(data stored in SCRATCH3701 zone)

EMBL: FM252031

ID   FM252031; SV 1; circular; genomic DNA; STD; PRO; 2095898 BP.
XX
AC   FM252031;
XX
PR   Project:PRJEA32239;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Streptococcus suis SC84 complete genome, strain SC84
XX
KW   complete genome.
XX
OS   Streptococcus suis SC84
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2095898
RA   Holden M.T.G.;
RT   ;
RL   Submitted (20-OCT-2008) to the INSDC.
RL   Holden M.T.G., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.pone.0006072.
RX   PUBMED; 19603075.
RA   Holden M.T.G., Hauser H., Sanders M., Ngo T.H., Cherevach I., Cronin A.,
RA   Goodhead I., Mungall K., Quail M.A., Price C., Rabbinowitsch E., Sharp S.,
RA   Croucher N.J., Chieu T.B., Mai N.T.H., Diep T.S., Chinh N.T., Kehoe M.,
RA   Leigh J.A., Ward P.N., Dowson C.G., Whatmore A.M., Chanter N., Iversen P.,
RA   Gottschalk M., Slater J.D., Smith H.E., Spratt B.G., Xu J., Ye C.,
RA   Bentley S.D., Barrell B.G., Schultsz C., Maskell D.J., Parkhill J.;
RT   "Rapid evolution of virulence and drug resistance in the emerging zoonotic
RT   pathogen Streptococcus suis";
RL   PLoS One 4(7):e6072-e6072(2009).
XX
DR   MD5; 8e162f0dadedd3dae843081dae321f19.
DR   BioSample; SAMEA2272312.
DR   EnsemblGenomes-Gn; EBG00001007314.
DR   EnsemblGenomes-Gn; EBG00001007315.
DR   EnsemblGenomes-Gn; EBG00001007316.
DR   EnsemblGenomes-Gn; EBG00001007317.
DR   EnsemblGenomes-Gn; EBG00001007318.
DR   EnsemblGenomes-Gn; EBG00001007319.
DR   EnsemblGenomes-Gn; EBG00001007320.
DR   EnsemblGenomes-Gn; EBG00001007321.
DR   EnsemblGenomes-Gn; EBG00001007322.
DR   EnsemblGenomes-Gn; EBG00001007323.
DR   EnsemblGenomes-Gn; EBG00001007324.
DR   EnsemblGenomes-Gn; EBG00001007325.
DR   EnsemblGenomes-Gn; EBG00001007326.
DR   EnsemblGenomes-Gn; EBG00001007327.
DR   EnsemblGenomes-Gn; EBG00001007328.
DR   EnsemblGenomes-Gn; EBG00001007329.
DR   EnsemblGenomes-Gn; EBG00001007330.
DR   EnsemblGenomes-Gn; EBG00001007331.
DR   EnsemblGenomes-Gn; EBG00001007332.
DR   EnsemblGenomes-Gn; EBG00001007333.
DR   EnsemblGenomes-Gn; EBG00001007334.
DR   EnsemblGenomes-Gn; EBG00001007335.
DR   EnsemblGenomes-Gn; EBG00001007336.
DR   EnsemblGenomes-Gn; EBG00001007337.
DR   EnsemblGenomes-Gn; EBG00001007338.
DR   EnsemblGenomes-Gn; EBG00001007339.
DR   EnsemblGenomes-Gn; EBG00001007340.
DR   EnsemblGenomes-Gn; EBG00001007341.
DR   EnsemblGenomes-Gn; EBG00001007342.
DR   EnsemblGenomes-Gn; EBG00001007343.
DR   EnsemblGenomes-Gn; EBG00001007344.
DR   EnsemblGenomes-Gn; EBG00001007345.
DR   EnsemblGenomes-Gn; EBG00001007346.
DR   EnsemblGenomes-Gn; EBG00001007347.
DR   EnsemblGenomes-Gn; EBG00001007348.
DR   EnsemblGenomes-Gn; EBG00001007349.
