANDEYSLRMFGNVPSSKPSAWNSYLKYIKHIEIEEATLTGDFSSYFRSNVFTVLE
FT                   SVRIERSNLSGVTSFARAFEGDSESESPLEKVIIRDNYYPETPSLTNISRMFTLCRKLS
FT                   ELDVSGLNTSSVTKMDTIFSNANSLKELDVSHFDTSSVTDMSSMFAACNSLEELDVSNF
FT                   DTSSVTNMKYMLSGLHLKKLDVSNFDTSSVTNMYGMFAYCYNLEELDVSNFDTSSVNNM
FT                   LHMFYVCNNLEELDLSNFDTSSVTNMFAMFAYCTSLKEIDVSNFDTSSVTTMSAMFFEC
FT                   SSLEALDLSNFDTSSVTTMASMFENSTALKSLYLDNFTDAASMTDMFKGTTSLTYLFVS
FT                   HNLSTFNRLENTSWYDEKNWVQFSNLSQLQTYHRKQSEPTGYRKGAFLSLTMDAMGGEF
FT                   EDAEEQKVQNKVSGEYWEEIVPVKEDYYFDGWYLDQNFTNKFDFSLPAAVSTTIYAKWV
FT                   ENYTVIIPASISLNEATELKVEGINRGSKALSVGLNRLATSVSESNELTLANTADTTVQ
FT                   CSAPLSWDGSENNPEKAILTLAPGSEITEGDAVMAIEAPENIQAGKYTGNLVFSINYE"
FT   regulatory      500572..500577
FT                   /locus_tag="Lm4b_00486"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        500585..502654
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00486"
FT                   /product="Putative membrane associated lipoprotein"
FT                   /note="Putative membrane associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00486"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04254"
FT                   /protein_id="CAS04254.1"
FT                   /translation="MKKLSIRVILIVTIIFIACGSANVSIAQERDIINKLPEVELGSLY
FT                   TSNLITEEVAQDKPAEVENLEQAPTTDDLVQNPDVLEQPIADSDDSDLTVVNSGDFWTI
FT                   YRNTVNGEYSLHMFGNVPSSKPTAWNSYLNRIKHIEIEEATLTGNFSSYFRNNVFTVLE
FT                   SVRIERSNLSRVTSFALAFYGSGIEKVIIRDNNYPTAPSLLTTEGMFKNCSNLMEVDLS
FT                   GLDTSAVTTMWDMFNSCRALEELDVSHFDTSSVTNMSYMFYDNRNLEVLDVSNLDTGSV
FT                   TNMYAMFEDCTSLEELDVSNFDTSSVTDMYRVFNGCEKLKKLDVSNFDTSSATAMVQMF
FT                   RNCSALEKLDVSNFNTSLVTDMRAMFAGCTSLEALDVSNFDTSSVTNMAAMFSDNEKLE
FT                   KLDLSTFDTSSVTNMGTMFKNCTALKSLFLDNFTHAASSTDMFTGTTSLSYLFVSHNVS
FT                   NFNGLENTNWYDEKNWVQFSNLSQLQTYHRKQSEPTGYRKGAFLSLTMDAMGGEFEDAE
FT                   EQKVQNKISGEYWEEVIPVKEGHYFDGWYLDQNFTNKFDFSLPATVSATLYAKWVENYT
FT                   VVIPASISLNEATELKVEGINRGSKTLSVGLNYEETTISESNKLTLANTADTTVQCLAP
FT                   LSWDGSETNPKNAILTLAPGSEITEGEAVMEIESPENIQAGKYTGNLVFSINYE"
FT   regulatory      502776..502781
FT                   /locus_tag="Lm4b_00487"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        502789..504549
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00487"
FT                   /product="Putative membrane associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00487"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04255"
FT                   /protein_id="CAS04255.1"
FT                   /translation="MKKFSMRVVLIISVLFIAFGSANVSIAQERDTTNKLPEEELGSLD
FT                   TSNIIAEEVAQEKPAEVEQLEEIPTTDELMQNPDVLEKSVADSDDPDLTVVSSGDFWTI
FT                   YRNTVNNEYNLRMFGNVPSSRPTAWNSYLKSIKHIEIEEATLTGSFASYFRGTDFPVLE
FT                   SVRIEQCNLSGVTSFEMAFYNSGIEKVIIRDNDYPKAPSLLTATQYMFSLCRNLSELDL
FT                   SGLDTSAVTNMYAMFQNCTSLEELDLSNFDTSSATNMYSMFSGCRSLEKLDVSNFDTSS
FT                   VAHMQFMFEKCSILEELDLSNFDTSSVTNMSYMFQLCPALKSLYLDNFTDAAIMTGMFA
FT                   GTTSLTYLFVSHNLSTFNNLENTSWYDEKNWVQFSNLSQLQTYHRQQSEPIGYRKGAFL
FT                   SLTMDAMGGEFEDAEEQKVQNKISGEYWEEVIPVKEGHYFDGWYLDQNFTNKFDFSLPA
FT                   AVSTTIYAKWVENYTVIIPASISLNEASELKVQGINRGSKTLSVGLNYEETTISESNKL
FT                   TLSNTADTTVRCLAPMSWDGSETNPEKAILTLAPGSEITEGDAVMEIKSPENIQAGKYT
FT                   GNVVFSIKYE"
FT   CDS_pept        504615..505088
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00488"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00488"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04256"
FT                   /protein_id="CAS04256.1"
FT                   /translation="MKKKRVVIISLLLLLVSVIGISSYFLFKDKINLLDVDHSAVEWNG
FT                   KKQKDTSGEENTIAIPGFEKVTLYANETTQAVNFHNPEINDCYFKISLIHPDGSVLWIS
FT                   DLIEPGKGMYSIELEKTLAVGEYENAVLKYECFSLNDQSPLNGSEINLKLVVV"
FT   CDS_pept        505108..505593
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00489"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00489"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04257"
FT                   /protein_id="CAS04257.1"
FT                   /translation="MNKLVLSTLSVAAMGMVFFSGGTAYAADKEGNTVVEYSVEGDYTL
FT                   VVPEKVNLSNDNATEMSVKTINRNLEPGKEVEVTLSSGLSADGEIELQRVGAISDVITS
FT                   SFKSNNSVVPMANPVIGSFSGYAMEETEVSKIQIGNPQGDKKAGAYQTTLTFTAAFK"
FT   CDS_pept        505621..505926
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00490"
FT                   /product="Putative peptidoglycan linked protein (LPXTG
FT                   motif)"
FT                   /function="putative peptidoglycan linked protein (LPXTG
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04258"
FT                   /protein_id="CAS04258.1"
FT                   /translation="MKRKLVLAMVLISFCGMFLLSPERVQASQTVVEVFISEDDLDVSE
FT                   ENIQEIPKKELAASSDKDNKQPILPKAGDTVTNYTLLGLVLVLIWLIMQRKRKKKE"
FT   regulatory      505988..505993
FT                   /locus_tag="Lm4b_00491"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        506002..506268
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00491"
FT                   /product="Putative transposase"
FT                   /note="Weakly similar to transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04259"
FT                   /protein_id="CAS04259.1"
FT                   /translation="MARIEYGEEIQKSLLVLYSRGSTIQSICKEYGIPRYEFHKWMKLH
FT                   DADKLETKEVKTFLQIRELKQQKNKLEEEILFLNEAINLLESP"
FT   regulatory      506309..506333
FT                   /locus_tag="Lm4b_00491"
FT                   /regulatory_class="terminator"
FT   CDS_pept        507002..507619
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00492"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00492"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04260"
FT                   /protein_id="CAS04260.1"
FT                   /translation="MLMSLSVLPLATYASETENTPTESYDGENFIATQTGNTLVIEDKK
FT                   TGETVKIEMNDEENGVITSDDGTIENVHRDEEGNVYVDNELELEAPPLDIEDGINIATQ
FT                   PRLLKASKWIYVQTTKYNTTTQGNMRSLALGILSFMPITGPIFGIVAIIDAARSMGAKT
FT                   LYVRVKQYRTSGYQFYKYDSYYYANASLTKLVKKTSQTKRMW"
FT   regulatory      507686..507704
FT                   /locus_tag="Lm4b_00492"
FT                   /regulatory_class="terminator"
FT   CDS_pept        507929..508276
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00493"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04261"
FT                   /protein_id="CAS04261.1"
FT                   /translation="MQKDTYSGIRLSVIQLIDSKKENLKENNIKLTIIKDEKDGYVVEL
FT                   DNDKCMAEIVVEEPTYAPYRYISFEVVSLMDGKVKIIYSWYDDETSQWSDIEKELNKGI
FT                   QFLNNFKTMEQ"
FT   CDS_pept        508680..508922
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00494"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00494"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04262"
FT                   /protein_id="CAS04262.1"
FT                   /translation="MKRIILTSTLIVWTIVCIYMSISMVSNNTGIAFPIWLHIILLICF
FT                   LATGIVNVKKKEYLWSTMLFEGVLVVLLSLIIVLV"
FT   regulatory      508992..509015
FT                   /locus_tag="Lm4b_00494"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(509005..509982)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00495"
FT                   /product="Putative oxetanocin A resistance protein oxrB"
FT                   /note="Similar to oxetanocin A resistance protein oxrB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00495"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04263"
FT                   /protein_id="CAS04263.1"
FT                   /translation="MKITDPLYGTFEIEPVLAELIQSPLVSRLAYVHQGGSSYLVNPLW
FT                   DLSRLDHSIGVMLFIRKFGGSLEEQIAGLLHDVSHTAFSHVVDYALDFEEEDYHEQIFE
FT                   DFVKTSTIPAILEKYGYSFEGIFDDISKWKILEQEAPELCADRIDYTLQDLYRHGKISL
FT                   AEVEEFLQALVMVDGRLYLANIALAEWFVAQYYSEVIDYFYDPLNVYSYEILAEAMRIA
FT                   FQQETITTADLRLTDTELLAKLNANSDAREKIQLLASAHLEENEADFTYHHKKKMRLIN
FT                   PSILVDGRLIPADELSENVREMNDWASERSKHGIYIKATKKSKQ"
FT   CDS_pept        complement(510078..510419)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00496"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00496"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04264"
FT                   /protein_id="CAS04264.1"
FT                   /translation="MIGMFHYLLPLNQIPHNFHAQPGRISQMMHQWDFFHYFNRVSHCT
FT                   GQGYLFSRFCSPFCSASSRLIWEIDSPIALATRSILSRKICATTEVSSGIITLPNCFSF
FT                   YQSHLRSFQ"
FT   regulatory      510732..510737
FT                   /locus_tag="Lm4b_00497"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        510744..511571
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00497"
FT                   /product="Conserved hypothetical proteins"
FT                   /note="Unknown, similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00497"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04265"
FT                   /protein_id="CAS04265.1"
FT                   /translation="MKKRLIGIITALLLVSGILLSPQMAQAETKVDYDALYQQGVSEGI
FT                   INKADVSLETWIKENESEYNQVYQDGLKDGVYDASLSYEEWIKLNNYGQPPVVDENWEE
FT                   VPQKPMLKGVYKGYNIKKGDILITNGTSSSGLLGHAAIANGNEYILDIPGAGKTTRQVP
FT                   TSKWMSDYDPEGWVKVYRLKDSSVANAAANWADKNYYSTKGTSKQNIFPKYGMTGSRYS
FT                   KNPTYCSKIVLQAYYFGTGNKPVVQVFPSLVTVYDLPNYFSKAYKPQQVKYFK"
FT   CDS_pept        511599..511958
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00498"
FT                   /product="Putative secreted protein"
FT                   /note="Putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00498"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04266"
FT                   /protein_id="CAS04266.1"
FT                   /translation="MKKYKKWWITIGLVLIICIIGYIYWFAIPKHTANEAVDDYLAAQK
FT                   INSTQVKTRDIQKDWTRGGYYVTIVFKDDPNLVYEYNYNSKRNTPYHINLLVFKDGSSQ
FT                   EDDQVKHPPLQEQKD"
FT   regulatory      511981..512004
FT                   /locus_tag="Lm4b_00498"
FT                   /regulatory_class="terminator"
FT   CDS_pept        512084..512329
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00499"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00499"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04267"
FT                   /protein_id="CAS04267.1"
FT                   /translation="MNLLNNLRHLNARELAGKPKSFGLVQLKSIIFIQGDNKAPTSPML
FT                   SLAIPTPPEIQLTQTNETGRMPWRNHSLLKKRLLVG"
FT   CDS_pept        512284..512844
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00500"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04268"
FT                   /protein_id="CAS04268.1"
FT                   /translation="MAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLTWTYENDFFHCLADGITLENWDKHVLKMLESIKENADFYKNTVSADASIL
FT                   SFCFSKLTNSLFMDLFEKIDTNGAVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPET
FT                   IANQLFRLAKDTEFLANSMYREN"
FT   CDS_pept        512954..514654
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00501"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04269"
FT                   /protein_id="CAS04269.1"
FT                   /translation="MKNKKRTLVALTGAAIGTGIAAKKISEQKAAEKERAVDEAIKARY
FT                   YGDKQVYFVGGGIASLAGAVYLIRDANFDGKNIHIIEGMHILGGSNDGAGSVEHGFVCR
FT                   GGRMLNEETYENFWDLFSSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDA
FT                   HSMGFNNNDRMLMTKLLATPEEKLDNLTIRDWFDEHFFETNFWFMWQTTFAFQKWSSLF
FT                   EFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF
FT                   KDAPGITATALHLSDGSTIKLGPDDDVIMTNACMTDSATLGDMNTPAPKPEEKPISGEL
FT                   WYKVAQKKPNLGNPEPFFGHEEETNWQSFTVTCHGDKLLKRIERFTGNIPGSGALMTFK
FT                   DSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCH
FT                   LNWQDDFEEIKADIINVIPCYMPYIDAQFEPRAMSDRPAVVPEGSTNFAMISQFVEIPK
FT                   DMVFTEEYSVRAARIAVYTLLDIDKKICPVTPHNRDPKVLAKATQTMFR"
FT   regulatory      514664..514689
FT                   /locus_tag="Lm4b_00501"
FT                   /regulatory_class="terminator"
FT   CDS_pept        514805..515908
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00502"
FT                   /product="Putative conserved hypothetical protein, highly
FT                   similar to B. subtilis YloN protein"
FT                   /note="Similar to conserved hypothetical proteins, highly
FT                   similar to B. subtilis YloN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00502"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04270"
FT                   /db_xref="GOA:C1KZZ3"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZZ3"
FT                   /protein_id="CAS04270.1"
FT                   /translation="MEKSSIYGLTWTKLTEWLEAHGQKKFRATQVWDWLYRKRVKTFEE
FT                   MSNVPKETIELLTANFVMNTLEEQVVQESTDGTTKYLFKLSDGNLIETVMMKQEYGLSV
FT                   CVTTQVGCNIGCTFCASGLLKKSRDLTAGEIVEQIMNVQHYLDGRNLEERVSHVVVMGI
FT                   GEPFDNYDNVMDFLRVINHDKGLAIGARHITVSTSGLAPRIIDFANEDFQVNLAISLHA
FT                   PNNELRTSIMRINKTYSIEKLMEAIHYYVNKTNRRITFEYIMLKGVNDHKKEALELAAL
FT                   LGEHRHLAYVNLIPYNPVDEHIDYERSTKEDVLAFYDTLKKNGINCVIRREHGTDIDAA
FT                   CGQLRSKQIKRVGVRERMKQKQAAAEE"
FT   regulatory      515918..515947
FT                   /locus_tag="Lm4b_00502"
FT                   /regulatory_class="terminator"
FT   CDS_pept        515998..516477
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00503"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00503"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04271"
FT                   /protein_id="CAS04271.1"
FT                   /translation="MEVEIVERNAFTAVGKKRTFSVENDAQKEKISQFWQEANTNGDAE
FT                   RINELAEFATIDGILGVCKMNGDKMDYYIAIESELTPPADMEKLIIPASKWAIFKSVGP
FT                   LPSAIQKVWEYIYGEWFQTSNYAHGNAPELEVYTEGDTTAADYYSEVWIPVVEKE"
FT   regulatory      516621..516626
FT                   /locus_tag="Lm4b_00504"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        516635..517000
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00504"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00504"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04272"
FT                   /db_xref="GOA:C1KZZ5"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR023953"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1KZZ5"
FT                   /protein_id="CAS04272.1"
FT                   /translation="MIIVTNTIKVEKGAAEHVIRQFTGANGDGHPTKDIAEVEGFLGFE
FT                   LWHSKPEDKDYEEVVVTSKWESEEAQRNWVKSDSFKKAHGRTKDTREQREDRKGIVGNA
FT                   IARFEVVHVQNPVIVEK"
FT   regulatory      517013..517038
FT                   /locus_tag="Lm4b_00504"
FT                   /regulatory_class="terminator"
FT   regulatory      517115..517120
FT                   /locus_tag="Lm4b_00505"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        517128..517496
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00505"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00505"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04273"
FT                   /protein_id="CAS04273.1"
FT                   /translation="MDSNNEKLKQQLQTLQKQQKDAELSLYMLKHEQNERIWLEEDFER
FT                   ICYEERESLELMREVWQGDQARNFGYYLEDLQADEKNKWCQTFQAEEEKRQEKINTYQK
FT                   NIYQLESKQQDIQKELFQ"
FT   regulatory      517480..517485
FT                   /locus_tag="Lm4b_00506"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        517493..518794
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00506"
FT                   /note="unknown, possibly truncated gene"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00506"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04274"
FT                   /protein_id="CAS04274.1"
FT                   /translation="MSRIDIGEIQDFAFQLRAANQTGRKIIQGVKTTVTNYVEDGSLKG
FT                   KAVEASKNYFQMTYIPLCDTIIEAMNESEERLKRYIQDFHDQVDLSPNAKIDADGLYEL
FT                   GQMIDRIESKKEALYQRMNSSTEGQMQTYRSQLATAYKQENILEKYLAFEQSHGAFFDH
FT                   LTDLVQGIQQTVRELQSNIQFDSQTGSYDLSKLNFATVNRMRKTLGKASATDTTVYNFA
FT                   SYSKVKQGVMWILSKDGKVDIKATEAYNTASFNGELPKESNQATEEGELLKATLESLKQ
FT                   NKDPITGQEIIKAQSFGILTSLVFGYTTKGYQGKKLTISKNTLIKLRQADKTVIERIKK
FT                   TSRIDYEEIVKKGSKMPKHIIVENKQSLPGKAMPSSSADLLNPDGSVKQRRYYDEKGRA
FT                   KEDIDFNHSDDGTHEFPHRHEWDWDRKPPRKPSK"
FT   regulatory      518794..518799
FT                   /locus_tag="Lm4b_00507"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        518807..519184
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00507"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04275"
FT                   /protein_id="CAS04275.1"
FT                   /translation="MKNTVHDSEILSYHADFENSQLIMFVKDEENRKYKVIFEGLLTFC
FT                   FEHQMSNSIILDIVKGEVSSFISEKSILLSEGKNYFWPLDYESEDELLNYLNEKKLNYY
FT                   ELQASYGLNGWILCSHYHIEL"
FT   CDS_pept        519418..519993
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00508"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00508"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04276"
FT                   /protein_id="CAS04276.1"
FT                   /translation="MIEKTIKERRSIKKANDAPISRETVNTILEQAAYAPFHSKVEPWN
FT                   VYVLHTLAEKERYIEKIIEFNEREQGVSFSEAEIADLKAGYAKKIITPPYLLIVTTNII
FT                   GHGKKDFESIGATSAFIQNIQLLGWEAGIGMIWRSNRFIFDAKFAEDLGIPSEQKIVGT
FT                   LHLTSLAEVPEAKPRRPLNEWVKNLADL"
FT   CDS_pept        520058..520228
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="Lm4b_00509"
FT                   /product="ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00509"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04277"
FT                   /protein_id="CAS04277.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHKGLTTPGLSRDSETGEYRMSHRISPD
FT                   GTYKGRTIIEK"
FT   regulatory      520236..520254
FT                   /gene="rpmF"
FT                   /locus_tag="Lm4b_00509"
FT                   /regulatory_class="terminator"
FT   CDS_pept        520321..521049
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00510"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04278"
FT                   /protein_id="CAS04278.1"
FT                   /translation="MTEEFVNKEDALKNYNAKEFRTPDGYTSDMILTTVKELNGKPTLH
FT                   ILLIKRSLTNAEGKPNMEGGKWAVPGGFVDENESADQAAARELEEETSLTGIPLIPFGV
FT                   FDKPGRDPRGWIISRAFYAIVPPEALEKRAAGDDAADIGLFSMTEALELPLAFDHLDML
FT                   KKAYSAITEEFLLTTAIRDFLPETFSAELLYQTLDGCTKPGILPDEVEFMENIEYLPYL
FT                   EKVGELYRFNADAEAGSIYF"
FT   regulatory      521057..521080
FT                   /locus_tag="Lm4b_00510"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(521086..521979)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00511"
FT                   /product="Putative transcriptional regulator (LysR family)"
FT                   /note="Similar to transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04279"
FT                   /protein_id="CAS04279.1"
FT                   /translation="MNLRQLYYFKKLAEKEHYTIAAAELSITQPSLSHSIAELERELGV
FT                   YLFEKQGRNIRLTKYGRFYLTYVEKSLAELEKGEKLLHELTSPSHGNIDLGFIYTMGAH
FT                   TVPELVQNFTKVESHKDITFSFFQGATKSIIPDLKNEKFDLAICSYVENEPDIEFLPLT
FT                   KQELVVVVAENHPLAKHDSIDLKDTADYSYIFFSDTSGLRPLIDSLFAEINIQPKIGCY
FT                   VEEDTAMVGLVSVDYGISIMPKISSLAHYNVKVLSINEPKHDRFIYLASLKNHYISPAS
FT                   KAFKDFALRYGKKHFL"
FT   CDS_pept        522177..524171
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00512"
FT                   /product="Putative NADH:flavin oxidoreductase"
FT                   /note="Similar to NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00512"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04280"
FT                   /protein_id="CAS04280.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMNY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKKGGTVPRPLTVEEIYEIVNKYGDAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGSPENRARIVKLILEKVRAEVGPFFPIVL
FT                   RFSADEFTEGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVATGQEDML
FT                   RKCISCNIGCADHRISKSKPIRCTVNPDIIHEDKYKETKVTRPTNVVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEASEQTGGLARAIANLPDKSRIADFPNYLANRAEKLTNLKVITGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLHDVIDKEGSKVHSIFGLISNIDDFTEFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNNVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGKEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
FT   CDS_pept        524271..525146
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00513"
FT                   /product="Putative shikimate 5-dehydrogenase"
FT                   /note="Similar to shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00513"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04281"
FT                   /protein_id="CAS04281.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
FT   CDS_pept        525212..525970
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00514"
FT                   /product="Putative 3-dehydroquinate dehydratase"
FT                   /note="Similar to 3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00514"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04282"
FT                   /db_xref="GOA:C1L005"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L005"
FT                   /protein_id="CAS04282.1"
FT                   /translation="MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVV
FT                   EWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVSDEFYFELNETL
FT                   AGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEA
FT                   LGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
FT   regulatory      525985..526019
FT                   /locus_tag="Lm4b_00514"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(525985..526019)
FT                   /locus_tag="Lm4b_00515"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(526039..526947)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00515"
FT                   /product="Putative transcriptional regulator (LysR family)"
FT                   /note="Similar to transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00515"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04283"
FT                   /protein_id="CAS04283.1"
FT                   /translation="MKLSNLKYFVDVAMEGSFTRASEKLFISQPTLSRRIKELETELGV
FT                   ELFIRNRHSLELSSAGQQFLIEVNDILNRVNKLSHMFDNQKTADEAGQLLKIGYLSNFN
FT                   MNAMYELLESFKQSHPHVQFSLKPDTPMNLAEGLSNGQYDLVFNLSAYFQPNMSIEEVL
FT                   FIKNHLQIAIPADHRFRKKKKVYFNDLKQEIVILLERKQSPIIVDYVVSQCTKHGFNLK
FT                   ANSYVKDLDEGLAMTSVGEGLAFLYSGMNDGTLEDKYNIKIMDIQEERNDQNIVAAINK
FT                   QSENTLLQELFSFIKSSLLTK"
FT   CDS_pept        complement(527022..528782)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00516"
FT                   /product="Putative acylase"
FT                   /note="Similar to acylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00516"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04284"
FT                   /protein_id="CAS04284.1"
FT                   /translation="MTAKITEKMLFSPSFEYVDNGIEHGVLSPFETKEIILEKGQQIAE
FT                   GFKPLDCSIKMLKDVPVKMRDGITIYTDIYLPITEEKVPTLIAWSPYGKSAGTAPRYKN
FT                   LFNMLGMGNAWNSGLTKFEAPDPAYWCAHGYAVCNPDMRGIAHSEGNTTMIGSQEAEDG
FT                   YDLIEWLAKQSWSNGKTALTGTSYLAFSQWYIAAEQPPHLTCINPTEGLADGYRDLAFI
FT                   GGIPDPNFIERLQINHVSAKNSQREDLTKEMEAYPLADSAIWKDKVADPSKITIPAFVI
FT                   ASYSNTLHTMGTFRSWRSLGSKEKWLRIHDRQEWPYYYDENNVEELRRFFDYYLLGKEN
FT                   NWTDTPTVRYALIDFQGGNQTDLPSEVFPPTNSENKRYYMNGLLRTLQETSTSDDFKVS
FT                   YTTENLPGRASFQMTFDKETHFVGYPKAKLFMEVDGYDDLDVFVWLQKLDKFGNVLSEF
FT                   VVPNHGAALQDFTQEGASALRYKGAWGRLRASMRQLDSQVSTDEIPAYSFDKVEKLSSG
FT                   EIVELDIILSPIGLTYKAGETLRVVVSSKDELGSVMPGTPGCTPNNKGMHILHTSKEHP
FT                   SYIQLPIINK"
FT   CDS_pept        528974..529567
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00517"
FT                   /product="Putative esterase"
FT                   /note="Weakly similar to esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00517"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04285"
FT                   /protein_id="CAS04285.1"
FT                   /translation="MKKLLFLGDSVTDAGRDFENDRELGHGYVKIIADQLEQEDVTVIN
FT                   RGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVIL
FT                   NRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNA
FT                   LAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK"
FT   regulatory      529600..529625
FT                   /locus_tag="Lm4b_00517"
FT                   /regulatory_class="terminator"
FT   CDS_pept        529753..530712
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00518"
FT                   /product="Putative transmembrane protein"
FT                   /note="Similar to transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00518"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04286"
FT                   /protein_id="CAS04286.1"
FT                   /translation="MQKEKAPIGLYFLLIAVMASWGFNVTMTKVLVSYFPTVTMTSFRI
FT                   FTAAITVIIILFITKKLRLPTKREFGLIFLASIFNIVIHHFFLSNGLKLTTGTNAGLIL
FT                   GSAPIVVAIFSVVFLRERIGAWRALGFLAGIFGVSLVVLSNGTGISGISLGDIDIFIAM
FT                   ASQAFSFIIIKKLAGSMDTGLMTGYMLFLGSVMLFGLSRFMEPDGMSELVAVHSWKLWL
FT                   LFVVSAVVATAFGNFVYNYAVGKIGPSRSAIFMNFNPLFSLIGALLFLGEAIKIPQLVG
FT                   FGFIIIGVLLGSGALMDLIYERKKTKVRDPEKLLEKEV"
FT   CDS_pept        530787..531011
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00519"
FT                   /product="Putative YnzC protein"
FT                   /note="Similar to B. subtilis YnzC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00519"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04287"
FT                   /protein_id="CAS04287.1"
FT                   /translation="MKLLLKNINELAAKQKSEGLTAFEKERQAALRQEYLKKIRGTVQD
FT                   NLHHVTIIDPLGDDVTPKKLKEIQAELRG"
FT   regulatory      531026..531054
FT                   /locus_tag="Lm4b_00519"
FT                   /regulatory_class="terminator"
FT   CDS_pept        531178..531627
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00520"
FT                   /product="Putative ribose 5-phosphate isomerase"
FT                   /note="Similar to ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04288"
FT                   /protein_id="CAS04288.1"
FT                   /translation="MEIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVDFPEY
FT                   AAKVGHFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLC
FT                   LGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELEEPEEDK"
FT   CDS_pept        531624..532292
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00521"
FT                   /product="Putative ribulose-5-phosphate 3 epimerase"
FT                   /note="Similar to ribulose-5-phosphate 3 epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04289"
FT                   /protein_id="CAS04289.1"
FT                   /translation="MKMIAASIMCADSLHLADELRALEQANVKMLHCDVMDGVFVENAA
FT                   MGAYVLQDIKNNTDMLLDIHLATVNPDKFVDLYAAIKPAYMSFHVEASPDVDATIKHIR
FT                   ALGIKPSIAISPDTEIEQIYPFLDKVDMVLMMTVNPGFAGQKFQHHVLEKIKKLQRELE
FT                   SHTNKPLIEVDGNIFEETVRLLEPIGADVYVVGTAALFNDKAGSYTEKLAPLREIIQER
FT                   "
FT   CDS_pept        532299..532949
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00522"
FT                   /product="Putative transaldolase"
FT                   /note="Similar to transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00522"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04290"
FT                   /protein_id="CAS04290.1"
FT                   /translation="MHLDSANLEDVKKIQASSIFKGITTNPTILVKEKCNRQTAINRIL
FT                   ELTDKQVFVQTVGFSYEEILADARMLLATFGKEKIAIKIPAHEAGINVIDTLKKEDKTI
FT                   QILGTAIYSADQAIAVALAGADFVAPYVNRMSAANIDPFKEIAGMRHFFDKKALKTQIM
FT                   AASFKHSGQVMQAYESGADTVTIPYEIYSQMTNKVLAVEAIRVFNEDATLYEK"
FT   regulatory      533045..533050
FT                   /locus_tag="Lm4b_00523"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        533058..535118
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00523"
FT                   /product="Putative transcription antiterminator (BglG
FT                   family)"
FT                   /note="similar to transcription antiterminator (BglG
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00523"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04291"
FT                   /protein_id="CAS04291.1"
FT                   /translation="MYLDNRSKTLFQEVIKNPNITNKQLEVKYKLSRYQISYSFQKVNE
FT                   WLKWKNYPEVKRSKNGRFILEPELTALFSEKETRDPSVEYLPSENERANLILLMLLTAK
FT                   EELSLAHFTTKIQVSKNTILRDLKVAQKLLPKETTVTYSRASGYQLAGSEWELRKVLTQ
FT                   VVSSVKEMFRGEHYFLSYSGIEKVQLMEIRRTLEEAEAMMQIKFTYEQIELLPYLLSVM
FT                   FLRIRDRRLIDTAFHIDEKSLSDTREYHITDILLEKTGPVPEQERLFITLQLLTTNIFS
FT                   GEILTEKLTEDLEKVVLTCLDLFEKKALVSLKNKHILIEKLLLHLKPAYYRIKYQMNLE
FT                   DTLYEKFNQEFEALNFIVKEAFDPLAKFIGREIPAGEIFFISLFIGSDMIPQNDIYHKQ
FT                   KRAIVLCPSGVTFSKIMENILVKLFPEIHFYPTISVREYAFFKAEVDIVFSSIPLKDGE
FT                   NVFVVQPFMNDIEKTQLRQHVLQNLFGMGNQLTSIDKIMEVVERNADIKDPNAIRDGII
FT                   DILSANTATDENKRVKKVYLHDLITEDNIMICEDVKNYQEAIRLASQPLLLQQAITANY
FT                   VKTMIDNHKFHDPYIIIGEDIAIPHAMPNAGVNRLAMSLLVVKNGVYFSETEQVHFVIV
FT                   IAPVDKEQHIEALYQIVHLAENHQILDDLLENVTKEKVMQTINQLVIREDE"
FT   CDS_pept        535122..535724
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00524"
FT                   /product="Putative sugar-phosphate isomerase"
FT                   /note="Similar to putative sugar-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00524"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04292"
FT                   /protein_id="CAS04292.1"
FT                   /translation="MDKQAILDNIHQTWQEEANAISRLPEVTSEEALVKTVEKIAECTG
FT                   KIVVAGCGTSGVAAKKLVHSFNCIERPAVFLTPSDAVHGTLGVLQKEDILILISKGGNT
FT                   GELLNLIPACKTKGSTLIGVTENPDSVIAKEADIFFPVSVSKEPDPFNMLATASTMAVI
FT                   ASFDAVIVCLMTYMNYTKEQFSVIHPGGAVGNKLLNK"
FT   CDS_pept        535752..536219
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00525"
FT                   /product="Putative PTS fructose-specific enzyme IIA
FT                   component"
FT                   /note="Similar to PTS fructose-specific enzyme IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00525"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04293"
FT                   /protein_id="CAS04293.1"
FT                   /translation="MDVLEYFKEEMVRFSNEQDKEKLLTEMAEQLCEVGAVKPSYKDAV
FT                   IKREKVFPTGLLTAHAGVAIPHTDSEHVIRPVVAVRILKKPVSFIEMASDNEAIDVRIV
FT                   FMMALRSADEQLDMLQTLIQLIQDEEVMTTLLKAQETGDVLSAIEHFSKNN"
FT   CDS_pept        536236..536634
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00526"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00526"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04294"
FT                   /protein_id="CAS04294.1"
FT                   /translation="MGSFFASFVDWLIGSPGRFVVNLIEDNMLIFMFVVMIYATTILYA
FT                   KWTLAYYLPKKMNQLAEMKTWELDELYAAWQTEKKALPWYILVPSRNEFWVKSARNAPE
FT                   STKLLHFSQQKLKLSDKEKLQKIIEIQS"
FT   CDS_pept        536645..537295
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00527"
FT                   /product="Putative ribulose-5-phosphate 3-epimerase"
FT                   /note="Similar to ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00527"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04295"
FT                   /protein_id="CAS04295.1"
FT                   /translation="MAKIVPSVFGADIGRINEQLEVLEKNGIDLLHVDMMDGSFVPNIA
FT                   FGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIK
FT                   SYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIG
FT                   NRPIQIEVDGGVNAELAKECTLAGADLIVVGSYLFEGDIEANLEKLSKGVLTE"
FT   CDS_pept        537292..538338
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00528"
FT                   /product="Putative polyol (sorbitol) dehydrogenase"
FT                   /note="Similar to polyol (sorbitol) dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00528"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04296"
FT                   /protein_id="CAS04296.1"
FT                   /translation="MKALKLYGKRDLRYEEADMPTIEQPDDVILKVKTVGICGSDISRY
FT                   SKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCR
FT                   KLTVIGARHPGAYAEYIKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDD
FT                   VVVVGSGNIGLLAIQWAKVFGAKRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVA
FT                   AHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSEL
FT                   TVWGSWNAISAPFPGKEWQTTIHFLANKQIKIEPMITHRLSLAEGPEVFERIYERNEFF
FT                   GKVLFFPE"
FT   CDS_pept        538354..538647
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00529"
FT                   /product="Putative PTS system, Galactitol-specific IIB
FT                   component"
FT                   /note="Similar to PTS system, Galactitol-specific IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00529"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04297"
FT                   /protein_id="CAS04297.1"
FT                   /translation="MKKKKIYVCCGTGIATSTVISKKVRAVLDEKRIPYEISQCTVQEV
FT                   ASKVSTSKPDIIVSSTTVTGDVGDVPVVIGRSFLTGLKKQETIDEILAILQD"
FT   CDS_pept        538662..539933
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00530"
FT                   /product="Putative PTS system, Galactitol-specific IIC
FT                   component"
FT                   /note="Similar to PTS system, Galactitol-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04298"
FT                   /protein_id="CAS04298.1"
FT                   /translation="MDIILDFFKYIIGLGVTVMMPIIITILGVIFRKKISVAFKAGLTV
FT                   GVGFVGLGVITSLMLTTITPVTKALVENYNFKLTATDIGWGVGSSLAWGTEVVPFVFVA
FT                   IIATNILMIAFKWTKTMDVDIWNYWQPLFIASALYLTTGSMIIAILSSIINMAIIFKIA
FT                   DWTQKDVENVLGLEGISLPQIQTTGWALVGYPMNWLLGKIPGVRKINWSTEKVQSRLGI
FT                   FGEPMLMGLIIGGGLAAIAQMPLSQVLQTGVTIAASLVLIPRMVSLLMDGLTVISEAAH
FT                   EFMEKRFPGRELFIGLDSAVGIGHPFVLSLGLLMIPITLILAFILPGNKVLPLADLTAL
FT                   PFYMIFAIVPSKGNLFRGIFTGIVIVIITLYLSGAAAPLMTELAGQIGYNIPKDAVEVT
FT                   SLAVGTQWYTWIVYYGLHWFGGIL"
FT   regulatory      539950..539975
FT                   /locus_tag="Lm4b_00530"
FT                   /regulatory_class="terminator"
FT   CDS_pept        540073..541008
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="Lm4b_00531"
FT                   /product="Putative phosphoribosyl pyrophosphate synthetase"
FT                   /note="Similar to phosphoribosyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04299"
FT                   /protein_id="CAS04299.1"
FT                   /translation="MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINI
FT                   EESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARS
FT                   REPITAKLMANLIQRAGADRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLIENYGEK
FT                   DVVVVAPDHSGVVRARRIADRLNAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDII
FT                   DTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQNSKIKEVITSDSIDLPEDKQ
FT                   FDKLTTISIGRILGRAIEGVQENRSLHPLF"
FT   regulatory      541024..541045
FT                   /gene="prs"
FT                   /locus_tag="Lm4b_00531"
FT                   /regulatory_class="terminator"
FT   CDS_pept        541629..542207
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00532"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00532"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04300"
FT                   /protein_id="CAS04300.1"
FT                   /translation="MKKILVPILLLATILASCSSPNEKITKDTKISKTITIRADYKIPK
FT                   DIKELEDNSANIVKVKFLQNKTIGKDGSTISEIEILTSYKGNLEKGSKVDISEPWYLSD
FT                   GKYVAVENYIALDKGQEYTIFLGEKDKDTYPLSSMGYGKFGGSLKEDQAVLADFNILGE
FT                   VQKFDFISENTEEVKNYQLIKEQVAGKYK"
FT   CDS_pept        542314..542994
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00533"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00533"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04301"
FT                   /protein_id="CAS04301.1"
FT                   /translation="MIIDVLQHVPHEGPGLIANWARENQHQLKIHSLFEENAHVPNDSD
FT                   FLIVLGGPMGINDTAEFPWLKDERKLIKRLSEQHKPVFGVCLGAQQIAATFGSEITVNK
FT                   EKEVGWFPVKRTSDKLSFFPESLNVFHWHQDTFALPAGATRLFASEGCLNQAFLYAENI
FT                   IGLQFHFEMEKAGIETILRIDEAFITSGKYVQSVEVMREKDVPEDNKQMLEAILDYLIN
FT                   PKTI"
FT   regulatory      542979..543002
FT                   /locus_tag="Lm4b_00533"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(542987..543010)
FT                   /locus_tag="Lm4b_00534"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(543019..543378)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00534"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00534"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04302"
FT                   /protein_id="CAS04302.1"
FT                   /translation="MEQILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQGLLP
FT                   DGDLQNMVVNIKLALPCDEEKLDEDTIRAIIPYGTVTIEKMAGGMMTTSGIFLEDKEDK
FT                   NDLMYIVNASVETGY"
FT   CDS_pept        complement(543385..543843)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00535"
FT                   /product="Putative transcription regulator"
FT                   /note="Weakly similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00535"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04303"
FT                   /protein_id="CAS04303.1"
FT                   /translation="MNNEQNMNQQIALFYFGYKAFTETADLIIAKHSLKRLHHRILFFT
FT                   ARMPGLTINELLTFLEISKQALHQPLAELKERELLTIEQGRRDKRQRCIFLTTAGKELE
FT                   NELGAAQRKQMAEIFANSSDTDGLHFTEVMEGYAKNRPGAALIKDFKE"
FT   regulatory      complement(543387..543392)
FT                   /locus_tag="Lm4b_00534"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        544225..546054
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00536"
FT                   /product="Putative internalin protein"
FT                   /note="Similar to internalin protein, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00536"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04304"
FT                   /protein_id="CAS04304.1"
FT                   /translation="MKKALKLFLATICMFIMIYPSTAAHAEETNIVNIPDANLKTYLNG
FT                   LLKQASDAPITKTQMNTIQTVTLSGSTYTDLTGLEEAGNLVTLSLNNTNIQTLEPIKNQ
FT                   TSLTYLTVGGDNVKDSLFVDLNGLVNLQSLSISGSEVTHNVFKTFNKLPKLTYLYAQNS
FT                   MKITDISALASLPALTTLLLQFDGIDDFRPLNDFESFKNGNLKALAAFGQNTGRTNPRI