DR   EnsemblGenomes-Gn; EBG00001007350.
DR   EnsemblGenomes-Gn; EBG00001007351.
DR   EnsemblGenomes-Gn; EBG00001007352.
DR   EnsemblGenomes-Gn; EBG00001007353.
DR   EnsemblGenomes-Gn; EBG00001007354.
DR   EnsemblGenomes-Gn; EBG00001007355.
DR   EnsemblGenomes-Gn; EBG00001007356.
DR   EnsemblGenomes-Gn; EBG00001007357.
DR   EnsemblGenomes-Gn; EBG00001007358.
DR   EnsemblGenomes-Gn; EBG00001007359.
DR   EnsemblGenomes-Gn; EBG00001007360.
DR   EnsemblGenomes-Gn; EBG00001007361.
DR   EnsemblGenomes-Gn; EBG00001007362.
DR   EnsemblGenomes-Gn; EBG00001007363.
DR   EnsemblGenomes-Gn; EBG00001007364.
DR   EnsemblGenomes-Gn; EBG00001007365.
DR   EnsemblGenomes-Gn; EBG00001007366.
DR   EnsemblGenomes-Gn; EBG00001007367.
DR   EnsemblGenomes-Gn; EBG00001007368.
DR   EnsemblGenomes-Gn; EBG00001007369.
DR   EnsemblGenomes-Gn; EBG00001007370.
DR   EnsemblGenomes-Gn; EBG00001007371.
DR   EnsemblGenomes-Gn; EBG00001007372.
DR   EnsemblGenomes-Gn; EBG00001007373.
DR   EnsemblGenomes-Gn; EBG00001007374.
DR   EnsemblGenomes-Gn; EBG00001007375.
DR   EnsemblGenomes-Gn; EBG00001007376.
DR   EnsemblGenomes-Gn; EBG00001007377.
DR   EnsemblGenomes-Gn; EBG00001007378.
DR   EnsemblGenomes-Gn; EBG00001007379.
DR   EnsemblGenomes-Gn; EBG00001007380.
DR   EnsemblGenomes-Gn; EBG00001007381.
DR   EnsemblGenomes-Gn; EBG00001007382.
DR   EnsemblGenomes-Gn; EBG00001007383.
DR   EnsemblGenomes-Gn; EBG00001007384.
DR   EnsemblGenomes-Gn; EBG00001007385.
DR   EnsemblGenomes-Gn; EBG00001007386.
DR   EnsemblGenomes-Gn; EBG00001007387.
DR   EnsemblGenomes-Gn; EBG00001007388.
DR   EnsemblGenomes-Gn; EBG00001007389.
DR   EnsemblGenomes-Gn; EBG00001007390.
DR   EnsemblGenomes-Gn; EBG00001007391.
DR   EnsemblGenomes-Gn; EBG00001007392.
DR   EnsemblGenomes-Gn; EBG00001007393.
DR   EnsemblGenomes-Gn; EBG00001007394.
DR   EnsemblGenomes-Gn; EBG00001007395.
DR   EnsemblGenomes-Gn; EBG00001007396.
DR   EnsemblGenomes-Gn; SSUSC84_0035.
DR   EnsemblGenomes-Gn; SSUSC84_0064.
DR   EnsemblGenomes-Gn; SSUSC84_0083.
DR   EnsemblGenomes-Gn; SSUSC84_0106.
DR   EnsemblGenomes-Gn; SSUSC84_0116a.
DR   EnsemblGenomes-Gn; SSUSC84_0120.
DR   EnsemblGenomes-Gn; SSUSC84_0164.
DR   EnsemblGenomes-Gn; SSUSC84_0181.
DR   EnsemblGenomes-Gn; SSUSC84_0198.
DR   EnsemblGenomes-Gn; SSUSC84_0199.
DR   EnsemblGenomes-Gn; SSUSC84_0243.
DR   EnsemblGenomes-Gn; SSUSC84_0244.
DR   EnsemblGenomes-Gn; SSUSC84_0245.
DR   EnsemblGenomes-Gn; SSUSC84_0304.
DR   EnsemblGenomes-Gn; SSUSC84_0308.
DR   EnsemblGenomes-Gn; SSUSC84_0326.
DR   EnsemblGenomes-Gn; SSUSC84_0327.
DR   EnsemblGenomes-Gn; SSUSC84_0351.
DR   EnsemblGenomes-Gn; SSUSC84_0399.
DR   EnsemblGenomes-Gn; SSUSC84_0410.
DR   EnsemblGenomes-Gn; SSUSC84_0413.
DR   EnsemblGenomes-Gn; SSUSC84_0436.
DR   EnsemblGenomes-Gn; SSUSC84_0438.
DR   EnsemblGenomes-Gn; SSUSC84_0488.
DR   EnsemblGenomes-Gn; SSUSC84_0489.
DR   EnsemblGenomes-Gn; SSUSC84_0490.
DR   EnsemblGenomes-Gn; SSUSC84_0514.
DR   EnsemblGenomes-Gn; SSUSC84_0521.
DR   EnsemblGenomes-Gn; SSUSC84_0524.
DR   EnsemblGenomes-Gn; SSUSC84_0526.
DR   EnsemblGenomes-Gn; SSUSC84_0527.
DR   EnsemblGenomes-Gn; SSUSC84_0528.
DR   EnsemblGenomes-Gn; SSUSC84_0529.
DR   EnsemblGenomes-Gn; SSUSC84_0530.
DR   EnsemblGenomes-Gn; SSUSC84_0531.
DR   EnsemblGenomes-Gn; SSUSC84_0538.
DR   EnsemblGenomes-Gn; SSUSC84_0585.
DR   EnsemblGenomes-Gn; SSUSC84_0603.
DR   EnsemblGenomes-Gn; SSUSC84_0608.
DR   EnsemblGenomes-Gn; SSUSC84_0610.
DR   EnsemblGenomes-Gn; SSUSC84_0619.
DR   EnsemblGenomes-Gn; SSUSC84_0625.
DR   EnsemblGenomes-Gn; SSUSC84_0645.
DR   EnsemblGenomes-Gn; SSUSC84_0677.
DR   EnsemblGenomes-Gn; SSUSC84_0678.
DR   EnsemblGenomes-Gn; SSUSC84_0694.
DR   EnsemblGenomes-Gn; SSUSC84_0720.
DR   EnsemblGenomes-Gn; SSUSC84_0721.
DR   EnsemblGenomes-Gn; SSUSC84_0725.
DR   EnsemblGenomes-Gn; SSUSC84_0785.
DR   EnsemblGenomes-Gn; SSUSC84_0786.
DR   EnsemblGenomes-Gn; SSUSC84_0822.
DR   EnsemblGenomes-Gn; SSUSC84_0848.
DR   EnsemblGenomes-Gn; SSUSC84_0856.
DR   EnsemblGenomes-Gn; SSUSC84_0857.
DR   EnsemblGenomes-Gn; SSUSC84_0925.
DR   EnsemblGenomes-Gn; SSUSC84_0941.
DR   EnsemblGenomes-Gn; SSUSC84_0948.
DR   EnsemblGenomes-Gn; SSUSC84_0971.
DR   EnsemblGenomes-Gn; SSUSC84_1001.
DR   EnsemblGenomes-Gn; SSUSC84_1002.
DR   EnsemblGenomes-Gn; SSUSC84_1004.
DR   EnsemblGenomes-Gn; SSUSC84_1087.
DR   EnsemblGenomes-Gn; SSUSC84_1159.
DR   EnsemblGenomes-Gn; SSUSC84_1185.
DR   EnsemblGenomes-Gn; SSUSC84_1186.
DR   EnsemblGenomes-Gn; SSUSC84_1281.
DR   EnsemblGenomes-Gn; SSUSC84_1282.
DR   EnsemblGenomes-Gn; SSUSC84_1294.
DR   EnsemblGenomes-Gn; SSUSC84_1295.
DR   EnsemblGenomes-Gn; SSUSC84_1301.