FT                   TLKSGKLDYNETNQTLYLPFSMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSAR
FT                   LSITDDGITVSGVTKEEFDNLDEIEYNARYDFPTGSYPTPPSMNSYTISSGTYDQYFDI
FT                   SHTLDLTADESFDYNQYDATSEEQFLKDVHAETDDGTAVKSDFDQVVKLDVPGEYTVTL
FT                   NAENAAGLKATPVTVKVTVHEKPVITADSQISYKKESTKSVDEFLQEIHSSVTGNAVLT
FT                   SDFDKVVDLNTPGEYTVTLNAINDRGQKADPVTVVVTVTTSDGGHVNPVPPTPEVKPTP
FT                   QEETDPTIIPEPQSENSEDPVKENNAKTEEKANKTSLTTKENKVEKADKAEKTNQPKTK
FT                   ALPQTGDTNKSTLPIAGVMLSLAALLIFRKSKS"
FT   regulatory      546140..546145
FT                   /locus_tag="Lm4b_00537"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        546155..546586
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00537"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00537"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04305"
FT                   /protein_id="CAS04305.1"
FT                   /translation="MEKYHRILVAVDGSEPAKLAFEKGLKLALKLDGVLGIASIVDLRA
FT                   FSPNVSYDGSLEEKAELELKTSVNEYAEKARTAGVKQVETFVAKGNPKILLSTDIPAEF
FT                   QADLIICGATGMNRVEKLVLGSVSSYIMAHAICDTLIAR"
FT   regulatory      546592..546623
FT                   /locus_tag="Lm4b_00537"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(546592..546623)
FT                   /locus_tag="Lm4b_00538"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(546633..548063)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00538"
FT                   /product="Putative encapsulation protein CapA"
FT                   /note="Similar to Bacillus anthracis encapsulation protein
FT                   CapA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00538"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04306"
FT                   /protein_id="CAS04306.1"
FT                   /translation="MKRRTYVIITGLVLIFVAGAFWITNSTNQSDQKATQTEPLKKTSP
FT                   ANVKTISSEAKKTLNSLASSGADKASISDLNQLIKELKSYPVEKNDSGAYLQNLTACLE
FT                   AVKSYTTGKTDEKTLGKVYPAFLASEQKLSAIEKTNQYDWFYAAAATNQQGLKEKGVVT
FT                   LTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCLPWFKSDDYTVINAESAFTN
FT                   ATKAENKKWRIKSDPAHVAFLPASGVEAANLANNHTMDYFQVGYDDTLKAFKENNIPVF
FT                   NTDAPLETTIKGMKTVLLGYDCRMSQQSPAYLERIVKDVKKYKKENTLVIVNMHWGVEY
FT                   RETPTDYQTQFGHAILDAGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLS
FT                   RMTSMFQLRFTKEDNKIVLKDISIVPTYENSDGSTTENNYQPLPVFGDDAKKIVDELNR
FT                   ISKPIEGGVTEYTYFDPF"
FT   regulatory      complement(548146..548168)
FT                   /locus_tag="Lm4b_00539"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(548184..548999)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00539"
FT                   /product="Putative phosphoglycerate mutase"
FT                   /note="Similar to phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00539"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04307"
FT                   /protein_id="CAS04307.1"
FT                   /translation="MKKNIFKLMMALCAVLLIAGCGNSTTADKKETKETKEDGTVTFYV
FT                   VRHGKTMLNTTDRVQGWSDAVLTPAGEEVVKSAGKGLKDVDFSAAYSSDSGRAIQTANL
FT                   ILKESDKSADKEVQTDPRFREFNFGSYEGDLNENMWTDIAKSQGKTLEEWQKAGISPKD
FT                   FADSVAALDKTRVKEGENWPAEDYATIQARLKEGLTDVAKKESKNGDSNVLLVSHGLSI
FT                   GALLDTIEPGYKLPAEGIKNASVTKITYKDGKFTIGDVNDLSYVEKGSK"
FT   regulatory      complement(549245..549265)
FT                   /locus_tag="Lm4b_00540"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(549280..549648)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00540"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04308"
FT                   /protein_id="CAS04308.1"
FT                   /translation="MAILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLAN
FT                   KKVQTLFANQGLYNGFLAAGLVWGLFFAGAGFAETVQIFFLSCVVVAALFGGATSSKGI
FT                   LVKQGLPAVLALVAVLLV"
FT   CDS_pept        549795..551210
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00541"
FT                   /product="Putative multidrug resistance protein"
FT                   /note="Similar to multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04309"
FT                   /protein_id="CAS04309.1"
FT                   /translation="MQQEATGGQKIRPIPIIASFLMAGFIGLFSETALNMALSDLIQVF
FT                   DISSATVQWLTTGYLLTLGILVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFA
FT                   MLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLIL
FT                   ENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTKPKIDILSIILSTLGFGGVVFAFSS
FT                   AGESGWGSATVLVSIIVGGLALGLFVWRQLTMEKPLMDLKVFKYPMFTLGLILVFISFM
FT                   MILSTMILLPLYLQNSLALAAFSAGLVLLPGGVLNGLMSPFTGRLFDAYGPRALVIPGF
FT                   IVAVVALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAI
FT                   MNTLQQVSGAIGTAVAITIMSAGQKAYMETAQGVGPEQMVASLTAGIQNAFVFGLIMAC
FT                   IGLLCSLFIRKAK"
FT   regulatory      551222..551244
FT                   /locus_tag="Lm4b_00541"
FT                   /regulatory_class="terminator"
FT   CDS_pept        551341..552345
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00542"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00542"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04310"
FT                   /protein_id="CAS04310.1"
FT                   /translation="MAIPRDLKELNKKNIKSILRQQGAMTKAEIAEVTGLSVVTVNKLI
FT                   RDLVENEEILEQDNSVATGGRRAVSYEINPNFQQVLVISLQEKWKKITYSFSVYNLLGE
FT                   PEFVEDMSGEDLDITALKRNTKDLVCAFPKISCVVIGVPGIEIGGKLRAMDFPLLLNVQ
FT                   LRETLEAEVNLPVLVETDTNAAILGYKNRPMKEENIVGLYYPERFPPGAGLLMNGEILK
FT                   GQNGLAGEIKHMPLQVDWDNFDFSVDEIKAHIRKMVLLTMSFYDPETIVLYTNFYFGQK
FT                   DFTEELTEELKQVYPYAVLPEIVLSRKFTTDYRIGLLAFGIDYLENNMTDWRI"
FT   regulatory      552360..552379
FT                   /locus_tag="Lm4b_00542"
FT                   /regulatory_class="terminator"
FT   regulatory      552610..552615
FT                   /locus_tag="Lm4b_00543"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        552623..555610
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00543"
FT                   /product="Putative HsdR type IC restriction subunit"
FT                   /note="similar to HsdR type IC restriction subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00543"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04311"
FT                   /protein_id="CAS04311.1"
FT                   /translation="MAEAKFEAALIKKLETEGWTYREDLSNVSIKKLEEHWRDILNETN
FT                   AHKLNGVPLSEIEFGLILQELQRIKTPYDAQLLLVGAGGVGSIPITRDDGSSLEVEIFY
FT                   EDDVAGGRSRYEIVNQVRFDNLPKGLTTKRIIDVALLINGIPVVHIEEKDEHLQNQWRA
FT                   FEQLKGYHGDGLYKGLFAFVQVQVIMSQHSAHYFARPNAFEQYNKTFVFGWRDENNKDI
FT                   TDAFEFIHQVMSIPALHRLVTVNMIPDASNDNIMVMRSYQIQATREILQRMKEMEASGL
FT                   VQKEGGYIWHTTGSGKTVTSFKVAQLLASAPRIKNVLFIVDRIDLIDQTLENFKSFAYA
FT                   HFKNRIKKVNGRELKRELKRKGSSQILLISVQGLTKAVKKGLENDDWNVIIMDEAHRSA
FT                   SGESVKLIKKALKKTTWFGFTGTPNFYSDEINDVKTTREISTHDIFGKRLHTYTIKDAI
FT                   GDGNVLGFDVTYFKPHWVVEHPQEDFSEKDYEKEVYQSDVYRQEVVKDILDNWTKTSSG
FT                   ALIAGKREENAFQAMFAVSGKQAAVNYYNIFKSKGSHLNVAMTFSRDESNEHGTKEQNE
FT                   ALKNAIKDYTEKFNVASILDAKDPARAYMLDITKRLARKRPYNQGKEEDRLDLVIVSDQ
FT                   LLTGFDSKFINVIYMDKMLKEGMLIQAISRTNRTFDLNSKPHGKVRFYRQGDEMREFVE
FT                   NALRIYTRGGNDTLQEAEEETKNQLPKDLENDDILAKPQSHQINELEEAILRLKELAGD
FT                   DFSQVPRGQNDLKEFVGLALTTQTKIQQLIQQGYELGSEIEELNEQGEATGRMVRLNIS
FT                   SIDEFGALQARLYDAKEKLPPEERPDLTEIKIGIEFYHHEIIDYDMLVELLNTFMDEKN
FT                   KSNKDAIEKHIVPMDEESQHEIHGIVDDIEAGHITEHFTTDSLQETRKKYRTEHRELKV
FT                   RRWAANQKVNGNRIVEAFDLFLPGHTLIDNPKLADIVREIEEEENIGFFEASDFEEELM
FT                   AFFNSL"
FT   regulatory      555642..555647
FT                   /locus_tag="Lm4b_00544"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        555658..557247
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00544"
FT                   /product="Putative HsdM type IC modification subunit"
FT                   /note="similar to HsdM type IC modification subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00544"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04312"
FT                   /protein_id="CAS04312.1"
FT                   /translation="MALSTEQKTKMWAMLNQTRGQIGLTAYKDYIFGILFYKYLSEKAT
FT                   HWLNGVLRGENWESVYSQDSVKALNYMKKNLGYAIQPNEFFVDWKKAIDTDRFNIGMMT
FT                   DTFTHFNQQIAFEAKNDFEGIFDGMRFDSADLGANAQARASVMISMIELLSSPEFDLSG
FT                   SNDTVSDIYEYLVAQFATVLASDMGQYYTPKEISNVMARILTFGREDMEKFSIFDPTVG
FT                   SGSLLLTTASYMKNSGRRGVIKYYGQEKDATPYRLSRMNLMMHGIEYNDININHADTLE
FT                   SDWPDGVVDGKDTPRMFDAVMANPPYSAHWNNKDREDDPRWREYGVSPKTKADYAFLLH
FT                   CLYHLEDNGRMAIILPHGVLFRGASEGRIRKALIDKHQIEAIIGFPEKLFLNTPIPVCV
FT                   VILRKNRIESDVLFVDASKGFEKIKKQNNLRSEDVEKIVDTVINRKEIEKYSHVATLDE
FT                   IKENDYNLNIPRYVDTFEEEEAIDLVALGNEMVALNADIKKAETDFLGLLDELAVTADT
FT                   KEIIEATKAVFR"
FT   regulatory      557231..557236
FT                   /locus_tag="Lm4b_00545"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        557244..558488
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00545"
FT                   /product="Putative specificity determinant HsdS"
FT                   /note="similar to specificity determinant HsdS"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00545"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04313"
FT                   /protein_id="CAS04313.1"
FT                   /translation="MKKLEKSVPVIRFKGFSEAWEQRKLGEIANSFEYGLNASSKTYDG
FT                   ENKYIRITDIDESSHVFNQDNLTSPDISLDNLNHYLLEEGDILLARTGASTGKSYCYNK
FT                   IDGKVFFAGFLIRAKIKHEYNVSFIFQSTLTERYNNFIQVTSQRSGQPGINAQEYARFA
FT                   LYIPKLKEQQKIGDFFKQLDDTIALHQRKLDTLKQMKKGLLQQMFPKSEEDVPKIRFAD
FT                   FDEEWYQRKLGEISDKVIEKNKESTYFETLTNSAEYGIISQREFFNKDISNEKNLNGYY
FT                   IVRENDFVYNPRISNYAPVGPIKRNKLGRIGIVSPLYYVFRTFDTNQSFLEYYFDGTVW
FT                   HNFMLLNGDSGARADRFAIKDSVLKEMPIPYSTLYEQEKISFFLDEITIIINLHQNKLK
FT                   KLSSLKKAYLQNMFI"
FT   CDS_pept        complement(558528..559457)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00546"
FT                   /product="Putative bacteriophage integrase"
FT                   /note="similar to bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00546"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04314"
FT                   /protein_id="CAS04314.1"
FT                   /translation="MKAKKRKEQTFHEYFKEWVDLYKVGAIRSITLQKYYVTEQKIQEL
FT                   VPELKIKDLDRYTYQQLLNNYALTHEKQTTMDFHHHLKGAILDAVDEGVLNQNPTRKIV
FT                   IKGKNPRPKKAKFLNQFEVQVLLKELNLKEDINWDWFILLIIKTGLRFSEALALTPSDF
FT                   DFSTQKISINKTWDYKMVTGSFQPTKNESSNRKIQIDWQLAMQFSQLIKMKDSDKPIFV
FT                   KSRVFNSTINNRLKVLCQNANIPTITIHSLRHTHASLLLFAGVSIASVANRLGHSSMTT
FT                   TQETYLHIIQELENQDNDKIIRHLSMLM"
FT   regulatory      complement(559464..559469)
FT                   /locus_tag="Lm4b_00546"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(559542..560744)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00547"
FT                   /product="Putative specificity determinant HsdS"
FT                   /note="similar to specificity determinant HsdS"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00547"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04315"
FT                   /protein_id="CAS04315.1"
FT                   /translation="MLPLFYVISHYSNLPFRAWEQRKLGDLVVDYVEKTSVQNQFPMLT
FT                   SSQQKGIVLQEDYFANRQVTTENNIGYFVLPRGYFTFRSRSDNDVFVFNRNDIIDRGII
FT                   SYFYPVFTLKSADSDFFLRRINNGIQRQLSIQAEGTGQHVLSLKKFKNIVAMFPSEGEQ
FT                   KKIGSFFKQLDDTIALHQRKLDTLKQMKKGLLQQMFPKSEEDVPKIRFADFDEEWYQRK
FT                   LGEEFEKINERNDGSFGKTHWISVAKMYFVEPNKVLSNNIDTRTYVMRKGDIAFEGHSN
FT                   TDFKFGRFVANDIGPGIVSELFPVYRHKTNYDNNYWKNAIQLEHIMAPIYSKSITSSGN
FT                   SSNKLDSKHFLNQKIYIADFEEQEKIGSIFKQLDNTIILYQNKLNKFDILKKAYLQTMF
FT                   I"
FT   regulatory      complement(560735..560754)
FT                   /locus_tag="Lm4b_00548"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(560751..560756)
FT                   /locus_tag="Lm4b_00547"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(560791..562107)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00548"
FT                   /product="Putative 6-phospho-beta-glucosidase"
FT                   /note="Similar to 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00548"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04316"
FT                   /protein_id="CAS04316.1"
FT                   /translation="MTKGIKIATIGGGSSYTPELIEGFIKRQDELPVRELWLVDVEAGR
FT                   EKLEIVGNLAKRMVEKAGVDMEVHLTLDREEALKDADFVTTQLRVGLLDARVKDERIPN
FT                   SYGVVGQETNGPGGMFKGLRTIPVILDICKDMERLCPDAWLINFANPAGMVTEAVLRYS
FT                   NQKKVVGLCNGPIGIERNIAETLGVDVSEIYVEFVGLNHMVFAKTVYHNGKDVTKDVVF
FT                   KMTEDEAGSSLKNINATGWDKTFLRTLNMIPIDYLRYYWQTKQQLEDQARAYAEHGTRA
FT                   EVVKKVEAELFELYKQEELAEKPKQLEQRGGAYYSEAACNLINSIYNDKRDIQIVNTRN
FT                   NGAILDIDPDSAVETNCVITRQGPIPLASGRLPIAINGIIQEIKTFERLTAEAAVTGDY
FT                   DKALLAMTINPLTPSESVAREMLDELLEAHKEYLPNFFK"
FT   CDS_pept        562309..563061
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00549"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00549"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04317"
FT                   /protein_id="CAS04317.1"
FT                   /translation="MLFLDKNLELNDTELDIYNYIVANLDKVVYMRIRDLATEAHVSTT
FT                   TILRFCRKFGCNGFSEFRVKLQLYLEEQKLAQIDMADETTYIDFLKRTAQPEFKAQIQN
FT                   AVEILRDRELVLFAGVGSSGVIAEYGAIYFSSLFTLALHIEDPLNHPFYHLSSKLSDKI
FT                   CMIAISVEGENEDIIRYIHQLKAQNCKVISITNSAKSTIARLSDANIAYYINKEMYQEA
FT                   NITSQLPALYTIENIAREIRTQIDKEKM"
FT   regulatory      563070..563095
FT                   /locus_tag="Lm4b_00549"
FT                   /regulatory_class="terminator"
FT   CDS_pept        563168..563611
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00550"
FT                   /product="Putative YybC protein"
FT                   /note="Similar to B. subtilis YybC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04318"
FT                   /protein_id="CAS04318.1"
FT                   /translation="MYSNRKEKVVFTLIMCSLMILCMSSYNIFLENGIGANSFMIILKA
FT                   FVPFLFIGFLLDFFVVGKIVYRLHAHLVSEDASKFKKIIMMQLLMVTFMCVLMSTLSLI
FT                   VNQGEWSHLGILILRNYFVALFLQIFIVSPFVRLISPRIFALL"
FT   regulatory      563622..563651
FT                   /locus_tag="Lm4b_00550"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(563622..563651)
FT                   /locus_tag="Lm4b_00551"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(563657..565318)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00551"
FT                   /product="Putative sulfate transporter"
FT                   /note="Similar to putative sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00551"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04319"
FT                   /protein_id="CAS04319.1"
FT                   /translation="MFKHILLSLNGYKISYLRNDVISGVGVAALTIPVAMGYAQVAGLP
FT                   PIYGLYASFLPVIAYVIFASSPQLVFGIDATASAITGSIILGTAGLAAGSKEAIALAPI
FT                   LAFFCAIFLVLFSVLKLGRFAKYISAPVLSGFISGLSVSIIMGQIPKIMGLKESGDSFF
FT                   SSLGIIFGQFFQSNWISFAMGVVTVIIVITCKKVIPKIPMSLVVLVLGTMAAYFFKLDQ
FT                   YNVDIVGKIPVGFPSLALPDFGASSWALAIGGGLVCAIATFAGSLLPSESFAMRNKYTI
FT                   DDNRELFAYGISNFVAAFSGCSPASASVSRTAANEQFRGKTQMVSIVAATIIALIVAFL
FT                   SGLLYYMPQPVLSGIVFAALVGIIDVDVLKGLFKVSRREATVWIVAALGTLLVGVIFGV
FT                   LLGIFLSFINVVSRSMKSPIAILGVIEGRHGYFDLKRKPEAKPIPNVVIYRYSASLFFG
FT                   NFNKFADGLKEAVQDDTKLVIFEASAIINIDTTATESMKDLLKWLDDKGIEYYFADLID
FT                   HLKTSFRKHDLGYIIDNGYTKKTVEDALEAYYAEHK"
FT   regulatory      complement(565425..565451)
FT                   /locus_tag="Lm4b_00552"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(565458..566198)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00552"
FT                   /product="Putative transcription regulator (MerR family)"
FT                   /note="Similar to transcription regulator (MerR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00552"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04320"
FT                   /protein_id="CAS04320.1"
FT                   /translation="MQIKELAELTGVSVRTLHHYDKIGLLVPQKDDRNGYRIYSENDVD
FT                   KLQQILFFKELDFPLKKIKQILDDPFFDKNVALDLQRHLLIEKKQRIETMLATLDQTIR
FT                   NEKGEITMTNKEKFTGFDFSTNPYEEEAKKRWGDKVVEKANEKVNNMNEKEKLTLKESF
FT                   DAEFRHLASVRELSPESEEAQLAIDHFFHYLNDTHGNIYSLEAFADLGEMYVADERFTK
FT                   NIDQFGDGLSHFLKEAMNIYAKNK"
FT   CDS_pept        566428..567903
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00553"
FT                   /product="Putative Transmembrane protein"
FT                   /note="Transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00553"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04321"
FT                   /protein_id="CAS04321.1"
FT                   /translation="MIGKVKSISMWLWHHLTPQIFAVICVFIITLIALFVPPYIGMADN
FT                   GDFFRIFSSNGLFVNNTNYDALQFGHFVKEFGIYQYFNENQVAIYSSQSIFIQMALLLN
FT                   KLFWSTTVFDVRFLGGLQLALLLPAIYLLVAGLTAKMKGWPGYVVAALTVFIFADTAYT
FT                   AYFNSFFSEGLILIMMLYISAGFLLLYQHKYNDYAMLGLIFVASLILITAKQQNAPIAV
FT                   VIAVCGILVFFIRKNRAFRISAAATFFVIFLSGVVMYAFIPGEFVTINQYQTMTRGVLL
FT                   DSENPEKSLEEMGMNSEFALLKGTNFYQKYKMIDLDSKLMEKEFYPNYNFVTVLSYYLE
FT                   NPKQFGKMLDLSAQNSFSIRPFEMGNFEKATGYKFKEKTHFFSIYSDVKEKLAPAKFTF
FT                   LILWALVFLICYGVSAFKHFREKNIRGMLLFDLVVLLIGSGFAVILVTIVGDGEADLTK
FT                   HNFLFNVCFDLTMLIGAASLLEVYMKKRGERNA"
FT   CDS_pept        567896..569392
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00554"
FT                   /product="Putative Hypothetical secreted protein"
FT                   /note="Hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00554"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04322"
FT                   /protein_id="CAS04322.1"
FT                   /translation="MRKKLIVSILLAFMIFVVGGHSAIAKSDDGVVVFYDSLATGTENE
FT                   GNMDALLRMLNSLGKRVTIYSWEENPDLSQTSEIIVLQNKKDGLSNKWTNKLAKSKAKI
FT                   AYIGGNPPTFLTDKLQLKTKAITEASITIQTQAGLSGKPQLVNETNLITSYKGTSFGEM
FT                   DAAENGQAAYGVQAGNYAYAPLFQADNTSEFALMDVLKALFDIKTTTNQYAFITGVNPF
FT                   IDFDLLKKTADTFYEKGIPFIVSAGPVFYNQDFQAAKNYAEILRYVQAKNGTIMMNVPA
FT                   VTYGDSPAGELEKIMQKSVHFFAENDVAPLGVTAELYWNFDKVYGVEGFAPFNTGILLP
FT                   NQKIIHTTKVNNGSAFEKSPYSVANDFYATTTEGRTFPVDIAITYPFFDNEKELKAAAE
FT                   ELANDNISDFRFQDHGVKTNKDTIESSAGSLYINNQSVTLDGDLNYIKTKNKTVKQAGS
FT                   LEGFFGYQNTFFTIVIVLSLGIIGVLFVFGYRLYMKKYMK"
FT   CDS_pept        569403..570653
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00555"
FT                   /product="Putative glucosaminyltransferase"
FT                   /note="Conserved hypothetical protein similar to putative
FT                   glucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00555"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04323"
FT                   /protein_id="CAS04323.1"
FT                   /translation="MVIADYLALFAVVCIWGLLLINIVLIVAGYVYYLKNEARKVPEIP
FT                   AEVPFVSVMVPAHNEGKVIVKTVESLLAFDYPVDRYEIIVINDNSSDNSSELLAAIQAK
FT                   NPTRFLKIINTDNITGGKGKSNALNIGFAESRGELVAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRNASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEEIGGWDVKAVAEDTEISFRIYMMGYRIKFQAKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDVLLVLYALGLVHTTLAG
FT                   LSGALWLLAILLFVAGTFITLTTEKGEISFSNLLFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTVLKRETKWYKTERF"
FT   regulatory      570656..570661
FT                   /locus_tag="Lm4b_00556"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        570669..572720
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00556"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00556"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04324"
FT                   /protein_id="CAS04324.1"
FT                   /translation="MKKLTVIGLLMFAVLFLYRPDVLAADKNYQTVFGTDKTAQGKFTT
FT                   TKQNFTVENYWDVSNANVKLVYTITQLSEKEVSTMTLKINDVAFYSFKPDKADKGTKQI
FT                   EIQIPKDKLKKGVNVLSIESFVYTDLPDGRCTIDDTPANWLQFDKTSAVNVSYSDKAFQ
FT                   KTIAEFGERFTGIDTVKSEQGAVAVSNKAGDAELGAALEGLSGFSAANTLEDKNIAFGQ
FT                   YEEAKTRDGKNYLVLFSSYDNLPNDLKSQIKDDNKLEKQALFQVVTVGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNTKWLTTDEKIDTPATNVDKNTKLTTTGDKLKGIGHI
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLTAKKANGD
FT                   KLTFQIPSDLNVKGDFSVTVAFDLVLTNNYCGFIADSEIPWAYITPESKINLNTSEETD
FT                   LLFEQYPYPFIANGDFNNAVVVVPDKLTTEDTDSLANIFNLLGRFHDGNRGDLTAVHAA
FT                   NWKKPKEGSNIIAVGTMNNNPVIKNANDDLYFQYNKTGDYFLSNEKISIEKNYGKQLGS
FT                   VQLITSDGVPILAVTGPGAKQTELGSDLIATKANLAKIYGDGAIVDTDNTIHSYRFKKA
FT                   ADTQEESFGSKISNNKEVTVFGAFALLTVVILVVAVLLILRKYRRSRK"
FT   CDS_pept        572735..573589
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00557"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00557"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04325"
FT                   /protein_id="CAS04325.1"
FT                   /translation="MKKITNNLFADIGFLFFILLCFITIGFMINTPDEYLRNIILLNIT
FT                   FLLVIITYFTNLTLGLILNVLYIFIYATYIIYEIVANQIAYGFGSYFWLIITPLFTVAS
FT                   AMFTRNTSRLQEENTKIKQQNLYLGTIDQETLLKNIVSFQNDERIFSSISRRYDLPLSL
FT                   MVIKVRHWRELKRFQSEEEMRLALQDISAILETCIRTSDVLYLLDKDDATWGLLLLTDE
FT                   PGGKLVADRIKSRIAEANTEEFAAKYRVKLELRIGTSQFDSEKVKTPLDFIDLATKELE
FT                   YDV"
FT   regulatory      573594..573627
FT                   /locus_tag="Lm4b_00557"
FT                   /regulatory_class="terminator"
FT   CDS_pept        573649..574479
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00558"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00558"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04326"
FT                   /protein_id="CAS04326.1"
FT                   /translation="MNLEEIVDCMLLNENDKEIQRTQTEHRIKLVDFWQVKNGDRVLEV
FT                   GCGQGDTTAVLANAVGASGFVQGIDIAPRTYGAPFTIGDATDHLQKSKLGAQIDFKLGT
FT                   DILNGDITFPENAFDVAVLSHASWYFSSKSELTIMLELLSKWAKRVCYAEWDTRITDVK
FT                   QTSHMLAVLTQSSYEAFKQDTQSNIRTFITPIDMQEIIQEHNWKMGAETSIFSEKMQDS
FT                   RWEIGYVKDFITKELEADLGLPEKFKAFLLSQSKLITLENSLPMASYCTSWQVK"
FT   CDS_pept        574557..574826
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00559"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00559"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04327"
FT                   /protein_id="CAS04327.1"
FT                   /translation="MRAVLTVIGKDNVGIVAGVSNKLAELNINIVDVSQTIMDGYFTMM
FT                   MMCDISQITKEFDEVKAELAGKGEDLQVKIHIQREEIFNAMHKL"
FT   CDS_pept        574845..576200
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00560"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04328"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L051"
FT                   /protein_id="CAS04328.1"
FT                   /translation="METNQILETIRMIEEEKLDIRTITMGISLLDCMDGDGEVARKKIY
FT                   QKIVTKARNLVAVGEAIESEFGIPIINKRISVTPIAIIAGSSADTDYVEFAKTLDAAAK
FT                   EVGVNFIGGYSALVQKGYTKGDEILIRSIPQALAQTERVCSSVNVGSTRTGINMDAVRQ
FT                   MGEVIKETADLTADTQGLGCAKLVVFANAVEDNPFMAGAFHGVGEADCVINVGVSGPGV
FT                   VKRAIEKVKGEPFDIVAETVKQTAFKITRMGQLVGQVASEKLGVPFGIVDLSLAPTPAI
FT                   GDSVAHILEEMGLEMVGTHGTTAALALLNDAVKKGGVMACGHVGGLSGAFIPVSEDAGM
FT                   IEAVQQGALNLEKLEAMTAICSVGLDMIAVPGDTTAETLAAMIADEAAIGVINNKTTAV
FT                   RVIPASGTKVGDMVEFGGLLGTAPVMPVNGKSSVDFIARGGRIPAPIHSFKN"
FT   regulatory      576208..576234
FT                   /locus_tag="Lm4b_00560"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(576208..576234)
FT                   /locus_tag="Lm4b_00561"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(576240..577208)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00561"
FT                   /product="Putative transcription regulator (LacI family)"
FT                   /note="Similar to transcription regulator (LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04329"
FT                   /protein_id="CAS04329.1"
FT                   /translation="MANIQEIAKLAGVSSATVSRVINKRDYVSDETRKRVQTIIDQLDY
FT                   VPNINAVSLKKGATKLIGMVIPSFTDSLNVFLKSFTMIAQEHGYNVTLFMTRIDPDKEL
FT                   EALEMLRQKQIDALVLVIRSNDWKTIEHYTKYGPIVTWQRVESEKIPSVFMNQYDGYTL
FT                   ALEHLYAKGYRKFVNVYGNTTGLNTQSRMLAFKDFCARYELDPHEFRQFYGQGSRQDGE
FT                   KIAHWFAETEHKPDAFLTPNDYFAAGLLTEARRLGYSVPEDFAICGFDNMEIAHLLDIT
FT                   TIHYPVNLQAENAFTLIMNQLFGSNLPLLDLDFHLVERKTT"
FT   CDS_pept        577380..578702
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00562"
FT                   /product="Putative 6-phospho-beta-glucosidase"
FT                   /note="Similar to 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00562"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04330"
FT                   /protein_id="CAS04330.1"
FT                   /translation="MKKGVKIVTIGGGSSYTPELVEGFIKRYHELPIRELWLVDIEAGR
FT                   EKLEIVGNMAKRMVKAANIDCEVHLTLDRREALKDADFVTTQFRVGLLDARIKDERIPL
FT                   SHGIIGQETNGAGGMFKAFRTIPVILGIVEDMRELCPDAWLINFTNPAGMVTEAVLRYG
FT                   NWDKVIGLCNVPIGAVKSASDVLEKPEEDLFFKFAGINHLHWHRVFDKDGTELTEKVID
FT                   GLYAPDANPGKVVENIKNMRFLYEQVKHLKMLPCPYHRYYYMTDAMLEEELASFKNEGT
FT                   RGEVVKKLEDSLFELYKDPNLDYKPEELSKRGGAHYSDAACEIINSIYNNKGTVMVVST
FT                   RNNGTIDDVPYDSAVEITSVIRAHGAEPINFGKFPPAQRGLLQVMKSMEELTIEAAVTG
FT                   DYATALQAFTSNPLVPSGDLAKTILDEMLEAHKEFLPQFAK"
FT   regulatory      578710..578734
FT                   /locus_tag="Lm4b_00562"
FT                   /regulatory_class="terminator"
FT   regulatory      578792..578797
FT                   /locus_tag="Lm4b_00563"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        578806..580077
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00563"
FT                   /product="Putative N-carbamyl-L-amino acid amidohydrolase"
FT                   /note="Similar to N-carbamyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00563"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04331"
FT                   /protein_id="CAS04331.1"
FT                   /translation="MQTNLERIKKHIEKLDTYTATPGQGTTRFTYSKEDLDARNYLKQE
FT                   MAKVGLAVSEDAIGNIYGRLEGENPNLPAVIVGSHFDSVPNGGAFDGPAGVITGLEVAT
FT                   VFYEQQIKPHFPLEIIAMVEEEGARFGAGLLASRTITGKVTKEMLHEMKDIDGITAAEA
FT                   MAKVGFDANQVVTAIRTKESVKAFIELHIEQGPVLENANEDVALVDTVVGLTEIKVTVK
FT                   GQAGHAGTTPMLDRKDALITAVEILGQLPELAIQEGGGTVLTVGKLNVYPNGANVIPDK
FT                   VVFTVDIRAKDEIHVQNTLAKTKEIIQSAEKNGITCEIEDMLYEPPTHLSKEIHQALTE
FT                   SADQLGLKYRTMVSGAGHDAMIFAGLTEVGLIFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLETVKKWTEESANESENKTSSFK"
FT   CDS_pept        580043..581218
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00564"
FT                   /product="Putative N-acyl-L-amino acid amidohydrolase"
FT                   /note="Similar to N-acyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00564"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04332"
FT                   /protein_id="CAS04332.1"
FT                   /translation="MNQKIKQAVLNNEEAMIAFRRDLHMHPELQWQEFRTTDKVAKELD
FT                   KLGIPYRRTEPTGLIAELKGGKSGKTVALRADMDALPVQELNQDLPYKSTEDGKMHACG
FT                   HDAHTAMLITAAKALVEIKDELPGTVRLIFQPSEEIAEGAKAMIAQGAMEGVDHVFGIH
FT                   IWSQTPSGKISCVVGSTFASADIIQIDFKGQGGHGAMPHDTIDAAVIASSFVMNLQSIV
FT                   SRETDPLDPVVVTIGKMDVGTRYNVIAENARLEGTLRCFNNITRAKVAKSIEHYAKQTA
FT                   AIYGGKAEMIYKQGTQPVINDEKSALLVQETITESFGEEMLYFERPTTGGEDFSYFQDE
FT                   APGSFALVGCGNPEKDTEWAHHHGRFNIDESVMKNGAELYAQFAYNYLNQN"
FT   regulatory      complement(581227..581256)
FT                   /locus_tag="Lm4b_00565"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(581267..582283)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00565"
FT                   /product="Putative tagatose-1,6-diphosphate aldolase"
FT                   /note="Similar to tagatose-1,6-diphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00565"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04333"
FT                   /db_xref="GOA:C1L056"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L056"
FT                   /protein_id="CAS04333.1"
FT                   /translation="MVQITKGKFDGLQRLSNEKGVIAALAIDQRGSLKKMIQQAKGTEN
FT                   KKDVEDFKQLVSEELTPYASAILLDLEYGTPAIKARHEGSGLLTSYEKTGYDATTPGKL
FT                   PDLIEDLSALRIKENGGDAVKILVYYDPDEPAEINEIKYAFLERIGAECRAVDIPFFLE
FT                   PITYDATVTDSGSLEYAKLKPAKVKASIKEFSKPRYGVDVLKLEVPVNFKYVEGFAEGE
FT                   VAYTQDEAARHFEECSDLSPLPFIYLSAGVTSEMFHKTIQFANQHNVQYSGVLCGRATW
FT                   ADGIEVYGKQGDDALREWLRTQGKENITSLDKLLDEGAVPWWTKYGSFEDVHVVEKQ"
FT   CDS_pept        582520..583713
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00566"
FT                   /product="Putative penicillin-binding protein"
FT                   /note="Similar to penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00566"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04334"
FT                   /protein_id="CAS04334.1"
FT                   /translation="MNRRERRKHKRRKNMIIVLSTVFLLFIATSWMIYEFKSKQEQTVS
FT                   APTKKKAATATNPPENAATNEPEETKEPEPVEEKPKETIVKNQEIDNYLQKIGFSGSAL
FT                   VVRDGKTIIQKGYMYANRDEKVLNTPDTLFYIGSSQKAIIATALLQLEEKGKINTNDPI
FT                   SKYIPDFPNGNKILVKNFMNHTSGIVGRPKLTSNMTPDQIIKAIEKRGIKSQPGKWDYL
FT                   DANYAVVGYLVEKVSGQPLATYLQENIFTPAGMKHTGYYQKDVDGGKNVSTGYKIDENG
FT                   VFQSPKLADLTKLYGAGDISMSTTDMYLFDKALMDKKLISEASLKKMFTSGSKSTYGMG
FT                   FYVDPGSYNSHGVVTGWDVSNSVSHTGRTYVILFSNVQNHIASFGKVNNDIYGFLNK"
FT   regulatory      583723..583744
FT                   /locus_tag="Lm4b_00566"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(583723..583744)
FT                   /locus_tag="Lm4b_00567"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(583754..584674)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00567"
FT                   /product="Putative ABC transporter (binding protein)"
FT                   /note="Similar to ABC transporter (binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00567"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04335"
FT                   /protein_id="CAS04335.1"
FT                   /translation="MYQKHKWAAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVTDT
FT                   MDRKVEVPTTPKRIVALQNVSEMEILGVKPVGTTDYYITTYPEATKGTESVGNDKPSIE
FT                   KIANLKPDLIIISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNIANLLNKKAEKEKWD
FT                   KDYAASSKEAKATLKDAGVANEKAAVIQFYGKEIYVHDAKVFDGLYSGAGFTPTDAAKA
FT                   NKETKAISSEAIPEYAAGADRLFILMPADGNTDSVDEMLKGVWKDIPAVKKNQVYKVDN
FT                   TKWSDYSASAQLYQMEDAVKQITGK"
FT   CDS_pept        complement(584785..585135)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00568"
FT                   /product="Putative PTS system, glucitol/sorbitol-specific
FT                   enzyme IIA component"
FT                   /note="Similar to PTS system, glucitol/sorbitol-specific
FT                   enzyme IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00568"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04336"
FT                   /protein_id="CAS04336.1"
FT                   /translation="MTISKIMEIGPLVPAFEEEKIVILFGPTATNELREISVIHEFQDV
FT                   PNNALTKGNTLLIGEQAYTIEEVGSDANKNLEELGHISVYFRSGQNEVLPGAIVVSPEI
FT                   FPTITVGDSIQF"
FT   CDS_pept        complement(585154..586140)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00569"
FT                   /product="Putative PTS system, glucitol/sorbitol-specific
FT                   enzyme IIBC component"
FT                   /note="Similar to PTS system, glucitol/sorbitol-specific
FT                   enzyme IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00569"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04337"
FT                   /protein_id="CAS04337.1"
FT                   /translation="MYQSIHVNKGQGGWGVGLDITPSEPRTKVVSITGGGIHPVALKIA
FT                   ELSGAEAVDGFKNSIPEEEMMCVVIDCGGTARIGVYPMKRIPTVDVLPSSPSGPLAKHI
FT                   TEDIFVSGVKPEDIEVRDRSTEPGKPFDREKFKEDYAKIKEDQEEASQLKEGFLVKFSR
FT                   GIGKAMGVFYQAGRDSVDMLIKNIIPFMAFISMIIGIINYTGIGKLIANTLSPLAGSLW
FT                   GMLLIAFICSLPFLSPILGPGAVIAQVIGVLIGSQIAIGAIPVTYALPALFAINAQAGC
FT                   DFIPVGLSLAEAKPKTVQFGVPAILYSRMITGVLAVVIAWVFSIGMY"
FT   CDS_pept        complement(586161..586682)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00570"
FT                   /product="Putative PTS system, glucitol/sorbitol-specific
FT                   enzyme II CII component"
FT                   /note="Similar to PTS system, glucitol/sorbitol-specific
FT                   enzyme II CII component"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04338"
FT                   /protein_id="CAS04338.1"
FT                   /translation="MNYIEWFGTNFIGLFEAGGKQFVSFMTGIVPLLIVLLTFTYSIIA
FT                   FIGEERVNRAIQFSAKNMILRYTLMPVLSVLMLTNPMAYTFGRFVKEHQKPAFYDSVVS
FT                   FLHPVTGLFPYANAGELFVYLGIANGVVEAGYSMSSLAVRYFLAGIVVILMRGVITESI
FT                   TKFLMRKEKV"
FT   CDS_pept        complement(586707..587087)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00571"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04339"
FT                   /protein_id="CAS04339.1"
FT                   /translation="MNIVLIASLIFIAQTGLAFFQVRYYQHHMNKVADKYAGKTGYYLY
FT                   SEMERLKFRTSAVAILVVNENRVVHECQILTGKTVFAKFKTFTNYHHKDLSEILTDLSS
FT                   KNKNTIQEKAIIKTVNSCMKAL"
FT   CDS_pept        complement(587142..588392)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00572"
FT                   /product="Putative NAD(P)-dependent oxidoreductase"
FT                   /note="Similar to putative NAD(P)-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00572"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04340"
FT                   /protein_id="CAS04340.1"
FT                   /translation="MTLYRQLLARENENNPIRVGVIGAGQMGFGMISQIAAIPGMSIVG
FT                   ISDIHVEAAQKAADAYNATATKKEKILLSNDFKEIIHSDLVEVIVDATGVPEVGAKISL
FT                   ETLLATKQLVLLNVEIDITIGPLMKKLYDSAGLVYTGSDGDEPAAITELYEFSKSMGME
FT                   VLVAGKGKNNKLKISANPDSCQAEADGKNMASHMLAAFQDGTKTMAEMNLLSNAIGYVP
FT                   DVVGMHGISGDVDSVIKDLDLKDQGGILNKFGVVEYVDGLAPGVFVIVKGQNEGVSHEL
FT                   SYLMKKGDRDHHILYRPYHLASLETPLTIAKAVLNHDHAIVPMGAPVSETVAVAKKDIA
FT                   AGEKLDGIGGFCVRGVLETHVDMATNGHIPIGLISGEVVARRNIKAGTFITDEDVSLDE
FT                   STTVWKLRKLQDETFNK"
FT   regulatory      complement(588589..588612)
FT                   /locus_tag="Lm4b_00573"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(588650..589597)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00573"
FT                   /product="Putative DeoR transcriptional regulator"
FT                   /note="Similar to B. subtilis DeoR transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00573"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04341"
FT                   /protein_id="CAS04341.1"
FT                   /translation="MKWEEKRDMVKIATWYYHYGWTQAQIAKKIGISRSIISKTLQRAK
FT                   DLGIVEIFIKDETYYTVDLEQKLEEKFGLEEAIVVATHDMSEEEALNFLAKEAAYTLSK
FT                   RIAKVKTLGISWGKTIRKFANEFPFIPHKDLTIIPLIGGMGSSDIDLHSNQICYDLKKK
FT                   MKCHSKYLYAPALVEDTEMKTDLSKNKYISEVLEEGKTVDMAIVGVSSPYNHSTMEEIG
FT                   YINSEDIEELRYKDVVGDINSRFFTADGKEAKTEINTHVIGLSLEELKNIPTVVALANG
FT                   LQKKEALVAALNAGLIDVIVITDRMAEYILQKND"
FT   CDS_pept        589965..590630
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00574"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00574"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04342"
FT                   /protein_id="CAS04342.1"
FT                   /translation="MEKLFTYKEFVDMMQKYGIRHTKRKLRRGENLMENASKFSNVVLL
FT                   IDGYISSYTYESPEKLLSIFEPGIFLRYSILEDQPEFVTNIALSDNCEVYEYKKEDIEY
FT                   ALTLFPENFGFQYFFLKRIGRHLYYRALLNGKEHKDKLYYAMKYLGELIGKTDENGNVS
FT                   LPPEVTLKVLIEYSTLSKAAFYRQRIHLLEQEILKPHENTFIVQKKVASHYEDQLTSI"
FT   CDS_pept        590648..592672
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00575"
FT                   /product="Putative internalin protein"
FT                   /note="Similar to internalin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00575"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04343"
FT                   /protein_id="CAS04343.1"
FT                   /translation="MKFNWKVVLLFVLILALIVPVYSKAVETGKELPKSPELQDDKSST
FT                   LKNVNTPKNLKASPLTIPANSTIADLFPDEGMAKTVANQLGRTENNNFQTPTKTDWKVD
FT                   DVVTEVELNRMWYLTSVATIGSIEGIQYLPNLYNVQLQFDDQCKDLSPFLKAPNGYPQL
FT                   YRLNINNGNISDISPLTELSAPTLKYIDLAGNNISDLSLFKKLPNKLPSLEEISVERNN
FT                   ISDVSPLADFASTKIKVFDLDDNHITDLSSLTNNKMPNLQRLYVRSQSFYVETPVVTSS
FT                   KYEFSLQPSVFGITKPVKITATNPKATIDPITSKITYSAEVMAKRPKYSSNRVSGVTYS
FT                   WDEDIPFNGSNNLVEYNGTFYKPLTYVEPPQVVSYNSGLTYELGTPLTEQQFLNDLNVI
FT                   TDQPTTITTNFDKVLKDVNSVGFYPVTIKASNIEGNTEFTTSVLIKYKPPVITADAEYT
FT                   YLVGDKVNATQFRADVNATLTGEGTLRDDFIYKVRLNTAGDYVVTLSSPKSGYYEQDAI
FT                   PVTVIVHVKELLELQIPDEFRMDIDANADSVPISDKKQTLTCYGSSGKAELEVIDRRTV
FT                   RQGWTITGAMTPFTNSGGDILQTSLKYQSKSPSSSPIYLNTTNQPIEKKQSAVTDPKYD
FT                   STIVNLEDSLSMEIEPNDALVNDSYESKITWTLEDAPRP"
FT   regulatory      592698..592703
FT                   /locus_tag="Lm4b_00576"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        592712..593008
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00576"
FT                   /product="Putative cell surface protein"
FT                   /function="probable cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00576"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04344"
FT                   /protein_id="CAS04344.1"
FT                   /translation="MKKMGFILICCLFVCASPFYVKANTDKATSKAGVIFTHDPRKPRT
FT                   GTDDRSGTFPTKVPPKRLPKTGDTTDFYLVLLGFGFILIAKKGYFKEVREEIR"
FT   CDS_pept        593052..593894
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00577"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00577"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04345"
FT                   /protein_id="CAS04345.1"
FT                   /translation="MTSRTVKVTTASLLALGLIVAPVLSGDFASAATSVTKDSKGIVKF
FT                   DKSTTPDPDPVNPDPVDPDPVIPDPTDPPVGTDGLWILAISDWDFGTHNVSSLSSGALN
FT                   VHAADDTISTYVDANGNGQQDLPGEVSVTKKVTPYAQISDVRGTNTGWTLSVTGSAFKD