DR   EnsemblGenomes-Gn; SSUSC84_1418.
DR   EnsemblGenomes-Gn; SSUSC84_1455.
DR   EnsemblGenomes-Gn; SSUSC84_1475.
DR   EnsemblGenomes-Gn; SSUSC84_1479.
DR   EnsemblGenomes-Gn; SSUSC84_1502.
DR   EnsemblGenomes-Gn; SSUSC84_1561.
DR   EnsemblGenomes-Gn; SSUSC84_1619.
DR   EnsemblGenomes-Gn; SSUSC84_1683.
DR   EnsemblGenomes-Gn; SSUSC84_1691.
DR   EnsemblGenomes-Gn; SSUSC84_1713.
DR   EnsemblGenomes-Gn; SSUSC84_1716.
DR   EnsemblGenomes-Gn; SSUSC84_1746.
DR   EnsemblGenomes-Gn; SSUSC84_1756.
DR   EnsemblGenomes-Gn; SSUSC84_1895.
DR   EnsemblGenomes-Gn; SSUSC84_1896.
DR   EnsemblGenomes-Gn; SSUSC84_1906.
DR   EnsemblGenomes-Gn; SSUSC84_r0001.
DR   EnsemblGenomes-Gn; SSUSC84_r0002.
DR   EnsemblGenomes-Gn; SSUSC84_r0003.
DR   EnsemblGenomes-Gn; SSUSC84_r0004.
DR   EnsemblGenomes-Gn; SSUSC84_r0005.
DR   EnsemblGenomes-Gn; SSUSC84_r0006.
DR   EnsemblGenomes-Gn; SSUSC84_r0007.
DR   EnsemblGenomes-Gn; SSUSC84_r0008.
DR   EnsemblGenomes-Gn; SSUSC84_r0009.
DR   EnsemblGenomes-Gn; SSUSC84_r0010.
DR   EnsemblGenomes-Gn; SSUSC84_r0011.
DR   EnsemblGenomes-Gn; SSUSC84_r0012.
DR   EnsemblGenomes-Gn; SSUSC84_t0001.
DR   EnsemblGenomes-Gn; SSUSC84_t0002.
DR   EnsemblGenomes-Gn; SSUSC84_t0003.
DR   EnsemblGenomes-Gn; SSUSC84_t0004.
DR   EnsemblGenomes-Gn; SSUSC84_t0005.
DR   EnsemblGenomes-Gn; SSUSC84_t0006.
DR   EnsemblGenomes-Gn; SSUSC84_t0007.
DR   EnsemblGenomes-Gn; SSUSC84_t0008.
DR   EnsemblGenomes-Gn; SSUSC84_t0009.
DR   EnsemblGenomes-Gn; SSUSC84_t0010.
DR   EnsemblGenomes-Gn; SSUSC84_t0011.
DR   EnsemblGenomes-Gn; SSUSC84_t0012.
DR   EnsemblGenomes-Gn; SSUSC84_t0013.
DR   EnsemblGenomes-Gn; SSUSC84_t0014.
DR   EnsemblGenomes-Gn; SSUSC84_t0015.
DR   EnsemblGenomes-Gn; SSUSC84_t0016.
DR   EnsemblGenomes-Gn; SSUSC84_t0017.
DR   EnsemblGenomes-Gn; SSUSC84_t0018.
DR   EnsemblGenomes-Gn; SSUSC84_t0019.
DR   EnsemblGenomes-Gn; SSUSC84_t0020.
DR   EnsemblGenomes-Gn; SSUSC84_t0021.
DR   EnsemblGenomes-Gn; SSUSC84_t0022.
DR   EnsemblGenomes-Gn; SSUSC84_t0023.
DR   EnsemblGenomes-Gn; SSUSC84_t0024.
DR   EnsemblGenomes-Gn; SSUSC84_t0025.
DR   EnsemblGenomes-Gn; SSUSC84_t0026.
DR   EnsemblGenomes-Gn; SSUSC84_t0027.