FT                   SSTPAKTIPGAELTIPKSTVSSATSTAQAPTGYDSVTISMTGGAAVPVMAAKDMQTATP
FT                   TNFNDDQGMGTWTDSFGSQAVSATDTSKPKLSIPKNVVVADGTYQSTLTWTLSDTPAV"
FT   CDS_pept        593970..595001
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00578"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00578"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04346"
FT                   /protein_id="CAS04346.1"
FT                   /translation="MKKICAIIFACVLAILCFPGQQAYATENSSFSVKAILPDNQASSV
FT                   TYFDLQMKPKQKQSLNVEITNQSKEEITVNCVANTAVTNEMGYVDYSIPNTKPDKTLKY
FT                   PFADMVKESVSEVTLKPNETKIWTAAIQMPAENYDGIILGGLHFQEKKEEDKEKDSSEN
FT                   DVQIKNEYAYVIGVKLTEKTTVVKPELELNQIKPATRNYRNVVEMNLQNTKATLVGGLA
FT                   VDAKIYKKGSEKVLHESKRTDLSMAPNSNFNYSVDWENQELKPGKYKVHLVAKNKEDKW
FT                   EWTKEFTISSDQAKKANKVALGLEKDYTWMYIVGGVLLFILLIIATYFVGKRAAKKKQE
FT                   NEK"
FT   regulatory      595015..595051
FT                   /locus_tag="Lm4b_00578"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(595015..595051)
FT                   /locus_tag="Lm4b_00579"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(595058..595693)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00579"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00579"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04347"
FT                   /protein_id="CAS04347.1"
FT                   /translation="MLIKNLCIPKINLTTVPGDATLQEAIHLLEESGYRCVPVLDEKGE
FT                   KFLGNIYKMHIYKHAANGGSLSDPVMSLIKNATKHICVNASFFEVFFTIKELPYIAVLN
FT                   EQGNFYGILTHGKLLGLLQDGWNVKTTSYVLTIATGEVQGALTKITKIIDRYSSISSLI
FT                   TLDNQTEDFIRRVLVSLPVGVTEDKKNEIVSHLERKGLRVVETEKIEK"
FT   CDS_pept        595903..597084
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00580"
FT                   /product="Putative NADH-dependent butanol dehydrogenase"
FT                   /note="Similar to NADH-dependent butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04348"
FT                   /protein_id="CAS04348.1"
FT                   /translation="MQKEMLNFDYYNPTHIIFGKNRFNELNEVIPQDKKVLILYGGGSV
FT                   ERFGTLDKVKTALKSREVGEFGGIEANPTYETLIKAIQLVKEENYDFLLAVGGGSVIDG
FT                   TKFVAAGALFDGEPMDIFGSGIGEKRPITKALPFGTVLTLPATGSEMNSGGVITFVEKK
FT                   AKLGFGSAYTYPVFSLLDPELTYTLPKRQLANGIMDAYVHVMEQYMTYPVGALLQDRYA
FT                   ESLLQTLIEIGPDVIKEDNHDYNTRATFMWSATNALNGTLSRGVPQDWASHSLGHEITA
FT                   LYGIDHARTLAIVLPSLLNVRRSEKHEKLVQYAERVWGIKSGSDEEKIDAAILKTREFF
FT                   ESLGAGTRFSDYGLGEEVVDLLVDQLERHGLTNISERGDQTLEVSRQIYTNAL"
FT   regulatory      597159..597164
FT                   /locus_tag="Lm4b_00581"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        597174..598652
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00581"
FT                   /product="Putative di-tripeptide transporter"
FT                   /note="Similar to di-tripeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04349"
FT                   /protein_id="CAS04349.1"
FT                   /translation="MSTKKGKTFFGHPRGLATLFNTEFWERFSYYGMRALLLYYMYTAV
FT                   ADGGLGFSQSTATAIMSIYGSLVFMSGVIGGWFADRVLGARQTIFYGGVLIMVGHIVLA
FT                   LPNGGAAALFGSMAFIILGTGLLKPNVSNVVGDLYPAGDNRRDAGFSIFYMGINLGAFI
FT                   APPIVSAVSDNAGSFHAGFGVAAVGMAIALVVYVLTGKRYLKDAGKKAPNPLQRSEAKS
FT                   LTFKIIGIVLGIGLLIAVLTLITGSLTIDTIILAVTVMGVGVPLAYFIMMMTSKKTEAD
FT                   EKSRLTAYIPLFLIAVLFWMIEEQGSSTLALFAAERTDLSIWGMNLNPANFQSLNPVFV
FT                   ITLSPIFAWIWTKLGDRQPSTPRKFALGLFFAGLSFVVMMLPGILHGNTTTLVSPLWLV
FT                   LSFFICIFGEMFISPVGLSATTKLAPKAFASQTMSLWFLSDAMGQSFNAQLTQLFNADT
FT                   EIAYFGITGFVAIAFAVALFIFAPFLKKYMKGVH"
FT   regulatory      598665..598690
FT                   /locus_tag="Lm4b_00581"
FT                   /regulatory_class="terminator"
FT   CDS_pept        598781..599488
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00582"
FT                   /product="Putative phosphoglycerate mutase"
FT                   /note="Similar to phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00582"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04350"
FT                   /protein_id="CAS04350.1"
FT                   /translation="MESSSRVVIYLTRHGKTILNTLDRVQGWADSPLTEEGALVAHDLG
FT                   RGLKGTDFVAAYASDRGRAIETARIVMKESDNHHLKLEKLAEMREFGFGKFEGEYNQAV
FT                   LKMVAKAHGFESIESYYDKTSENNSNIVIDTVHKMDETGMTENSVIFEERLTAGLDTIL
FT                   ADANKRGGGDVLVVAHGMVIHRIIEMIDPSKNLRIIENASVTKVIFEDGAYSIEEPGNM
FT                   FYVEAGKKAQGGV"
FT   CDS_pept        599489..600184
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00583"
FT                   /product="Putative phosphoglycerate mutase"
FT                   /note="Similar to phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04351"
FT                   /protein_id="CAS04351.1"
FT                   /translation="MATGKLNVYLVRHGKTMFNTSRRVQGWSDTPLTNEGIEVAEFLGR
FT                   GLRETPFDAIYTSDRGRTIETAGIILRESKQTHLEINELRDFREFGFGKFEGEYEDIMF
FT                   GKVMEHLGFQSMEEAFEKFGDDGYQIISETVEKIDETGMSENWDEMVARLKNALDTVSA
FT                   ENQVENANVLVVSHGMAINTIISFFDKSLINPDIANASVTRLGFENGEWTIETVNDLSY
FT                   IEAGKLVLV"
FT   regulatory      600189..600216
FT                   /locus_tag="Lm4b_00583"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(600189..600216)
FT                   /locus_tag="Lm4b_00584"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(600226..601266)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00584"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00584"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04352"
FT                   /protein_id="CAS04352.1"
FT                   /translation="MSKNQATAYIGTYTKAESQGIYRLVIDKTTGEIKENKLAGKMDNP
FT                   TYLKISDDEKFVYSVAKDGDKGGVAAFSVEEDGSLTFINQDVQTGNPPCYVDASHDGSI
FT                   VVSANYHLGTIVSYPTENGALKSSVSTIQHTGKSVHERQEKPHAHFAGFTPDQKYVITC
FT                   DLGTDKVTTYSATAGKLEKVTELDVKPGSGPRNLVFHPNAKYVYIMTELTSEVIFAEYD
FT                   EATGALNVIQTIASLPEGFDKENKGSAIHISPDGRFLYVSNRGQDAIVSYAVAENGTLT
FT                   LAATTPVEGVGPRDFDLNYTGEILVATNENSNNVTVFGVNKETGALTLLQKDVKVPEPV
FT                   CIKFVK"
FT   CDS_pept        601666..602571
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00585"
FT                   /product="Putative membrane protein"
FT                   /note="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00585"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04353"
FT                   /protein_id="CAS04353.1"
FT                   /translation="MSIQTIFGNGKYNWINIDTDSTDNLADFYEKYHIDDEVIAYSIDR
FT                   NERAHFEYDQKSNTFVIVFNVPDQRKMDNHYETIPMVFIIKDKQLITITNNDNQYITRK
FT                   MKRYLKESDDVTIFQFLFSSLYFIMDAFFPYVEEMDTDRRTINDKLKIKTTKKNLLSLS
FT                   DLETGIVYFVSASKQNAALLEQMKAHLIYRELNEVEKEQFEDALIEARQLVEMTGLSSQ
FT                   ILQQLSGTYNNILNNNLNDTMKILTALSILLTVPTIITGFFGMNMPLPLEHNTFGWIVT
FT                   IFISVILWFGLSFILRKLMR"
FT   regulatory      602579..602605
FT                   /locus_tag="Lm4b_00585"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(602579..602605)
FT                   /locus_tag="Lm4b_00586"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(602614..603990)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00586"
FT                   /product="Putative NADP-specific glutamate dehydrogenase"
FT                   /note="Similar to NADP-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00586"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04354"
FT                   /protein_id="CAS04354.1"
FT                   /translation="MAQTSTIQNDTKAAEEYAARVFETIKLRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVPWVDDSGTVHVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDSEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTITGKGLSYGGSLARTEA
FT                   TGYGLVYFTVEMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSAGFVY
FT                   DKEGIKVETVKQLKEVERKRISEYTTIHPSAEYYAGGDVWSVPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLDAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWTFQTVDEHLQNIMKDIYKNSSNAASEYGAPGNLVIGANIAGFLKVADTMISQGII
FT                   "
FT   CDS_pept        complement(604483..604794)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00587"
FT                   /product="Putative phosphorybosil-AMP-cyclohydrolase (HisI2
FT                   protein)"
FT                   /note="Similar to phosphorybosil-AMP-cyclohydrolase (HisI2
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00587"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04355"
FT                   /db_xref="GOA:C1L0J0"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J0"
FT                   /protein_id="CAS04355.1"
FT                   /translation="MLNDLYEEIKLRKTQPREGSYTNYLFDKGLDKILKKVGEEATEVV
FT                   IAAKNNEQELIAEVSDLTYHLLVLLAEQNIPLSKIQAELQNREGKLSTTRDRKEINDL"
FT   CDS_pept        complement(604795..605112)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00588"
FT                   /product="Putative phosphoribosyl-AMP cyclohydrolase (HisI1
FT                   protein)"
FT                   /note="Similar to phosphoribosyl-AMP cyclohydrolase (HisI1
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00588"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04356"
FT                   /db_xref="GOA:C1L0J1"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J1"
FT                   /protein_id="CAS04356.1"
FT                   /translation="MTSVDFSKGLVPTIILDDQNGDVLMLAYMNEESYQKTLETGYTWF
FT                   FSRSRNELWNKGATSGHTQKVKQIWTDCDNDTLLIRVTQIGPACHTGKKSCFFNLIKED
FT                   F"
FT   CDS_pept        complement(605109..605864)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="Lm4b_00589"
FT                   /product="Putative cyclase HisF"
FT                   /note="Highly similar to cyclase HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00589"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04357"
FT                   /db_xref="GOA:C1L0J2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J2"
FT                   /protein_id="CAS04357.1"
FT                   /translation="MLTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGAD
FT                   ELVFLDITATVELRQTMIDVVERTAEQVFIPLTVGGGISSVSDMKELLQAGADKISLNS
FT                   AAIKRPELIQEGAAKFGNQCIVVAIDAKWNGTNWSVFTRGGRNDTGLDAIEWAKKAVQL
FT                   GAGEILLTSMDGDGTKNGYDIPLTKAISAAVSVPVIASGGCGNAAHMAEVFEKTKATAA
FT                   LAASIFHYGELSIKNVKTTLLEKGVNIRP"
FT   CDS_pept        complement(605854..606576)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="Lm4b_00590"
FT                   /product="Putative phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="Highly similar to
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04358"
FT                   /db_xref="GOA:C1L0J3"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J3"
FT                   /protein_id="CAS04358.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGAT
FT                   YLHIVDLDGALEGRPINLEIIQRMKKAAKIPVQVGGGIRSMAQVDYYLESGIDRVIIGS
FT                   AALTDPDFLRAAVQKYGAKIVAGIDAKNGFVATRGWLDVSQVSYLDLAKRMEKVGVETI
FT                   IYTDISRDGTLTGPNLEQMANLKEHVKVSLIASGGVSSRADLEALAQLGLYGAIAGKAL
FT                   YNHDISMSDIVEVEQIAY"
FT   CDS_pept        complement(606555..607181)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="Lm4b_00591"
FT                   /product="Putative amidotransferase"
FT                   /note="Similar to amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00591"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04359"
FT                   /db_xref="GOA:C1L0J4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J4"
FT                   /protein_id="CAS04359.1"
FT                   /translation="MIVIIDYDTGNTKSISKALDFIGLQNKISSDKTEIAQADGVILPG
FT                   VGAYPEAMQELTRRGLDKTLKEIATAGKPILGVCLGMQLLLESSNEHSYTKGLGLIPGH
FT                   VEMLPDESEFAVPHMGWNQLQIKRTTPLTQNIAGEYVYYVHSYYANCPEAYIIATSGYS
FT                   IDIPGMINNGNIYGAQFHPEKSGQIGLEILKGFKEVIRSCKSSQQ"
FT   CDS_pept        complement(607182..607766)
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="Lm4b_00592"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00592"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04360"
FT                   /db_xref="GOA:C1L0J5"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J5"
FT                   /protein_id="CAS04360.1"
FT                   /translation="MRTATKTRITAETSIELSINLDSQAESIISTGVGFLDHMLTLFAK
FT                   HSRITLNVKADGDTYIDAHHTVEDIGITLGLCLKEALADKASINRYGSAYVPMDESLGF
FT                   CALDLSGRSYLVFDAELTNPKLGDFDTELVEEFFQAVAFNTEMNLHLRVLYGKNTHHKI
FT                   EALFKAFGRALREAITINPEIKGVNSTKGVL"
FT   CDS_pept        complement(607767..609050)
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="Lm4b_00593"
FT                   /product="Putative histidinol dehydrogenase"
FT                   /note="Highly similar to histidinol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00593"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04361"
FT                   /protein_id="CAS04361.1"
FT                   /translation="MKILTGTVNELLNELKIETDTNTSIQVETEVKTIIEKVKTAGDQA
FT                   LFDFTSKFDGVGLTELRVPAADIQAASAKIEPAFLDALQQAKVNIESFHSKQKQHAFLD
FT                   SEKDGVIRGQLIRPLETVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPGENGI
FT                   NPYVLASAQLAGVDEIYQVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGL
FT                   VDIDMIAGPSEIVVLADENANPAFIAADLLSQAEHDILARAILITTSKKIAEETQNEID
FT                   KQLENLPRKAIAQKSIETRGKIIIAATTQEMFDIMNEIAPEHLEVQLENPMNYLYQIKN
FT                   AGSIFLGSYASEPLGDYFAGPNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKE
FT                   KDAIVLLAKKEGLDAHAKAIQIRFEEEN"
FT   CDS_pept        complement(609047..609688)
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="Lm4b_00594"
FT                   /product="Putative ATP phosphoribosyltransferase"
FT                   /note="Similar to ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00594"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04362"
FT                   /db_xref="GOA:C1L0J7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J7"
FT                   /protein_id="CAS04362.1"
FT                   /translation="MKALKIALTKGRLEKDAVALLEKAGIDCSSMTDKKRKLIFHSSTQ
FT                   PISFILVKAVDVMTYVKHGVADIGIVGKDVLMEASKSHYEMLDLEIGKCQFCLASTPDF
FT                   DPSSYRRKIIATKYPTVASKFFREKGEDVEIIKIEGSVEIAPVLGLADAIIDIVETGST
FT                   LKENGLLIYEKMYPISARLIVNKASLKQNKTQIFQLIDQLEQVIKEERAE"
FT   CDS_pept        complement(609688..610866)
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="Lm4b_00595"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00595"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04363"
FT                   /db_xref="GOA:C1L0J8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L0J8"
FT                   /protein_id="CAS04363.1"
FT                   /translation="MNLNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPV
FT                   IEFEDVFSSEHQADAKLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALEIPNFQIELGHAAIY
FT                   RRVIQLLNLSETAEIDFRQLIQNKSLTGIKRFVANNPSTLDDFILAIPRLFGPATAILN
FT                   QAKSLTTDKGILTALREMETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTSSSSPAVGLALNLDSLTTLQNRAGIIKKQTPTTLLIHYDLEALP
FT                   QAEKFMQETPNSELSFFETASNAISFAKKWHIPEVVHVSSQGIQTIFQREVD"
FT   CDS_pept        611018..611845
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="Lm4b_00596"
FT                   /product="Putative Similar histidinol phosphate
FT                   phosphatase"
FT                   /note="Similar histidinol phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00596"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04364"
FT                   /protein_id="CAS04364.1"
FT                   /translation="MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSS
FT                   EFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFT
FT                   RDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGV
FT                   KQSIEADLGLFKPRRMGHISLCQKFQQFFGADTSDFSEEVMEKFRVILALVKKRDYELD
FT                   FNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQK"
FT   CDS_pept        complement(611830..612126)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00597"
FT                   /product="Putative methyltransferase"
FT                   /note="Similar to methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00597"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04365"
FT                   /protein_id="CAS04365.1"
FT                   /translation="MIPADFEDRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATL
FT                   KHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSEGVTFKENGHVKMKDHFWQ"
FT   CDS_pept        612203..613234
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00598"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00598"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04366"
FT                   /protein_id="CAS04366.1"
FT                   /translation="MPDFSYAKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFNKDEYYQFTHETDLDFNEVRTFAANMFVAEDEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFFIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLVFNVDHDTGNKVLILDRLNRGDSVYWKDKFLSIDKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATSEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKREKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEEKGKNYMIV
FT                   YYD"
FT   regulatory      613244..613264
FT                   /locus_tag="Lm4b_00598"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(613244..613264)
FT                   /locus_tag="Lm4b_00599"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(613277..614572)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00599"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00599"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04367"
FT                   /protein_id="CAS04367.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGME
FT                   LKAVFVATILASVVGSLAMGLIANYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTISGLREKIVNAIPTELKFAVGAGIGFFIAFLGLKNAGIIVPNESTIVAL
FT                   GDLHSGPVLLAVFGIVVTVAYMTIGWKGAIFFGMATTAVAGMLFGLIDVPTQVVSSVPS
FT                   MESTFGQAIIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDNKIPRAGR
FT                   SLFSDSLATVFGAIFGTSTTTSYVESTAGVAVGGRTGLTAVVIAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEVAVPSFFVILMMVLTFSIATGIAIGFIFY
FT                   PITMVLKGRYKEVHPIMYVMMVLFILYFMFVV"
FT   CDS_pept        614888..616282
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00600"
FT                   /product="Putative beta-glucosidase"
FT                   /note="Similar to beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04368"
FT                   /protein_id="CAS04368.1"
FT                   /translation="MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRF
FT                   FNDVGPTNTSNFYYQYKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRV
FT                   IDEMLANDVEPFMNLYHFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFT
FT                   FNEPIVPVEAGYLYDMHYPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIIL
FT                   NLTPSYPRSQNPADLKAAHIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEED
FT                   LAIIKNNIIDILGVNYYQPRRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEI
FT                   FERAIYDIAINLRDNYDNIPFFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWL
FT                   HKAIEEGSNCHGYHLWTFMDCWSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELSE
FT                   NNGFED"
FT   CDS_pept        616326..617054
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00601"
FT                   /product="Putative transcription regulator GntR family"
FT                   /note="Similar to transcription regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00601"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04369"
FT                   /protein_id="CAS04369.1"
FT                   /translation="MAQNQTKYSFIAEEIRKRIMNHAYPLNQPIPDEITLAKEFDCSRM
FT                   TMKKALEVLVLEGLLYRKRGHGTFIIKSALDADRLQIHNQEVNGFTKLLNGKKVISKVI
FT                   EFKVIFPTEEIAERLHIEMETPIYDILRVRLVKDEPYVLEHTYMPVGVIPGINQQILEG
FT                   SIYSYIQDDLNLKIASSYKQIRADKATQLDQQYLDCASDDPVVEVEQTVYLNNGLAFEF
FT                   SKSRHRYDKFVFTTVNIARR"
FT   regulatory      617064..617101
FT                   /locus_tag="Lm4b_00601"
FT                   /regulatory_class="terminator"
FT   CDS_pept        617503..618966
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00602"
FT                   /product="Hypothetical cell wall associated protein"
FT                   /note="Hypothetical cell wall associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00602"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04370"
FT                   /protein_id="CAS04370.1"
FT                   /translation="MKKKYILCLFAVMLFCTGFLFGNSQVDAAETDTSNVTYKYIDIST
FT                   LTETQKNSIIKGKPNETLTNDYENYSFVYQKNTSGPTTNTDNTSDNNKDQNGTLLKAGD
FT                   VGPNIYLVILGFILLGSGIGLLTLKKRHAKQLLVFLLVLGGSSLLVGSIVQATENSNLK
FT                   TQESQTVVKGTKETKQPESIAGYTYVGYIHTSKNNTAPPVEKGIVTVNYQDEQGNSVAA
FT                   TETLEGDIGKPYQTSMKNIEGYTWKEVKGEATGTFTEKAQVVTYVYQKVSVATVTVRYL
FT                   DQDGKPIHEPQTISGNVGEPYDASTDKYKLQIDGYVLDTTKLPNNANGTFTNQATQVTY
FT                   IYTKEAQDVTITIKFVDNNGNPFVLTDLTTYKNGDLVPVYPNLDQYHMRLNYNQQIYSQ
FT                   GEAVSDIVLSAKEGETYSLPERMTFNIIDDKGNEIPYVISQNPDFSSSGIEKWENYRSI
FT                   PANHEGTLTGENVVVTYQIFVYGVMIPAP"
FT   regulatory      618994..619014
FT                   /locus_tag="Lm4b_00602"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(618994..619014)
FT                   /locus_tag="Lm4b_00603"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(619021..619479)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00603"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00603"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04371"
FT                   /protein_id="CAS04371.1"
FT                   /translation="MDLVWTIIIQLVLSYVATVTFAIITNVPKRALNACGITGTFGWMA
FT                   YWTLMQMDSGTGASSLAGAFVVAVLSHFFAKYKKLPITIFNVPGIVPLVPGGLAYQAVR
FT                   NFVLGDYTEAIGFSVQVTVVAGAIAAGLMLSEVFNHSIRTFRERKERI"
FT   CDS_pept        complement(619493..620245)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00604"
FT                   /product="Putative conserved membrane protein"
FT                   /note="Putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00604"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04372"
FT                   /protein_id="CAS04372.1"
FT                   /translation="MSTETTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIATIASNKK
FT                   GISFVTPTGLFMSLEGERNVQLQQIPTRTINLEKVSMVNEFSRDFAEKRISLKELHTKL
FT                   VNLDKDVRYFPIWLQIIAASLVSGSLMVIFGGGWFDFIPTCIIGAIGFIIFYYTQIFMK
FT                   VKFLAEFLASLSVGLLAVLTISIGWGINLDTMIIGGVMPLVPGVPITNAVRDLIAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVVFRFFL"
FT   CDS_pept        620410..620619
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00605"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00605"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04373"
FT                   /protein_id="CAS04373.1"
FT                   /translation="MANIEYEIIEEIGVLSENARGWRKELNKISWNGRPPKYDIRDWSE
FT                   DHEKMGKGITLTDEEAEVLKKLLD"
FT   CDS_pept        620641..621297
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00606"
FT                   /product="Putative carboxylesterase"
FT                   /note="Weakly similar to carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00606"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04374"
FT                   /protein_id="CAS04374.1"
FT                   /translation="MFAYDIYEPIGRKDEDTFPVIFALHGFGGDELEMAGRLELLMDRF
FT                   VVVSMRGDVEYGPAYGFYHMVTEGDPNPQEVDYISLRVAQFIDKICTDYISIDKEQVFL
FT                   AGFDQGAVLTISIMQSYGGQYKAAALLSGRLPYYMEERPANLMLKDKRIFIGHGIEDAV
FT                   IQISEADDIARLFEKMGCHVEKHRYFIGHNVNEAEEDDLYRWFESFLPNQPVKNK"
FT   regulatory      621302..621323
FT                   /locus_tag="Lm4b_00606"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(621302..621323)
FT                   /locus_tag="Lm4b_00607"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(621328..622512)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00607"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00607"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04375"
FT                   /protein_id="CAS04375.1"
FT                   /translation="MKNLVKVKVFPKFTKGYKEGYPLILKERMEKWPKELQEGDVLELT
FT                   DTNGQFIARGYHGEQNKGSGWLFTWDKKQQLDEDFLTNLITTAIEKRQFLFADDSTTAF
FT                   RIFNGEGDGLGGFTVDFYDGYLVIQWYSLGIYAFQKMIIDIFLSFPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYSVSKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLSKTKEQLEVNGLDPNEQAIIVEDVFHYF
FT                   KYAARKQLTFDLVVVDPPSFARTKKVTFRAAKDYPAMLREIIDITAPNGTIVASTNYAG
FT                   FGMKAFKKLIAEAFQTSDRTYKIVETHSLPADFTVNKNFPEGNYLKVLFLTLDI"
FT   regulatory      complement(622554..622582)
FT                   /gene="iap"
FT                   /locus_tag="Lm4b_00608"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(622600..624033)
FT                   /transl_table=11
FT                   /gene="iap"
FT                   /locus_tag="Lm4b_00608"
FT                   /product="P60 extracellular protein, invasion associated
FT                   protein Iap"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00608"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04376"
FT                   /protein_id="CAS04376.1"
FT                   /translation="MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSK
FT                   GTTVDAIKKANNLTTDKIVPGQKLQVNEVAAAEKTEKSVSATWLNVRSGAGVDNSIITS
FT                   IKGGTKVTVESTESNGWNKITYNDGETGFVNGKYLTDKVASTPVAPTQEVKKETTTQQA
FT                   APAAETKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQ
FT                   DIMSWNNLSSSSIYVGQKLAIKQTANTATPKAEVKKEAPAAEKQAAPVVKENTNTNTNA
FT                   TTEKKETTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNNTNTSTPSKNTNTNTNSN
FT                   TNTNSNTNANQGSSNNNSNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAK
FT                   AGISLPRTSGAQYASTTRISESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVK
FT                   YDNIHGSGWGKYLVGFGRV"
FT   regulatory      complement(624040..624045)
FT                   /gene="iap"
FT                   /locus_tag="Lm4b_00608"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        624452..626782
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00609"
FT                   /product="Putative preprotein translocase SecA subunit"
FT                   /note="Similar to preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00609"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04377"
FT                   /protein_id="CAS04377.1"
FT                   /translation="MRQNYDDRKIVKQYREIARQIVKKEGLYKNMDQAELCEQTNFWRE
FT                   KFKTKPMTDRDKINIFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLM
FT                   SLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVSVALNESGLDIAQKKAIY
FT                   TADVIYGTASEFGFDYLRDNMVRQKEDKVQSGLDFVLIDEADSILIDEARTPLLISDRK
FT                   EEDLSLYHTANKLVKKMMKDDYEMEEHKRFVWLNDAGIEKAQKFWGVESLYSAEAQSEL
FT                   RITMLLMRAHFLMHKDKDYVVLDDEVLIIDPHTGRALPGRRFNDGLHQAIEAKEGVEVK
FT                   EESRTLATITIQNYFRMYKKISGMTGTAKTEEEEFRQIYNMDVVVIPTNLRVNREDMQD
FT                   DIFYTKKEKGRAIVYEVSWRYEKGQPTLIGTSSIKSNEWISGLLDAAGIPHQVLNAKNH
FT                   AQEAEIIAKAGKRGMVTLATNMAGRGTDIKLDPDVHKLGGLAVIGTERHESRRIDLQLM
FT                   GRSGRRGDPGFSKFMISLEDDLLEQFESKSWEKLSTKLKRKAPRDGKPVNSRKIHAVVV
FT                   DAQKRLEGANYDIRKDLLSYDEVIDLQRKMVYKERDLLLERNKLGVSSEKILREVAEYS
FT                   FIHPSDIPEEELEIYYSRQKELLGGTKFPISFDQVTLMDPREVVEEIVSWHKKERNKFP
FT                   AETIAAIEREVYLNLMDQMWVMHLDAMVQLREGIHLRAYGQQDPLVMYQKEGAQLFEKF
FT                   QADYHFYFAHALLELDPDGLIQG"
FT   CDS_pept        626898..628070
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00610"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04378"
FT                   /protein_id="CAS04378.1"
FT                   /translation="MKGSFTKFKQFFIENKFVLGLLIFLLVALDIYVLTKIAFIFDPLM
FT                   VILKTVAAPIILAGISYYLFNPIIDWLEKHKWKRGWAIALLYLVIIGLLILLFSFVIPA
FT                   VKDQIVSLFKSFPGYWDQITQKFDEFSRSSLFDQIKDKLNTNMSDIMKTLSTKGTSVIN
FT                   SAISSIGSIVGTVTEVVLAIVTTPLVLFYLLKDGKKLPDFLLKMLPVNGRAHTRQVLGE
FT                   ANHQISSYIRGQIIVSLCIGILLFIGYLIIGLPYALTLAIIAACTSIVPYLGPAIAITP
FT                   AIIIAIVTSPWLLIKLIIVWCVVQLLEGKFISPQVMGKTLKVHPITILFVILVAGNLFG
FT                   VLGVIFAVPGYAVLKVIVTHVFIWFKRISGLYGEQPESEYVESPTEEKEL"
FT   regulatory      628079..628114
FT                   /locus_tag="Lm4b_00610"
FT                   /regulatory_class="terminator"
FT   CDS_pept        628328..629041
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00611"
FT                   /product="Putative secreted protein"
FT                   /note="Putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04379"
FT                   /protein_id="CAS04379.1"
FT                   /translation="MIIKKTLIVGLIGISSVTLFAPAAFAVTSEGDSKATVKFKAGTGV
FT                   VNPVDPENPTKPIDPLDPSNPTDPGTGNTGSLTLDYVSSVNFGEHEVSSTEQSYSSTSR
FT                   KPFIQISDRRGTGAGWKVTATATAFQNEDGAASLSGATLSFKNGETASASNTATTPTAA
FT                   QTVELPTDGTSIVSVVSAKESEGMGTWINRWFGATPNDTASLNNNVQLTIPAGSATLGD
FT                   HEATITWTLSDAPGV"
FT   regulatory      629048..629074
FT                   /locus_tag="Lm4b_00611"
FT                   /regulatory_class="terminator"
FT   CDS_pept        629109..630134
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00612"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00612"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04380"
FT                   /protein_id="CAS04380.1"
FT                   /translation="MKKSFLSLLFIIPLLVTCSNFTEAQAAEGDVGYSVQAHIPTNQID
FT                   KRQTYFDLKMQPKQKQTVNIDVMNSSNEEIQVEAAINYASTNRTGVIDYTKNDLTKKDK
FT                   SLEYPLPELAKIPDDQKLLTIPVDGKKTVQVMIEMPAESIDGVVLGAVEFKKKNTNETK
FT                   KTKGVSLKNEYSYIVGMQLAETDKQVKPHMNLLSIKPALLNYHTAIVAKLQNDQPVILE
FT                   NLSIDAKVYQQNSDKLLYQTKKANMKMAPNSNFDFGIDLENQPLKEGKYRLKMTATNGV
FT                   ETWTWDEAFTIGKEGQNLNKEAVNLEKTNTWLYVAIVAGVVLIALIIILVIRKRRQKQE
FT                   K"
FT   CDS_pept        630152..632617
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00613"
FT                   /product="Putative secreted protein"
FT                   /note="Putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00613"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04381"
FT                   /protein_id="CAS04381.1"
FT                   /translation="MAFKKLILVLTIAALFLGFKIVVAAENGSRDLASNEAIVTNFTEL
FT                   KTAISEDNGIDTVYLGADVELSGGIIIPATKKTFTLSGKNPATGEIHTLTETMASAGAQ
FT                   SSVITVNTNTGAKETTLRDINVVGKNYYGTISVYGAAKNVVQNYENVHYQGPQMIYNLN
FT                   GTANFKGTNDITIASVVSGSAAPNEVAEIKGVSVSGKLNINHASSNANSAFWFGGGTAE
FT                   VNTFTVEENAEVTILSNGTGMFYRSGTKPIDIDVKKNAKLAITSNNNIFRDTPGGAVKI
FT                   ASGADVTMTKTAGGNPLLWVADDITVSPDARFILNKTGGTGYIIQFYNATAKLDINDPR
FT                   SFLITTNSNTPMFYWPYANTFNLNAQMVNYWDTVGTIDRTDLAAQSFSLPNGENVTGSL
FT                   TYTGTTTKILSTNAGMTPTNFNQNTARMIAMGRLEGTINPVTDVDNEITGTATPNAFIS
FT                   ISYTENGENKVLEGQANEAGTYRIAIPNGFIKPYIKLTTTIKQDQKRITLDDITVEDVT
FT                   PPSGEAVTQIIQLGDPFPDVAELVTNIYDHSDNTSGAGVTTTLQSAPDTNVFGPTEAIV
FT                   RLEDKAQNYVDIRVPVFIKDDETEIQDGKALRAADFSVNVKDIIELNDAELEQFILSKS
FT                   GAKAFNIETGEDLSAELKVASTNLKKETGTYAATIQIDGLTKEIAIQVTGELKFNHVPE
FT                   TISFETMELNQQKNIAKRNADFDLSVLDSRGSGGKFSVTATVKTPLTSTINSAHTLPNG
FT                   LIFIDNTGAKKILSAEPITIFESQSASEMIVPIEWAEDQGILVEVDVAEAYVDESYETT
FT                   IEWTLTDAP"
FT   regulatory      632621..632642
FT                   /locus_tag="Lm4b_00613"
FT                   /regulatory_class="terminator"
FT   CDS_pept        632729..634132
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00614"
FT                   /product="Putative DNA photolyase"
FT                   /note="Similar to DNA photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00614"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04382"
FT                   /protein_id="CAS04382.1"
FT                   /translation="MTSVMWFRRDLRVNDNKALYHACKEDDLLLLFQVNPAQFITGSPS
FT                   HQAFFASVAHFKQEIDKTAHLQIMFGEPIECFQQLKDSLPSWDKVYFNRDETGYGAKRD
FT                   EAAQAFFDEQKIEVQAFHDSYLHSAEEVKKSPTEYYKIFTPYYKKWREEIKETPFKVTL
FT                   KHENIRKESLFLKYEEQFAEMTSDLPILDIGERAANTRLANFIKHDVADYDKARDFPEL
FT                   DKTSHLSRYLRTGEISIRTIWQTLQETEATEGRATFEKELCWRDFYNMIYVSFPNQKNE
FT                   PIQENYRFIEWENNREYFKAWQEGKTGFPLVDAAMRQLKETGWMHNRLRMITASFLTKD
FT                   LLIDWRFGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTTQSQKFDSTGK
FT                   FIRKYVKELANLPDKYIHQPEKMSETEQKEHGLLLGKDYPFPIVDHKERRKLAIARYEF
FT                   SKEHSRGNI"
FT   regulatory      634141..634164
FT                   /locus_tag="Lm4b_00614"
FT                   /regulatory_class="terminator"
FT   CDS_pept        634270..634683
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00615"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00615"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04383"
FT                   /protein_id="CAS04383.1"
FT                   /translation="MAQFLKLFLTSAVVFLIFDLFWLLVASKKMYQQFIGDLMGDVKLA
FT                   PAVIFYFIYVVGVTFFVLLPGTEKGSLGYTILAGALFGLVCYATYDLTNLATLKDWPIT
FT                   MTVIDLVWGTAVTTVTSVIVYFINLHFFSGVGS"
FT   regulatory      634671..634676
FT                   /locus_tag="Lm4b_00616"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        634686..636452
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00616"
FT                   /product="Hypothetical protein"
FT                   /note="Similar to a fusion of two types of conserved
FT                   hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00616"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04384"
FT                   /protein_id="CAS04384.1"
FT                   /translation="MESESKRLLQSMLNGAAEVISKKDELNRINVFPVADGDTGSNLAS
FT                   LMQAIIDHVSPREYSTKELLEEVASAALIGARGNSGMIFAQYLNAVAESYHHLESTFDG
FT                   LVQAFQNAVHKAYEALLDPKEGTILSVMKAWSEELAGTYEQERSFQQSLLNAQIVAEKA
FT                   LINTEFQMPILRKNRLVDSGAKGFYYFIAGLTNAYCGKAVSDPVRFTEVEQTAEHRHVE
FT                   TSEPKYRYCSEFIIKQATISHQHLQEILAAKGDSLVIAGNEKQIKIHIHTNEPKEVLSL
FT                   MAAYGVMTYQKVDDMRLQYEVTKKPRAKIAIVTDSIADLPEAFLLEHQVHVLPMNILAG
FT                   EENFLDKLTVGPDMMQEKLRKQTKMSTAQPTIRTVDALLSFLEHKYEHVLVISVAAKLS
FT                   GTYQLIKQRIKARELSSDWIRVIDSKLNSVAQGILVKQAVELVESGKSWESIYPEVEQM
FT                   IERTFIYVAVADLSPMVQSGRIPRVLGKLAQKLSLYPIVSLDESGDGKLIGVSFSQKQS
FT                   MKKIIKKIAKLQLKELAITHVSSRDTAAIWQKQLEKETGEISYLVDSSAAIAISAGLGS
FT                   VAVAGIKKEETI"
FT   regulatory      636436..636441
FT                   /locus_tag="Lm4b_00617"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        636452..637222
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00617"
FT                   /product="Putative unknown membrane protein"
FT                   /note="Similar to unknown membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00617"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04385"
FT                   /protein_id="CAS04385.1"
FT                   /translation="MYWTVALALLVYFILWFIISKIKGKYSLVDIAWGGGFVVVAWTGF
FT                   LTTFSMTAQSITILVLVTIWGVRLFWHLARRNWNKPEDYRYVNMRKRWGTTLVNLKAFL
FT                   NVFVLQGVLLFIIALPITHSFANETATFAWWQILGIVIWIIGFIFEVGGDLQLENFKKN
FT                   PANKGKLLTTGFWSVTRHPNYFGEALSWWGVFLVAYTQLNDLWLITSPIVITLLLLFVS
FT                   GVPLLEKKYQDRADFQAYANKTSKFFPFIGKKGL"
FT   CDS_pept        637350..637892
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00618"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00618"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04386"
FT                   /protein_id="CAS04386.1"
FT                   /translation="MKKEKTVLIMNFDEESISYQAFSEMKRLHQERKIIGYQMAVVKHE
FT                   PGNKLVAQDFLDFTGADKNMKDSLIGMLIGILGGPFGILIGWMVGAIVGSMRDAGEVKD
FT                   ALNVFERTLKTIPEGSTGVILIATEQELANVNDVAMDELHGRVQRMDEAIVAQEIKSAQ
FT                   ETEGKAKDSAKKHWFSK"
FT   regulatory      637905..637928
FT                   /locus_tag="Lm4b_00618"
FT                   /regulatory_class="terminator"
FT   regulatory      638104..638109
FT                   /locus_tag="Lm4b_00619"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        638119..638919
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00619"
FT                   /product="Putative transport protein"
FT                   /note="Similar to transport proteins (formate?)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00619"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04387"
FT                   /protein_id="CAS04387.1"
FT                   /translation="MDVESSPLMQKIDYSTRKKIDLVNNSILRYIVRAMLACLFLTLGT
FT                   AVAVMIGDKVDHFAPGLGKITYAFMFSWSLVMIIYMNAELGTSNMMYMTTGVYQKIVKP
FT                   GKALQILLLCIVCNLLGGILAGYLVSLTSVFHNLPADHFLFTAVSGKLEKAPLQIFVEG
FT                   IFANIVVNTAVLCTLRMKDDAGKVIAMIFIIFIFAFLGFEHVIANFSSFSLAFFASGGT
FT                   LAAMTAGNVTVNLVLALLGNFVGGGLVIGLGYAWLNRTKSIYKD"
FT   regulatory      638926..638952
FT                   /locus_tag="Lm4b_00619"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(638926..638952)
FT                   /locus_tag="Lm4b_00620"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(638957..640063)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00620"
FT                   /product="Putative homoserine O-acetyltransferase"
FT                   /note="Similar to homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04388"
FT                   /protein_id="CAS04388.1"
FT                   /translation="MTLQQKELFQKSPLLLENGETLSPVLVGYETYGTLSASRDNCILL
FT                   EHALTGTAHAAKHFESDAPGWWDDYIGPGKTIDTDKYFLVCTNVFGGCSGTTGPSSINP
FT                   KTGEPFRLQFPGFSIKDIIKVQRELLEQLGVTRIVSVIGGSMGGMQATEWAIDYADITD
FT                   SIINIASPLAAGPDAIGYNLIMRMAILNDPDFNGGNYVGQPEGGLATARMVGMMTYRTS
FT                   ELFSKRFERFTVAESSPAAFSKEHFQIESYLQYQGDTFVERFDANSYLYLTKAIDLFDV
FT                   TAPAKDDLPAFAKIKIPYLLIGITTDQLFRIHDLRRGYELLKEWDVPVTYHEVASEYGH
FT                   DAFLVKKEVPKFEPLIRSFLSNLPVKSI"
FT   regulatory      complement(640073..640078)
FT                   /locus_tag="Lm4b_00620"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(640080..641357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00621"
FT                   /note="Similar to O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00621"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04389"
FT                   /protein_id="CAS04389.1"
FT                   /translation="MSNEYKFETIQVHGGHTPDGDTHSRAVPIYQTTSYTFDSPEHAAA
FT                   LFGLQETGNIYTRIMNPTTAVLEERLTLLEGGIGAVATASGMAAITYSILNIAGSGDHI
FT                   VAAATLYGGTHTLFSHTFKTFGIDVTFVDPNEPENFEKAIKDNTKAVFIETIGNPDINI
FT                   VDIEKVAEIAHASDIPLIVDNTFATAYLNRPFDFGADIVVYSATKFIGGHGVAIGGAVI
FT                   DSGKFNWANGKFPKLVVPDDSYNGLSYTNDVGAAAYITKLRVSLLRDTGAALSPFNAFL
FT                   LILGLETLSLRLEQHVKNAKQVANFLNDHPKVAWVNYPGLSDNKYHELAQKYLPKGPGS
FT                   IFTFGVKGGYEAGKKVIESVELFSHLANVGDAKSLIIHPASTTHQQLSEEQQLTAGVKP
FT                   ESIRLSIGIENADDIIQDLTKALEQI"
FT   regulatory      complement(641365..641370)
FT                   /locus_tag="Lm4b_00621"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        641805..642332
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00622"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00622"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04390"
FT                   /protein_id="CAS04390.1"
FT                   /translation="MKTFTRILVLLAGIAMIILGVWFLFHPGISLLTSTLMFGFLLLIS
FT                   GIFHTISYFSDRKSQNVSGWVLADGILSILLGFLLLFNEFDGTLTLVLLFGMWVLFAGI
FT                   MRTIGAFTAKQNNVQGWGWILTIGIIGIIVGFIALFNPVVSAIGIVLVVAIFFIVQGIG
FT                   AIATFFFIGKNS"
FT   regulatory      642340..642364
FT                   /locus_tag="Lm4b_00622"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(642340..642364)
FT                   /locus_tag="Lm4b_00623"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(642421..643122)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00623"
FT                   /product="Putative transcription regulator CRP/FNR family"
FT                   /note="Similar to transcription regulator CRP/FNR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00623"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04391"
FT                   /protein_id="CAS04391.1"
FT                   /translation="MSLLNEENSFYNVDLLNLLKDSSEAVLPYKRIRFRRNQQILAEGA
FT                   ETDYFYIIEDGVVSMSKNTCKEDSIINFLGKQECIGPLTLLGGAKSPVNYTTISEVSVY
FT                   QFERKYVLNKFLSSPDVFWQMNALMQSMVTPMLEREGYVNLPSSEKVLAGLIACGERFG
FT                   RIESDGSCLIPYYFTQKILGNYLNLARAYVATNLRKLEEDGIIALSPKPWRVNNFEIHK
FT                   QKLKENHEPYI"
FT   CDS_pept        complement(643198..643746)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00624"
FT                   /product="Putative protein involved in biotin metabolism
FT                   (BioY)"
FT                   /note="Similar to proteins involved in biotin metabolism
FT                   (BioY)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00624"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04392"
FT                   /protein_id="CAS04392.1"
FT                   /translation="MRDQKLKFLVVDALFAVIIALLAQVAIPLGPIPLTGQTFAIGLAA
FT                   TILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGILFGPTGGFIVGFIFNALLTGWLLE
FT                   KTKFTVPYAIVANILGAIVTLIFGVLWLKVSTGLDWPTAFLTGMVPFIIPGIIKAVFAA
FT                   LLGILIRDRLIKAKLLRAS"
FT   CDS_pept        643940..644272
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00625"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00625"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04393"
FT                   /protein_id="CAS04393.1"
FT                   /translation="MEVNPQFKKGVLELCCLFLIQKKDCYGYELANQVSKYIEVAEGAI
FT                   YPVLRRLVKEEYCSTYLVESNEGPSRKYYQLTVKGEIYLNELISEWNNFTDSVAKLLTE
FT                   GDAVNE"
FT   CDS_pept        644265..644855
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00626"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00626"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04394"
FT                   /protein_id="CAS04394.1"
FT                   /translation="MNKQDFLNELNQRLELLDPKERRELLSDYQEHFRNGIEAGKSEEQ
FT                   IVFDLGSPEEIAADIISERGIREEPAEMDYYYVPRKNQNENRSVSKQILIGVGLFFLDI
FT                   CLIIPIMVSLWSLVISLWATVGGFLLSPVILGVGIIFGADFEFYQMFVSIGLVGLGLML
FT                   LFVANALTQLTSKVTMAIIQWHKYAVKGGGKNA"
FT   CDS_pept        644848..645948
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00627"
FT                   /product="Putative cell surface protein"
FT                   /note="Similar to cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00627"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04395"
FT                   /protein_id="CAS04395.1"
FT                   /translation="MRKHHLSKKLFFAGLVLFIIGAIGVALTMNKGNMIEKGEPLTKQW
FT                   DLSAENINSIAFSSERDVTFEWKESTNGKNYIELKGNYSANDKKAIQKLDPVSEDGTSF
FT                   NITVPEEEDWYNGFGKIYAYGQQKVTVYLTKDTKLADLEVKSHSGDINVADFKVKKFVS
FT                   STNSGELKVSNLEANTAQMATSSGDLELSNMKANSSVETGSGQTDLTNLTGDLEVNGGS
FT                   GDVNVTGVKAKKLKIAIDSGDIELTSGTVTDLAVLTTSSGDIDASTKGKVQAESNSGAI
FT                   ELAGITNDVTAKTSSGDIDAAFIKQVKNIEINTDSGEVELDLPGDFKAIYEASSNSGSV
FT                   KAPTSDSNTDNRVTVKTSSGDIKIEK"
FT   regulatory      645957..645980
FT                   /locus_tag="Lm4b_00627"
FT                   /regulatory_class="terminator"
FT   CDS_pept        646054..646554
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00628"
FT                   /product="Putative transcription regulator"
FT                   /note="Weakly similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00628"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04396"
FT                   /protein_id="CAS04396.1"
FT                   /translation="MNFHIRKATNSDAEAIQHVAITSWHHTYQDLIPGDVQDDFLERFY
FT                   NVETLHNRISATPFAVVEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLE
FT                   VGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNHHAF
FT                   EEE"
FT   regulatory      646560..646596
FT                   /locus_tag="Lm4b_00628"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(646560..646596)
FT                   /locus_tag="Lm4b_00629"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(646602..646988)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00629"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00629"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04397"
FT                   /protein_id="CAS04397.1"
FT                   /translation="MRFIIAYLSIFVLGIFSALLVETILYDNVTPQLVFSAILFAAPVI
FT                   LVASTLGEIFYGFSKKASYFTFAIWGFAYGVVAAVIILSIIQVSGMLISVGVSILAGVI
FT                   MALLAIIFFFLRGGKSTSGKAATK"
FT   regulatory      complement(646997..647035)
FT                   /locus_tag="Lm4b_00630"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(647041..647385)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00630"
FT                   /product="Putative YvlA protein"
FT                   /note="Similar to B. subtilis YvlA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04398"
FT                   /protein_id="CAS04398.1"
FT                   /translation="MLDKKIISALSYFSLFFAPVITPAIIWCTTKDKEIRHHVRWALLT
FT                   QTTFVAGVVVMILLYNNVPFSTNSADTINFLALATVFFIVFLNVSILIFNLIRGITRIV
FT                   KHSDDNWARC"
FT   regulatory      complement(647502..647528)
FT                   /locus_tag="Lm4b_00631"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(647534..648874)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00631"
FT                   /product="Putative Conserved hypothetical membrane protein"
FT                   /note="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04399"
FT                   /protein_id="CAS04399.1"
FT                   /translation="MSSVHKVASISLFTLAWPIFLEQFLRLMISYIDVFMLGHYSDDAV
FT                   AATGVANQILVISIIIYGFISVGVQIIVAQMIGAKKHKEIENVITNGLVVAFLIGIVMS
FT                   IIFIFMSKNFLTWMGIDPHLVQVGAPFLEIIGGSSVVIAIHASILPILRAHGYVRQSIL
FT                   VPVTISIINVVGNYLFLYGPLAYLDYGVAGVGISTAVANFVGMGLAIWMLRKYIGYTFH
FT                   FKKLEQVSKKLLYSILRLGLPSAGENLSYAGSQLVVTAIIAILGTEALTTKVYASTVSQ
FT                   FVALFAIALGQASQIIIGRAVGAKEIDKAYKQGLRSWKIGLVVAIVVSVSIYLFAEPIM
FT                   SLFTTNTEIIAMTKELFLLSIFLELGRATNIIIISSLNSTGDVRFPFICGLIVMWIVSL
FT                   PFSYVLGISAGLGLVGVWLAYIIDEGVRAVLMYRRWRSKVWSLKSVI"
FT   CDS_pept        649040..649501
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00632"
FT                   /product="Putative transcription regulator MarR family"
FT                   /note="Similar to transcription regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00632"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04400"
FT                   /protein_id="CAS04400.1"
FT                   /translation="MSSKNQDLGHSVIKAFMNFKHAEIKSFQIPGYSKSETRFIFILSR
FT                   GLKSRGPKIRVSDLGHMLRISKPSVTQMIQSLEGKGLIKRVQNPEDKRSMYVELTEVGA
FT                   GVSEKMLDEFQASFEDMQEFLGEDDMKKLITLLEKLTDYLNTKSENKEA"
FT   CDS_pept        649521..651233
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00633"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00633"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04401"
FT                   /protein_id="CAS04401.1"
FT                   /translation="MKRLKPYWLSITAVLVLTFGQVIGQLYLPTLMSNIIDKGVVTGDT
FT                   DYIWSTGMQMLLISFASVILSVIVVYLASRISMGFGKDLRDKIFTKVEDFSLQEFDKVG
FT                   TSSLITRTTNDVVQIQNVLYMMMRLMVMAPIMLLGGIIMAVGRDAKLSLIFVVVLPLLL
FT                   LLVVILGGKAMPMFKSLQKKMDKLNRVIREGLTGIRVVRSFNRNEDELEKFEEANADYA
FT                   TTAIKVNRLLSLMSPLMMLLMNLTSIAIVWIGSIFIGNGDMQVGDLMAFIQYAMQIMMS
FT                   FMMLSAVFIMIPRAGASAERINEVLDMNAEILNPENPKTSAPPAKLSFEHVTFRYEGAE
FT                   KPVIEDITFEANAGETVAIIGSTGAGKSTLINMIPRFYDVESGVVKINGIDVREMDQSS
FT                   LRQKIGLVPQKAVLFTGTIASNMRYGKEDATDEEIWAALRTAQAENFVSKLANGLGSRV
FT                   EQGGNNFSGGQKQRLSIARSLIRKPEIYIFDDSFSALDFKTDAKLREALKAETTEAVTL
FT                   IVAQRITSVVNSDQIIVMNEGKIAGIGTHEELKETNQIYQEIMRSQLSEEEIA"
FT   CDS_pept        651230..653047
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00634"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00634"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04402"
FT                   /protein_id="CAS04402.1"
FT                   /translation="MSGPGPGGGMRMQTTAKPKNFKQTLFRLLGYMKPRSVAIIVVFIF
FT                   AILSTIFNIFSPKELGKATTEIFKGVMSPAGIDNDKIFNILMIVLVLYLGSSLFSFIQQ
FT                   YVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQ
FT                   AITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGILN
FT                   DTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGY
FT                   VGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFEMM
FT                   DEEEEKDEIPANVNQVAGEEHSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGPTG
FT                   AGKTTIINLLMRFYDVDGGQIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADNIA
FT                   YGREGATKEEVIGAAKAAYADDFIRRLPNGYDTVLNEEGSNISQGQKQLLTIARAILSD
FT                   PSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGSVI
FT                   EQGTHQELLDAKGFYADLYNSQFTGAQAV"
FT   regulatory      653057..653084
FT                   /locus_tag="Lm4b_00634"
FT                   /regulatory_class="terminator"
FT   CDS_pept        653164..653463
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00635"
FT                   /product="Putative phage shock protein E"
FT                   /note="Similar to E. coli phage shock protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00635"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04403"
FT                   /protein_id="CAS04403.1"
FT                   /translation="MYQSITANDLEQDLKKASHNILDVRDADAFVEGHIPDAINIPINE
FT                   LPEKLASLDKEKPYTIICYAGGRSERASQFLAAEGFDVTNVMGGMGAFHGIVTK"
FT   regulatory      653471..653496
FT                   /locus_tag="Lm4b_00635"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(653471..653496)
FT                   /locus_tag="Lm4b_00636"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(653505..655274)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00636"
FT                   /product="Putative internalin protein"
FT                   /note="Similar to internalin proteins, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00636"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04404"
FT                   /protein_id="CAS04404.1"
FT                   /translation="MRKMGVKIGLCVLLMMPFTISFSANVSAEEEISVKAAQDVVNIPD
FT                   PVLKSYLNGLLGQSSTSDITEAQMDTITNVTISNSSLTDLTGLDYAHNLTILHLSNTGV
FT                   TDYALVAKIPSLTNLSIAGDNLTNDSLPDLNNLSNITNLNLSPGKLDNNALTKFNKMSK
FT                   LSYLNLDSNPSITNIMPLKSIPNLATLFVQFCGINDFRGIDTFPKLVSLSAYGQNVGRT
FT                   VLINSSIKSSALNFDEANQTIFVPFTLMTERGVNFDGYLFPFTTNTSSASTYFTLNETK
FT                   IDGSRLTIDDKGITVSGITKSYFDTITKMEYNALYNNPAGSYQTPPNFNNYSVSGGSYD
FT                   HYFDIDHSLTITNDSAISYGEQTTVTEEQFLKDVHAETDDGTPVTSDFNTVVDFSKPGV
FT                   YTVTLNAENAAGLKATPTQVTVTILAKPVITADKSISYTKDSTKTDQQFLQDISAKTSD
FT                   GSKVTSDFDSVVDLAKVGTYKVTLNAVSADGLNADPVIVLVNVVEGNEPPTPPAPGPDP
FT                   TPDPTPNPNNPNINPNPDNGQSANSENASNPSNSEVNAALPNTGDASQATTVLIGIIIA
FT                   GVAILFFRQRKHS"
FT   regulatory      complement(655400..655426)
FT                   /locus_tag="Lm4b_00637"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(655435..656061)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00637"
FT                   /product="Putative acyl-carrier protein phosphodiesterase
FT                   and NAD(P)H dehydrogenase"
FT                   /note="Similar to acyl-carrier protein phosphodiesterase
FT                   and NAD(P)H dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00637"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04405"
FT                   /protein_id="CAS04405.1"
FT                   /translation="MTNVLFIKANGLPAERSVSVALYEIFLTEYKKSHPDDNVTELDLF
FT                   EADLPYYDVTMMSGLHKEAAGETLSPEEKRLADIANSYLDQFLAADKIVMAFPLWNFSI
FT                   PAQFLTYLFYLNQAGKTFKYTANGPVGLVADKKIALLNARGGIYSDGPMQSFEMSLSYV
FT                   KNVLAHFGISEPEMVIVEGHNAKPDQAKDIISAGAKEAVELAKIF"
FT   CDS_pept        656230..656679
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00638"
FT                   /product="Putative transcription regulator MarR family"
FT                   /note="Similar to transcription regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00638"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04406"
FT                   /protein_id="CAS04406.1"
FT                   /translation="MGVKTLKPCTERSELLYRMHLLSKEISHVFEQQTNMSFTKVEILF
FT                   HIQQTPGQSQNRLREKLYIDSASITRHLKRMEAQGLIVRKKQDENKRYTYLFLTSAGEA
FT                   ELATLLLEKEKFQNGALEAFSEEEVSALLKSVTKMMNNVEKMEEK"
FT   CDS_pept        656682..657623
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00639"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00639"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04407"
FT                   /protein_id="CAS04407.1"
FT                   /translation="MKAVVIENYGGKEELKEKEVAMPKAGKNQVIVKEAATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDEVFARPETTRFGTYAEYTA
FT                   VDDHLLAPLPEGISFDEAASIPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTLAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEERAKEKNVTATGIWLQPNGEQLKELGKLLANKTVKPIVG
FT                   ATFPFSEKGVFDAHALSETHHAVGKIVISFNK"
FT   regulatory      657636..657655
FT                   /locus_tag="Lm4b_00639"
FT                   /regulatory_class="terminator"
FT   CDS_pept        657733..658251
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00640"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04408"
FT                   /protein_id="CAS04408.1"
FT                   /translation="MKNGQIIMIREATKEDSSNIITYLNEVAGETDYLSFGQGEFAFSI
FT                   AEEAEYIEENDKNPGSVMLLCFIDDELASISQLMGHMKKRELHTSELAISIRKKYWGLG
FT                   IGTICMGELIKYAKSSEYLKLIYLEAVSENKRAINLYKKFGFIEAGEIPALMQVDSRYL
FT                   DVTMMYLVI"
FT   CDS_pept        complement(658248..658490)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00641"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00641"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04409"
FT                   /protein_id="CAS04409.1"
FT                   /translation="MHPIEQLLANNNTTTTDVESNTRLKEGSLQKIIDKDIRTSDISLR
FT                   ILSQIAIFLNTGADIIAKQLSDIEVVNDLVFLIED"
FT   CDS_pept        658597..660348
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00642"
FT                   /product="hypothetical protein"
FT                   /note="C-terminal domain similar to glycerophosphoryl
FT                   diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00642"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04410"
FT                   /protein_id="CAS04410.1"
FT                   /translation="MNDLKDIFKVLYQFKTDYLKVTLLLTILQAFVMGPFIYYFFFFIL
FT                   RVIGVPGITDANLGEVFSSPVAVIMLLILALLILLFIYYELGFFIMMAIYQLRGESYTV
FT                   FKIIQRLNVKAKYFLSYQAIYFLLYFFLLLPIAGLSLPITITENLYLPHFITDELMKTT
FT                   TGTWLYVIAIAIIFYISARLVFALPYFIEDKSLKISGAIRKSWKYPQKNLFFMLLKWVL
FT                   IIVAIGFLVSIIATIMMLPLLLIEKITPGIAVFIAGITLTILQVIGFFAAGIFQGIIAQ
FT                   LLVKNAFAIEGQPALVTRNQFPHKKRFIIVAIIVFIIFSSFNIYTVNATLYEPNTKIIA
FT                   HRGDTMNAVENTVEAIESAAEAGADYSEIDIQETKDHQFVVFHDMTLRRLAGSSKRVAD
FT                   MTLNELQQTKVKSGDYSSHIASFDEIIKTAKRNKIDLLVEVKLHGGESSDMVERLVTLL
FT                   KKEKVTDKYLVQSLDQPVIEKIEQADPTLETGIILALNIGNLPKTSADFIVLEDFSINK
FT                   RLLTQARQNNKRVFVWTVNKEKLMQMYLRKNVDGIITNYPKKAIELRESFNENDSLRSR
FT                   IENRLGF"
FT   regulatory      660355..660381
FT                   /locus_tag="Lm4b_00642"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(660356..660380)
FT                   /locus_tag="Lm4b_00643"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(660387..660881)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00643"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00643"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04411"
FT                   /protein_id="CAS04411.1"
FT                   /translation="MKKLKSVLLLMGIVTFALALTACGGTEDKASTEKTETAKADTKKK
FT                   ANPNELGDYKVEILSSEVVKDFEGNNAIAIKTKFTNNSKENISFMVAIDQQAFQNGTQL
FT                   ETTVSADASMGGSEKDVQPGGTLEVTELYKLQDTQNKVDVEAKELISFSKNAVKKSFEL
FT                   K"
FT   regulatory      complement(660939..660961)
FT                   /locus_tag="Lm4b_00644"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(660961..662103)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00644"
FT                   /product="Putative protein kinase"
FT                   /note="Similar to protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00644"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04412"
FT                   /protein_id="CAS04412.1"
FT                   /translation="MGEMTLAFIEEQYKELDNLNNKENPAVLTRNTSTGELFVRKIIPS
FT                   SFAPVIEQLKDLSSKYLPKIEVMIPNGNQLIVYEEYINGKNLADLMKANATFDADEVTR
FT                   LMLMLSDALTELHANAIIHRDIKPSNIMISSDGVLKLIDFDASRVFEVGKNQDTVNLGT
FT                   IGYAAPEQYGYSQTDVRSDIYSIGVLMLELLLGKNTLPDKEHATSLEKIAMQAAAFDPE
FT                   QRYQSIQDFRTAVKNDSLGPSYVSELSDFTELDNFSTESDWENVSADYEKDFVPWYKHI
FT                   PGFRTGTPWKMIVGVLGYIFLLFGLFTPPTEGVKMSPIVNFFNNFFLIVPAFVIFTNLC
FT                   GIWSKLPLLKSSSPGTRKAGIVIYIIVCVSIYGIYNEIFS"
FT   CDS_pept        662210..662665
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00645"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00645"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04413"
FT                   /protein_id="CAS04413.1"
FT                   /translation="MDGEKETSKLLHELKKATNLRQVLDENEAEFKSSEMVTYLKELLA
FT                   EKKLTKASVIRAARLHETYGYQIFSGVRRPSRDRTIALSFGFKLTGLEASRLLKYTEYP
FT                   PLYAKNRRDAIIIFALDHGYTLDQTNDSLYDLEEALIETYKEEKPLI"
FT   CDS_pept        662721..663113
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00646"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00646"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04414"
FT                   /protein_id="CAS04414.1"
FT                   /translation="MINEQTILQAATSEKNAGDFPKVVQSFKELGVTKYQFLVEKGIYV
FT                   FWDEMDNQVESKLNGVSMPISEEISRDRLKDAIKQAQAGKIDFEIFIKLAGLAGVRLWE
FT                   ADLSAMKVTYIDNTGNDLIVEPIPSI"
FT   regulatory      663123..663139
FT                   /locus_tag="Lm4b_00646"
FT                   /regulatory_class="terminator"
FT   CDS_pept        663210..663950
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00647"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00647"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04415"
FT                   /protein_id="CAS04415.1"
FT                   /translation="MDIITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAVTSIPTTFLGAMVNQMLPEAVYRFLYGA
FT                   LIVVLLGIMIWKKKRHNEKPHFLSEYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLL
FT                   DEKWIAILFNVLLIALFALNLIKI"
FT   regulatory      663958..663977
FT                   /locus_tag="Lm4b_00647"
FT                   /regulatory_class="terminator"
FT   CDS_pept        664036..664314
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00648"
FT                   /product="Hypothetical protein"
FT                   /note="Hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00648"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04416"
FT                   /protein_id="CAS04416.1"
FT                   /translation="MKRSWPDFAAFLLTILTVTWIILTWGLHISDIVPGGEKGVWYKLI
FT                   PLFLGIISTISVFFVKEKLVKWILLGFNILLLILIYFVYHIGEIGMF"
FT   CDS_pept        664331..664609
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00649"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00649"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04417"
FT                   /protein_id="CAS04417.1"
FT                   /translation="MDEPTKAVIYQILSKTEEQNATMDHLVFEMMQFPGAAAFTKNELL
FT                   FGIYWLETYHYIFRMNENQKTRYYRTEKGHEKLAELELLKKNSKKTT"
FT   regulatory      664594..664621
FT                   /locus_tag="Lm4b_00649"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(664602..664629)
FT                   /locus_tag="Lm4b_00650"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(664637..665080)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00650"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04418"
FT                   /protein_id="CAS04418.1"
FT                   /translation="MTASDLEDFLSTAITDYANEKVEAGTWDEEEALAKSQDSFNKLLY
FT                   DGITTPNEYLYSIISGEKIGYIWFHVDETRSGKHAFIYDFVIFEAFRGKGFGTKTLEAL
FT                   DALAKEMQITKIELHVFAHNQTAIGLYNKVGFQNTDITMAKYL"
FT   CDS_pept        complement(665111..665812)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00651"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00651"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04419"
FT                   /protein_id="CAS04419.1"
FT                   /translation="MKKTIQSVGVWGDSIMKGVLFNPEKNRYTLLKNNCIKRASEKLGL
FT                   TFQNHSTMGRTITKGHEILTKDLAKDATNDIAIIEFGGNDCDFNWTEVSENPTAEHIPS
FT                   TPLNIFETQLLEMIARLKKLDIKPILMTLPPLHAKRYFEFITRNGLNKDNILQFLGGDV
FT                   EMIYRWQERYSNTISRIAAETGSHIIDVRDSFLAEFHYENLLCADGIHPNEAGHIAMSR
FT                   KFIQYASFHKA"
FT   regulatory      complement(665850..665894)
FT                   /locus_tag="Lm4b_00652"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(665897..667576)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00652"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00652"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04420"
FT                   /protein_id="CAS04420.1"
FT                   /translation="MWKKHKWLIIAVLLLVIYVAPLFILGGNSHVRIHDNLDSNVTWYK
FT                   MVLDSGDYTAKVGTANIDQIMDDSVPRDSFDSEFVGIDWLYMIFSTPIAFAMSQLITRF
FT                   FAFLGLFLWARDYLIKDKKYLVPLYFVSLAFALTPFWPSGMLSTLGMPLALWAFLNIRN
FT                   NKRRIWNVVILTLLPFYSSLILGFCFFLVMVGCIWLYDVFKKKQVNIRFLLSMLYMTLL
FT                   YALVNYRFIYAMFLHPEPDSRSEFSLPELSFLSSIRLSFKNFIIGHTHDQALAGFVIIP
FT                   VLLLVLALIIIKREWGKEKLFLWLFGFNLFLSFWYGFWWYRGWNVIKEHVEIMRTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLIKKGNWWRKLAYVVVALQLVVVFANNSEIYYRTGNGSP
FT                   SINQFYATEQMEEIKDYIGKPQSSYRVGSIGLHPSVSQESGFYTVDGYVNSYPLAYKRA
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYIFSAELGKNYDFGKDSKKHIKQLDFNSEAFKK
FT                   VGGEYILSAVPIDNASEVGLQFEKAFDNKESYWKIYLYKATK"
FT   CDS_pept        667879..672663
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00653"
FT                   /product="Putative adhesin"
FT                   /note="Peptidoglycan bound protein (LPXTG motif) similar to
FT                   adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00653"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04421"
FT                   /protein_id="CAS04421.1"
FT                   /translation="MLKHNWQKVFVVMVAVALIFQLVPWSNIFAGAEENQTKTTQQIAQ
FT                   SDEQKGADENKTTVTSDNRETTKNLVNGKQLLKGSVDWNFTNKVTDANGNTKQTYAPGD
FT                   SLKFSISLAIPSYSESVLDETYTFWIQKDFFQGDKVTFVNPAIDGLTPRQNVFTDDSMK
FT                   NSIGTKTINGVEYIGYTLKFNQSPEALAKYEDEPLTNAKFDMFATINTTITTKDDYKAI
FT                   VIEDDKDVDISNIEVPVTPPTPDTDNGVLTASKAIDSAWRLDKDTGKYLKVATSSTNYT
FT                   PEKDDLVFYYVYATNNSAENAVLEKMVDELPAGFSIITEGSPEWQALSTASGSSLQRGW
FT                   VASADQTNLAPGATRYELPFSPAQTISKNGGGIYKTIAAKVTDPTKDLTNVTKSPTKGG
FT                   EGKSGSVTPSGKDVYDMAITTKISSTYDKNNKYIGAVSSTTTPVSISEGSTVGVTYTAI
FT                   NQGNYTKDVVVYAYVPAGYELNNDTSDFKTTNDKWKYETTVPSGGGVWSDIKVYSITLS
FT                   GGMASGATATATMYMKAIGMPDDGTYSAVDFYMAGEIGSFSNFNGDSTLDGAITDVDST
FT                   PDMNPGNDLISNVDGSTVKPIDGFQKEKPHVVKENAKSTATLQDEDDFDFDYVTFIKTP
FT                   EVIPSEGKVFEKTRLSAADAEKTARNMIGSDIMGSALKDYTPLADDGRITSPKTYMVYE
FT                   MNINPSGVEDTLNSSFTDTLPKGLKMLEYDIAGLNSSNKHIYGFTTNKFEGTPKFTNAD
FT                   GQDVIVYQKGLYSEKQVCIANPTLNDVGVRYFGNNADKMGVTGSVTKDARTLTLNFGQP
FT                   AADPMYSETKAAYKVYMIVVIDPDEIDYSSIMQNKATYTYNDKVITSYENSEMYWDAGG
FT                   GTAYAKKYVLDNKTNAYLSGSQYNVATPDADGNLSVGYKIRVRSAYEFDKSSINIGDII
FT                   AADNFKSISNVEVNGYEASPNTGFQIDGELENPVPLAADKYAVEAKATANTLDITNPVD
FT                   IPQMQLYNVLFKVNYQKVKYGAKLVNQAAGSEVATVVPLNLNLLKQDDISKTALTGYEF
FT                   KAYYADENGKADLTKPVKDTNSNEIVMTDSSGAANFIPTGYKTTSKNQEWKVVLVETKT
FT                   PTGYESNENKEYPVTVKSDANGNLSIPATTETSLEITNNDHGATTATIDNHADVKMIDV
FT                   NGAKTWTGDTEADRPDSIEVQLLQDGVAYGSPITVTKADDWKYEFKNVPETNADGNKYT
FT                   YTVLENTVTNYTSAVTGLDINNTLIKPDVKMINLDGQKTWKNDTENDRPASIEIQLQQN
FT                   GQDYGFPVTVTKDSDWKYEFKNLPETTNDGAAYNYTIVEKAVPGYETKVDGMNVINTKI
FT                   DAPKTTVSGEKTWKNDTAKDRPDYIEVQLLQNGQTYGDPVKVTKENDWKYSFKDLPKGD
FT                   ANNNDYRYSVTEIAVPGYKTTTDGMNLTNTKVTDEKNVTTASGTKTWVGDNEKTRPASI
FT                   EVQLLQNGKAYGTPIKVTAKSNWKYNFTNLPEKDKTGEKYSYTVSEKQVSGYSVKVKGM
FT                   DLTNTKVTKTTPKDTPKNTPKNTPKDTPKDTHSTNKPSKTKKLPGTGDTNGMLLFAGGL
FT                   VLLFLGLHLRRKSTK"
FT   regulatory      672673..672696
FT                   /locus_tag="Lm4b_00653"
FT                   /regulatory_class="terminator"
FT   CDS_pept        672760..673035
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00654"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00654"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04422"
FT                   /protein_id="CAS04422.1"
FT                   /translation="MKEELLQAIEVGEPVLLVTAIGYIVGIVETKGELIRLNDVYINCV
FT                   SASRVNRFSRGLAVNVNQVIGMQLLSKSEKDEMIGGWKAYVAPTAG"
FT   CDS_pept        673078..673605
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00655"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00655"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04423"
FT                   /protein_id="CAS04423.1"
FT                   /translation="MILLVVDTQKLIMTNNLYNFDSLVPNIEQLIVTARKNKIEIVYIR
FT                   HDDGPNTELTEGKEGFEIYEKFQPTTLERIFDKSVNSAFKGTGLLAYLKEKGTKKIVVA
FT                   GLQTDFCIDATVKCGFEHGFHMIVPAHANSTEDNHFMSGENSYKYYNEWMWPDRYATCI
FT                   SIEETINEMENN"
FT   regulatory      673603..673638
FT                   /locus_tag="Lm4b_00655"
FT                   /regulatory_class="terminator"
FT   CDS_pept        673691..674395
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00656"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00656"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04424"
FT                   /protein_id="CAS04424.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFENAFKTVFGKADHLKIENLYIKSRFY
FT                   SDEVYHRVVQGEMPKAKMHVYRITQALNDFDYQITKKEAEAFQHAYEQNQRKIELTSGI
FT                   KEILTWAKKNEITMGIITNGPKEHQQHKINDLQINDWIPTEHTFISGKVGIEKPDKKIF
FT                   KLVEEQIGIKGAETYYIGDSFENDVIGSKSAGWKSIWLNRRGHLIPTEAAFQPDYCVEN
FT                   EQQLFAILQEIF"
FT   regulatory      674399..674420
FT                   /locus_tag="Lm4b_00656"
FT                   /regulatory_class="terminator"
FT   CDS_pept        674500..674916
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00657"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00657"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04425"
FT                   /protein_id="CAS04425.1"
FT                   /translation="MKFSKATNYALHTMVYLANLSPEKSVGVKELATKQNVSPTYLSKV
FT                   LTMLVKAGFIESVTGVNGGYKLAEPASSISFLDVIQAIEGKGAFFHCDPKNHSESQPHC
FT                   LIGEVMNKAEQQMEDYLSKQTVGSIVVEIEKHQH"
FT   CDS_pept        674929..675522
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00658"
FT                   /product="Putative methyltransferase"
FT                   /note="Weakly similar to methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00658"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04426"
FT                   /protein_id="CAS04426.1"
FT                   /translation="MKHHHNHHGEAGFKRKVDYLDRPERSEVLSPEDFLQAMPIGKTAS
FT                   ILDLGAGTGFLTIPAAKFVDNTVFALDLDAKMLELIESKAKEAGLANVETLEASMDDIP
FT                   LEANSVDVVLASLVLHEADSLADVLREVSRVVKTGGYFASLEFDTKGTDLKGPPMEIQI
FT                   SAEKLKEELAGFGFEVVKNWQLDEGMYVSIAVKK"
FT   regulatory      675532..675578
FT                   /locus_tag="Lm4b_00658"
FT                   /regulatory_class="terminator"
FT   tRNA            complement(675591..675680)
FT                   /locus_tag="Lm4b_t00011"
FT                   /product="transfert RNA-Ser"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 65.56"
FT   regulatory      676206..676211
FT                   /locus_tag="Lm4b_00659"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        676222..676893
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00659"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00659"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04427"
FT                   /protein_id="CAS04427.1"
FT                   /translation="MEMKKLIKCTAPIFIATLIILPVSPSISALANETSEISEGINATE
FT                   KTIETEELVVEEISNDEYQVLDKETNETTSIEFSKNHMQSTITNPDGTIDTMIKKDNLI
FT                   YLNGEVIGEEVKEESRQLLKASAYKYVTTFKTKMSLKKTSASIAVSLAGLLGGPVGVFS
FT                   TVAGMLLTLKSYAPSKEVYIKIKQYYNSYSREIKNDYSIYKKSNYTGLLKTFTHKYRPY
FT                   G"
FT   CDS_pept        677649..678182
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00660"
FT                   /product="Putative transcription regulator (surface protein
FT                   PAg negative regulator par)"
FT                   /note="Similar to a transcription regulator (surface
FT                   protein PAg negative regulator par)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04428"
FT                   /protein_id="CAS04428.1"
FT                   /translation="MERKLIQEINLLENKKLVMNLNIVAIAIVLILTVLGIVFSGGFAI
FT                   TNGFMGIIWMFGGYAVAIVIHEAVHGIFFKAFRPEAKVKFGFKNGMAYAGSPGAFYTKA
FT                   QFFIISIAPFIVLTGLFIFLRFLGVNEAVLYLIFALHTSGCVGDFYYCILLINQPAGIV
FT                   VEDTDKGINFYSEG"
FT   regulatory      678232..678237
FT                   /locus_tag="Lm4b_00661"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        678246..679163
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00661"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00661"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04429"
FT                   /protein_id="CAS04429.1"
FT                   /translation="MKRITIGNSALTASEISLGCMRMADLSKEDANKVINTALENGIDF
FT                   FDHADIYGGGKSEEVFADAIDMNATIREKMILQSKCGIRQGFFDFSKEHIIASVEGSLK
FT                   RLKTDYLDTLLLHRPDTLFEPEEVAAAFTELEKSGKVRHFGVSNQNPGQIELLKKYVDQ
FT                   ELIANQLQFSIMHTGMIDTGFNVNMTIDPSLDRDGGILEYSRLNNMTIQAWSPFQYGFF
FT                   EGVFLDNDKFPELNKVIDKIAADKGVTNSAIAVAWIQRHPASFQTVVGTMNPGRIADIA
FT                   KASDVTLSREEWYEIYRAAGNQLP"
FT   regulatory      679174..679196
FT                   /locus_tag="Lm4b_00661"
FT                   /regulatory_class="terminator"
FT   CDS_pept        679429..681309
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00662"
FT                   /product="Putative heavy metal-transporting ATPase"
FT                   /note="Similar to heavy metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00662"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04430"
FT                   /protein_id="CAS04430.1"
FT                   /translation="MKEWMKQNWQFITTGISGILIVIGCLVGSDVGDFWTAVIFLSAFV
FT                   IGGFEQAKEGIQATIKTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYT
FT                   TNKSKREITKLMAFQPERAFRLLPNGDLEEVAAKELQLDDMVFVRPGESVPIDGVIVRG
FT                   STTLNEAAINGESVPATKTVGADVFGGTVNVSSAITVKVTQTFDNTIFSKIIRLVESAQ
FT                   SEPSKTARFIERFEDAYVKAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCAL
FT                   VASVTPATLAAISNGARHGILFKGGVHLENLRGVKAVAFDKTGTLTNGTPELTDRLFAE
FT                   NVDKQQVINVVGAMERQSLHPLAAAITQDLEAEITEKLTEIEVTDVAGWGVQAIYQEEN
FT                   WQVGKAGFVGKEAAAAFSNGAFERLAGEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTI
FT                   KALQAKGIKTIMVTGDNEQTGAAIQAELGMDYVVSGCLPEKKVDVLKELSVTYGSVAMV
FT                   GDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIPYAYNLSERLHWITWQN
FT                   ICFAIAVILVLITANVFQLINLPFGVVGHEGSTILVILNGLRLLRSNRKK"
FT   CDS_pept        681404..682132
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00663"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00663"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04431"
FT                   /protein_id="CAS04431.1"
FT                   /translation="MKKINWTQWIALFVFASMGISVVFTIYEIFTAPIKQPATGPHVTL
FT                   RGDYIFLLFEIILGIFILLLPSIIARRFKFEIPGLVYILFIVFLYGSIYLGTVQKFYST
FT                   VPHWDKILHTFSGAMLGAIGFSFVSLLNANNKVVMKLKPGFIAVFAFCFAVTMGAFWEV
FT                   YEYTFDGIMNLNMQRYNLSNGTPLTGRAALEDTMTDIIVDIIGALFIVIVGYFALKKGR
FT                   PWMERFEFKRKNWKKEPKKK"
FT   regulatory      682143..682162
FT                   /locus_tag="Lm4b_00663"
FT                   /regulatory_class="terminator"
FT   CDS_pept        682272..682922
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00664"
FT                   /product="Putative transaldolase"
FT                   /note="Similar to putative transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00664"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04432"
FT                   /protein_id="CAS04432.1"
FT                   /translation="MFLDTGNLEEIKKALQFPFFEGVTTNPTILLKENKPRNTHIANIP
FT                   AKVVFVQAAGLTEEEIWEDVLRIQAIEPAEGTVIGLKIPAHEAGIKVIAKVRANFPNEI
FT                   ILATAIFSSEQGYIAALSGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLEDVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHQAALPK"
FT   regulatory      682932..682958
FT                   /locus_tag="Lm4b_00664"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(682932..682958)
FT                   /locus_tag="Lm4b_00665"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(682965..684785)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00665"
FT                   /note="Conserved hypothetical protein"
FT                   /note="Similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00665"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04433"
FT                   /protein_id="CAS04433.1"
FT                   /translation="MILFYFLLIIGKFTFAYFQIFKDPNFLALGMDLLFIVLLLGLIHL
FT                   FAPVRSHIYWYAGMSLFIGILMLVCVLYARFYNEVPTYHSFSLIGEVGVVKNSATSLLS
FT                   GTDWLYILDIVLLPFILYFHIKKGHEFPSFRITSRVYGVSFISTLLVLSGFTYFMMQQN
FT                   IISDSKRAKRMGIFTFNISTALTGADHVKAADITAKNVNDIKGVSVKSNPDYFGAAKGK
FT                   NLIIVQLESFQRNLTNVKINGQSITPTLDSLQNETMYSNQFFQTVSKSNTADAEWSVYT
FT                   STFPSGYYTNTQTYGDRVIPSMPRLLGKNDYKTATFHTNDASFYNRDEFYPAVGFDKFY
FT                   DRKFFGDEDVIGFSPSDEVLYNKAFPILEEQYKNNQKFYAQLISVSSHMPFDIPKDKQE
FT                   IDLPSDLKDTELGNYFEAVHYADKQLGEFIQKLKDSGIWDDSVVVFYGDHHIIKTDQLP
FT                   EEQKKYVNRSTELKADPADDYRIPFFLHYPGMENPGEIKNVGGEIDIMPTVMNLLGIKT
FT                   GDQIMFGTDILNSSNNYVPERYTMPEGSYFTNSYMYQPDESFETGAATNYDGTNKELSS
FT                   DVKKRFDASRKLLQYSDSYVNNLPLRDEDK"
FT   regulatory      685006..685011
FT                   /locus_tag="Lm4b_00666"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        685020..686411
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00666"
FT                   /product="Putative amino acid transporter"
FT                   /note="Similar to amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00666"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04434"
FT                   /protein_id="CAS04434.1"
FT                   /translation="MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGI
FT                   FILPGTVAAKNAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHISIPEAISGPFNPEVGTFINLPAI
FT                   IIVLVIAFLLTLGIKESTRVNTIMVAIKVGVILLFLVVGVFYVKPDNWQPFMPFGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKDPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVINQDWVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEINQKYQTPVKNTWIFAVIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKDIQARGFKVPFYPVLPIVSFLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHS
FT                   ELLKK"
FT   regulatory      686451..686492
FT                   /locus_tag="Lm4b_00666"
FT                   /regulatory_class="terminator"
FT   CDS_pept        686501..687340
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00667"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00667"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04435"
FT                   /protein_id="CAS04435.1"
FT                   /translation="MAEISEELRLGEVVLNVGHLKEMAGFYQEVIGLKLLEENERMVRL
FT                   GVSGSDEALLVLKKIDNAVVPEVPRIGLFHTAFLLPTRESLADVLLHLAKSGYPIDGAG
FT                   DHAYSEALYLHDIEGNGIEIYADRPKAEWMRDGDGNLPMVTEQVDVDSLLQIATDEPFT
FT                   GMPNGTIIGHVHLQVADADKAEQFYKEVLGMNLTTAIPSARFFAAGDYHHHIGSNVWAG
FT                   RNLELLQENETGLAWFTIITPDKDAIITNLIEQGYDVKRLENTISVTDSNGIKIHFK"
FT   regulatory      complement(687347..687379)
FT                   /locus_tag="Lm4b_00668"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(687423..687707)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00668"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00668"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04436"
FT                   /protein_id="CAS04436.1"