DR   EnsemblGenomes-Gn; SSUSC84_t0028.
DR   EnsemblGenomes-Gn; SSUSC84_t0029.
DR   EnsemblGenomes-Gn; SSUSC84_t0030.
DR   EnsemblGenomes-Gn; SSUSC84_t0031.
DR   EnsemblGenomes-Gn; SSUSC84_t0032.
DR   EnsemblGenomes-Gn; SSUSC84_t0033.
DR   EnsemblGenomes-Gn; SSUSC84_t0034.
DR   EnsemblGenomes-Gn; SSUSC84_t0035.
DR   EnsemblGenomes-Gn; SSUSC84_t0036.
DR   EnsemblGenomes-Gn; SSUSC84_t0037.
DR   EnsemblGenomes-Gn; SSUSC84_t0038.
DR   EnsemblGenomes-Gn; SSUSC84_t0039.
DR   EnsemblGenomes-Gn; SSUSC84_t0040.
DR   EnsemblGenomes-Gn; SSUSC84_t0041.
DR   EnsemblGenomes-Gn; SSUSC84_t0042.
DR   EnsemblGenomes-Gn; SSUSC84_t0043.
DR   EnsemblGenomes-Gn; SSUSC84_t0044.
DR   EnsemblGenomes-Gn; SSUSC84_t0045.
DR   EnsemblGenomes-Gn; SSUSC84_t0046.
DR   EnsemblGenomes-Gn; SSUSC84_t0047.
DR   EnsemblGenomes-Gn; SSUSC84_t0048.
DR   EnsemblGenomes-Gn; SSUSC84_t0049.
DR   EnsemblGenomes-Gn; SSUSC84_t0050.
DR   EnsemblGenomes-Gn; SSUSC84_t0051.
DR   EnsemblGenomes-Gn; SSUSC84_t0052.
DR   EnsemblGenomes-Gn; SSUSC84_t0053.
DR   EnsemblGenomes-Gn; SSUSC84_t0054.
DR   EnsemblGenomes-Gn; SSUSC84_t0055.
DR   EnsemblGenomes-Gn; SSUSC84_t0056.
DR   EnsemblGenomes-Tr; EBT00001532359.
DR   EnsemblGenomes-Tr; EBT00001532360.
DR   EnsemblGenomes-Tr; EBT00001532361.
DR   EnsemblGenomes-Tr; EBT00001532362.
DR   EnsemblGenomes-Tr; EBT00001532363.
DR   EnsemblGenomes-Tr; EBT00001532364.
DR   EnsemblGenomes-Tr; EBT00001532365.
DR   EnsemblGenomes-Tr; EBT00001532366.
DR   EnsemblGenomes-Tr; EBT00001532367.
DR   EnsemblGenomes-Tr; EBT00001532368.
DR   EnsemblGenomes-Tr; EBT00001532369.
DR   EnsemblGenomes-Tr; EBT00001532370.
DR   EnsemblGenomes-Tr; EBT00001532371.
DR   EnsemblGenomes-Tr; EBT00001532372.
DR   EnsemblGenomes-Tr; EBT00001532373.
DR   EnsemblGenomes-Tr; EBT00001532374.
DR   EnsemblGenomes-Tr; EBT00001532375.
DR   EnsemblGenomes-Tr; EBT00001532376.
DR   EnsemblGenomes-Tr; EBT00001532377.
DR   EnsemblGenomes-Tr; EBT00001532378.
DR   EnsemblGenomes-Tr; EBT00001532379.
DR   EnsemblGenomes-Tr; EBT00001532380.
DR   EnsemblGenomes-Tr; EBT00001532381.
DR   EnsemblGenomes-Tr; EBT00001532382.
DR   EnsemblGenomes-Tr; EBT00001532383.
DR   EnsemblGenomes-Tr; EBT00001532384.
DR   EnsemblGenomes-Tr; EBT00001532385.
DR   EnsemblGenomes-Tr; EBT00001532386.
DR   EnsemblGenomes-Tr; EBT00001532387.