FT                   /translation="MEFMSMIVTGIVLAAIISGLSFVVGKLSGLSWFWIAFCANSGFFI
FT                   IFITVQNSFPDNAAVALSYLNLGIGVVLIALTLFQSSNWLFKKTMQRKH"
FT   CDS_pept        687805..688755
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00669"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00669"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04437"
FT                   /protein_id="CAS04437.1"
FT                   /translation="MIEFFKTTNEKMEQISALEDGCWVKVTAPTDDEIEMLSKEMDVPK
FT                   PYILDALDSEERSRIELKRAEQDVRHSLVIVDYPYESEDELGYAMYETLPIGIVLTRKH
FT                   LVTITLRDLPILKDVQSMKLEEYDTTNHKQFLLKLLYAVSYYYLKYLNQIIKQTNNLEI
FT                   QIKQSMKNEQLYAFMAVQKSLVFFATALQSNKAILDKMEDVEHFMQQEDNHDLLRDVII
FT                   ENKQAIAMTDTYTQIISGMSDVFSSVISNNLNIVMKFLTSFTIILSLPTIVASIYGMNI
FT                   KLPFMHNEHAFALILLFTLLITTGVTVIFWRRKYF"
FT   CDS_pept        688779..689420
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00670"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04438"
FT                   /protein_id="CAS04438.1"
FT                   /translation="MEKQTYEKLAYYTIKEKILSGKLHVGQHISEAGIAKELSISRTPV
FT                   RKAIAVLVSEELIEYELNRGAIVIESSMSAGRFIELLEMAEILVVQTIEKCKNKNLTYK
FT                   PEQGNALLEEMREIQKEEDVEAYLSLLSKWLLQFVAQLANSYAEDIVRKMKRDFFNKAQ
FT                   KDIKMIPVLLEEETMETLEQLTYYMVEKKHDLAKEVIQKLVNLYIIRTFR"
FT   CDS_pept        689463..692153
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00671"
FT                   /product="Putative Conserved membrane protein"
FT                   /note="Conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04439"
FT                   /protein_id="CAS04439.1"
FT                   /translation="MRKVYEIFILDWRRLFKAPLALLLVIALIILPSLYAWFNIEALWD
FT                   PYSNTSGIKVAVSIDDEGAEIDVPGKKPQQVNVGDQLKKTLEKNKKLGWTFVSEDEAKK
FT                   GVKSGKYYASIHIPKDFSEDMVSVVNDNVTKPTIDYSVNEKINAIAPKMTESGATTIVN
FT                   QISSEFVGTVSKAVLEEFNKAGIDLENELPTIRRLKTKVFQVQDALPELKKMGAEAVKI
FT                   EAKLPELKAKANQVVELNEKIPELNKATENVLLVEQQLPKIDQLGQDILVLQKKIPEIK
FT                   QIAESVKEVDENFGTIKKTVNDAVNESGKALDVIDTAMAAIPTVEKIAQNGSGYVDKVS
FT                   DFADEINKSFDTLAPAIKQNLTLMKQMADNIYQVTEAIKNGSITPEQAITELKKMEQDI
FT                   DSLQQMITKQTATLESLNETLPNKPFTDLIANLKTINSQLGAQKETITKVRTELENGAQ
FT                   PSEELLNQLNEQAKKVSAKLDQILANYDSEIVPAIKVGLNQIQGDLKDSQKLLETLQAK
FT                   IPEITQVLKDSRETLQTGQTYLKEFQERLPEIQKTLDEATKVINTKLDTIIAGINEAAN
FT                   FYQNDYPNVKANIKKAANFIRDDLPGLEKEINQASNLIQEKMPEFEKAIKIAADLSREE
FT                   LPEFEKAINNAANKITDFDKNYDLQSIIKMLRNDADKDSSFIANPVKLKETSYYPIPNY
FT                   GSASSPFYTALCLWVGALLLISLLRVDVEVPAGIFSHYHRYFGRLLTFLSIGLMQALIV
FT                   TLGNIFLLGVSIAEPLLHVLFSMFISVVFMTIVYTLVSLFNNVGKGIAIILLVLQISGA
FT                   GGNFPIQVSPPFFQAIYPFLPFTYAVSLIRESVGGLYMPTVWIDMSVLAGFAILFITLG
FT                   ILLKKPLDKVVPKLSEKAKRSKLIH"
FT   CDS_pept        692199..692846
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00672"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00672"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04440"
FT                   /protein_id="CAS04440.1"
FT                   /translation="MANKFKTLDKMVYNLLLEKIKNGELVANEHLAEEKLAREFGVSRS
FT                   PIRKAIATLTAQGIVSYHENSGAVLNDCIVDSDRYVQLMETIEIFVDAAIAKAAHFGYE
FT                   MDLEKLYARMQEMERLSYLTDIENYYDAHHRFILCLISFAENPYQVRIVKQIFFQMIHF
FT                   SDGINMFKSVEIREWTNKKSNQICELLAEEETELARKTIKSMFAELTIQAYR"
FT   regulatory      692850..692873
FT                   /locus_tag="Lm4b_00672"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(692856..693392)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00673"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00673"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04441"
FT                   /protein_id="CAS04441.1"
FT                   /translation="MNQNKITAGGLEFLVRFAAPTDRLKINDLMIDTARWLKESGSTQW
FT                   SDILHGFDVHNIEQRIELGEVALFETEAGALAGAMIIRKTPSDWDTDLWEDLAIDKAYY
FT                   LHRIMVSRAFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNETLNQMYVRYGFQFSG
FT                   KKNGFYLYQKELSLL"
FT   CDS_pept        complement(693379..694371)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00674"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00674"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04442"
FT                   /protein_id="CAS04442.1"
FT                   /translation="MTISQVKQTAKESLRGNWGIAIGIFVLAWLIETVGGGLIGWIPVI
FT                   GWIAIFLLTGPLYTGVAWVYLAISRREQPDVAYMFSGFKQFGRTVLAYLLISIFTFLWS
FT                   LLLIVPGIIKTYSYSQTFFILRDNPNISALDAITESRHMMNGHKGRLFGLSLTFLLWYL
FT                   IPLAVAIAGTVIVAGGMATTSYTADPAEVLSALAAGATFGGLVLILASWLITLGISLYV
FT                   YPYLITSIAVFYDDLYAATEGTFTEETVIVEEEVNPFGTTEADPFAEDTHPEGFGPEAT
FT                   KEPETPVVPEAPEAPETPETPEVPETPEAPETPEAPETPEAPKDNNEPK"
FT   CDS_pept        694562..694771
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00675"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00675"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04443"
FT                   /protein_id="CAS04443.1"
FT                   /translation="MAHENLRELEDQLIELRQTYQEVISETREFEDPQLQNGPINAAEV
FT                   RLSALRHEIAEVEKKIKKAESKTE"
FT   CDS_pept        694839..695546
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00676"
FT                   /product="Putative phosphoprotein phosphatase"
FT                   /note="Similar to phosphoprotein phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00676"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04444"
FT                   /protein_id="CAS04444.1"
FT                   /translation="MKPIFAVGDVHGEITLLDELLENWDKEQERLLFVGDLIDRGENPA
FT                   AVLRRVKALADQTGAIVLKGNHEQMLLDFLENPSGKMHYYLSQGGMETIQSLIADSLDK
FT                   KMTPEGLAERVKEEAAELIDFIRNLPLYYEEGKYVFVHAGVDLTKKDWHDTEERDFFWI
FT                   REPFLFGQNKTGKVFIFGHTPVQNLHIDESSGIWVSEDKTRLDIDGGAVFGGELHGVVV
FT                   EEKVITKSFSVKK"
FT   regulatory      695547..695583
FT                   /locus_tag="Lm4b_00676"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(695547..695583)
FT                   /locus_tag="Lm4b_00677"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(695592..696155)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00677"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00677"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04445"
FT                   /protein_id="CAS04445.1"
FT                   /translation="MEQNKEKLTKPTSEKNYFWPIMIISFVAVVVILLLFFSPIGYQGA
FT                   VHFDITIFPRMNAIFNSFTFVFLVIALWAIIKKKNIKMHRGFILAAFTSTLFFLVTYLT
FT                   FHYLSAETSTFGGTGIIRPIYFFILITHSFLAAIVVPLALFALVWGWTMQIEKHKKIVR
FT                   WTMPIWLYVSLTGVLVYLFMAPYY"
FT   CDS_pept        696275..696691
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00678"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00678"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04446"
FT                   /protein_id="CAS04446.1"
FT                   /translation="MSIIARELTKAEEAEIIRLKEEGEVMLQTDGTPEERIEKIAEYLK
FT                   QTSPDPDLAEELGYILGSLYGEAVREKYEWRWLFVSENDLEGYAITSKEHGYTFMVHDY
FT                   FMQVIVQNKPDNSKMLFELMVDMTGNRNDFRMIG"
FT   regulatory      697235..697240
FT                   /locus_tag="Lm4b_00679"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        697249..698418
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00679"
FT                   /product="Putative type II DNA modification enzyme
FT                   (methyltransferase)"
FT                   /note="similar to type II DNA modification enzyme
FT                   (methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00679"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04447"
FT                   /protein_id="CAS04447.1"
FT                   /translation="MIRVVDLFSGAGGLTLGFQNRIINNTFLPMSDYNILFANEVDKHA
FT                   SEAFSLNFPQIPMLNCSITELTEDYLDNHEIEYSNIDLVIGGPPCQSFSTVGRRQYDEK
FT                   ATMYKEYRRMLSFLQPKVFLFENVTGLLTMKNDEGEPVLEDIRKEFGDFSDFEIDLTYE
FT                   IRETVLNAKHFGVPQNRERVFLLGIRKDLEIKQNWEFPERLLFEDDFLTLEDAIGDLPA
FT                   LRNGERKDAYDGDPYTPYQNLMRNNSTILMDHFNGLNGEKMLRIMETVIPGEGKKYINE
FT                   LVESGQLDSKYYLTSGYNNTYSKLWWDRPSSTITNNLSTPSSFRCIHPIQNRALTPREG
FT                   ARIQSFPDTFQFVGSKEKINSQIGNAVPPLLAIVIAQEIYNFFEENNWI"
FT   regulatory      698438..698443
FT                   /locus_tag="Lm4b_00680"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        698451..700592
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00680"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04448"
FT                   /protein_id="CAS04448.1"
FT                   /translation="MNEKQNEIPFDFSYYALHLLGKGLYKNRWSAISELIANGIDARAT
FT                   KISLYMNLIDKEKAVIEIFDNGTGMDYDDLVSKYVHIGRNKRDEELDDVERNALMGRKG
FT                   IGKLAALNLSQKYYLISKTRNESSLWCLDATEVNKSDTPKLKRVESKSVALESIEHWKE
FT                   NSTGTMIKLTNVDMTGFGIQSMEGLKLKLSDFYLLNQMSCEIEVAYITTKEEKNNIKFK
FT                   KVEKKVAFKNFYGFFENMENDKYKASLADTVRFPSVYETITEKPRKVLYFDKQNFPEIK
FT                   GKRRFKNKNGTLSEKEYEFELKGWIGIHTSTKKDDAERNDITFFRNNTYTPNKLRLYIR
FT                   DKLIVEDFMAQYIRSTQATSGYIEGEISFDILDVNDLEDITTSDRQGFTHEDDRVKLLI
FT                   DILKPIVNLLIRERNKMGGQIRKEEEEYREQEREEIRKQKDVEAIKRKEAEDQKEAAEK
FT                   AKAKVNQENMILKNRITQKDIHLGSEKKRNIFLKSSLSEDKKSFSQKAHMIRINVKTIE
FT                   NTTSFLVNEITKEKPKFNIIKEKLKIISHNTNRIKRIISYVDSAKFNIDNEKTEGDLIG
FT                   FFEEYVVNIANQEWEKPQGKVVNPGKCSLIKVFSPQDIGVLIDNLFSNSSKNKARNIII
FT                   SIKEDKKYCYLNFKDDGNGLPSHITDTAELFEFGKSYTIRGTGVGLAHIKDIVNDMDGK
FT                   VYIPKDNKEGFEVEMRLTK"
FT   CDS_pept        700589..701581
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00681"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00681"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04449"
FT                   /protein_id="CAS04449.1"
FT                   /translation="MRADLSIMWVEDTTSWYTEQKDLLNMDIESLGIDIEFTRISTIDD
FT                   FYKLVRNDNTGFSKYDIFFVDYALSSDTEQKGSNIIVKLKDMGLTTDILFYSSKNIREI
FT                   REIVKKDIEQFEGIYLADRDKDFRDKSFQLVEKNIKSLSSIKNIRGLLMDQTSENDFIV
FT                   KSYISKEINELLPEQKEKIYKWFEKEVDKNIEEVTKTIKGYVERKPSTIEKYLKLPSYI
FT                   LPVKLQYNLLEEIININGVETFVDSTIDYYLKKVVSNRNKLAHRKLVMCRQQQHLLQYN
FT                   NINTFLNDDSNVCDNHEGDVVSIDDWIQLRVEVKEYGKLFDDLWEKIKS"
FT   CDS_pept        701829..702458
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00682"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00682"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04450"
FT                   /protein_id="CAS04450.1"
FT                   /translation="MNVNEQKVLVLNNLVEHYGYQDWWEADNRLADWLSMILIQRTTEK
FT                   NAKQALANLAPYLDLDSLIEMDKAKLEELIYPAGFYKQKSIYIKALAEWFYGHGASLDK
FT                   FQTYSTEALRKELVGIKGVGEETADAMLLYIFERNVFIADLYARRLFTRLGFGEYTTYA
FT                   QMRDEFMPIIENIPHKLCKEWHSVIDVHGKHFGKDKSMNESWLLES"
FT   CDS_pept        complement(702455..703351)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00683"
FT                   /product="Putative transcription regulator (Rgg type)"
FT                   /note="similar to transcription regulator (Rgg type)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00683"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04451"
FT                   /protein_id="CAS04451.1"
FT                   /translation="MVGYGKTVRDIRTSKGIHQKDLYDNIISKSFAIEFEKGKHDITLT
FT                   LFEKILKRMNMDLDEFFYIHRELSVSAEKNYLCMNQERGNIYDLASLELLYNELSKHNG
FT                   ELVEVWKAFVRSRIKLVEHLFKYHEFTVDVITPKDKCTIQKYLFSIDTWTLEELKICAN
FT                   SIYFFEEDLQIQFLNQVIKAIHSYKNYDRARRVLCTLLINTIEMFISRGQLSSASKLII
FT                   LLDSLCLYNESAFYRNISHFLKGLVKMQNNHIQEGYNQAKKAIQIMNDLRFEEIAYLYE
FT                   ILLDQFIRIKGIDIVKS"
FT   regulatory      702542..702562
FT                   /locus_tag="Lm4b_00682"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(703359..703364)
FT                   /locus_tag="Lm4b_00683"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      703572..703577
FT                   /locus_tag="Lm4b_00684"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        703585..703866
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00684"
FT                   /product="Putative transposase"
FT                   /note="similar to transposases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00684"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04452"
FT                   /protein_id="CAS04452.1"
FT                   /translation="MAKAKYDENFKKSLVALYRRGKTKHSICQEFSVPNSTFGKWIKKF
FT                   NNDDNIESNEILNILQAQELKKQRALLEEELSILTEAINVFENPPIKN"
FT   regulatory      703911..703945
FT                   /locus_tag="Lm4b_00684"
FT                   /regulatory_class="terminator"
FT   regulatory      704130..704135
FT                   /locus_tag="Lm4b_00685"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        704144..706618
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00685"
FT                   /product="Putative peptidoglycan linked protein (LPxTG)"
FT                   /note="peptidoglycan linked protein (LPxTG), highly similar
FT                   to ORFA of Listeria seeligeri"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00685"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04453"
FT                   /protein_id="CAS04453.1"
FT                   /translation="MKKILHIVIALSVICSIILVPVDWSAKAGGNNKRDDLIKSVSFYN
FT                   SNGQNVTAKENYNEKLNYFLEVAFGGNSFQKGDYFNITLSSDALLYTEKAYDLKVDIDP
FT                   TAVTNEQVVGKVTVEKINGSPTLHFVFTEDSESFFINSFDASFKIQVMPAHGDKNVINL
FT                   SYSGAAKNFKNIGTSSVEWNVNMADDWPPVGISDFSKISGDLYHAILVYEKPSSKVNYE
FT                   TEILVSYPLFEKRIPLGNVQNIKIEVWDEAKEIYRVGVAGVDYGTITYDVGTPFVGGPI
FT                   FQMNCTIPFKGISTKTRVSFDIDTNVDGKPGTTDPYLVSLSSVSSATKSLEFYPVNNAD
FT                   TKMTAAFFGKVTTRFEDELGNPVTFDNYSTVTTPGKVNQDGKFEIAEPFLHNSVQNVDK
FT                   HAYDTLLDTNKYKLLEVTSPNKLSETADNLSIQIKRGYQNDVLYKIKALQKPVISALPE
FT                   IEYSKTVNRTMEEFLEDVEAKTDIPADIDCDLTNVKWGVPGDYLVLITAVNEDNQAADP
FT                   VPVTIKISKNPAPVITVDPEIIYDKTVTKEESTLLNEVNARTNDGSTITSNINDKVKWG
FT                   VPGDYEVTLNAVNEDGVAAESKTFIVRILKSPAPIITVDPEITYPKTITKTEAELLQEV
FT                   NAQTNDGSPLVSDMNDKVKWGVPGDYEVTLNAINEDGVAAEAKTFIVRILKSPAPIITV
FT                   DPEITYDSSVIKDERELLKDVHARSSDGSVITSDSQVKVKWKKTGSYTVTLNAVNEDGI
FT                   SANSVQFTVHIVDAKAIPVVIEEKPESTPKPDTKEKVVIKKEKLPKTGDTNTKTILSGI
FT                   FCLGAWYLLRRK"
FT   regulatory      706626..706647
FT                   /locus_tag="Lm4b_00685"
FT                   /regulatory_class="terminator"
FT   regulatory      706785..706790
FT                   /locus_tag="Lm4b_00686"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        706802..707470
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00686"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00686"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04454"
FT                   /protein_id="CAS04454.1"
FT                   /translation="MVVKQMDDWSTLIGELEHNTPEKVWIVREELNISEVFEIQKLEAH
FT                   FILVLEGVLRMENEHQQILHYFRENNVIYQSPYELRVQNKLRLVAETPAHIVLLHREFF
FT                   LNYATNQPAYSEKLVRAIMDNAASFMFELMKNDLKSEDRLAYSLQQLCQSLELEVKNEF
FT                   YLLPHYINKNKLALYSDISRKSLYKYLQNLERKGQIKMNGNQILVRISRFTNSENVDWL
FT                   "
FT   regulatory      707646..707651
FT                   /locus_tag="Lm4b_00687"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        707659..709275
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00687"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /note="similar to internalin proteins, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00687"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04455"
FT                   /protein_id="CAS04455.1"
FT                   /translation="MKLGKVGALLLGTALVFQAPFQVFATSVNGEEQVKKEAAAPKISV
FT                   NKQTLAATSDLEQTVGEAITKTIHLQDQALPNNEWGSYISDVKVTLSNMDGISYDVKYG
FT                   PLSEDGTHYQYADITLSGAPTKAGTGSISLEYYDGAGNGGVYSYSVNTKSKTTIQYVDG
FT                   DGNKLAEDTVKTGDLNTAYTSEPKTIDGYEVDETKLPSNQNGQFAETNQTVTYIYSKTK
FT                   SEVNKGTVGISFYTPDGSRRELKSSLDLSYAYPDGVPTDTVTFGDLAKNTTYKDLRNTP
FT                   DAPTLLWNDLLHYMVDYMNGDIDAAQFEEAVGLTPANFDLDFISRNFEGYKFDEAMYQE
FT                   NLSKLVTFEQDGDQVDLQVPFKKVEVGADITVKYVDTAGNELASVETLSGDVDDNYTSE
FT                   AKTIDGWTLKETPNNATGVFSKEAQTVTYVYEKNDDTDVTPAPDNSADTNDDSNSSDNT
FT                   ATTDDNSSSAVKEKAQTQASSPKAGKVTTQESTSNKVTAQSKESLPKTGDNVLESSLLV
FT                   GLGMLLLGGLFVFLRKTRKVK"
FT   regulatory      complement(709281..709297)
FT                   /locus_tag="Lm4b_00688"
FT                   /regulatory_class="terminator"
FT   regulatory      709302..709343
FT                   /locus_tag="Lm4b_00687"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(709361..709669)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00688"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00688"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04456"
FT                   /protein_id="CAS04456.1"
FT                   /translation="MKVSKSFEAFAKEAPEVHSAWMETVHKLDAASKLDKKTEELAYIA
FT                   VMAATRLESGLPFHVKMAKTNGATRDEIISAVLVGLPAVGNTVISALPVALEAYDEV"
FT   regulatory      complement(709705..709723)
FT                   /gene="thiD"
FT                   /locus_tag="Lm4b_00689"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(709732..710547)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="Lm4b_00689"
FT                   /product="Putative phosphomethylpyrimidine kinase thiD"
FT                   /note="Highly similar to phosphomethylpyrimidine kinase
FT                   thiD"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00689"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04457"
FT                   /protein_id="CAS04457.1"
FT                   /translation="MTIKKTLTIAGSDSSGGAGLQADLKTFEEYGTYGFSAITTIVTMD
FT                   PDNNWAHGVTPIDAQLVREQLKTILSGGPVDAMKTGMLGSIDIIKATREAIDKYDLKNV
FT                   VIDPVMVCKGEDELIQPENAEAIRDLLLPKATITTPNLFEAGQLSGLGKLTTLDDMKKA
FT                   AKKIIELGAKYVVIKGGKALESDKAIDLLYDGKEFTIYEVEKISPSHNHGAGCTFAAAI
FT                   TAGLAKGLTVEEAVAKAKDYVTAAIKGGFALNEFIGPVWHGAYNKAENR"
FT   CDS_pept        complement(710573..711439)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00690"
FT                   /note="Conserved hypothetical protein"
FT                   /note="Conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04458"
FT                   /protein_id="CAS04458.1"
FT                   /translation="MIKVIASDMDGTLLNSDIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKANLYAPAICMNGAEIRDEHGKIILQHPIDRNLARNTYNTLTELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDVPAETIMDKVEERFESKDVHEIPDVERILGN
FT                   KDLTILKFISFSSDKDILAKAKQKLEKDSELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGVTLDETFAIGDNMNDISMLKMAGYSVAMGNGEEEVKDLAEHVTLSNDEHGVAAAIY
FT                   KMLETND"
FT   CDS_pept        711613..712176
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00691"
FT                   /product="Putative acetyl transferase"
FT                   /note="Similar to acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04459"
FT                   /protein_id="CAS04459.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELAHGRNRARKFCREINDAMDSESRA
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGDNCMMAPG
FT                   VHIYTATHPLDPVERNSGLELGKPVEIGDNVWIGGRAIINPGVKLGNNVVVASGAVVTK
FT                   SFPDNVVLAGNPARVIKTIEVEEK"
FT   CDS_pept        712173..712436
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00692"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown Listeria proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00692"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04460"
FT                   /protein_id="CAS04460.1"
FT                   /translation="MIIADSKIFEQMENELAKAKAATTKASQDKHLHGLMLLVQLAKTG
FT                   DETTAAVEPIAIQSAEPAQIASMDGKKIELEDGANGDSLLDF"
FT   CDS_pept        712446..712823
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00693"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00693"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04461"
FT                   /protein_id="CAS04461.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKDVLGSYASTWETGVQYQM
FT                   FHAGGILVVGLLMEKQASRLYTWAAILFSVGIVFFSGSLYVLSISKVSILGAITPIGGV
FT                   CFVVGWFLLILGVSRRTMSRY"
FT   regulatory      712832..712869
FT                   /locus_tag="Lm4b_00693"
FT                   /regulatory_class="terminator"
FT   CDS_pept        712937..713872
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00694"
FT                   /product="Putative ABC transporter (ATP-binding protein)"
FT                   /note="Similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00694"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04462"
FT                   /protein_id="CAS04462.1"
FT                   /translation="MTYALEIKGLRKIYSTGVEALRGVDLTVEEGDFYALLGPNGAGKS
FT                   TTIGIITSLVNKTSGQVSVFGYDLDTDIVRAKQQIGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVSRKEAIKRSEKYLKQSNLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRREMWTFLRELNESGTTIILTTHYLEEAEMLCRNIGIIQSGELIENTSMKS
FT                   LLSKLQFETFIFDLEPYEGAFEITGYNHVFEDKQTLSVEVERNQGVNHIFEQLSEHGIK
FT                   VLSMRNKSNRLEELFLKITEEKHQVGEKHV"
FT   CDS_pept        713865..714635
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00695"
FT                   /product="Putative ABC transporter, permease protein"
FT                   /note="Similar to putative ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00695"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04463"
FT                   /protein_id="CAS04463.1"
FT                   /translation="MFNLYFTALKSLAAKETNRYMRIWVQTLVPPVITTSLYFIIFGKM
FT                   IGSRIGEMNGFSYMEYIVPGLIMMSVITSSYANVSSSFFSQKFQKNIEEILVAPVPTHI
FT                   IIWGFLIGGIGRSVLVGALVTLISMVFVPIHIHSWTIGIITFLMTAILFSLAGLINGIF
FT                   ARSFDDVSIVPTFVLQPLTYLGGVFYAISMLPPIWQAISKVNPIVYMISGFRYGFLGVT
FT                   DVPVAISLSILVVFSAVLYSICWYLISKGRGLRS"
FT   regulatory      714654..714673
FT                   /locus_tag="Lm4b_00695"
FT                   /regulatory_class="terminator"
FT   CDS_pept        714895..715779
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00696"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00696"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04464"
FT                   /protein_id="CAS04464.1"
FT                   /translation="MMNKENPLNKYHTGKFEKQRQDYPGLQSKMTPVPDTGESSYQGAN
FT                   KLTGKKAFVTGGDSGIGRAAVIAYAREGADVAINYHPDEEVDAQEVKAIVEEAGQKCVL
FT                   LPGDLRKEGLAKDLVKKAYNELGGLDILVLNAGLQQYQLDIQKLPAEQLRDTFEVNVFS
FT                   VVFAIQEALNYLKAGASIILTSSIQGVKPSAHLVDYAMTKSSLISLTKSLAAQLGEKGI
FT                   RINAVAPGPIWTALQISGGQPQDSIPAFGQDQPLGRAGQPAELASAYVLLASDEASYTT
FT                   GQVYGITGGAPIN"
FT   CDS_pept        715797..715973
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00697"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00697"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04465"
FT                   /protein_id="CAS04465.1"
FT                   /translation="MPWTKNDYPDSWKNLRKTEREKAIEIGNALLKDGYSESRAIPIAT
FT                   SKAEEWYKNHKES"
FT   CDS_pept        716098..716706
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00698"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00698"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04466"
FT                   /protein_id="CAS04466.1"
FT                   /translation="MNKRRWIFSTVVAAFLLIIGGFLVYQQMTPKPFTEVVAAAKIDGY
FT                   ESGDELESASTVIVTGQLEKRGDSIIERASDDAVIGVYRMSTFKIAQVLKNETDDNLAK
FT                   EMTISVYENEGYDAKTNTTYHIAGYTKMEKEEKYLLLLQKDSEDDYYVPTAVIFGKINL
FT                   NPNKRYELFPKNSDTESAINKVQAEVLKNLENEIERENK"
FT   CDS_pept        complement(716878..717105)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00699"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00699"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04467"
FT                   /protein_id="CAS04467.1"
FT                   /translation="MYDLYYITTCRYLSMVNSPSGCSPKHPYLCSLRISPVAFINIGKC
FT                   RTPRTFPCSRSFHLFSVFYKKILLVAANNR"
FT   CDS_pept        717617..718045
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00700"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04468"
FT                   /protein_id="CAS04468.1"
FT                   /translation="MGFLEAYKSFWRNYVNFSGRAPRSAYWYVVLWNVIIFVILYALAF
FT                   IFGISAIMEAAMGGTGMAGGGGAIVLVIILWLYLLAALLPTISLMVRRLHDSGKSGFFV
FT                   LLSLIPFAGGIIMLIFMCLESDGPNQYGDGDIDSKFDF"
FT   regulatory      718054..718078
FT                   /locus_tag="Lm4b_00700"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(718054..718078)
FT                   /locus_tag="Lm4b_00701"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(718084..718293)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00701"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00701"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04469"
FT                   /protein_id="CAS04469.1"
FT                   /translation="MYIEIYTVNGESIRLDDDAKINNISIHELSKADLKNLFNEKCIEL
FT                   TKYDLTYFINTNQVNWFLVSEGIH"
FT   CDS_pept        complement(718312..719232)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00702"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00702"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04470"
FT                   /protein_id="CAS04470.1"
FT                   /translation="MPKSEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEKTAEEI
FT                   YHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLN
FT                   DLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRKTQKNTKKEKTNIFGKVVPAE
FT                   FKAPTSIKEQISYDKSREKNLVDLLSGVKSNVQLLSENQGEENNVYDLLKSIYSLSSLA
FT                   VQKEELDKKYQDLQTKCQELEQENSYLKQQNETMTDSFHTLVLQVADFAYASDLDQIQA
FT                   LPLFSQQLVVTLNQLGVFKENYKQM"
FT   CDS_pept        719604..719918
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00703"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00703"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04471"
FT                   /protein_id="CAS04471.1"
FT                   /translation="MEYFLSLLKIIVLLAVLAGISYFLVKKNKQANRTRKSENDLIKLK
FT                   DTLLISHQLRAVLLEADGEKVLAIISNNDIRTVSLKGKTDQNEALFRELLLKEETKENA
FT                   "
FT   CDS_pept        719911..720678
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00704"
FT                   /product="Putative flagellar biosynthesic protein FliP"
FT                   /note="Similar to flagellar biosynthesic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00704"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04472"
FT                   /protein_id="CAS04472.1"
FT                   /translation="MRKIASRRVFQVSFIVIFAISLVVFWPGVNVHAESWLDSLGVNGT
FT                   DGVNSSVALFVLVTVLSLSASIVLMFTHFTYCIIVLGLTRQGLGATNLPPNQVLVGLAL
FT                   FLSLFMMQPLITAWYDDVYKPSQKEEWSASKVWDETKPLLTKYVAENTYKHDINMMLKA
FT                   EGEDPVTKKEDAPLMALMPAFILTQITQGFLTGMFIYLAFIFIDLIVSTLLMYLGMMMV
FT                   PPMTISLPFKILVFIFIGGYGLITNMIFQTIHF"
FT   CDS_pept        720691..720963
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00705"
FT                   /product="Putative flagellar biosynthesis protein FliQ"
FT                   /note="Similar to flagellar biosynthesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00705"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04473"
FT                   /protein_id="CAS04473.1"
FT                   /translation="MNLTPITQIFQDFFYSGLALILPVSLICIVVVIVVAILMAMMQIQ
FT                   DQSLTFLPKIVAFVVALFILGPWMFEHMTDLFVGIFSKLPLMIRV"
FT   CDS_pept        720966..721727
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00706"
FT                   /product="Putative flagellar biosynthetic protein FliR"
FT                   /note="Similar to flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00706"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04474"
FT                   /protein_id="CAS04474.1"
FT                   /translation="MEFEFFLAVVIVFSRVASFLFFFPLLKGRNIPNSVKVVFGMAISI
FT                   PVATGVDVSGITTLPDLLLRVTSEVVFGLALAKLVEIIAVIPKMAGFMIDYDLGFSQVN
FT                   LIDPSYGTQNSITAAILDTFFVVIFLSLQGMDYLIYYLMKSFEFTASVSILFEKGFIDL
FT                   LLGTLGFALASAVSIALPIMGSIFIVNIILAFISKSAPQINIFMNAFIIKITFGIFILA
FT                   CAVPILSTVFKNLTDEMIQQYVSFFDYLLKK"
FT   CDS_pept        721743..722789
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00707"
FT                   /product="Putative flagellar biosynthetic protein flhB"
FT                   /note="Similar to flagellar biosynthetic protein flhB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00707"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04475"
FT                   /protein_id="CAS04475.1"
FT                   /translation="MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYF
FT                   FGEMFIKNTIQAFVALLKQPPKLANMESYSLFYLMEFGKVLMPIMVMVVIFGLMNYGVQ
FT                   VGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDT
FT                   LISYTGQNWLYSLGQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKD
FT                   EMKDSEGRPEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPK
FT                   LLVKGEDELALFIRQVADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVMKEL
FT                   MDADKIKF"
FT   CDS_pept        722836..724911
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00708"
FT                   /product="Putative flagella-associated protein flhA"
FT                   /note="Similar to flagella-associated protein flhA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00708"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04476"
FT                   /protein_id="CAS04476.1"
FT                   /translation="MGNLGAIKKYFAILIAVSFVIALIVPLPPFVLDLVLVTILAFSVL
FT                   VYMRATSIKDWNELKSFPSLLLLMGIFRVSINISTTRAILTTGDPGQVIKQFGNFVIGS
FT                   NFVVGIVIFIILIVFQFIVANGSSRTAEVAARFTLDALPGKQMAIDADLNQRLITEPEA
FT                   KEKRAYLNMETEFYGAMDGAGKFVKGDVLFTVLLAVVNIVFGLIVGMVQGGLSFGEAAV
FT                   KYTELTIGDGIVSQIGSLLMAMSAGVIVTRVFDGSDDNVAVGIFKELMQNSVVVYTLAA
FT                   MFILMGVFSPLPTIPFVGIGVVLGIIGYRTQFNLKKKEQLELEKEMELIQSETSSAEAE
FT                   HNQAFGAAREKFPVVVELGLNIAALVKQKMNGETAKDKVVLMRKSILQDLGIGVPGINF
FT                   KDNTSFQPRGKYEIKVKGVAVASGVLKAGHLLALKTPGVMMDLDAEPTKDPIFGEDGYW
FT                   ILPGELEDAQMKNYQVLEPLSILITHLDVVLRKNLHELLMRQQIKDLIDGLADENQILI
FT                   DEIKKKEIDYSLIQGVLRQLLKEGISVRDLPTIVEGIIDGQTIYPNDLDGITAFVRERI
FT                   SKVICEQAKNQDGKIYALLLQDSIEMDTEIVNTPYYGYALNWALDKELPIIQKVRDTVN
FT                   KAQLTGREPVILTRRKDFRFGFVRVLERYQLDVPVLSISELSPETEVEQIALIEPT"
FT   CDS_pept        724933..726156
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00709"
FT                   /product="Putative flagellar biosynthesis protein FlhF"
FT                   /note="Similar to flagellar biosynthesis protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00709"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04477"
FT                   /protein_id="CAS04477.1"
FT                   /translation="MGKHLVEKMEIFKANSKREIHKKIRLVTNEPYKITDERVTKLGIF
FT                   KKQYEVTAVIMSEVAIADGRMDFQETFQKSVVKNRPKTDDLLKKEKLLEMLAAGAELAQ
FT                   STPLLEERKTQEEELSAMRLELAALNRELAVKMREEREQNSDFVKFLKGRGISDTYVAD
FT                   FMQAGRKQFKQVETAHLDDITDWFVPYFSGKLAVEDSFDLSNHRIISLIGQTGVGKTTT
FT                   LVKLGWQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDAELIVATSPAELEEAVQYMT
FT                   YVNCVDHILIDTVGRNYLAEESVSEISAYTDVVHPDLTCFTFSSGMKSADVMTILPKLA
FT                   EIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTDGQNITENIFRPKSRWLAERFVG
FT                   TDRRRVLE"
FT   CDS_pept        726153..726932
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00710"
FT                   /product="Putative flagellar hook-basal body protein FlgG"
FT                   /note="Similar to flagellar hook-basal body protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04478"
FT                   /protein_id="CAS04478.1"
FT                   /translation="MKGLYIGAAGMMNYMQHIQVHSNNVANAQTPGFKFDQLTSEVISR
FT                   NKVNYQNGPVARQVGTIDYGVRPAATHINLTAGSSYITNRDRDFFMQDTDPTQGSNFFI
FT                   TAKNGEISLSRGGQFHSDQFGFLRTADGANLLSATGEAIQVGQKTSIRAEANGDLYNAE
FT                   TGQYLGRLGTKFVSANQADSLVKDGEGRIHVNGINTMNLPAGQGIIQNGVIETSNVDLG
FT                   VEMVQLMDNQRMVQASKNVVNMFDKVYDKEATGLIRQ"
FT   CDS_pept        726961..727749
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00711"
FT                   /product="Putative chemotactic methyltransferase CheR"
FT                   /note="Similar to chemotactic methyltransferase CheR"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00711"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04479"
FT                   /protein_id="CAS04479.1"
FT                   /translation="MIPDLEKDYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKQY
FT                   ITFGEFFKHLKKDAVLLDEFISLITINVSSFFRNRNRWDALEKQVLPRLLEDSRGKLRV
FT                   WSAACSSGEEPYSLAMMMERSVGTRHYDILATDLEPAILKRAVIGEYQSRQMEELTEQE
FT                   RHTAFVEKGDTYQILPKYRKSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAY
FT                   QKFAESLRRGGVLFIGGSEQILNPADYGLATLNNFFYIKT"
FT   CDS_pept        727774..728109
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00712"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00712"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04480"
FT                   /protein_id="CAS04480.1"
FT                   /translation="MGRIENIKNLAFFEDKPGLAEQILMLEKKTQLFLPNEFEIRQTVG
FT                   YEIGDKEVILGRLESFYFLALKGVGEDNYRSQAFASEADAKAFFVHLPEMENELVAFWL
FT                   NEVELVR"
FT   CDS_pept        728136..728987
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00713"
FT                   /product="Putative motility protein (flagellar motor
FT                   rotation) MotA"
FT                   /note="Similar to motility protein (flagellar motor
FT                   rotation) MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00713"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04481"
FT                   /protein_id="CAS04481.1"
FT                   /translation="MEITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTIT
FT                   AVMMAHPWSDVKVVPKLFKILFTKEKMPDKVDVLVQYKEYADEIRRSGVLALEDSVDEI
FT                   EDPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA
FT                   AMGLIHAMGEMSNPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM
FT                   MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEEIERGQASQETAGG
FT                   TR"
FT   CDS_pept        728947..729774
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="Lm4b_00714"
FT                   /product="Putative motility protein (flagellar motor
FT                   rotation) MotB"
FT                   /note="Similar to motility protein (flagellar motor
FT                   rotation) MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00714"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04482"
FT                   /protein_id="CAS04482.1"
FT                   /translation="MAKRRKKPQEEHVDETWLIPYSDLLTLLLALFIVLFASSSVDAKK
FT                   FEQMGNAFKKIVEEGAAGNQAYVSKEKGPDDPNVNAVLKAMEEQDKKKEATEQEKAKKA
FT                   AAALLKKQNEEKIEAFKKQIDSYIAAEHLGAKMTTKYSDEGLLITIRDDILFQSGSAEL
FT                   TAGKREIAKEIGELFAQGKGTMEGIVSGHTDNVPISTSIYSSNWELSVARAVNFMEAII
FT                   QENSEVNPGEFSARGYGEFRPVAKNDIAANREKNRRVEIMVRPINRDTLDEDE"
FT   CDS_pept        729784..730284
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00715"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00715"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04483"
FT                   /protein_id="CAS04483.1"
FT                   /translation="MQLFLSGSHTLTDYDKQEIQAYLEKFAPVNHIHLLCYKSIENEVL
FT                   QFFLKKEHLAPRLSIYTFAPKECLPEPFLSTIDYLECLGSSYQSFGYFDTVITKPTYEK
FT                   FLAQIVSKMDLVCCFYNGDKPTDVIPVDVAKSFDVQSMIYDLPKAKKHLLHRASSDKIK
FT                   LVN"
FT   CDS_pept        730307..732220
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00716"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00716"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04484"
FT                   /protein_id="CAS04484.1"
FT                   /translation="MRPLISICMIVKNEAHILRQSLASFRKFTEEIIIVDTGSTDETKE
FT                   IAQEFTDFVYDFEWTGNFSDARNFAAKHATGKWILAIDADECLEEESYRKLEKQLKSPI
FT                   EPIQMAQIISFTGEKGRVTTTNQMARVYKNDGTICFRGVIHEQLEAVDKHPIAAGVAEV
FT                   KIYHYGYMTEIVEKQDKSDRNLRLLEKEVKNNKNSGFVHFNIGQEMNRLGNKKEALKEF
FT                   SEAFRLRDHNHYIWAKLSAYHIAELLEQEKRYDESLAIIEEARIIWPNVPEFPLKKANI
FT                   LYVNHQLEDAKEIYQSLLENTAIDYQSIVLYEATNFMPHKMLGTIYLEEKDYTRAMTHF
FT                   SKAYAENSSDYGVMFQMIMLLSKFHQPKEIFAFMERHHFISSTETGLRLLSMTTQQGYA
FT                   ELSELIVQSLTDVYPPVAEATEVKIATIRNVFPVISESAILFGIKEELIDAADLCLWHY
FT                   ENPQLPIERVMKNSDVGDIYDFIFENGPRISKKRYLFVLERAIALGKGEFADYLLALRN
FT                   VYHDSINSHIADLFFQYDFADIALDFYNIVDADEVTKQGYINLINYLVDAEVLDEALAI
FT                   AERGIDNFSTDFRFYLWTIKIDTENRANRISEAMDEFPNNRYLAKLLDEVTMLQDTVTN
FT                   NR"
FT   CDS_pept        732233..733141
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00717"
FT                   /product="Putative CheA activity-modulating chemotaxis
FT                   protein CheV"
FT                   /note="Similar to CheA activity-modulating chemotaxis
FT                   protein CheV"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00717"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04485"
FT                   /protein_id="CAS04485.1"
FT                   /translation="MTEEKGILLQSGTNELEIVTFTVGENLFCINVLKVKEIIHPLEVT
FT                   PVPDSNPAIEGVSQVRGEIMPVVNLARVMKLPEIEPENTKFIITELNQMKIVFRVDEVH
FT                   RIQRISWEQIEEPEKLSIGLEELAVGIVKLDGNLVLLLDYEKIIYEISGNADFAVTGED
FT                   RMARKVNREEKTIFIAEDSQMLRQLLEDTLHEAGYTNLQFFANGREAQEHIFKLLKEQK
FT                   EQTFENVNLLITDIEMPQMDGHHLTKVIKEDEIGRELPVVIFSSLITEDLEHKGAGVGA
FT                   DAQVSKPNIHQLINILDELVL"
FT   regulatory      733145..733180
FT                   /locus_tag="Lm4b_00717"
FT                   /regulatory_class="terminator"
FT   CDS_pept        733380..734243
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="Lm4b_00718"
FT                   /product="flagellin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00718"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04486"
FT                   /protein_id="CAS04486.1"
FT                   /translation="MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAG
FT                   LAVVTRMNVKSTGLDAASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSD
FT                   EDRKQYTAEFGSLIKELDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDL
FT                   FNAKGLSAGTITLGSGSTVAGYSALSVADADSSQEATEAIDELINNISNGRALLGAGMS
FT                   RLSYNVSNVNNQSIATKASASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQML
FT                   TQLINS"
FT   regulatory      734284..734309
FT                   /gene="flaA"
FT                   /locus_tag="Lm4b_00718"
FT                   /regulatory_class="terminator"
FT   CDS_pept        734518..734877
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="Lm4b_00719"
FT                   /product="Chemotaxis response regulator CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00719"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04487"
FT                   /protein_id="CAS04487.1"
FT                   /translation="MLKLLIVDDAMFMRTMIKNIVKDSDFEVVAEAENGLEAVKKYDEV
FT                   KPDIVTLDITMPEMDGLEALAQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKP
FT                   FQADRVLEALEKAAK"
FT   CDS_pept        734897..736753
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="Lm4b_00720"
FT                   /product="two-component sensor histidine kinase CheA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04488"
FT                   /protein_id="CAS04488.1"
FT                   /translation="MTTNMLDLFIEEASEHLQALNDNLLQLEKDPTNGQLVSEIFRSAH
FT                   TFKGMSATMGFQQVADLTHAMENVLDEVRNNRLAVTEHLVDIIFTCTSHLETMVSDIQH
FT                   GGQGAADISKTVADLEALLHPEQETDLAVEKTYRIQIQIEEAAILKAVRAVMCLERLAE
FT                   MGIISETTPDREAIELEEFEQSFEVVLESAQTKEEIEAVVLDISEIEKVTVTEEVEEVQ
FT                   VIEPIKKAAKQTTKRLENKTIRVQLEKIEKLMNVFEESVIERARIDEIAEKTNNKELME
FT                   HLGRFSSISKEIQNGLLNMRMVPVDSVFNRFPKMVRTLAKELGKKIDLVIEGADTEVDK
FT                   IVIDEIGDPLVHLIRNSVDHGAETVEVRRKNGKNETATINLKAFHSGNNVVIEIADDGA
FT                   GINKRKVLEKAIAKNVVTRAESTKMTDAEIFDLLFDSGFSTADQVSDLSGRGVGLDVVR
FT                   NTILKIGGKISVESSENAGSTFRIEIPLTLSIIQSMLVATSERRYAVPLANVAEAITIN
FT                   PADIQHVHGKDLINYRETIIEVLDLGECFHETPLNDTDELLLLVVKNAKRTFGLIIKDI
FT                   IGQREIVLKTLGGFFSESQIAFSGATILGDGRVVLILNLETF"
FT   regulatory      736753..736758
FT                   /locus_tag="Lm4b_00721"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        736763..737065
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00721"
FT                   /product="Putative flagellar motor switch protein fliY
FT                   C-terminal part"
FT                   /note="Similar to flagellar motor switch protein fliY
FT                   C-terminal part"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00721"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04489"
FT                   /protein_id="CAS04489.1"
FT                   /translation="MMEQVFQVELPEWEPKEPSQEGREKGSIRQVDNIGVNLIVRLGKK
FT                   EMPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
FT   CDS_pept        737084..737494
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00722"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00722"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04490"
FT                   /protein_id="CAS04490.1"
FT                   /translation="MKQEAYNAVKMKVDQEKTAILKELQLLLSKREKVVEKLAHEKEVY
FT                   YSRTKKERLQVAVLAGSMQLDAFSPSRIQQMEREIHQISQYIKSNEQILEQLEEKGKQA
FT                   KKMYDDTRKKWQQLENKREEQTLRDLKMVLLK"
FT   CDS_pept        737510..738556
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00723"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00723"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04491"
FT                   /protein_id="CAS04491.1"
FT                   /translation="MLIPDNLLQPLVGKKQVEPKESLAEELVELPFISLLMENSPAPLL
FT                   KGEADNGEQATLPLKEIAQPLVSAKLLDDAPETKLQVAPLELKEVKETLAAIAKQAIDQ
FT                   PKIENAPQAVETPVTNTPKEPTKNASREQQPPPELIIPTKESPKLAENVAKNQPVLAKL
FT                   PQEKEVVQLFKASIKEPVTAKEEVAVKKPAESSNIWHDTAKQLTPAAKPEVPVTLKQLD
FT                   KTITDQIEQLQKFQVKQNKAFFAIQPESLGKVEVLLKKMPDKIFVHIEYQEQTAKQKLE
FT                   QMAQDLHNRFRDRGVEVAVTMTEKQAPKENNQGSDGRHQGESKKEKERENPHQERAKQE
FT                   AFDLEEET"
FT   CDS_pept        738558..738980
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00724"
FT                   /product="Putative flagellar hook assembly protein"
FT                   /note="Similar to flagellar hook assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00724"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04492"
FT                   /protein_id="CAS04492.1"
FT                   /translation="MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPS
FT                   SPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNSALQSAVNFIGKDIKGVSLNGE
FT                   VISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN"
FT   CDS_pept        739000..740235
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00725"
FT                   /product="Putative flagellar hook protein FlgE"
FT                   /note="Similar to flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00725"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04493"
FT                   /protein_id="CAS04493.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLNGNLQPIQIPLNSAIP
FT                   GEATKNGSLSGNIPLDWGEKDTISSELSVYDNAGGKHKLQVNMKAATPDASGNVSYEYE
FT                   IQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGKQVNMGLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
FT   CDS_pept        740249..740485
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00726"
FT                   /product="Putative flagellar switch protein"
FT                   /note="Weakly similar to flagellar switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00726"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04494"
FT                   /protein_id="CAS04494.1"
FT                   /translation="MKINHTIPLRIDFELGRTKQPVGSLLDVKKGTVFRLEDSTANVVK
FT                   ITISGKCIGYGEILTKDGKMFVKITKLGEGSSS"
FT   CDS_pept        740506..741498
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00727"
FT                   /product="Putative flagellar switch protein FliM"
FT                   /note="Similar to flagellar switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00727"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04495"
FT                   /protein_id="CAS04495.1"
FT                   /translation="MSDKLSQEQIDALLSQISEGKVVDESTEIGDFGRFHPYDFHKPEK
FT                   FGAEHLESLKTIASAFTKKSMEFVSQRIRIPIHTEATLADQVSFASGYIETMPNDSYIF
FT                   CIIDLGNPELGQIIIELDLAYIIYIHECLSGGNPKRKLSERRLLSVFEELTLKSILEKF
FT                   CEALKDSFKSVHPISPEIVNIETNPALLRVTSPNDMMALVSVDIKSEFWISTMRIGVPF
FT                   FSVEEIMNKLENVVEYTFDKRRNFDAEVEQELHQVEKEARIRVGEIKTTWKELNKLEVG
FT                   DVLLTETHIRDTLKGYVTEKWKFECYMGKSGNQKAVKFMRHTGRTEQER"
FT   CDS_pept        741501..743048
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00728"
FT                   /product="Putative flagellar motor switch protein FliY"
FT                   /note="Similar to flagellar motor switch protein FliY"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00728"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04496"
FT                   /protein_id="CAS04496.1"
FT                   /translation="MEQLLEKNITQMELDVIGEIANISFGSASTVLSDLLHQQVTISTP
FT                   KVEIVDLYNTKDIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNE
FT                   ELSELHLSAVQEAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDTNDQTMIK
FT                   VGFDLIIGDLITSNLMQLIPIDKGHELAKRLLGDAVPEPEPVKEEISLTAEELDVFLEV
FT                   CNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTF
FT                   IISKNAALIMADLMMMGDGLVQEDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKID
FT                   ISPPTMEFCNFGDTMIQKNIEEGKTVEVIFPLEVEGLLKTPMYQIFNPAAAKEMAQLML
FT                   GIQAKEVAEKEATTPAEIIEPEKLAEPVHQAVIEEKETLSEMEQILEDIPVTLEVVFGT
FT                   AKVKLEKFISWCEKDVIILKESMNEPLVLALNGVTIGKGILVRVDDHFGIQMTELVR"
FT   CDS_pept        743054..744457
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00729"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00729"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04497"
FT                   /protein_id="CAS04497.1"
FT                   /translation="MRKLGLMTILFWLFFSVQAFAADPEPPIISLEGEQHVFTSGEVIS
FT                   FHIENAADLKIILVNEHGQRKLLDEETYTVTDWDLDGSYQAEFYQADVPKPFVTVEDLF
FT                   EVKQLEDVAKDETAPSLKTIEITHDEDVLLTSVLRVSADLDDAESGVKQATLVVHSESN
FT                   ESEIELIRNNYTGKFAAEIPLEKFQLGEKITFQLQLVDFAENEITVDLENTVQLYQPKA
FT                   PLLSYDGNDITNVQKKIGQVGKQIELTLDKYTTEFPELETETGKIIPLKWQKTATEWKG
FT                   SLTLPSELSGEIIHIQGMDQHLLVRATSEPFGEVQLVNNAILTGTILSDFTLISNLYIE
FT                   VNGQKFSVERAGNRFTSAEITTTGKIVLHWTDWDGQIYSKQMNQEIKPVIAMPGKEIIA
FT                   PPPVIPNEKTQILTSPAPKPSVEAHENTPKKQVKKETSTKDNSSSIPFWIPALMIIGVI
FT                   IFSGNRAMK"
FT   CDS_pept        744480..745646
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00730"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04498"
FT                   /protein_id="CAS04498.1"
FT                   /translation="MKIDGIQESAENRNQLERELIKQNPVVKEGTIKAQMNTEVAVPKT
FT                   PPVSFSFKELSSLQLNGTSAASLELYMKLMMNNAKKANDLIFYVMRAGIKNPTDSTKWQ
FT                   TVRSEISSQLSTILMKQHNFEAYFSENPANQKLFLANQKIMNEISFLLKMLPTLTFETT
FT                   GKYDFLRMMQIASGNMETGIQMMREFQGHIEHATRLDPIVDARQETNWMIKVLREFGNM
FT                   FQSRHLLPYELQAENINIWKLSSEYLKLMNQLLPQIGAFPNGNIKIFHQQATKPLTELF
FT                   QELQRLADGQMTQGGIAVILDRMQGQLTRLAQLFQKMEIEAGFTDTERILGSVDAEFAS
FT                   DMTKMMLLAQQEMSFFDLLVKDFRSVSKQPIFFMIVAIFIILLLIILF"
FT   CDS_pept        745753..746217
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00731"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00731"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04499"
FT                   /protein_id="CAS04499.1"
FT                   /translation="MNNVSIGQISQSKQTNVVRGMQELNQTQQLYFEQMKANGKKQTPS
FT                   LTEINELITNVTDKKSLVEMDMTVDNVLSYKKAVQTFLNFYVNNVMDYDNIESRHPKYG
FT                   FSQKMTILKQVEKQTNELDDVMNLIDTKTGHLDMLNRIGEITGMILDVVL"
FT   CDS_pept        746227..746655
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00732"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00732"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04500"
FT                   /protein_id="CAS04500.1"
FT                   /translation="MQNELINQLEILIEKNVKATDAAILLGKLVQEENWIEAEECQLGL
FT                   QRELAALQNEYQALKTIIGEDNTLRTLQNTWTPAENAIIDERKKMLLEKENLLRVSVTE
FT                   NQIRTEMQLAFSEHMVDVITGHHAETQAENNMMINETF"
FT   CDS_pept        746675..748195
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00733"
FT                   /product="Putative flagellar hook-associated protein FlgK"
FT                   /note="Similar to flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00733"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04501"
FT                   /protein_id="CAS04501.1"
FT                   /translation="MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQTAV
FT                   YGDGGLLGGKQTGYGVKVTDIKRLTNTALTTQYNNQIAKQSASLYQSGALGQALNLFGT
FT                   PGKNTPSDNLDNFFTAWAALAKNPDQATNTTALLSSMSIFTDQLNQLHSGLKELETTIA
FT                   ADTDAAIQDLNSLIKKLGSINKAIGNAGSNPPNDLLNQRDQLLSTMAGYAGISVSAHPN
FT                   NPDVYDVTIGGRLVVQGDETTEITSTRTATGFEFSVDGQKLNMPEGSIIASVRVNQNEI
FT                   KSYQEKIETFSNSLAKALDDIQVKNVNKTMDDLQKINDALKANPNDEKLLSNRDELLRQ
FT                   LEKFPGVTRSGDTLTIGGVDHAIDTLGTSTYVTDVNDFSIPIFTQSSGKWILNPAITSN
FT                   ADNKPFLGVIAADIASLKTDKNIQGTTFPSFMDGIITEVATDASKSSATSTADTQALNS
FT                   LSESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML"
FT   CDS_pept        748207..749082
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00734"
FT                   /product="Putative flagellar hook-associated protein 3
FT                   FlgL"
FT                   /note="Similar to flagellar hook-associated protein 3 FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00734"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04502"
FT                   /protein_id="CAS04502.1"
FT                   /translation="MRISTNQQANSIINQLNNVSGNLAKYQLQVSSGKKYESMSENPGA
FT                   TAQILSYNHVLSQLNREKTDVTEAKSLLNTAETSLSSMSTSMNRVNALVLQAINGTSDK
FT                   DNMSQSAEEIKGLLDVLISVANSEDDGRYVFSGSSTSVKPFTTDKTTGEIIYNGTTENK
FT                   KFRVTDTLEVEVFHDGSAMTDVFNNIQKIVDAMKTGDKDALSALQETNSKNIEIITNSM
FT                   TNIGGQKNGVAAYDNVLSSKIVDFSERKSNVEEVNMPEAVSNLNKTSIAYQAALQSSVM
FT                   VQKLSILNYM"
FT   CDS_pept        749094..750383
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00735"
FT                   /product="Putative flagellar hook-associated protein 2
FT                   FliD"
FT                   /note="Similar to flagellar hook-associated protein 2 FliD"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00735"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04503"
FT                   /protein_id="CAS04503.1"
FT                   /translation="MGSSIASSLMDPTQYYSQFISLQKASLEKAKTPYQNQISSYQSRI
FT                   DLYASLKNALSESLKTMSSFTTYESKTKLATSSNETSFTVSSTSSSVNGSYSIEVQNLA
FT                   TADTYNKAVPDIEAKIGVSGTIKINGKEIKVDADSSMKNVMNSINSAGAKVNIYTLGEN
FT                   MVVTSSTTGVENSIKFEGDSAVLDALGLVQNSPDHLAAEDAKLRINGATVTSATNKVTN
FT                   YIPGVTINLKKETTGAEKLTIQDQSDEKAASMITSFVNTYNALTSTMKTYTGKGTILQA
FT                   SAADLEANRALNNVFQHKKDGNTLFDFGISVDKEGVLKVDETAMKKMVAEDPTAVERFF
FT                   FGIGGIGDELYQSLNKTFGSTGFISDETTSMTNEINKLNLKLTDITSRNDTLLTNITDQ
FT                   YNKWLEMMQAMQSDAMTLDALIDGMNSSNK"
FT   CDS_pept        750402..750788
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00736"
FT                   /product="Putative hypothetical flagellar protein"
FT                   /note="Similar to hypothetical flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00736"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04504"
FT                   /protein_id="CAS04504.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKLDKALEQLHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
FT   CDS_pept        750760..751041
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00737"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00737"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04505"
FT                   /protein_id="CAS04505.1"
FT                   /translation="MNQAKTHLVELKALFHSTGQLNVTLEEYQAKLNELLKSTEHLPKD
FT                   TKEAILKETREVINKGILFTQKQLESTENAFSENKSRNAANLNYAKFF"
FT   CDS_pept        751062..751463
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00738"
FT                   /product="Putative flagellar basal-body rod protein FlgB"
FT                   /note="Similar to flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00738"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04506"
FT                   /protein_id="CAS04506.1"
FT                   /translation="MENYTTHIGNYLNYLQTANQVVSNNIANANTPNFKASEASFEESF
FT                   GSSLRASGQNSTESAGNLTKTNTKHLAGTDIDETNAKVTTKSGSINEDGNNVNVTSEMI
FT                   SLTKNNQMYALAISALNYNSSINTAARGK"
FT   CDS_pept        751475..751885
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00739"
FT                   /product="Putative flagellar basal-body rod protein FlgC"
FT                   /note="Similar to flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00739"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04507"
FT                   /protein_id="CAS04507.1"
FT                   /translation="MFEGINTSGSALNAAKQWMEVSSNNIANADSSAAPGETPFLRKRV
FT                   VLSEITPFETALTGTKGVKVSEISSDTGSVKRVYDPTHPNANEAGYVNYANVDMTAEMT
FT                   NLMVGQKMYAANTSALQANEKMMEKDLEIGKV"
FT   CDS_pept        751902..752198
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00740"
FT                   /product="Putative flagellar hook-basal body complex
FT                   protein FliE"
FT                   /note="Similar to flagellar hook-basal body complex protein
FT                   FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04508"
FT                   /protein_id="CAS04508.1"
FT                   /translation="MAIESINAASVLPKVTLGETAKTDNATGAGNTFTQMLDSMSDTQS
FT                   NAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV"
FT   CDS_pept        752266..753918
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00741"
FT                   /product="Putative flagellar basal-body M-ring protein
FT                   FliF"
FT                   /note="Similar to flagellar basal-body M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00741"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04509"
FT                   /protein_id="CAS04509.1"
FT                   /translation="MAKIKTMYSKLKNWHKGAILVGLFVVVTVLLLYMNTPKTEVTLYK
FT                   NLSETSQQQVTDQLAKMGVDYTVDKSGNILVDEKVETLVRDKFADLGIPYTGQDGNDIL
FT                   LNSSLGASEEDKKMQEKVGTKVNLEKEIVQSYGTTIDSASVQLTLPESSSIFEEASQKG
FT                   TAAVTLKTKNNQTLTSEQVLGIQRTVSAAVPNVASDDVAIIDTKNGVISEADTSKEEGS
FT                   SAYKNEVDIQNAIGKNVKTDIEGTLSSIFALDNFRVNTNVSVNFDEIKQNTEHYPNDGK
FT                   VRSNQKDTSTDTSKGSANTTESGTASNADVPNYTEQNGDDTNTYTSEKSSETTNYELDS
FT                   TIQEIKKHPALAKTNVVVWVDQNALNKNGVDMAEFTKAIGVSAGLTPNMTTEEAGADGE
FT                   AAAAPTFEGTFQNGDVTIMPIQFLDNATPAEEDTTEKAAPASKAWIWWLAGSLLFAIIA
FT                   AGIIAYIIFLKRKEQLEEALEPEEKDYIPAEEAIINPEEHPDFNFQTDAFDLSEPELKA
FT                   RKESLKNKLGEMAKEDPGRAAAVIQKWLNERQE"
FT   CDS_pept        753921..755027
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00742"
FT                   /product="Putative flagellar motor switch protein FliG"
FT                   /note="Similar to flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00742"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04510"
FT                   /protein_id="CAS04510.1"
FT                   /translation="MAETLKETLEETNAELETVEVEETEEKTATSADSGISRREKAALI
FT                   IWSLDEQIATEVVDLLPDASKQRLAREMAKMKEMDGGAVEEATREFLGELELLSGGIAK
FT                   LDREHLQRLFPDMTTEELNQLIYGVEAESRIGETALDILREIDDVDSLFTIISDESPQT
FT                   IAMIASYMKPEEASKLLALLPEEKMINTVIGIASLEQFDSEVMQNVSNLLRIKLDTMSN
FT                   SSLNKTDGIKNVANILNNVTRGLERTIFEHLDAEQAELSERIKEKMFMFEDIILLDNMT
FT                   LQQVLAEIQDNNKIARALKNEKEELKEKILSCVSKNRRDMITEELEVLGPIRLSDVEQA
FT                   QQDIANVVKNLEKDGKIVIQRGEQDVLI"
FT   CDS_pept        755014..755706
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00743"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00743"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04511"
FT                   /protein_id="CAS04511.1"
FT                   /translation="MSLSNPRIPKGKVTLSDVKMELFYLDDIEETEEVESPYSKELEQL
FT                   ESHQKELEKHLSAIEIEQQKLANEKAALQAERQAIEELKREAETEIEANKQAFEKEKTQ
FT                   MYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   KALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNAER
FT                   KILGGDKP"
FT   CDS_pept        755703..757004
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00744"
FT                   /product="Putative H+-transporting ATP synthase alpha chain
FT                   FliI, flagellar-specific"
FT                   /note="Similar to H+-transporting ATP synthase alpha chain
FT                   FliI, flagellar-specific, -"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00744"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04512"
FT                   /protein_id="CAS04512.1"
FT                   /translation="MNWSPKTKAWQELKNTVPYIQKGKIHTVQEQVYISKGPQVKIGDT
FT                   VMVGENKVLCEVISIEKENNMLLPFNQSDKVAYGDWVYVTDTKITIPADEYLLGKVLNA
FT                   SGDILNEEAGVAKFKQKMPLEAPPIHAFSRAEITDTLETGIKAIDGMLTIGIGQKIGIF
FT                   AGSGVGKSTLLGMIARNAKADINVIGLVGERGREVKDFLRKDLGEEGLRKSVIVAATSD
FT                   ESHLMQLRAAKLATSIAEHFRDQGKTVLLMMDSVTRFADARRSVDIAVKDLPIGGKTLL
FT                   MESYMKKLLERSGKTQNGSITGIYTVLVDGDDMNGPVPDLARGILDGHIVLTRELATKN
FT                   HYPAIDVLGSVSRVMEEIVPESQWKTASKIREWMSIYQENELYFKLGTIEQTSDNAAIF
FT                   TSKEKSYFIHQFLKQLRDESVTLEETSKLMETLV"
FT   CDS_pept        757021..757689
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00745"
FT                   /product="Putative transglycosylase"
FT                   /note="Similar to transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00745"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04513"
FT                   /protein_id="CAS04513.1"
FT                   /translation="MNPVEQVISARQAEFQSAFEAAKQSATTFETKLNERLNETTTAKT
FT                   TSVQTVTDAELTRAREAYEALINQSDTNSAASASSTTTETPTTSTGESTNWNNYQIKPI
FT                   SAENEGKYSDLIKTSAAKYGVPEALIKRVIQVESNFNPNVVSSAGATGLMQLMYGSNRT
FT                   DPATNIDAGTKQLAGYIKKYDGDLKLALAAYNAGPGNVRKYGGVPPFKETQNYLTKIIG
FT                   "
FT   CDS_pept        757703..758347
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00746"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00746"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04514"
FT                   /protein_id="CAS04514.1"
FT                   /translation="MGNWQQKWESWRDMTAAMQQEIKIEAAEKVTSYIKNDQFEEAINV
FT                   IRQTENLLNELDFETKMNRVEEQLQAFTSDQEAAKSFEASQLQNLEKPSTKVSFDLSHV
FT                   KSEAINQFTKRDFNLVDSNDTHMQFLKGNRNFYMDIFNPEESEEYHYANLDEKCQYKNI
FT                   GFICQNDAAAEIATKLTNEWLETLEAPKKKFLTVNIANLNAMKQNQEVLFQ"
FT   regulatory      758355..758376
FT                   /locus_tag="Lm4b_00746"
FT                   /regulatory_class="terminator"
FT   CDS_pept        758466..758792
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00747"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00747"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04515"
FT                   /protein_id="CAS04515.1"
FT                   /translation="MKGLTELLKGSLEGMILERISRGETYGYEITKYLNDLGFDEIVEG
FT                   TVYTILVRLEKKGLVEIEKKKSELGPPRKFYTLSPAGEEELAIFWKRWDFIQGKIMQVK
FT                   GGQA"
FT   CDS_pept        758792..759115
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00748"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00748"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04516"
FT                   /protein_id="CAS04516.1"
FT                   /translation="MFNWYKKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFAK
FT                   GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDKQRQKLRD
FT                   SIK"
FT   regulatory      759120..759153
FT                   /locus_tag="Lm4b_00748"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(759120..759153)
FT                   /locus_tag="Lm4b_00749"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(759158..759805)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00749"
FT                   /product="Putative fibronectin-binding protein"
FT                   /function="putative fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00749"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04517"
FT                   /protein_id="CAS04517.1"
FT                   /translation="MKEFIEPYQYNFIKNQLANVSRAYRSANDTSTLKALKSLTEEKIN
FT                   ELFPESVLEEHKELFSELHAITSTKEAEPFLDGLKAYVIPFAPPSDVKLKKLFAKTKKL
FT                   KIPAWSKLDLRDYTFYGWNDIAQQRKYIVTYEDGNLVGVQGTISTEIQKGVCSICHSHS
FT                   KVSLFMAKTKSSSDGIYTTNGNYICYDSDVCNQQIKTHETLDEFIEVVKKRK"
FT   regulatory      760063..760068
FT                   /locus_tag="Lm4b_00750"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        760076..761806
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00750"
FT                   /product="Putative pyruvate oxidase"
FT                   /note="Similar to pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04518"
FT                   /protein_id="CAS04518.1"
FT                   /translation="MKKVKASETLVQTLKNWGIDHVYGLPGDSIDTVVDALRKEQEAIE
FT                   FIHVRHEEVATLAAAAYTKLTGKIGVALSIGGPGAIHLLNGMYDAKMDHVPMLVLAGQV
FT                   TTDVLNTGFFQEVNLPAIFEDVAVYNKQIDNAETLADVVDEAIRTAYKEKGVAVLTIPN
FT                   DIPSQVIKASLEAKPVKFEQENPKLDEAAIQEAVARIEKAEKPVILAGLGTKHAGPELI
FT                   AFSEKLKIPIIHSLPAKTIVPDNHPNALGNLGKIGTKPAYEAMQETDLLLMFGNDYPYS
FT                   DYLPKKADCIQIDIDPAKISKRFPATVGLVGDAAEIIGNLTAKTAPVEERKFLQACQEN
FT                   MQEWWKWLEEDIAQTTDPIAPEVVMANIQKIADKDAIFSIDVGTATVWSTRYLHLAPQN
FT                   DFIVSAWLGTMGCGLPGAIAAKKAFPDRQAIAIVGDGGFSMVMQDFVTAVGLNMPMIVV
FT                   VLNNQQLSFIKYEQQSAGELNYAIDLPDINYAKFAESCGGIGFRVEKMADLEAAFENAK
FT                   LATKPVIIDVSVDSAAAPLPGKIVMDEALGYTKFEIQSVLEDHRFAKMPPLKTILRRFL
FT                   "
FT   CDS_pept        761968..763773
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00751"
FT                   /product="Putative metyl-accepting chemotaxis protein"
FT                   /note="Similar to metyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00751"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04519"
FT                   /protein_id="CAS04519.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVATLSDNM
FT                   VDNNVAPMKEIAKIQTNMAQINIDILTMFDTINGKSALIKDIDDLYAENDQAIHNFKKA
FT                   NLTAEDKKQLAYFEEKLADMKSSASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNEMNYKEVENSSQAISDFGVKISIIFTAVIIAVLISLFIFNAYITRVILKGIR
FT                   HLQTAVHKVASGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTDAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNTGLSESEAGQKIISETEATFTDLLNRVNDISAQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYIANFNTEVSE
FT                   EAVEVTEEPESETKDPGEPVLAENV"
FT   regulatory      763772..763777
FT                   /locus_tag="Lm4b_00752"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        763786..764514
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00752"
FT                   /product="Putative YvpB protein"
FT                   /note="Similar to B. subtilis YvpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00752"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04520"
FT                   /protein_id="CAS04520.1"
FT                   /translation="MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYKLDN
FT                   EPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFNGKRVTKNELANNLPTTPIEQNGL
FT                   HGNPDKAFVGSISGDSPGLGVNHAPIANLAAKYVNEAHVHDISGNSIQDIITVLSTGAP
FT                   VWIITTTDYHAPKNWQTVQTKEGKKKITYSMHSVVITGFDKNNFYINDPYGHKNRAVKR
FT                   SVLEEGWSAMGKQAIYLSHP"
FT   regulatory      764520..764552
FT                   /locus_tag="Lm4b_00752"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(764520..764552)
FT                   /locus_tag="Lm4b_00753"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(764557..764769)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00753"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /note="Putative peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00753"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04521"
FT                   /protein_id="CAS04521.1"
FT                   /translation="MVFAKKLVASIAVFISLGFIYFRESTAVAFESTNTASFLPSTGDA
FT                   FSVWPIVIGVVLVALAVVLFIKKKI"
FT   CDS_pept        765217..767022
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00754"
FT                   /product="Putative L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /note="Similar to L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00754"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04522"
FT                   /protein_id="CAS04522.1"
FT                   /translation="MCGIVGYIGTNNAKGILLEGLEKLEYRGYDSAGIALQNKDLVTVV
FT                   KEKGRIADLASLVPSDAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTMVHNGVIEN
FT                   YTLLKEEYLKNHSFVSDTDTEVIVQLIELFAAELSTKEAFKKALSLLHGSYAICLIDQT
FT                   DTETLYAAKNKSPLLIGKGENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKDGFTLET
FT                   LEGEEISRASYTAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQAYQNEAGEINVDQT
FT                   ILDEILSSDRIHIVACGTSYHAGLVGKNLIEKMAKIPVEVHVSSEFGYNLPLMSKKPLF
FT                   IFITQSGETADSRQCLVKVKELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTK
FT                   AYTAQISVLAVLAVSLGREIGDAEALSINLAAELGIVATAMEAMVSSKEVIEHIAGEYL
FT                   ATSRNAFFLGRNIDYFVAMEAALKLKEISYIQAEGFASGELKHGTIALIEDGTPVLALI
FT                   TQESINWNIRGNVNEVLARGAKTCVFAMENVAQPGDRFVIPQVHPLLTPLASVIPCQLL
FT                   AYYAALHRDCDVDKPRNLAKSVTVE"
FT   regulatory      767032..767056
FT                   /locus_tag="Lm4b_00754"
FT                   /regulatory_class="terminator"
FT   CDS_pept        767135..767875
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00755"
FT                   /product="Putative riboflavin kinase / FAD synthase"
FT                   /note="Similar to riboflavin kinase / FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00755"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04523"
FT                   /protein_id="CAS04523.1"
FT                   /translation="MEVSHVTLEPNKDSRPAVLTIGKFDGVHIGHQTILNTALSIKKEN
FT                   EILTAISFSPHPLWALKQIEIYREMLTPRMEKERWLAHYGVDHLIETAFTPRYAETTPE
FT                   EFVRDHLTNLNLSHIVVGSEFNFGKGRDSDVDLLRDLCKPYDIGVTSVPVIETNQTKIS
FT                   STNIRAFIRRGHFQEAEELLGHPWYITGIVENGEMTGLDDYVLPATGTYQTDSGIVNVT
FT                   NNRTIEVGLSDGLQQLHMKNELSE"
FT   regulatory      767860..767880
FT                   /locus_tag="Lm4b_00755"
FT                   /regulatory_class="terminator"
FT   CDS_pept        767958..768437
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00756"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00756"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04524"
FT                   /protein_id="CAS04524.1"
FT                   /translation="MKIPTTLKHKPVIVVENYEEVDGKNAYHSDAKGLSLGLAQWNDRG
FT                   KVDISAKVWRHTGDKWSRQSEELPLHRVLDLAILIARTKVHFKDAYRLPHFYDKENPTL
FT                   DRIGLQGDALTIAVCEDNEYIDEDMQLFEQVLKNDDELLSERLKTLSKLLQEAGY"
FT   CDS_pept        768451..768789
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00757"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00757"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04525"
FT                   /protein_id="CAS04525.1"
FT                   /translation="MNKDNRKELIRAYKEKSPDAGVYRFISTKSGKSLIDNTMDLKGIA
FT                   NKLAFGVKIGAGNMLPPEMAKEAKEYGIDTIQFEILEKVDIKPEMTKEDIKEENDVLLS
FT                   LWLEREDI"
FT   regulatory      768790..768809
FT                   /locus_tag="Lm4b_00757"
FT                   /regulatory_class="terminator"
FT   CDS_pept        768934..769338
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00758"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00758"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04526"
FT                   /protein_id="CAS04526.1"
FT                   /translation="MNPRKSEFVLTLIAGITGIIAGITGIAGGGLLAALSGSEELSNAT
FT                   AMTAADSEALAAAGGLTVIFSIIALVLGIALIVFAVLIKRNAKVFGILTLVAGVVGFFL
FT                   VGLLWIVPGVLAVIAGIMCLARKVPTDTFS"
FT   regulatory      769352..769383
FT                   /locus_tag="Lm4b_00758"
FT                   /regulatory_class="terminator"
FT   CDS_pept        770032..771936
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00759"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /note="Putative peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00759"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04527"
FT                   /protein_id="CAS04527.1"
FT                   /translation="MKKAFLCLSAVVLSLNFMWVNPLSGLASKIETTKLKSTMDTNQQV
FT                   NLKNNATDIVTSEDLGGQTWLINEVNRQLAPKKVGVDLTFDDLAKIKIISLSNKSLTGE
FT                   VPPEIKNLVSLEKLLLYSNKLSGEIPAELGELTNLSELRLDYNQFTGKIPDGLGKISSI
FT                   ALQNNELVGQIPLSLYENRTGTNEVNVSGNQVTINSREPEPSIYSYSTFIYPATTPQYS
FT                   GHLTATTTYFSNVTNDTLLTPFLSGSSTFIDLHAEFMLDRELFEGHEVTITDESSGKIL
FT                   YEGELNSDISISLKSFSSGYHNIRVVLDNAPNNPQNQVTFGISMASTVAGDLTVNYVDE
FT                   DGKTIHDPQIVSGFVGDDYDVTTPDYELVIDGYELDTSKLPTNGMGTFDYAPLSVTYVY
FT                   KKMEGAPVTVKYVDENGNEITTSDTLTGKLDDSYHAKAKEITGFTLDNSKLPANASGVF
FT                   ETNPQTVTYVYNAVPAKIKAHDSTIYVGDTWSAEDNFDSAVNSVGAAVSFDDVKVEGKV
FT                   DTTKAGVYPVTYSFSGEAVTINVTVKAKVIPAPPVTPVQPINPDQPNIPNTPSVDQTHV
FT                   AKPGNLKVTKTQPTVAGKIKLPTTGDNLWDSVLYSVFGLIAVCVAFSLFFWRKKQKHS"
FT   CDS_pept        772213..772722
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00760"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04528"
FT                   /protein_id="CAS04528.1"
FT                   /translation="MLNENIKAIRKSKGLSQEEIAIKLNVVRQTISKWEQGLSVPDSDM
FT                   LISISEVLETPVSTLLGETVMVSKVDDVKAISEKLEIINLQLAQRKTARQKMLYWLFIS
FT                   MCTVIAIISAVFIILNSPYLGWDYSDPETSVIGVAFHTFEWLFVRLAPIILIGGVVGIF
FT                   LTRKNV"
FT   CDS_pept        772943..773095
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00761"
FT                   /product="Putative 6-phospho-beta-glucosidase, C-terminal
FT                   part"
FT                   /note="similar to 6-phospho-beta-glucosidase, C-terminal
FT                   part"
FT                   /db_xref="PSEUDO:CAS04529.1"
FT   CDS_pept        complement(773109..773768)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00762"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00762"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04530"
FT                   /protein_id="CAS04530.1"
FT                   /translation="MPEKLDTVLGYLKEFPDYYKYVTKKTYTVNEKIIFEDEKAKSIFF
FT                   IVEGYAAVELEDNLRKTNYISIFVLPYNVLGIDAFSSYPKKKHSITVMSEHLMLYKIDA
FT                   DFLLNILSIKPDVNDFLLTSIADVFARHYALLGMIAKTPKERIYMALENLAVEMGTEDE
FT                   ERNEIVLPNFINQSVLARYCRTTQPNISNLLTELVEEEFLVNKKSPYRIDKDSLDI"
FT   regulatory      773124..773146
FT                   /locus_tag="Lm4b_00761"
FT                   /regulatory_class="terminator"
FT   CDS_pept        774031..774408
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00763"
FT                   /product="Putative transcriptional regulator (GntR family)"
FT                   /note="Similar to transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00763"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04531"
FT                   /protein_id="CAS04531.1"
FT                   /translation="MKFDDSKPIYKQIVHYIHTEIVTGIYNAGDKLLSVRELATKLEVN
FT                   PTTIQRAYAELEETEIIYTVRGTGKYLTEDKRRIEQLENDIAKQLTENFISEMSKLGIN
FT                   KEKIIAWVKKVEEVEVNVSGK"
FT   CDS_pept        774392..775081
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00764"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00764"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04532"
FT                   /protein_id="CAS04532.1"
FT                   /translation="MLVGNNIAKSYPNKLVLQNVDLEAKPGDMIVLTGENGSGKTTLLD
FT                   MLASLKKPDSGTLELDNEVFTTNDIRQQIAYLNNELYAKKSTTIEDYMKQHGLLFENME
FT                   LDKWDRLLAGWRINKRLKLGELSTGMLMKVKIGSVLARKAKLYLYDEPFASIDIMARSE
FT                   VMKAIISETNPDAITIISSHHLEGTEKLYSKLWLIKDNTLKTIETETYREETGNALIDF
FT                   YKEEMNK"
FT   regulatory      775062..775067
FT                   /locus_tag="Lm4b_00765"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        775078..775782
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00765"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00765"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04533"
FT                   /protein_id="CAS04533.1"
FT                   /translation="MTKMITFYLKQISPILLIGLAIILGLNFLGFTMNLLEGTDLLFRA
FT                   IRGTTVMSLILVLITTWKITKLDTSKENVTLASLSGFSETKKFFGKLFAAYLSAITVIL
FT                   LQSTFIWYYGFETGRMEAGDALSFVSGTLMMFLFIAMFVCYFVIPVGWLKDHVKASSLQ
FT                   KAAVILLLFAILIVNLLAEYYLHIYNGPGIISILPNGHFDISLLSIVWNVGLCSVIAGS
FT                   YIYMKSKKMDTI"
FT   CDS_pept        775797..777797
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00766"
FT                   /product="Putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00766"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04534"
FT                   /protein_id="CAS04534.1"
FT                   /translation="MLEIKHLKKSYKLGKKNETPVLKDINVTIQDGEFAAIIGKSGSGK
FT                   STLLNIISGLDTDYEGKVLYNGEDLQDIDLDAYHFNHIGFIFQSFHLVNHMSVIENVKV
FT                   PLYLNPELAESDRNARALDLLKQVGLEDFASKKPTQLSGGQKQRVAIARSLANNPDMII
FT                   ADEPTGALDSVTSDEIIKLLKDLAAKGTTVIVVTHDLNIADQTDAVLRLADGEVISFER
FT                   KKEVVQKVTHKNEKKLRLNWWATAKISFKSFFNRKFRNLLVALGTSIGIIAILLAFGLG
FT                   NGVNQSLSKIFGTTFSPNQITTYYKEDGGSKSPEPTTSLTSSEIKKIKQLYEDENITEI
FT                   YERTTVQGIKFEYDGEYLKGISGEMQEANFKPSRYEDLTVKDEYLLSGKMVTSDETGAV
FT                   IPSSVARAILGKKDSDELTKSDGDKLIGKKITLVYAGRNSDTKNTVKTETIISGITNPS
FT                   KEGFARGFDVSTKTMNDFIKTTGIEKPILSVDAFTKTTAEAEEIVEKYEDDKDWANYSI
FT                   TNANAFVDTFSQFTDIIVYLIAFIAGLSLAVAGVMIAIVLYIGVVERTREIGVFRAIGY
FT                   RKRHIRGLFMMEASYIIILANVLSSLVAVTIAKIASPILETKIGFEDMIHISFWNFLVT
FT                   LAITITIGFIFSIYPSNKAAKLDAAEALRSE"
FT   CDS_pept        777826..778329
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00767"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00767"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04535"
FT                   /protein_id="CAS04535.1"
FT                   /translation="MKKPLKISLIVVGIAVVIFAGVMLSYRFIKSMDVTENAEINKSAT
FT                   GDHVLLATQGSKFKDSVMDQVKKDMEGKNVHVSIIDTTKLDKVTADDYDKVVLFTTVQS
FT                   DDIPENVTTFMNDNKDKSIHIAVTADSGRWDDKPKDIDAISEASKAENKQDFVDDLTKA
FT                   IVAE"
FT   regulatory      778342..778361
FT                   /locus_tag="Lm4b_00767"
FT                   /regulatory_class="terminator"
FT   CDS_pept        778480..779316
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00768"
FT                   /product="Putative a putative haloacetate dehalogenase"
FT                   /note="Weakly similar to a putative haloacetate
FT                   dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00768"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04536"
FT                   /protein_id="CAS04536.1"
FT                   /translation="MSVLNIEGAKLSYQKVGQGPILIFIPGANGTGDIFLPLAEQLKTS
FT                   FSVVMVDRRGYGDSELTAAIPERASHAYDDYRVTRDAADIAALAKALSDEPVYILGSSS
FT                   GSIVAMHVLKNHPEVVKKIAFHEPPINTFLPDSEMWQEANEKIVQTALTKNMAEAMQLF
FT                   GETLHIAPIDAESMSKPAVTIDEVTKDSTTQQMKYWFTYEIRQYTSSNISLDDFKPYVH
FT                   QITLLNGTDSKGSFPQDVNAFIAKQLGLTIVDIPGGHLGYIQKPAGFAKVLLSIWG"
FT   regulatory      779327..779353
FT                   /locus_tag="Lm4b_00768"
FT                   /regulatory_class="terminator"
FT   CDS_pept        779442..780122
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00769"
FT                   /product="Putative transcription regulator Crp/Fnr family"
FT                   /note="Similar to transcription regulator Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00769"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04537"
FT                   /protein_id="CAS04537.1"
FT                   /translation="MNIRTELQNSQLCEGLTEAQLNELMNKITVKEKHYKNNEILFYTD
FT                   EVTKVYILVKGNAAIAKNTSSGKRILGKNVTEPGELAGEIYYFSHRNPFWDYVIVLEPT
FT                   TVLEISSIDQETLQTLDLALQNQLLVNLLKSVTRKFEYIGEKVRMVSEDSVRAKISNYL
FT                   FGIQDDDGSIELTETREEIADYLDITRPSLSRELGRMQKENIIRIEGSSVIILDAIIFD
FT                   TFIE"
FT   CDS_pept        780203..780814
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00770"
FT                   /product="Putative a bile acid 7-alpha dehydratase"
FT                   /note="Weakly similar to a bile acid 7-alpha dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04538"
FT                   /protein_id="CAS04538.1"
FT                   /translation="MLLTRNEPFTAEKIQAKTDILELVQFERFCRDNALWDEMETCFTK
FT                   DSNVKISWFQGTGHGFIEASKKMTNPAPHKIYNTQVWINNDRAVAIMQATIQTRTIING
FT                   VEMELNSDAKLVTRVERIEGRWYINAFEGVYEKDSLMPIIPSKLADVPAELLANFRKSY
FT                   ACLALSLTLNGYEIDNNLPGIDRPEQVAQFFKEADEWLLQ"
FT   regulatory      780823..780848
FT                   /locus_tag="Lm4b_00770"
FT                   /regulatory_class="terminator"
FT   CDS_pept        780929..781750
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00771"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00771"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04539"
FT                   /protein_id="CAS04539.1"
FT                   /translation="MKKSKTVQILLVFSVVALILSMVGVVSIWYGQKNHQTNNAKTTAK
FT                   KETTVTKKQDTFKITALGDSLTYGVGDTEGGGYVRVVENFYKQKEKNVENVNLAISGAK
FT                   SDQLLKQLDQKEVQNQIKSADVILMTIGGNDLFRGGEALDDFKSNAIKQAEASYTNNLK
FT                   QIYQTIRKLNPSAPVFHIGLYNPFMSLKNASEMSAVANEWNMQSQNLSQNEKNIIYVPT
FT                   FDLFQQNGDAYLATDKFHPNHAGYQFIGNRVTEVIQTGGGKDDDGASTSSN"
FT   CDS_pept        781722..782627
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00772"
FT                   /product="Putative ABC transporter (ATP-binding protein)"
FT                   /note="Similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00772"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04540"
FT                   /protein_id="CAS04540.1"
FT                   /translation="MTELALQVTNLHKKIRKREIIKGISFEVMPGEVFGFLGPNGAGKT
FT                   TTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYTFLTGQENLAYFAR
FT                   MDSSIKKERIQEVTELVGLEKRINDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNG
FT                   LDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLL
FT                   SSRAQLRWLATPFEQAKAFLESVTEVEVDGEYLVTAVNEHSAEWNEQLVAKGIQVHEID
FT                   KKKPSLEDLFLELTGGHTID"
FT   CDS_pept        782620..783600
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00773"
FT                   /product="Putative hypothetical protein"
FT                   /note="Similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00773"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04541"
FT                   /protein_id="CAS04541.1"
FT                   /translation="MINLVYNEQLKLWRKKRLIVILALVAIIVAIFTYAQFRQHQEDEK
FT                   QAGTSDWHVQTQQQIVDLENRLGTGRLPEEYQKYFKVLVGQLQYYLDNDINPNAPGAPT
FT                   FLKTFVENGISLLFPLFIMVIAADLISAETSAGTMKFLLTRPVKRWRILTSKYISMLLS
FT                   ISAIMVLSAVIAYLISGIVFGYGGWDAPVLTGFGMKDGAVTTTDVYQLPVWQLLLMEFG
FT                   LAWFVSVVVGVLTMFVSVLVRSTAAVMGIMLASLITGTILTNLVSSWPSAKYLFMVNLQ
FT                   LTNYLNGSSPPVEGMTLSFSMLVLTAWMLVAFILSYFIFTKRDVY"
FT   regulatory      783602..783619
FT                   /locus_tag="Lm4b_00773"
FT                   /regulatory_class="terminator"
FT   CDS_pept        783727..784617
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00774"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00774"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04542"
FT                   /protein_id="CAS04542.1"
FT                   /translation="MIKGIHHVSALTKSFSENHHFYSDILGLRLVKNTVNQDNIHMRHL
FT                   FYGDYTGSPGTLLTFFEVPRIGSSYNERAFFGNITLGIPKGTSSYWKKRLNDFAISFQK
FT                   EGQTLTLQDPDTMGIILTEIPETISNPTIHTDIPAEKQIVRIIGADYHVPNPAATSQFF
FT                   TDLFGLESQNGVLVDKDKTSFAKLHATSSDKKSRTGRGTIDHIAYTVETKEAVDELHHI
FT                   AVRNDLKIEEFVDREYFKSLYIREPGGLRIEFASAGPGFTIDEPLETMGDNLALPSFLE
FT                   EKRTEIETYFGGDLS"
FT   CDS_pept        784614..785573
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00775"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00775"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04543"
FT                   /protein_id="CAS04543.1"
FT                   /translation="MIKDLKGIHHVTAMTSSAEKNYAFFTEVLGMRLVKKTVNQDDIHT
FT                   YHLFFADDKGSAGTDMTFFDFPNLPKGRHGTDSISRVAFRVPSDAALEYWLDRFEQLEV
FT                   PHSDIKTLFGKKYLTFQDFDDQQLQLISDENNEGVAAGTPWKNGPVPEKYAIYGLGPVF
FT                   LTVVSLKNMDAILQTIFGFRKVTEEDGLHLYEVGEGGNGAQVIVEERTDIPAAMQGYGG
FT                   VHHVAFRVEDHEELQKWIDRMNTIEAPNSGYVNRFYFESLYVPVSERILFEFATDGPGF
FT                   ASDEPYETLGEKLALPPFLEPKRAEIEKMVRPINTKRS"
FT   CDS_pept        785580..786188
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00776"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00776"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04544"
FT                   /protein_id="CAS04544.1"
FT                   /translation="MELIYIPGKNKDLAPLLLLHGTGGDEKSLVEVAEFIAGDAAVLSL
FT                   RGDIKEGGANRFFKRFHDGSLDLEDLESKTAELITTTRELAEKYQLDFERMIAVGYSNG
FT                   ANIAANALLQAEDSFHKAILFHAMPAGNKQPEFSISHRNVFLSAGLNDPLITAKASEEL
FT                   VEILEKRGAKVETVWTAAGHSLTMEELEEAKKWYQNNQK"
FT   CDS_pept        786198..786818
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00777"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00777"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04545"
FT                   /protein_id="CAS04545.1"
FT                   /translation="MTIFKSADLSQKENYKFLTGSIIPRPIAFVTTLAEDGETVNAAPF
FT                   SFFNVVSSDPAIVSIAVQRANGEQKDTARNAAFTKEINIHIVSESFVEEMNKTAARLAP
FT                   DVSEIDKTSLHLEKVPGMKTPKISEANIVLTAKLEQIIPIKNDAGEVVSDLILARILTY
FT                   DFADEVFDSEHHYILPEKLEPVARLAGNDYTKLGDIFRIERPN"
FT   regulatory      786198..786234
FT                   /locus_tag="Lm4b_00776"
FT                   /regulatory_class="terminator"
FT   CDS_pept        787146..788402
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00778"
FT                   /product="Putative ATP/GTP-binding protein"
FT                   /note="Similar to ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00778"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04546"
FT                   /protein_id="CAS04546.1"
FT                   /translation="MEKKVLIVGISQKQKDFDYSMEELANLAAANNMEVVGEIRQNIDR
FT                   ENRATYVGKGKVDEIKGLAEMQDARLIIFNDELSPSQIRNLEEALELDVMDRTGLILAI
FT                   FANRAKTKEAQLQVQIAKLQYELPRIFGQGEDMDQQSGKGGLSNRGSGEKKIETDRRTI
FT                   KYQIRHLQKELDMLVDDREVRRRKRKKNEIPVVSLVGYTNAGKSTTMNGLVRAYSETAE
FT                   KQVFEKDMLFATLETSVREIVLPDNKQFLLTDTVGFVSKLPHQLVKAFRSTLEEARDAD
FT                   LLIHVVDYSDPHYKTMMKTTEETLKAVGVEDVPVIYAYNKADLIEGEIYPKQTENTIVF
FT                   SAREKESLEFLTEVIRKELFASYEKATFLIPFEAGNVVAYLNDHADVLATEYLENGTQI
FT                   VAEVSPADLQKLAEYQVAE"
FT   CDS_pept        788468..789340
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00779"
FT                   /product="Hypothetical protein of unknown function"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00779"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04547"
FT                   /protein_id="CAS04547.1"
FT                   /translation="MKKTGWGILGAVAAFTGYAYWSTKHLTVTDYEIVSDKIPAEWDGA
FT                   TFVQLSDLHSASFGLYNNPLLSIVNELAPDAVFLTGDMIDGDESPYVAMAVVRKLAKEF
FT                   PVFYVSGNHEGRSAFYEDFKADMEKHHVTVLENERYFLKKDGAAIMVAGVRDPRFVRDD
FT                   WAEKELPKEVWEEAALKEALDDATANLSPDYFTILLAHRPEFWPLYQAYPIDLVLSGHA
FT                   HGGQFRLPLTEGLFAPGQGLMPKWTAGIHRAGGKALIVSRGLGNVTKLPRLFNDPEIIR
FT                   MTLRAKGDA"
FT   CDS_pept        789346..790335
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00780"
FT                   /product="Putative lipoate-protein ligase"
FT                   /note="Similar to lipoate-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04548"
FT                   /protein_id="CAS04548.1"
FT                   /translation="MIYLDNEDVLDQAYNFAMEEYALRSLDENETYFMFYRMKPTIIVG
FT                   KNQNTLEEINHAFVKEHHIDVLRRLSGGGAVYNDEGNISFSMITKDDGNSFQNFAKFTE
FT                   PVIRALRKLGVNAELSGRNDIEVNGKKISGNAQFATKGRLYSHGTLLFDVDLSMLEKAL
FT                   QVDPEKYLSKGVKSVRSRVTTIREHLAEDIDILTFKQILLESIFETKDIPRYTFTEADK
FT                   QGIEKLRTERYRNWDWTYGKSPKATIKRKKRFPAGTIEFQVSLEKGQVKEATIYGDFFG
FT                   TEDVAELAGKIIGCRFERKSIQNAWQEINAKDYFGGIEKEAILDMLFE"
FT   regulatory      790345..790367
FT                   /locus_tag="Lm4b_00780"
FT                   /regulatory_class="terminator"
FT   CDS_pept        790490..791788
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00781"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00781"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04549"
FT                   /protein_id="CAS04549.1"
FT                   /translation="MVIANRDFIQISTEKIKKEINNQKLVEMYKRCMENTLDTTIKIRD
FT                   SGLTFILTGDIPAMWLRDSVCQVRPFLIFAKENEEIESMLIGLSKEQVSLVEIDPYANA
FT                   FNETPNGAGHQADKTEMHPQVWERKYEIDSLCYPIQLAYFIWKITGRTEQFDSAFFKML
FT                   QTIFALWEVEQHHETKSPYRFERMDCVPSDTLKRNGLGTETAYTGMLWSGFRPSDDACE
FT                   YGYLIPSNMFAVVVLGYAKEIIEAFYPREIETIKQAVTLQNDIQLGIEKFGTYNHPTFG
FT                   EIFAFEVDGLGNQLLMDDANVPSLLSMPIIEYLEKESPIYQNTRKFILSKSNPYYFEGK
FT                   LAKGIGSPHTPAGYIWPIGLAIQGLTASDKSEKLEILQMLLRTDAGTGLMHESFHPDYP
FT                   EDFTREWFSWANMMFCELVLDVAGFRMANVLKN"
FT   CDS_pept        791805..792695
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00782"
FT                   /product="Putative sugar ABC transporter, permease protein"
FT                   /note="Similar to putative sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00782"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04550"
FT                   /protein_id="CAS04550.1"
FT                   /translation="MATIRNKSAQIHQQRMAYLFIALPVLLLAIFMILPIGMALFVSFT
FT                   DYDIVNSPNWIGFDNYIKMFRDPYFLISLKNTIIYTALFVPLGLAASLGAAILINMNKK
FT                   GAGLFRTFFYVPVLCSTVATATIWYWLLNPQYGLINRVLGWFGINGPAWLYDSNWAMFA
FT                   IVMMSVWMTFGTNMMIFLAGLQGIPANLYEASKIEGASRWKTFRYVTWPSLSRTTFLVT
FT                   TMLIINAFQVFDQAYVLTKGGPGNSTITLVYYIYNEGFGGLKMGYASAISFVLFLIILV
FT                   FSIINMRVNKEDRTA"
FT   CDS_pept        792707..793582
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00783"
FT                   /product="Putative ABC transporter, permease protein"
FT                   /note="Similar to ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00783"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04551"
FT                   /protein_id="CAS04551.1"
FT                   /translation="MNTIKFKKGSKSFIWYIAVLLISLVTVFPLIWTVSTSFKPTSEIL
FT                   SNSMNLIPKMFTWDNYKDVFSTTPFARYLVNSLILAVGGVLTNLFFGSLAGYAFAKLPF
FT                   KGKKGLFMTFLGSMMIPAVVTMIPSFLVLKNFPLMGGNDITGHGGMGFINTYWAILIPG
FT                   AAGAFSIFFMKQFFETLPDELSEAARIDGCSEFKIFWKIYMPLAKTALATLGIMTFQAG
FT                   WNQFMWPLIVLNSQKMMTVQVGLASFQYNESANYGALMAGTIVSTIPVLFVFIFAQKYF
FT                   VEGIAHNGGK"
FT   CDS_pept        793604..794857
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00784"
FT                   /product="Putative sugar ABC transporter (binding protein)"
FT                   /note="Similar to sugar ABC transporter (binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00784"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04552"
FT                   /protein_id="CAS04552.1"
FT                   /translation="MKKVLLAILSMVLLLSLAACGGSSDSSKDKDGKEEIVMWGSWSGD
FT                   QIKQLEKQIDSYNKSQDKYKVKYVMQENVEEKLLTGIAGGELPDIIMWDRYQTALYAPK
FT                   GVLEPLDKLVKEDNVKMDDFYEESVKEMTYSDKLYGLPLLNDNRILFYNKKLLQEAGVK
FT                   PPTTWDELATAAQKTTKWDGNKMTQAGMSLQDVGLFNLYLMQAGGELVTSDNKETAFNS
FT                   EQGLEVLNYWDKMQNDLKVYQRGFDDGSDAFAAGKEAMTYNGPWALADYNKVEDLDYGV
FT                   VEPPKGPNGDKGAIMGGFGLVMPKQAEHKDGAWDFMKWWTTKPENGVEFAKISGWLPAN
FT                   KIAAEDEYFTKDPNYSVFVNTMKYAKIRPTVAGYADVEGLAMKPQFEKFMNGNISAEKA
FT                   LSQAEKEGNQILKEERDK"
FT   CDS_pept        794861..795889
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00785"
FT                   /product="Putative alpha-1,6-mannanase"
FT                   /note="Similar to alpha-1,6-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00785"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04553"
FT                   /protein_id="CAS04553.1"
FT                   /translation="MKWSEYANLAQLSLEKFYLADTKEQFLNNFYPTENLEEDNKVFNY
FT                   WWLAHLVEVRLDAYLRTKKQADLEIAENTYLHNKNRNGGTLIHDFYDDMLWNALAAYRL
FT                   YKETGKPIYLEDAQLVWQDLVDTGWNNIMGGGFAWRRPQMYYKNTPVNAPFIILSCWLY
FT                   NEFNETKYLEWAMKTYEWQTKVLVREDGFVEDGINRLEDGAIDYEWKFTYNQGVYIGAN
FT                   LELYRITKDAKYLDTANKTADISLKELTEDGIFKDEGSGGDEGLFKGIFYRYFTDLMEE
FT                   TANKTYRNFVFNSCQVLVDNAKLDGYLLMGMNWKENPSGKIPYSAELSGMIALEMAAKL
FT                   ER"
FT   regulatory      795894..795914
FT                   /locus_tag="Lm4b_00785"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(795896..795916)
FT                   /locus_tag="Lm4b_00786"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(795901..797019)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00786"
FT                   /product="Putative transcriptional regulator (LacI family)"
FT                   /note="Similar to transcriptional regulator (LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00786"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04554"
FT                   /protein_id="CAS04554.1"
FT                   /translation="MKKLLYQKVYDQLKLSIQEGKIPVGSKMPAENELMAQFDVSSITL
FT                   KKALELLKKDGYISRRPRVGTFVINASPVSEQIETRMFDKPLFGCIMTNFDDTFGTTLL
FT                   SGMLEHSDSKAHIIVKKSLGDTEREEEILQEFIEMNVAGILILPASSKFVSPTLLELAS
FT                   QKFPLVVIDRTLEGLPISSISSDNTEAGRIITEKLFELGHKHIGMITSTSPVSTLDSRV
FT                   NGFIRGHASFHTAFHSDYVFREIESVMPNSTVSIQTDIDKIAHFLNTHSEITALVATEY
FT                   NIALLIKQACNKLGKSIPGDLSVVCFDHPDNFFDNSAFQFTHIKQAQYEIGVKAVDMLL
FT                   NQVLKPDTINKETLPPMLIEGDSVKMLKSTSK"
FT   CDS_pept        797179..797931
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00787"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00787"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04555"
FT                   /protein_id="CAS04555.1"
FT                   /translation="MAIKKLNDFYFKKLGNWNLIHSFLKGFWRAFFFLLLLLLIADLIV
FT                   MKFVNDRYFIPVILLSLLCIPLLYYILIYSRAKKFIRTRYQLRSFAELTTMRRYLLYAY
FT                   LEKSGFSTRADLEKLIRFIHSEMAEEKKNYQPLSTVVGVFIAAFLAILGGTFLFLMDDV
FT                   VERLIAAVLIMVMAILLYIVGTFIMSIIRSKSENNTKKERVLTKEIIAIQTAMLVSENT
FT                   SYHPFLAMERKIAENDFLKEIITSRSFL"
FT   CDS_pept        797967..798614
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00788"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00788"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04556"
FT                   /protein_id="CAS04556.1"
FT                   /translation="MTTKRKETRESVCYREIKKKIRNGELKPGDRLIENTLSQQLEISR
FT                   TPIRKAIGMLAADGYVEYNDFRGAFVRDSIINKERYFEMTEIIGLFLKQAIQKIRTKKI
FT                   AFNKMRVVAKLVEIEREQPTDPATYFEYEKWFVSDLLTYMKNNYYLKISDDFFNNIQEF
FT                   GDEEVIKIAQNACVKTIANIQRFIDALDVQDYDKCIAIIDQVIDAHVLVAYR"
FT   regulatory      798619..798647
FT                   /locus_tag="Lm4b_00788"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(798619..798647)
FT                   /locus_tag="Lm4b_00789"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(798655..799644)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00789"
FT                   /product="Putative alcohol dehydrogenase"
FT                   /note="Similar to alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00789"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04557"
FT                   /protein_id="CAS04557.1"
FT                   /translation="MKSFQALFIEKEADNTSLHFRETTIDNLPENEVTIEVHYSGINYK
FT                   DGLAVLPDGKIVSEYPFIPGIDASGVVVHSKSDQFQVGDEVIVTSYDFGVSYFGGYSEF
FT                   IRVPAAWVVPLPDGLSLKEAMILGTAGITAALSVDALEFSGVTPDAGKIAVSGATGGVG
FT                   SLSSAILSKRGFSVVASSGKSDAKEFLEKFGVSEIVSREAFQPEKVRALDKQLYAGAID
FT                   CVGGKPLSYLLTAVQYGGAVTTCGMSAGGKLDTTVFPFILRGIQLFGIDSVLCPMPKRE
FT                   RIWNRLATDFKLTNLESLVTEVGFSELPEALHQVMNGGVTGRYLVKIK"
FT   CDS_pept        799823..800752
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00790"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04558"
FT                   /protein_id="CAS04558.1"
FT                   /translation="MGKALLIVNPSSGKEKGKTYQGKTEEVLKKRYDEVEVRLTEKAGD
FT                   ATEFASWAAEQGFEAVIAMGGDGTLNETINGLAIHEKRPDFGFIPLGTVNDLARSVGIP
FT                   LKPEKAIQALEKAIAVPMDIGRIGDQYFMNVLAIGMIAQAVDQVSVEQKTKFGSVAYFL
FT                   EGLKAFNRNELLHFKIEYDEEVWEGEAALVVAGLTNSVGGMESWAPDAKIDDGYLHIII
FT                   LTKLGLLDAANMIPQLIRGNLKNSDGVVYIKTKKLTIDASGDDLSINVDGDPGPGVPAE
FT                   IEVLGSHLNILAPKKSSKKRFGPFILKK"
FT   CDS_pept        800792..801124
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00791"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00791"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04559"
FT                   /protein_id="CAS04559.1"
FT                   /translation="MEEELEVIHKGLANAKNGFKAVPGKLYLTATYIVHKPNDYFDEEI
FT                   NIPLNRVAKIRGVRTKILGKELLSNILEIDMISGVKYQFVVNKQKKWLEAVSEVLESRG
FT                   ESEKLG"
FT   regulatory      801128..801157
FT                   /locus_tag="Lm4b_00791"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(801162..802028)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00792"
FT                   /product="Putative transcription regulator (repressor)"
FT                   /note="Similar to transcription regulator (repressor)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00792"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04560"
FT                   /protein_id="CAS04560.1"
FT                   /translation="MTILAFDLGGTAVKFGVLTTAGEILEKGKFKTPDNLDEMLQSLMD
FT                   VKANYDYTLQGAAFSCPGAVNNETGIIGGASAIPYIHNFPFKQLLEEKLGLPVTMENDA
FT                   NCAALAEVWIGAAKDKQDIIFMILGSGVGGAVIRGGKVHHGANLHGGEFGYMLMDRDGR
FT                   TLSELGTVVNAATRIAERLEVPKASIDGLRAFELRAEGNKIAKEELDTMFYYLARSIFN
FT                   LQYTLDPELVVIGGGVSERADFIQELTEYVAKVKASVPIATISPTVVGCHFGNDANLIG
FT                   ATAFHLA"
FT   CDS_pept        802186..802569
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00793"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00793"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04561"
FT                   /protein_id="CAS04561.1"
FT                   /translation="MEIKVQKKLTDGRIAFSSEYGECVGIWADEDPEPSRVYTVEITIP
FT                   DMISAELLHESEEKHCALEIDEEGLVHVIGKLEDYEEDGFAVLRLEESIICFDTKFSEE
FT                   IEMLHGRFVEFVIPEIKLSNVGI"
FT   CDS_pept        803023..803373
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00794"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00794"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04562"
FT                   /protein_id="CAS04562.1"
FT                   /translation="MKKKKWLQLIMAVIVLCAIIFGIKWLLYRDNLVEMMQVDDTLYIV
FT                   SYEPAKQEDALEKIGEIEHRIRHYRIPNKNFTSNYLSEGTELYKAKNGDEFPRTILFKE
FT                   DGEYFIASEAMK"
FT   regulatory      complement(803529..803571)
FT                   /locus_tag="Lm4b_00795"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(803576..804043)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00795"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00795"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04563"
FT                   /db_xref="GOA:C1L148"
FT                   /db_xref="InterPro:IPR009328"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L148"
FT                   /protein_id="CAS04563.1"
FT                   /translation="MVWDATNIFLFAANILTVLYILYNDAVIPLWKGKTVLSVKLRSRG
FT                   RWDGYIFVGIIVLLFVSNTFFREGPFSTSVLLGIMGVLFIYICFFRSSKAVFKESGLFY
FT                   ALLFFPYAKIERMNLSEDGVLVIETNRQRLMLFARSEKDLEKMLAVFTTYS"
FT   regulatory      complement(804177..804200)
FT                   /locus_tag="Lm4b_00796"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(804225..805103)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00796"
FT                   /product="Putative mannose-specific phosphotransferase
FT                   system (PTS) component IID"
FT                   /note="Similar to mannose-specific phosphotransferase
FT                   system (PTS) component IID"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00796"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04564"
FT                   /protein_id="CAS04564.1"
FT                   /translation="MSEQITVNEKKITKSDLMGVFIRSNLFQGSWNFERMQSLGFCFSV
FT                   IPVIKRLYPEKGPEREQAIKRHLEFFNTHPYMAAPILGVTTAMEEQKANGADIDDGAIN
FT                   GIKVGLMGPLAGVGDPIFWGTVRPVLAALGAGFATDGSIIGPILFFVLFNAIRLGFRYW
FT                   GVFYGYTKGTDVVSDMSGGLLQKLTEGASILGLFVMGALVNKWTTIYVPLVAYTTEDSK
FT                   TGKDVPTTVQSILDQLMPGLLALLLTFACMWILKKKVNALWLILGLFVVGILGYWSGIL
FT                   GLPPAGYSPLG"
FT   CDS_pept        complement(805121..805936)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00797"
FT                   /product="Putative mannose-specific phosphotransferase
FT                   system (PTS) component IIC"
FT                   /note="Similar to mannose-specific phosphotransferase
FT                   system (PTS) component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00797"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04565"
FT                   /protein_id="CAS04565.1"
FT                   /translation="MSAIQLILVFLVSCISGMGSILDEWQTHRPLIACTLIGLVLGDIT
FT                   TGIIIGGTLEMIALGWMNIGAAVAPDAALASIISTILVITGGQDISVGISLAIPLAALG
FT                   QVLTILVRTITVAFQHMADKAGKEGNLRSLDWIHVTALLLQAMRIAIPAVIVAVTVGTQ
FT                   AVENLLNAIPDVIVNGLNVAGGFIVVVGYAMVINMMSAKYLMPFFFLGFVVAAFTAFNL
FT                   VALGVLGLVAAIIYIQLNPKYQLKEAIQQYGGGGGGRSADDDLDDDLDD"
FT   regulatory      complement(805944..805949)
FT                   /locus_tag="Lm4b_00797"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(806111..806596)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00798"
FT                   /product="Putative mannose-specific phosphotransferase
FT                   system (PTS) component IIB"
FT                   /note="Similar to mannose-specific phosphotransferase
FT                   system (PTS) component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00798"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04566"
FT                   /protein_id="CAS04566.1"
FT                   /translation="MEIRLARIDDRLIHGQVATVWTKETQVERIIVISDDVAKDEVRKT
FT                   LLTQVAPPGVKASVVDVQKGIRVYNNPKYATTPVMLLFTNPTDVLTLVEAGVNITTVNI
FT                   GGMAFREGKHMITNAVSVDETDEAAFRKLDEKGIELEIRKVASDNKVKLIPLLDKDK"
FT   CDS_pept        complement(806596..807030)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00799"
FT                   /product="Putative mannose-specific phosphotransferase
FT                   system (PTS) component IIA"
FT                   /note="Similar to mannose-specific phosphotransferase
FT                   system (PTS) component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00799"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04567"
FT                   /protein_id="CAS04567.1"
FT                   /translation="MPVGIIIGTHGEAARELLKSTEMIIGKQDNVEFITFVPGENTDTL
FT                   ITKYKEKLDKLDTSEGVIFMVDLFGGSPYNASSQIALPEDNMDVVTGVNIPMLLETLSM
FT                   RAASNQKDLVETALTAGSGGVKSLKQSLPKIETEVGEDDL"
FT   CDS_pept        complement(807318..810134)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00800"
FT                   /product="Putative transcriptional regulator (NifA/NtrC
FT                   family)"
FT                   /note="Similar to transcriptional regulator (NifA/NtrC
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04568"
FT                   /protein_id="CAS04568.1"
FT                   /translation="MKRIDRIYEFILENPSTKTIREQLEKNEGFTASTISETLSILRNN
FT                   VSMELNELHRQGKIIKIVGRPVLYFPKKAVEDEIGRTLSDNELEFDSCEPLLKMLKPSI
FT                   VERSPFDDLIGVNDSLKTPVEQAKAAVLYPPNGLHTMILGQTGVGKTLFANLMYRFSQH
FT                   AKRLPADAPFIIFNCADYYNNPQLLMSHIFGHVKGAFTGADNDKGGLVEKAEGGILFLD
FT                   EIHRLPPEGQEMIFYLMDSGTYNKLGETDRTRKSNVLIIGATTENPESSLLKTFMRRIP
FT                   IIITLPSLEERTAFERVELLKYLLSSEAHRVNKPIRIEDEAAKALIGNTTYGNIGQLKS
FT                   NIQLVCAQGFLNSFDKDEEILIDFKTLPINIKDGFFHFSNRRKELQAIAEYLEPYTTIF
FT                   PELNNTLITSDEYEPNFNLYKIIEDKASILMDQGVEDDDIKKFIKMDIDIHLNSFYNKF
FT                   KNTIHNRENILKIVNEEILNFAEGVELRIEHQLGKKLNERFLLAFSLHLTSFIKRIESN
FT                   KPLKYTNIENVVNDQPEAYELSREIKDDIEATFHIRVPNMEVMYLTLLISSLLKEQENA
FT                   RVAVLVATHGNNTASSMVSVAKKLLGEGLVEGIDMPLDQSPKIVLDKLTERAKEMDMGR
FT                   GLLLLVDMGSLTSFAPVISERTGIPVRSIDMVSTATVIEAVRKSNILDMELDSIYDSLK
FT                   DFRGYGGYNSDDDTLDSNQKPHAIITICATGEGTAEKLQLFIENILDTITTDAIKVIPI
FT                   GLHEMDTKLEQLQEENDILMAVGIQDPKIQIPFIPLERLFGIDGEEQLVSLVKQRNIIV
FT                   KKGETGRIAKEIIEESLNEFLTYLNPKKTIEILSSFASVLEKKLGYKLDNTFKINLLIH
FT                   VGCALERMVLNDGLIYREPKDMLETNIFKALEQTNKEVIYKMNLKLTNDELCYLYDILN
FT                   EIQPEVLS"
FT   regulatory      complement(810142..810147)
FT                   /locus_tag="Lm4b_00800"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      810313..810318
FT                   /locus_tag="Lm4b_00801"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        810327..810962
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00801"
FT                   /product="Putative acyl-carrier protein phosphodiesterase"
FT                   /note="similar to acyl-carrier protein phosphodiesterase
FT                   and to NAD(P)H dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00801"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04569"
FT                   /protein_id="CAS04569.1"
FT                   /translation="MSKVLFIKASPLPNEVSRSSQVAETFMAEYKAKNPSDTVEELVLY
FT                   NTEVPLLDLELMTAGRELQAGKAFTDLAPDVQKKLNAYNALTEQFLAADKYVFVFPLWN
FT                   LGIPPLLKAYIDTFVIAGKSFRYTEHGPEALLKDKKAILIHGSGGIYSAGPTSSFTHGE
FT                   PYLRTILQFIGINVVPSIFVEGIDHNPSKEAEIVAAAKAVAQESAAEF"
FT   regulatory      810999..811018
FT                   /locus_tag="Lm4b_00801"
FT                   /regulatory_class="terminator"
FT   CDS_pept        811156..812532
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00802"
FT                   /product="Putative amino acid transporter"
FT                   /note="Similar to amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00802"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04570"
FT                   /protein_id="CAS04570.1"
FT                   /translation="MEEQKEELQRGLKNRHIQLIAIGGAIGTGLFLGAGKSIHLAGPSI
FT                   MLVYLIIGAILFFVMRALGELLIHNPTTGSFTEFAEQFIGPWAGFITGWTYWFCWIVTG
FT                   IAEITAVGMYVKFWVPDLPQWIPALACVLILLLFNLATVKAFGEIEFWFAIIKVVVIIA
FT                   LIVIGFVLVFIGYKHGTSTASFSNLVDYGGFFPNGIAGFLLAFQMATFSFVGIELVGVT
FT                   AGEADDPERTLPKAINNIPIRILIFYIGALLVLMSIYPWSNIDPNTSPFVSVFTMIGIP
FT                   AAAGIINFVVLTAAMSSCNSGIFSTSRMLYTLSAEGKAPKKMHHLSSNGVPATALITST
FT                   ACLLIGVFLNYFLPEQVFILVTSIATICFIWVWGVILVAHLRFRHKHPEIAEKSKFKMP
FT                   LSPLMNWVSLIFFGGLLVILGFAADTRIALFVTPVWFLILGIAYQVLKASNRKTKIRHN
FT                   "
FT   regulatory      812540..812580
FT                   /locus_tag="Lm4b_00802"
FT                   /regulatory_class="terminator"
FT   CDS_pept        812797..817227
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00803"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00803"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04571"
FT                   /protein_id="CAS04571.1"
FT                   /translation="MIHAGLDVGSTTAKAVALNDQGDILFQTYRRHYSDIKKVTLEIMQ
FT                   DMQKKCGMTEMTFKITGSSGLAISKFLNVPFVQEVIACTEAVEQVIPETDVVIELGGED
FT                   AKIIYFSGGIEQRMNNACAGGTGAFIDQIATLLQTDPTGLNELAQNANTIYPIASRCGV
FT                   FAKTDVQPLLNEGARKEDIAASIFQSVVTQTISGLACGRPIRGKVAFLGGPLTFLDQLR
FT                   YRFTETLKMKDSDIIAPQNAEYFIALGTAFTGLNDVPLKVDDMIYRLSNMDMTTMATDT
FT                   VILPALFEKQEDLEAFRARHNQMKAKRAKLEDYEGDAYLGIDAGSTTTKLILMSQTNEI
FT                   LYSFYSSNNGNPLQSVIDATSDLYEILPEKVRVAQSGITGYGESLIKAALKIDVGEIET
FT                   VAHYRAAREFLPDVDFILDIGGQDMKCMKIKKGALDSLMLNEACSAGCGSFLETFAQTL
FT                   NLSIEEFAARALEAKAPVDLGSRCTVFMNSKVKQVQKEGVSMEDLSAGLAYSVVKNALQ
FT                   KVIKLRSPKDIGEKVIVQGGTFYNESVLRAFELLTGREVVRPDIAGMMGAYGAALIARE
FT                   HYETGEVTEMLVLEKLREFSAETSQSRCNLCSNTCQLTVTRFGDDRMFVSGNRCERGER
FT                   VETKRNLLPNLYAYKLKRTFDYKSLKKSEATRGTIGIPRALNVFENYPLWHTILTNLGF
FT                   RVVLSSKSSKNLYDKGIETIASEAVCFPAKLTHGHIMDLIKKKADRIFYPSVVYEKPEF
FT                   GEATNNFNCPVVAGYPEVIRVNVDALEEKNIPMISPFLTLDNEKALIEQMSLAFPEVPA
FT                   ADMEKAVQAGLEEAELCRKDIQAEGEAALTYIKKNKIKGIVLAGHPYHIDPEVNHGIPE
FT                   LITMNGMAVLTEDSISHLGEIDHKLRVENQWKYHARLYRAASFTAKSEDLEFVQLTSFG
FT                   CGLDAITTDMCQEIIEGHNKVYTLLKIDEINNLGAARIRVRSLKAAMEEREKNNVKPGI
FT                   MPKPKERPLFTKEMKKTYTILAPQLAPTHFEMLEAACKVGGYNLEVLPAVTPRAVDEGL
FT                   RYVNNDACYPAILTIGQMMDALKHGDYDVNNLAVLMTQTGGGCRATNYISMLKKALGEA
FT                   GLDHIPVISLNANGLEKQPGFKMTPKVLVRFLAGISLGDALDRMLYRTRPYEVEPGSAN
FT                   KMFRHYLDAGRALMENYSFGAYKKLANEMVRAFDNLPITNEVKPRVGVVGEILVKFHPG
FT                   ANNNIVDVIEDEGGEAVVPDLTDFILYCCYDDHFAANTFGRSKVKSFAKQSVAIPLINQ
FT                   FRKPVTDALKKSERFEAPASIESIAEKASQLLSLGNKMGEGWFLTGEMFELLDSNVPNI
FT                   ACLQPFACLPNHITGRGMIKGLKKMYPEANIMSIDYDAGSSSVNQLNRIKLMLSIARKQ
FT                   LETTEVITEKETNTRFNPREKILGKAKQVRESAPVEMIGNKVKQARDADPVGAIAQKVK
FT                   HVASSSSEHVQTDND"
FT   regulatory      817234..817254
FT                   /locus_tag="Lm4b_00803"
FT                   /regulatory_class="terminator"
FT   CDS_pept        817405..819585
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00804"
FT                   /product="Putative cell surface protein (LPXTG motif)"
FT                   /function="putative cell surface protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00804"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04572"
FT                   /protein_id="CAS04572.1"
FT                   /translation="MKKFVLIFICFLTLTTIVPWNTLETKAASTSWLEQELDGNEAFIT
FT                   ETERVLSKNREDITLADLETIQELDIYGDASSIPDKISDYKNLNTLLALNGTISEIPTS
FT                   ITKLTKLTRINVDNNNFQEFPMILLQMPSLSSIEINRNKIKEIPSEITTLSPHLGSLDV
FT                   RYNELITLPDNIFTTEWESKLSLLTTGNQLVSDIPADWLDNFNQADNMLEFYNNPPNDY
FT                   HQKQDQLTYSGARIEVPLNTDLKTLTPDKTKLGLKSGRTLFEQHEFMYYDDGTSNNILT
FT                   NGVATATGNGYITIKSTLSTNSNPFAKVRVPITVTPPVKGGDVTVQYKDTTGVVLADSI
FT                   TLSGNVGENYTTTAKTIDGYSLTTTPTNANGTFSTNPQTVTYTYKKDPIAQPVTVNYID
FT                   TDGKTIAPTETLSGNVGENYTTTAKTIDGYSLTTTPANANGTFSTNPQTVTYTYTKDPI
FT                   AQPVTVNYIDTDGKTIAPSETLTGNISENYTTTAKTIDGYSLTTTPANAKGTFSTEPQI
FT                   INYIYAKNAETAQPITVNYRNSTGQKIAKSEVLTGNIGESYSTQPKTIAGYTLTTIPPN
FT                   AKGTFTTNAQTVTYMYTPIAISALPVTVNYLDENGKEIADSVVLNGRVGEAYNTLAKEI
FT                   DGYTLIKTPTNSNGVFSAEAQSIDYIYRKNKPVVIVNPPIKNPIIKIDSSTNVIKEETS
FT                   VLPKTGDSNPYNDFLAGILLLSSAMFLWKNHK"
FT   regulatory      819620..819651
FT                   /locus_tag="Lm4b_00804"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(819689..819712)
FT                   /locus_tag="Lm4b_00805"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(819702..820550)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00805"
FT                   /note="Conserved hypothetical protein"
FT                   /note="Similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00805"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04573"
FT                   /protein_id="CAS04573.1"
FT                   /translation="MNLSVYVASAFSKNNKGGNKAGVVLNEPTLATAQKMAIAKQLGYA
FT                   ETAFLTESNCADYKLEYFTPKEEVDLCGHATIGTFAILMHLNKIHKSQYTIETNSGVLT
FT                   ITIKDGTIFMEQNQPTFYDTIPPNKLTGCFNLNLLNTNYPIKIVSTGLKDILIPIKSKA
FT                   DLYALEPNFEEVKKVSKHYEVVGMHLYTFNADQIICRNFAPLYDINEEAATGTSNGALA
FT                   CYLYKNHYLRKENYVFEQGYSLHSPSEIFVNLVISNKDEIEKVYVGGKGYYCEMQDLSM
FT                   E"
FT   CDS_pept        complement(820577..821053)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00806"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator (EbsC from
FT                   Enterococcus faecalis)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00806"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04574"
FT                   /protein_id="CAS04574.1"
FT                   /translation="MNKKTNACRILDKQKVNYELREYAWSEDSLDALHVAAETGNNPAQ
FT                   IFKTLVLTGDKTGNIVACIPADKTLHLKHLAKISGNKKCELIAVDTLEKLTGYIRGGCS
FT                   PIGMKKLFPTFIDNSAESLDTILISAGKRGLQIELAPTDLKKVVRAEFAMITEE"
FT   CDS_pept        821177..821827
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00807"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00807"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04575"
FT                   /protein_id="CAS04575.1"
FT                   /translation="MKKGLFSMVLVLAMVLVLSACGASRVEPKKAGEITVNAVVYNKDT
FT                   DKVKDVYGEDGSKFEKEFETSFKESFISTFTASFSSDVNLDKQVDEFYDALRKQVNEKT
FT                   SYTTKVTNDDKESPEIQFAVKGLDMKGVQTELVEELTKAATADPSLATDDQKMAEKTME
FT                   IYTKAVQNADAVSEAKTVTLKLKADPDDDSLWKMENDMAFMQELTTAFFMGGM"
FT   regulatory      821845..821870
FT                   /locus_tag="Lm4b_00807"
FT                   /regulatory_class="terminator"
FT   CDS_pept        821933..822823
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00808"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00808"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04576"
FT                   /protein_id="CAS04576.1"
FT                   /translation="MTTIKIALIQQKAVPNNKEANLKLAIKYIKEAHEKGADLVLFPEM
FT                   WSNGYAPPFEDAFNHPLATDFDNERTKWLNEAITEDSAYVLTLKELAKELKIGICATYL
FT                   SKTEQKPQNTAIIIDRKGEIILDYAKVHTCDFSLEILLQSGEEFKVCEFDGIKLGVMIC
FT                   YDREFPESARVLMLKGAEIILVPNACDINPARLNQLNSRAFENMVGVAMANYPGEKWGR
FT                   STAFSPIVFDENGDYRDNTIIETEDVSEGIFIAEFNLDEIRTYRENETWGNAYRKPQTY
FT                   TDLISLDVEAPFKRN"
FT   regulatory      822829..822848
FT                   /locus_tag="Lm4b_00808"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(822829..822848)
FT                   /locus_tag="Lm4b_00809"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(822858..823559)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00809"
FT                   /note="Conserved hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00809"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04577"
FT                   /protein_id="CAS04577.1"
FT                   /translation="MVLLGALVNGLGILIGSVIGMKLHNIPERMKDTVMKGMGLSVIVL
FT                   GIQMAFKTSNSLIVILSICFGAVIGEWLNIDYHLNQLGHWIERKVGAKGKSNVSKGFVT
FT                   ATLIFVIGAMGIIGALDSGIRGNHDVLYTKSVMDGFIALLLSTTLGWGVMLSAIPVFLF
FT                   EGIIALFATQINQFVPADLMALIIKELTATGGIMILAIGLNLLGLTKIRVANLVPGILV
FT                   VALIITGLYYF"
FT   regulatory      complement(823640..823666)
FT                   /locus_tag="Lm4b_00810"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(823674..824315)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00810"
FT                   /product="Putative YwnB protein"
FT                   /note="Similar to B. subtilis YwnB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04578"
FT                   /protein_id="CAS04578.1"
FT                   /translation="MKIGIIGATGRAGSRILEEAKNRGHEVTAIVRNAGKITQTHKDIN
FT                   ILQKDIFDLTLSDLSDQNVVVDAYGISPDEAEKHVTSLDHLISVLNGTVSPRLLVVGGA
FT                   ASLQIDEDGNTLLESKGLREAPYYPTARAQAKQLEHLKSHQAEFSWTYISPSAMFEPGE
FT                   RTGDYQIGKDHLLFGSDGNSFISMEDYAIAVLDEIERPNHLNERFTVAGK"
FT   CDS_pept        complement(824399..825319)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00811"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00811"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04579"
FT                   /protein_id="CAS04579.1"
FT                   /translation="MENKQNGQLGGIIAGALAYVCWGVLPIYWKLVTNVPPMEILAYRI
FT                   IWSFIFMLFLIVCLRKASMVFQETKDVLLKPKTLIAIIAAAFLVTANWYLFIYTVNSGH
FT                   VTEASLGYYINPLVNVLLATVILKERLSRGEIIAVISATIGVLILTWHLGSVPWAAIGM
FT                   AVTFSLYGLIKKVVSVSVWTGLTLETMIITPFALIYVIFFATNGLMQYAAQTNIILVGA
FT                   GVVTAIPLLLFATAAKKISYTMVGFLQYIGPTLMLALGVLLFKESFDHIQLFAFMFIWL
FT                   ALIIFTISHIYSAAKIKQLANAAKK"
FT   regulatory      complement(825394..825418)
FT                   /locus_tag="Lm4b_00812"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(825428..825958)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00812"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00812"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04580"
FT                   /protein_id="CAS04580.1"
FT                   /translation="MTVEKWNVDPAHSSIEFQVKHMMVSKVKGAFSDFTADIEMDPEDL
FT                   TSAKLNFSVAAASVDTRQAQRDGHLKSEDFFNVEKYPNVTFSATKITADGDDEYEVTGD
FT                   LTIRDVTKPLTLEVSYEGTGKDPNTGNMVAGFEAKGKFNRKDFGLNYNAALETGGVLIG
FT                   DEVKLNIQIEASK"
FT   CDS_pept        826214..826675
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00813"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00813"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04581"
FT                   /protein_id="CAS04581.1"
FT                   /translation="MVGINTDTENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAM
FT                   INVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKLNKTIPNDSMDLTLKLSK
FT                   KGEDLSKRSTANAFMYKAMMKVFENLTENEIEELIRLNKKVETLLKKSK"
FT   regulatory      826679..826721
FT                   /locus_tag="Lm4b_00813"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(826679..826721)
FT                   /locus_tag="Lm4b_00814"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(826727..828187)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00814"
FT                   /product="Putative lysine-specific permease"
FT                   /note="Similar to lysine-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00814"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04582"
FT                   /protein_id="CAS04582.1"
FT                   /translation="MKKETHGEIRRDLKTRHLSMIAIGGSIGTGLFLASGNAIHTAGPG
FT                   GALVAYIAIGIMVYFLMTSLGEMATYMPVSGSFSTYASRFVDPAFGFALGWNYWFNWAI
FT                   TLAVDISTAAIIVQFWLPNTPAWLWSAIFLILIFGLNALSVKAYGESEYWFSIIKVATV
FT                   IIFLIVGVLTIVGILGGEVIGFSNFTAGDAPFKGGFFAILGTFLIAGFSFQGTEMVGIA
FT                   AGESATPETSVPKAIKQVFWRILLFYIFAIFIIGMIIPYTNPNLLSAEATDVAISPFTL
FT                   VFEKAGLAFAASVMNAVILTSVLSAGNSGLYASTRMLWAMARDKKAPKFLGKVNRRGIP
FT                   MAALIVTTIVGAMTFITTLTENGTVIYTWLLSASGLTGFIAWVGIAISHYRFRKAFIKQ
FT                   GHDLSELKYKAKFFPFGPILALILCILVIVGQDYAAFLKPEFTNPAWWQKIGISYIGLP
FT                   IFLVFWLSFKFTNKTKVIPLEDCKFDQK"
FT   CDS_pept        complement(828543..829304)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00815"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00815"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04583"
FT                   /protein_id="CAS04583.1"
FT                   /translation="MTAYPQFDVILKALNLSSVGVIITDPEQKDNPIIFVNTGFENITG
FT                   YAKEEALGSNCHFLQGDDTDKKEVAKIRHAINEKSTANVLLKNYRKDGTSFMNELTIEP
FT                   IYDDHNHLYFVGIQKDVTTEHDYQLELEKSLTEIEKLSTPIVPIKENICVLPLIGSLTH
FT                   DRFQHMSEYVSEYMDHGKEDYLIMDLSGLAEFNEDAVMNLVKFHGFMKLTGVELIITGI
FT                   SPKFAMTLIRYEENLASLTTYSTIKEALQFY"
FT   CDS_pept        829457..829810
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00816"
FT                   /product="Putative YqkB protein"
FT                   /note="Similar to B. subtilis YqkB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00816"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04584"
FT                   /protein_id="CAS04584.1"
FT                   /translation="MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRL
FT                   VEEKTAEDDEIESNIGPVLIKRWTEMFLEEALTIDYNDTEKTMILKSDGQYYNRNLLLV
FT                   TNTDEVISCPVTS"
FT   regulatory      829824..829850
FT                   /locus_tag="Lm4b_00816"
FT                   /regulatory_class="terminator"
FT   CDS_pept        829965..830603
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00817"
FT                   /product="Putative GTP-pyrophosphokinase"
FT                   /note="Weakly similar to GTP-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00817"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04585"
FT                   /protein_id="CAS04585.1"
FT                   /translation="MEQPSVDELKNWRNVMLLHRFALEEVNTKLKILNEEFQFIHDYNP
FT                   MEHLKSRVKSLESIGAKLEKKKVDITPENALKYVHDIAGIRITCSFVSDIFRIHEMLAG
FT                   QSDITIKRVKDYVTNPKPNGYRSLHLLCEVPVFLTNRSEKMTVEIQIRTVAMDFWASLE
FT                   HKIYYKYQQEAPIELVKELQDAARIITHLDEKMKNLNDQIDQYKKEKEK"
FT   CDS_pept        830732..832780
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00818"
FT                   /product="Putative Na+/H+ antiporter"
FT                   /note="Similar to putative Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00818"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04586"
FT                   /protein_id="CAS04586.1"
FT                   /translation="MEIFLYVLALLVAIFISNLLNRFVPFVSVPLIQIGLGVLIAIMPI
FT                   TFDLQLNPELFLVMFIAPLLFNDGRQTDKAALWGMRMPILVLALGLVFATVVVIGYFVH
FT                   WMIPTIPLAAAFALAAALAPTDAVAVSSLSGRINLPKRIMNLLEGEALINDASGLVAFQ
FT                   FAIAAMVTGVFSFMDASISFFVIAIGGILVGLILSWLKFRLLKWVRGLGMEDVTFHMLI
FT                   QILTPFIIYLAAEEIHVSGILAVVAAGIMHSMEQKKMDPQSVKLNVVSQSTWSVIIFVL
FT                   NGLVFLLLGTQLPAITEVVWNDSGSSNLQVMAYILSITAALILLRFLWVYISWSIGAKQ
FT                   RQKQNKKTQLPKFRPVVLTSLSGVRGAVTLASALAIPFFLDDGSLFPQRSLIIFIASGV
FT                   ILCTLVIATFILPLLAKSEEVTTEDERAETATRIRILRNVIRELKEQTLPETKAATDEV
FT                   IEDYRRRIYDLQQNNSSNRGMDERERAKRLEIIQWERENTQKMTDEGRIVATDSYRYQH
FT                   YLNMMEQAIKQRFRTKIKTAWMFLYRLIMLVIHPKKWGRITHKVKKGISKDSERFQAIR
FT                   QLREENEVLIISKLKEQLTKENVDIIGPLITEHTIFLERVRKEHSPRGKRAKFEQKKRE
FT                   VQVLAFQLERDIIQNMFEKGGISRDLARDLRQNLNMIETYLYDDFLE"
FT   regulatory      832787..832816
FT                   /locus_tag="Lm4b_00818"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(832787..832816)
FT                   /locus_tag="Lm4b_00819"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(832820..833293)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00819"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00819"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04587"
FT                   /protein_id="CAS04587.1"
FT                   /translation="MKSYPFFKYNMNIKTFFMFIVCFAILSLGLYFFITFESLRIWQFF
FT                   GIYTFFSAYTIYVLTTYVNGTVSVNSHALFYKKGFSDKKYLFNQYMLECDTRLHGRTTS
FT                   FLPFYTINILDLETGKETKIKIRNAAIVHRNGRKNFHLEIVNLAEQLKKIQAK"
FT   CDS_pept        complement(833321..833779)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00820"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04588"
FT                   /protein_id="CAS04588.1"
FT                   /translation="MKKYRFSELNINIGTVLLIIMISFTFITFIIIGMTLPVPWEYFVI
FT                   LFVIALMFSVFFKRLFPSNFSVSEEAFYYKEKAYPYSEYLIECDAKLIRFNGGSRGMPY
FT                   YRIVIINKDTRAEKLIRVYNAERRYKNANKHMQELMEELRNEINQYQA"
FT   regulatory      complement(833789..833794)
FT                   /locus_tag="Lm4b_00820"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        833989..834531
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00821"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00821"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04589"
FT                   /protein_id="CAS04589.1"
FT                   /translation="MEIGKRIKNLRLSKNLTQEELGERTDLTKGYISQLERDLSSPSIE
FT                   TLFAILEVLGSTPKDFFDEEEHNQKVIYGELEHTFFEDEEKGYRIKWLVPESNEKEMEP
FT                   VLLEIEANSCFKSFEPSLSETFAYVLKGEVTVLLGRNEYVAKKGEAIYFHAADEHQIIN
FT                   RSNEQATLILVATESYL"
FT   regulatory      834532..834537
FT                   /locus_tag="Lm4b_00822"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        834547..835641
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00822"
FT                   /product="Putative spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="Similar to spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00822"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04590"
FT                   /protein_id="CAS04590.1"
FT                   /translation="MTETIIRFENVTKQFDNDPPVLDNVSFEIEKGKFYTLLGPSGCGK
FT                   TTILRLIAGFLEASEGQIYLGDKVINQIPANKRPVNTVFQDYALFPHLNVYENVAFGLR
FT                   IKKLKKDAIDEKVKEALRFVNLKGYEKREISEMSGGQRQRVAIARAIVNEPEVILLDEP
FT                   LSALDLKLRTEMQYELRDLQKRLGITFIFVTHDQEEALAMSDEIFVLNKGEIQQSGTPI
FT                   DIYDEPINKFVADFIGESNIVNGKMIQDFEVEFVERRFECVDQGFRPNEVVEVVIRPED
FT                   LEITSAEKGQLQVTVDWMLFRGVHYEVGCIDTDGNEWLVHTTRKVRVGDKIGLAFEPEA
FT                   IHVMRLGETEEEFDKRLDSYDEVQ"
FT   regulatory      835628..835633
FT                   /locus_tag="Lm4b_00823"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        835641..836450
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00823"
FT                   /product="Putative spermidine/putrescine ABC transporter,
FT                   permease protein"
FT                   /note="Similar to spermidine/putrescine ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00823"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04591"
FT                   /protein_id="CAS04591.1"
FT                   /translation="MNRRTRTVYLVPYVLWILLFVVAPILLIVYYSFFDVDGNFTVDNY
FT                   IHFFTPVYLKMTASSFWYAFLITVFTLLISYPTAYLLTKLKHKQLWLLFIILPTWINLL
FT                   LKAYAFIGIFGTYGAANQFLEIIGIGSKQILFTDFSFLFVSTYIFIPFMILPIFNAIEE
FT                   INPTLIQASRDLGASSLTTFRRVIFPLTADGVKSGCQAVFIPALSLFMITRLIAGNRVI
FT                   TLGTAIEEHFLVTQDWGMGSTIGVFLIIAMILIMFLTGSKKKRGARK"
FT   CDS_pept        836447..837253
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00824"
FT                   /product="Putative spermidine/putrescine ABC transporter,
FT                   permease protein"
FT                   /note="Similar to spermidine/putrescine ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00824"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04592"
FT                   /protein_id="CAS04592.1"
FT                   /translation="MKKSKWGTIYLVLVFVILYAPIFYLIFYSFNKGGTMHNFSGFTLG
FT                   YYKEVFQDTRLLIIVLNTFVIALLSSVIATIIGVCGALAIKFMPKPFAKNSLLSLNNVL
FT                   IVSPDVIIGASFLIFFTILGVKLGFISVLVSHIAFSIPIVVLMILPKLQEMSPTLMDAA
FT                   RDLGASQWQVLSKVILPYIMPGVLAGFFMALTYSLDDFAVTFFVTGNGFSTLAVEIYSR
FT                   ARQGISLSINALSTLIFLFTIILVIGYYFINQRNTSKNIRTGATKE"
FT   CDS_pept        837250..838323
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00825"
FT                   /product="Putative spermidine/putrescine-binding protein"
FT                   /note="Similar to spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00825"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04593"
FT                   /protein_id="CAS04593.1"
FT                   /translation="MKQLLKIFVPVIVVALLMMLLATTMNRSEGYAGSNTLTIYNWGDY
FT                   IDPSLITKFEKETGIKVIYQTFDSNEAMMTKIEQGGTTFDIAVPSDYAISKMKEENLLI
FT                   PLDHSKLPNEKYLDPRFMDLSFDDDNKYSMPYFWGTLGIIYNKEMFPDKNFDTWNALFD
FT                   PELKNQILLIDGAREVMGLGLNSLGYSLNDTNKAHLQAARDKLETMTPNVKAIVGDEIK
FT                   LLMADNEAGVAVTFSGEAAEMLSENEDLEYVIPKDGSNLWFDNMVIPKTAKNVDGAHKF
FT                   INFMLKPENAAINAEYVGYATPNAKAVELLPKEISSDERFYPDMDELNNLEVYDNLGKR
FT                   MLSYYNELFLEFKMYRK"
FT   CDS_pept        838453..839154
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00826"
FT                   /product="Putative carbonic anhydrase"
FT                   /note="Similar to carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00826"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04594"
FT                   /protein_id="CAS04594.1"
FT                   /translation="MTKEKVLWGYDEKTGPEMWGHICSDFEIAHTGKAQSPVDIEQADV
FT                   VKLKPSTMKFYYKETDYTIRRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLL
FT                   DGYIYPIEWHFVHEKPDGTTLVMSAWMEIDNTNNVEFKDLPTYFPEVFADFETEREITL
FT                   DVNEFMPEERVFYTYQGSRTTPPTVEGVTWIVLKNAKTLGQEDFTEFEKAIGNTSRPVQ
FT                   DLNGREITFYN"
FT   CDS_pept        839222..839764
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00827"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00827"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04595"
FT                   /protein_id="CAS04595.1"
FT                   /translation="MYEKARQMMIKAHSGQVRKITGEPYFSHPLNVARILRRAGFREEV
FT                   VVAGLLHDAVEDTEMTDADIRAAFGAEVADLVASHTENKTLSWEERKAHTIEQVRTGNL
FT                   EEKALIVADKLDNLTSVKYALSSEGKSVWSYFKRGYDLQKWYNQGIKNNMEYGLNPSEI
FT                   PPFFGEYARLVKWIFKK"
FT   CDS_pept        839900..840772
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00828"
FT                   /product="Putative fructokinase"
FT                   /note="Similar to fructokinases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00828"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04596"
FT                   /protein_id="CAS04596.1"
FT                   /translation="MVYGAIEAGGTKFVVAIGEKSGKIIKRESYPTTEPAETMKAVIQF
FT                   FKQYEDELKAIGIGSFGPIDIRKSSATYGYITQTPKLAWRNYDIVGAMKKEFNVPIGFT
FT                   TDVNAAALGEVSLGAAAGLDSCIYLTIGTGIGGGAVVSGKILEGFSHPEMGHIMVRRHK
FT                   RDRFTGSCPSHSDCLEGLAAGGAIEKRWGQKAAELADNEEVWNLEAHYIAQALMNYTLI
FT                   LSPERIVLGGGVMKQRQLFPLVRQKLKALVNNYVQLPDLDEYIVPPKLEDDAGITGCVL
FT                   LAVDAEESN"
FT   regulatory      840783..840803
FT                   /locus_tag="Lm4b_00828"
FT                   /regulatory_class="terminator"
FT   CDS_pept        840857..841783
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00829"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00829"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04597"
FT                   /protein_id="CAS04597.1"
FT                   /translation="MSITNLLNIKYPIIQGAMAQIAKAPLVAAVSNAGGLGIIASGGMT
FT                   ADMLREEIKKTKALTDKPFGVNLMLMMTNIAELTEVIIEEKVGIVTTGAGTPKTFMPIW
FT                   KEAGIIVIPVVPSVMIAKRMEKMGADAVIAEGTEAGGHVGETTTMALLPQIVDAVTIPV
FT                   IGAGGIADGRGIVAALALGAKGVQIGTRFLATDECPVHPDFKAAVIKASDRDTMVTGRK
FT                   AGAPVRSIKNKMIKEYIRLEEENADRDTLEELTLGSLRKAVQEGDTDNGSVMAGQIAGL
FT                   ITEIKPCKDVIEEMMTDAKNVIAGLEL"
FT   regulatory      841792..841827
FT                   /locus_tag="Lm4b_00829"
FT                   /regulatory_class="terminator"
FT   regulatory      841983..841988
FT                   /locus_tag="Lm4b_00830"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        841999..842283
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00830"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04598"
FT                   /protein_id="CAS04598.1"
FT                   /translation="MREIKVNEATFQKHASKLDSKSAGSYLPLKGGNMAYSRANSINQL
FT                   RSALIDLVDVVEDFQAVTKQDAGRLKKMGMAYAKQDQAMGQKINQLEVR"
FT   regulatory      842270..842275
FT                   /locus_tag="Lm4b_00831"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        842284..842652
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00831"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00831"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04599"
FT                   /protein_id="CAS04599.1"
FT                   /translation="MDSTHTRLEQQLQQVKKAQDVLQDNLGQTKRKQVEQEWLEEDSHQ
FT                   LEMEKQGLLDFLRGGWQGEEANGFHRYLEEQQHEEAMAWRKDLSEKRVHLEEEARTTRA
FT                   EMHDIETKQASLRKEWNQ"
FT   regulatory      842636..842641
FT                   /locus_tag="Lm4b_00832"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        842649..844124
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00832"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00832"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04600"
FT                   /protein_id="CAS04600.1"
FT                   /translation="MSRIDIAELNGFLQGLRSSNAEAKKMIRGIQQAASKYAQDKSLKG
FT                   QAVSASQSYFASSYPSIAQSILEALEESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVASLKRKEEDLHRQLTAPNTKPDMQQVYVVQARSAHTQLLQAIEKEDILERYIAFE
FT                   QSHAQFFSALTELIHSTGRAVQELKQNVTFHEKTGTYAVPKSVHASISLMRKAMDKARK
FT                   ENAKDSFPEAFEDYQLFAYTYVNDKGETVTMWLLERNGKRASNKELQAFLEENGAELDP
FT                   ILYTNLSGDELERKVNDAWKDGVNYLNGQKVTGFSEATLRSSAYVASVKDAMDDAGLTD
FT                   MALGLGFGIAAARNKKIIAKKSEKVEVDLGRYSVATLNRDQARLVVEHLLERGEISLKD
FT                   LGDIIPKGTPNTFKTTDTLKNGAKYEFQLADGQKAIIRWHEPDPIAAAKFPGSASGSRW
FT                   TAQIKIGSKQVTINKGWTKKQNSNEVHIPIKGR"
FT   regulatory      844116..844121
FT                   /locus_tag="Lm4b_00833"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        844129..844560
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00833"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00833"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04601"
FT                   /protein_id="CAS04601.1"
FT                   /translation="MKKIMKKDDYSKMPWVSAEDLYLLFEQALKDFKQSKLSKKEFFDI
FT                   LDELTMRQVDTYEILKEPLRGQLDNELYNLWNTENYDDVDIITSLLINLGLKNTYNKMK
FT                   KSIEDTSEISPEILEEIQDAIEEVGDNIDDPYQDYMKKM"
FT   regulatory      844624..844629
FT                   /locus_tag="Lm4b_00834"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        844638..844910
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00834"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00834"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04602"
FT                   /protein_id="CAS04602.1"
FT                   /translation="MKELRLFLDYKCYPVWVYNDAGILKENDLPDELKQDEYDKLFIDT
FT                   EIEFRYEAFKDEKEKEEFFHEFIEVQKHLKETLGKEYNIVNKILV"
FT   regulatory      complement(845002..845033)
FT                   /locus_tag="Lm4b_00835"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(845045..845449)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00835"
FT                   /product="Putative PhnB protein"
FT                   /note="Similar to E. coli PhnB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00835"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04603"
FT                   /protein_id="CAS04603.1"
FT                   /translation="MSFAVPYLVFNGEGQDALTFYADVFQAEITSVQRFKEMNNFDGNA
FT                   VFGERLMHSRLAKNGEEFIYITDAPYDGFTIGNRVTILINFETEEDIKYAYEVLSATGK
FT                   VEMELQVAFWGSTYAQVTDQFGVFWQLNFG"
FT   CDS_pept        845674..848304
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00836"
FT                   /product="Putative cation transporting ATPase"
FT                   /note="Similar to cation transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00836"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04604"
FT                   /protein_id="CAS04604.1"
FT                   /translation="MLWVKESIEQLLSKLHTNLDTGLTKEQVKQKHAEFGTNEFEEGKK
FT                   ESLLQKIGHHLVEITTIVLLFAAAISAYLAITTGYGWAKVVVILGIVVLNMVLGIYQEN
FT                   SAEKALAALQSMNAHLTTVVRDGVRMQVDATELVPGDIIEIVAGDMIPADARIISSSSL
FT                   QVEESALTGESVPVEKDANAVVSEKAPIGDRLNMLYSGCLVTNGRATAVVVEIGMETEM
FT                   GKIAGLLNSTSKLMTPLQLRLKELAKRLSIVALLAGILIFIIDVYVYGETIIETLMIAI
FT                   SLAVAAVPETLPVIVTLTLAYGVQNMVRKNTIIRRIPAVETIGNTSVICSDKTGTLTQN
FT                   KMIIQQIWAADHAPIKATAEFDTAEQKVLEMLSLSSNATIDVTDGEETIIGDPTESSII
FT                   RLLEEKGTTKKALEAKYPRVFELPFDSDRKLMTTIHQVEDGFLSITKGAFDRIPVNFSE
FT                   AFLAEAERVHDSFAEDALRVLVVAYKKYPEMPTDLSSEALETDLTFAGMVGMIDPPRPE
FT                   SKAAVLAAKKAGIKTVMITGDHIVTASAIAKEIGILTDGDKAITGAELAEMSEADLEKN
FT                   IRDYAVYARVSPEDKIRIVKAWQKNGEIVTMTGDGVNDAPALKAADVGAAMGITGTDVS
FT                   KNAADMVITDDNFATIVDAVKEGRTAYENIRKTIYFLLSTNFSQIFIMLIAIILGWGAP
FT                   VVAVQLLLINVVSDGIPGFFLSREKADDSIMERKPIPKNAGIFANGLGKKMATQAVVFT
FT                   IVTLAGFYIGQFVTINNSIGASYEVGMTMAFVILAWSSVAHIFNVRSDKSIFTIGFLSN
FT                   RGLFFSAICSMLIILGLAIIPPLANMFFLVEMSLTHWILAFILSMFPLLFVEIQKLIQR
FT                   KRAKA"
FT   regulatory      848305..848310
FT                   /locus_tag="Lm4b_00837"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        848319..849167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00837"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00837"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04605"
FT                   /protein_id="CAS04605.1"
FT                   /translation="MNETEKLVAALLERNFGKNIGTRYPDNEAAQMRAEEVIGEIAIVI
FT                   APLVEKLGIESKTVKKTIPFLYELQKNQFCDMSAYPYPLLLVNGTSADTEKYWRDLPTY
FT                   WTDDANKIVLPYVLEHIKNNKVRQKLLAFHAWLIGEVVEMNEELGADFRIKLVFESDMR
FT                   IRLRVYDVEQIAIEVHFLDNHDTEQQHLGYDVSLDVDITDKARLLLRQGILTENLGLEA
FT                   LKAYMKSVLPIAHSLKNLEYLTVEDTKKLTKLLTQEEPKIMEDTDLTSKALDFLQKAAQ
FT                   Q"
FT   regulatory      849263..849268
FT                   /locus_tag="Lm4b_00838"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        849277..849834
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00838"
FT                   /product="Putative acetyltransferase"
FT                   /note="Some similarity with acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00838"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04606"
FT                   /protein_id="CAS04606.1"
FT                   /translation="MIRHAKKSDAPKIAPLLLVIWKDMELPILEVETEEAITNALIEAI
FT                   QTEDYRYSYRHLHVYEKDGDIAGVLAGYPGKIEPEIDRAWNEIAKKHGIRYEEPIFADK
FT                   ETFPGEWYLDSIVTNEKYRGHGVGTALLAKLTEIAAEDGEKVVGLNCDKGNPHAKRLYE
FT                   RLGFHVTGEIILSGHEYEHMQK"
FT   CDS_pept        849851..850513
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00839"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00839"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04607"
FT                   /protein_id="CAS04607.1"
FT                   /translation="MKKIIFAVVLSLVLILAGCADVTNTVKVDKKGEATISFDIDISSV
FT                   AGIFASSYSDEVEAKLKEAGFTVDKKSNTSYHIEKKLDKNETTKSDMKPEDFGVKITNS
FT                   KSFFTQKIKVDADIDIEKIWKKEVADVPFPKEILSQVDYTFILDLPISSIGENNAKSVD
FT                   GGKLTWDVPLDKKSEMYFEVTVPNVKNIAIVGGILLVAIIGLLIYLIKRHRKKKKQL"
FT   regulatory      850518..850548
FT                   /locus_tag="Lm4b_00839"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(850529..850918)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00840"
FT                   /product="Putative transcriptional regulator"
FT                   /note="similar to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04608"
FT                   /protein_id="CAS04608.1"
FT                   /translation="MQQTIKEASEHTGLSAHTIRYYEREGLIPFLARDKNNNRIFDNDA
FT                   LHWLELLTCLRVTGMPLAKQKEIVELTKGGDGTVSERIAVLKEHQQDMYRRQAELDRAF
FT                   KKIEKKLACYEELEQAVNKSVDQFS"
FT   regulatory      complement(850927..850932)
FT                   /locus_tag="Lm4b_00840"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        851038..851862
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00841"
FT                   /product="Putative oxydoreductase"
FT                   /note="Similar to oxydoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00841"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04609"
FT                   /protein_id="CAS04609.1"
FT                   /translation="MNLKDTVKLANGVEMPRLGFGVWKVQDGDEAVNSVKWAIEAGYIS
FT                   IDTAAAYKNEEGVGQAIKESGVKREDLFVTTKLWNAEQGYESTLAAFDESLRKLELDYV
FT                   DLYLIHWPVKGKFKDTWRAFEKLYKDKRVRAIGVCNFHEHHLKELMEDAEIAPMVNQIE
FT                   LHPQLTQEPLRKFCAENNIVVEAWSPLGNGKLLSNPEIKAIADAHGKSVAQVILRWDLQ
FT                   IGVVTIPKSVHQERIIQNADIFDFELSEEEVAKISGLNKDERTGPDPDNFNF"
FT   regulatory      851874..851902
FT                   /locus_tag="Lm4b_00841"
FT                   /regulatory_class="terminator"
FT   CDS_pept        851941..852909
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00842"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00842"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04610"
FT                   /protein_id="CAS04610.1"
FT                   /translation="MDAKTIIENRFQSQKLIQTAWSDSPERIVFHFGAMQSQNYGQSLW
FT                   AVGSRMTTPSEKAVEQAINNGEIIRTWLLRGTIHLFSAKDYHWMMDLIAPSIDKICKPY
FT                   RAKLGLTDEVLHKATEVVSEIVSEQAVTRKDLAAHLATKDLPSAGIPFAQLLVYLSSRK
FT                   VICSGPNETFRNTMHIPADTNHFTREEAIKELAKRYIQSHAPATLKDFCFWSGLTVTDA
FT                   KIGIADMPKMGDYYITTLVENGTMPTTIPLAGFDEWIIGYRDRSVVLPEIWHDEIMTKN
FT                   GIFRPAIITEGKVVGKWEKPKKRAELDGDFWDRYIQFRNML"
FT   CDS_pept        852950..854230
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00843"
FT                   /product="Putative 3-hydroxy-3-methylglutaryl-coenzyme a
FT                   reductase"
FT                   /note="Similar to 3-hydroxy-3-methylglutaryl-coenzyme a
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00843"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04611"
FT                   /protein_id="CAS04611.1"
FT                   /translation="MNAFDKFYKKTVEERRAILAEYADLNEEEQAFLASTGALSFDKAN
FT                   HMIENTIGIYSLPLGLGMNMLLNDKHYVVPMAMEEPSVVAAQSAGAKLIGQNGGITGSA
FT                   TKRKMIGQIELISVSDIQAAKENIIANEEQLIAIANQAHPSLQKRGGGAVEIQVRTAQT
FT                   ANDETLLIVHLLVDTQEAMGANMVNTMVETLAPELEMLTNGTANMRILSNLVDEATATA
FT                   VCRINPESLATKTQSGEWVRDRIIAAYEFADADIYRAATHNKGIMNGIDAVIMAFGNDW
FT                   RAVEAASHAYAARTGSYKPMSKWSKDAEGYLVGELTLPMPVAFVGGSIGIHPIATLSKK
FT                   IARVESAKELAMLVCAVGLTQNLAALKALVTEGIQRGHMSLQAKSLAMTAGAEADEIEK
FT                   VATFLQESKQLNVVAAKEFINKLRSGK"
FT   CDS_pept        854429..856063
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00844"
FT                   /product="Putative transport protein"
FT                   /note="Similar to transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00844"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04612"
FT                   /protein_id="CAS04612.1"
FT                   /translation="MGDINIQQMIFQFIGGLGIFLFGIKYMGDGLQMAAGDRLRDILDK
FT                   YTTNPFMGVLAGILVTVLIQSSSGTTVLTVGLVSAGFMTLKQAIGVIMGANIGTTVTAF
FT                   IIGIKLSEYALPIIAAGAVLLFFFKNHKVKNIGQVFFGFGALFYGLDLMGQGMKPLAGM
FT                   ESFHELTAQMSTNPFLGLLIGTIFTAVVQSSSATIGILQELYGQGAIDLQAALPVLFGD
FT                   NIGTTITAVLAAIGASVAAKRAAATHVIFNLIGAIIFMLILPLFTSLVTYLQGLFGLNP
FT                   EMTIAVAHGTFNITNTFIQFWFIGAFAWLVTKLIPGDDSRIDYKTKHLDTNLIDQSPGI
FT                   ALEMAREETLRMADYAKFGLQEARQYLVNRESKHAESTIQVEEAVNNLDRKITEYLTKI
FT                   SSVALTNNETEEHALMLDTVRDIERVGDHMENIVENIDQLIKNKAKMSEEASDQLIEMF
FT                   ELTTANFERAVKSMHKKDRALAEETILVEKDIDKAERRLRKNHIRRLNEGKCQVVSGIL
FT                   YIDIVSDLERIGDHANNIAESVLELNE"
FT   regulatory      856072..856099
FT                   /locus_tag="Lm4b_00844"
FT                   /regulatory_class="terminator"
FT   regulatory      856199..856204
FT                   /gene="nifJ"
FT                   /locus_tag="Lm4b_00845"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        856216..859863
FT                   /transl_table=11
FT                   /gene="nifJ"
FT                   /locus_tag="Lm4b_00845"
FT                   /product="Putative pyruvate-flavodoxin oxidoreductase"
FT                   /note="similar to pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00845"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04613"
FT                   /protein_id="CAS04613.1"
FT                   /translation="MRNRKTMDGNTAAAYISYAFTEVAAIYPITPSSTMAELVDEWSSK
FT                   NKKNLFNEPVKVVEMQSEAGAAGTVHGSLQAGALTSTYTASQGLLLMIPNMYKIAGELL
FT                   PTVFHVSARTISAASLNIFGDHSDVMAARQTGFAMLAEGSVQEVMDLSAVAHLASLKGS
FT                   LPFLNFFDGFRTSHELQKVEVLEYDELENLLDKEALQQFRNRAMTPNNPKTLGSNQNPD
FT                   IFFQQRETVNRYYEEIPSIVQNYMQEINQLRGTDYDLVNYYGAEDATDVIVAMGSVTPV
FT                   IEQVIDYLTTQGKKVGLLNIRLYRPFPAENFLAKLPKTVERVAVLDRTKEPGSGGEPLL
FT                   LDVQSVLYDSETRPLVIGGRYGLGSKDVTPDQILGVYSHLTTEKPKPRFTIGITDDITN
FT                   LSIENAGPSDLTSEKTFQCKFWGFGSDGTVGANKAAIKIIGDNTDLYAQGYFSYDSKKS
FT                   GGLTVSHLRFGEKRIRSAYLIQQADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGE
FT                   QLERHLPAAMREYIAKNNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKA
FT                   LADLKESAIATYGKKDMAVAEKNILAMDQTVANLHKVEVPASWANPVVTAETNATTEKP
FT                   AYVQNILEPVNRLEGDNLTVGDLISNGMVSGAYPPGTAAYEKRGIALEVPEWISENCTM
FT                   CNECAFVCPHAAIRPILTDEEEMESAPEGFMTREMRGKDGLRYRIQVSPMDCTGCNLCA
FT                   ETCPAKDKALVMKPFEEVAAKENPNWSFAINVKPKKNPGKKNTVPGSQFEQPLLEFSGA
FT                   CAGCGETPYVKLLTQMFGDRMMIANATGCSSIWGASAPATPYTVNDKGHGPAWGNSLLE
FT                   DNAEYGYGMYLANQTMRKALNNKVTKALREEAMSETLREALIDWQTQMDVSEDTRERAE
FT                   ALQLALLSEMEGNAALESIYNDRELFIKRSQWMLGGDGWAYDIGFGGIDHVLASGEDVN
FT                   IFVMDNEVYSNTGGQSSKATPTAAIAKFASGGKSVGKKDLGIMAMSYGNIYVAQIAMGA
FT                   NKRQTLKAIEEAEAYPGPSLIIAYTPCINHGISSGMKTMLSETQKAVECGYWSLYRYNP
FT                   ALEEKGKNPMTMDYKKVDFNQFEDFLKRETRYSALYKANPDVATKLSEKTRLDAEKRFK
FT                   RYATMAGLDLEKIWKKKEATEDVKAPVDDERAARKAAREARRLAREQGK"
FT   regulatory      859869..859894
FT                   /gene="nifJ"
FT                   /locus_tag="Lm4b_00845"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(860113..862074)
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="Lm4b_00846"
FT                   /product="Putative fructose-1,6-bisphosphatase"
FT                   /note="Highly similar to fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00846"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04614"
FT                   /db_xref="GOA:C1L199"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L199"
FT                   /protein_id="CAS04614.1"
FT                   /translation="MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSD
FT                   VHGEYSAFEQVLRNGSGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLLASETED
FT                   LQAWYRTTLFRLIELCQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEE
FT                   ILQHIISLGRAEEFISALSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQ
FT                   WGNHDILWMGAASGSRVCAANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPC
FT                   TYFQPKNEENINYSNAEITQIARMHKAISIIQFKLEGEIINRRKEFDMDHRLLLQFIDY
FT                   KKGTIHLKGKEYLLLDSHFPTINPEKPYELTDAERELIGKITAAFKNCRRLQKHVQFLY
FT                   SKGSMFLTYNGNLLYHGCIPLHEDGTFMEMKLRGEKYAGRSLLEQFEILTREAYVRPTG
FT                   TKEKKYACDIVWYLWTGAISSLFGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELIC
FT                   KQILEEFGLDGECGHIINGHTPVKEGKGESPIKANGKMLVIDGGFAKAYHKETNLAGYT
FT                   LLFNSYGLQLVSHQPFTTKEDAIKNETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAE
FT                   DLKLLLDAYRNGLLHENR"
FT   regulatory      complement(862171..862188)
FT                   /locus_tag="Lm4b_00847"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(862189..863100)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00847"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00847"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04615"
FT                   /protein_id="CAS04615.1"
FT                   /translation="MEFLLILLPVFGIFAIGFIGQKTLKFDIPNLSKLTLYLMSPFLAF
FT                   NTFYTNALTIDYAYLAIYIFALCLSLILLVSLISFLLGYNLQDRCALILASAFMNNGNY
FT                   GTPVVLLVFGAVGLDIAVVLMVLQQLAMSTIGIYFAAKGSKDANGMKTVMKRVVRMPIA
FT                   YGALLGLTLQLLHVSLPSALMTCVKLVGDAAIPTIMIVLGMQLAVISFRRIELTKVGIA
FT                   LVLKLLIAPIIAFGLTLILPVDEMTKQIMILLAAMPTAANTTLMAVQFDTKPDLVSSAT
FT                   FISTVLSIITLPIVLYFLHPVF"
FT   regulatory      863745..863750
FT                   /locus_tag="Lm4b_00848"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        863756..864040
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00848"
FT                   /product="Putative transposase"
FT                   /note="similar to transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00848"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04616"
FT                   /protein_id="CAS04616.1"
FT                   /translation="MPKKLYNEKFKKSLVYLYHHGTPKYTLCNDFGVSIASLTRWIKFY
FT                   NTENIDLNEATNILQMYELKKQKSVLEAEISALSEAITIFNMETSSVEN"
FT   regulatory      864047..864072
FT                   /locus_tag="Lm4b_00848"
FT                   /regulatory_class="terminator"
FT   CDS_pept        864232..865122
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00849"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00849"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04617"
FT                   /protein_id="CAS04617.1"
FT                   /translation="MVAYGELIREVRLSKGLTQKEVYTGVISKSYAIGFEKGKHDITLV
FT                   LFEEILERVMLSSDEFFFMNRGYSLAEEDNFWYKFANAANQKSLADLQELYQEVLQQTG
FT                   DRANLRKAIVHSRMEINEQFLLNNRFDVSIVSEKDKAVIQTYLWKVQSWTLEEIRIFAN
FT                   SVDYFEEDVQIYFFQLVLKSLEKYKHYDRGKKVFSTLLSNIIEELITRNQLEYAAQLLE
FT                   ILRELSSTHDCAFYRIMHNYYQGLIWMKNDQVEQGLKESKSAIRILDVLDYKSLAQLYN
FT                   TLLQQFLEKENIQIV"
FT   regulatory      865132..865151
FT                   /locus_tag="Lm4b_00849"
FT                   /regulatory_class="terminator"
FT   CDS_pept        865200..865970
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00850"
FT                   /product="Hypothetical protein of unknown function"
FT                   /function="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04618"
FT                   /protein_id="CAS04618.1"
FT                   /translation="MYYLECTNFHMLFWKGEIFILNQKYQLLLQNEYDTKSGDLVKKEI
FT                   VAIKKTKNLLEDLTTHLLCVTNQTEYGKFINWYEMEVKKVLQVYPNQHFIVKISFQQLY
FT                   FRETMLLLENLQKDSRRITIELVGDSQISPNSKEHFSAEDSDAFLKGKLKMLRKWHYFI
FT                   SKHIESGAIEQTLIFTPYIDELKYSLTQKSKLLNNITELKFFLSFWKNWAELRFVDFLV
FT                   LVDEKNEFVSYVLLPDELNVRCKMYENFGGMVSE"
FT   CDS_pept        865963..866967
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00851"
FT                   /product="Putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /note="Putative peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00851"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04619"
FT                   /protein_id="CAS04619.1"
FT                   /translation="MSKNVKKIVITILALIMTVGLASGFISPIKASAATNNFTVKVEYV
FT                   DADGAEIAPSDTLTDYHYVSTPKDIPGYKLREIPHNATGNITDTGIIVRYIYDKIIDVS
FT                   YVDETGKDLLPVVEIIDSEAAILETIPDYTFVRKDISIDGLHIIFRYKKNISTIPEFGK
FT                   PNQVTVNYLDENNTSIAPSLYLSGLFNEAYNVPMKKIKGYTLLKYDSEILGVFTESPQT
FT                   INIIYQKKAPEQAPSMEPLPDTTVPENPSVEKAKIKKSKIETTEKRTISKAKIEPKALK
FT                   LTKVEQKKQETKDRLPKTGDSSVNLLITCLGIIAISCGVYLLVQQSQKRCRKE"
FT   regulatory      866978..867004
FT                   /locus_tag="Lm4b_00851"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(866978..867004)
FT                   /locus_tag="Lm4b_00852"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(867010..867423)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00852"
FT                   /product="Putative YrkR protein"
FT                   /note="Similar to B. subtilis YrkR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00852"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04620"
FT                   /db_xref="GOA:C1L1A5"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1L1A5"
FT                   /protein_id="CAS04620.1"
FT                   /translation="MKRLEKISSIVPILLRITLNLALIMVGFTLVAFLIREAFTIFNNI
FT                   FFLDTDVSYYYMTQDILTFFLYFEFIALIVKYFESHFHFPLRYFIYIGITAIIRFIIVD
FT                   HSSATSTLILSGAILLLVAALFLANTKMLKREG"
FT   CDS_pept        867512..869233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00853"
FT                   /function="unknown"
FT                   /note="Similar to ABC transporter (ATP-binding protein),
FT                   AUU start codon"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00853"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04621"
FT                   /protein_id="CAS04621.1"
FT                   /translation="MLKRFFSYYKPYRTLFIIDFGCAVLAAILELAFPVAVNHVIDTLL
FT                   PGKDFGLIITAALALLFFYILNTFMQYIVTYFGHMLGLNIETDMRRDLFSHLQKQPFGF
FT                   YDNQKTGKLMSRMTTDLFEIGEVAHHGPEDIFISIMSLFGAFFLMLNINVKLAISTFIL
FT                   VPILTVLIVYFNKRMTKVTTGIFKDLGNFNAGVENAISGVRVVQAFANEPHEKGRFRVL
FT                   NQAYRQSKLMFYKVMGLSFSFNYFLMRLISLFALLFGAYFTINGEISYGEFVGFILLTN
FT                   VFIRPIEKINNVIESYPKGFAGFKRFLEVMDTEPAIQDEKDAKPAKAFRGDIAYNHVSF
FT                   EYSDGKNVLNHINLSIKAGETVAFVGPSGAGKTTICNLLPRFYDVSAGEITIDGENIKR
FT                   FTLPSLRAQIGVVQQDVFLFSGTVRENIAYGKLDASDEEIEHVVKLAHLSKVVEEMPDG
FT                   LDTIIGERGVKLSGGQKQRLAIARMFLKNPPILILDEATSALDTETEQVIQASLEELAE
FT                   GRTTLIIAHRLATIKHADRIIVVNETGIAETGTHNELLAQDNGAYKRLYDAQFNTI"
FT   regulatory      869280..869315
FT                   /locus_tag="Lm4b_00853"
FT                   /regulatory_class="terminator"
FT   CDS_pept        869527..870912
FT                   /transl_table=11
FT                   /gene="uhpT"
FT                   /locus_tag="Lm4b_00854"
FT                   /product="Putative hexose phosphate transport protein"
FT                   /note="Highly similar to hexose phosphate transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00854"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04622"
FT                   /protein_id="CAS04622.1"
FT                   /translation="MSLFSLKRKNHFVPLEIQRQQWFKHFIVAFMSVFICYLTVYLLRN
FT                   NFKAAQTLLIEQNHFSTTELGMIGLAFSVMYGIGKTILGYAVDGRNAKKIMSFLLGISA
FT                   IISIIIGILLVTKQATVGILFILWGANGFVQSPGGPASYSTITRWTPKLKRGRWLGFWN
FT                   ASHNIGGALAGIVAFWGATTFFNGGAGGMFIVPGIIAIIIAIICFSVGHDEPEELGWNS
FT                   AAEIFEEREEQGESETKDLSRFQILCRFVINNPWVWTLCVINIFIYIVRIGIDNWAPVY
FT                   CIQALGWSTKDAIMTISFFEIGALLGSLSWGWLSDIMKGRRMLCSIIAVVIEFFMLISY
FT                   SQVTSVYSMYTVLFILGFLVFGPQLLIGVSVIEFVPRNALAVTNGLTGTFAYLFGDSFA
FT                   KVFLGYIADPTKAGIQIFGYTLHGWGATFTIMFTALIIAGLMMIPVALKQEKIIRQAKV
FT                   LHL"
FT   CDS_pept        complement(871020..872231)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00855"
FT                   /product="Putative Tetracycline resistance protein"
FT                   /note="Similar to Tetracycline resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00855"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04623"
FT                   /protein_id="CAS04623.1"
FT                   /translation="MSSTKSIINKKTLLFGLISVFLCGMGFSIIMPVVPFLVTPYVTNA
FT                   SDQALMVTLLTSVYALCVFFAAPGLGALSDRFGRRPVLLICFIGSAIGYFIFGLGGALW
FT                   VLFLGRIIEGITGGSISTLFAFFADITPQKERTKYFGWVSAAAGAGAALGPAFGGLLAH
FT                   FGYAMPFFFGAAITFINFLFGYFYMPESLEEANRLKRIPLMRLNPFSQLLNILTIKNLG
FT                   RLLIAAFFIWVPNGSLQAVMSQFAIDSFSWKPALIGMMFSIMGIQDILSQAFVMPKLLL
FT                   KLTDKQIAILGMIAEIIGYLLIAASSIFTLAPLLVIGMFVFGFGDSIFGPSFNGMVSKS
FT                   ASASEQGRIQGGSQAIQSVARIIGPVIGGQLYITLGHAAPAIMGVLLITVAIFILYKKT
FT                   SLAK"
FT   regulatory      complement(872237..872242)
FT                   /locus_tag="Lm4b_00855"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(872327..872351)
FT                   /locus_tag="Lm4b_00856"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(872361..872831)
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00856"
FT                   /product="Hypothetical protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00856"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04624"
FT                   /protein_id="CAS04624.1"
FT                   /translation="MDKNEQVMANVRDLFNKLAWINKVKMEKALEGYKPSEVHCIEYIA
FT                   KNEDPNVTKLAEAFYMTKSAISKITKKLMDKGYIESYQKPENKKEIYFRLTAKGAEINQ
FT                   VHDDLHQEFLDRDKVVFEDVTDAQYAEVLKFVDKYSRHLDNEMQKVYNQKSE"
FT   CDS_pept        873033..875675
FT                   /transl_table=11
FT                   /locus_tag="Lm4b_00857"
FT                   /product="Putative cation (calcium) transporting ATPase"
FT                   /note="Similar to cation (calcium) transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lm4b_00857"
FT                   /db_xref="EnsemblGenomes-Tr:CAS04625"
FT                   /protein_id="CAS04625.1"
FT                   /translation="MEIYRKSAAETFTQLEATEQGLTTSEVTKRQEKYGFNELKNKKKD
FT                   PLWKLFLETFKDPMVIVLVIAALVQLVLGEVVESLIIFLVLIVNSIISVVQTRKAESSL
FT                   DALREMSAPVAKVIRDGSKQSIHARELVPGDVVILDAGDFVPADGRLFESGSLKIDEGM
FT                   LTGESEAVEKYIDTIPDEVGLGDRVNMVFSGSLVVYGRGMFVVTGTASETEIGKIAGLL
FT                   ETAEAKQTPLQRKLESFSKKLGLGILALCVLIFAVEAGRVLLGDNSADMATAILNAFMF
FT                   AVAVAVAAIPEALSSIVTIVLAVGTNKMAKQHAIIRKLPAVETLGSTSVICTDKTGTLT
FT                   QNKMTVVDYYLPDGTKENFPESPENWSEGERRLIHIAVLCNDSNINSEGKELGDPTEVA
FT                   LIAFSNKNNQDYNEIREKFIREGEIPFDSDRKLMSTLHTFNENKAMLTKGGPDVMFARC
FT                   SYVFLDGEEKPMTEEILAKLKETNEEFSNQALRVLAYGYKRMPADTTELKLEDEQDIVL
FT                   VGLTAMIDPPREAVYASIEESKKAGIRTVMITGDHKTTAQAIGRDIGLMDADDIALTGQ
FT                   ELDAMPEEELDKKLEHIAVYARVSPENKIRIVKAWQKKGKITAMTGDGVNDAPALKQAD
FT                   IGVAMGSGTDVAKDSAAMILTDDNFVSIVDAVGVGRTVFDNIKKSIAYLFAGNLGAIIA
FT                   ILFALVLDWINPFTALQLLFINLVNDSLPAIALGMEKAEPDVMKRKPRDINEGIFAGGT
FT                   MRAVISRGVLIGIAVIISQYIGLQISPEMSVAMAFTTLILARTLQTFAARSNVQTAFGA
FT                   GFFSNKYVIGAVLLCFVLYGITVLPGAREIFSIPASFGLHEWSIAAGLALAAVVMMEII
FT                   KLVQNKFFK"
FT   regulatory      875686..875720
FT                   /locus_tag="Lm4b_00857"
FT                   /regulatory_class="terminator"
FT   regulatory      876112..876117
FT                   /locus_tag="Lm4b_00858"
FT                   /regulatory_class="ribosome_binding_site"
FT