DR   EnsemblGenomes-Tr; EBT00001532388.
DR   EnsemblGenomes-Tr; EBT00001532389.
DR   EnsemblGenomes-Tr; EBT00001532390.
DR   EnsemblGenomes-Tr; EBT00001532391.
DR   EnsemblGenomes-Tr; EBT00001532392.
DR   EnsemblGenomes-Tr; EBT00001532393.
DR   EnsemblGenomes-Tr; EBT00001532394.
DR   EnsemblGenomes-Tr; EBT00001532395.
DR   EnsemblGenomes-Tr; EBT00001532396.
DR   EnsemblGenomes-Tr; EBT00001532397.
DR   EnsemblGenomes-Tr; EBT00001532398.
DR   EnsemblGenomes-Tr; EBT00001532399.
DR   EnsemblGenomes-Tr; EBT00001532400.
DR   EnsemblGenomes-Tr; EBT00001532401.
DR   EnsemblGenomes-Tr; EBT00001532402.
DR   EnsemblGenomes-Tr; EBT00001532403.
DR   EnsemblGenomes-Tr; EBT00001532404.
DR   EnsemblGenomes-Tr; EBT00001532405.
DR   EnsemblGenomes-Tr; EBT00001532406.
DR   EnsemblGenomes-Tr; EBT00001532407.
DR   EnsemblGenomes-Tr; EBT00001532408.
DR   EnsemblGenomes-Tr; EBT00001532409.
DR   EnsemblGenomes-Tr; EBT00001532410.
DR   EnsemblGenomes-Tr; EBT00001532411.
DR   EnsemblGenomes-Tr; EBT00001532412.
DR   EnsemblGenomes-Tr; EBT00001532413.
DR   EnsemblGenomes-Tr; EBT00001532414.
DR   EnsemblGenomes-Tr; EBT00001532415.
DR   EnsemblGenomes-Tr; EBT00001532416.
DR   EnsemblGenomes-Tr; EBT00001532417.
DR   EnsemblGenomes-Tr; EBT00001532418.
DR   EnsemblGenomes-Tr; EBT00001532419.
DR   EnsemblGenomes-Tr; EBT00001532420.
DR   EnsemblGenomes-Tr; EBT00001532421.
DR   EnsemblGenomes-Tr; EBT00001532422.
DR   EnsemblGenomes-Tr; EBT00001532423.
DR   EnsemblGenomes-Tr; EBT00001532424.
DR   EnsemblGenomes-Tr; EBT00001532425.
DR   EnsemblGenomes-Tr; EBT00001532426.
DR   EnsemblGenomes-Tr; EBT00001532427.
DR   EnsemblGenomes-Tr; EBT00001532428.
DR   EnsemblGenomes-Tr; EBT00001532429.
DR   EnsemblGenomes-Tr; EBT00001532430.
DR   EnsemblGenomes-Tr; EBT00001532431.
DR   EnsemblGenomes-Tr; EBT00001532432.
DR   EnsemblGenomes-Tr; EBT00001532433.
DR   EnsemblGenomes-Tr; EBT00001532434.
DR   EnsemblGenomes-Tr; EBT00001532435.
DR   EnsemblGenomes-Tr; EBT00001532436.
DR   EnsemblGenomes-Tr; EBT00001532437.
DR   EnsemblGenomes-Tr; EBT00001532439.
DR   EnsemblGenomes-Tr; EBT00001532441.
DR   EnsemblGenomes-Tr; EBT00001532442.
DR   EnsemblGenomes-Tr; EBT00001532443.
DR   EnsemblGenomes-Tr; SSUSC84_0035.
DR   EnsemblGenomes-Tr; SSUSC84_0064.
DR   EnsemblGenomes-Tr; SSUSC84_0083.
DR   EnsemblGenomes-Tr; SSUSC84_0106.
DR   EnsemblGenomes-Tr; SSUSC84_0116a.
DR   EnsemblGenomes-Tr; SSUSC84_0120.
DR   EnsemblGenomes-Tr; SSUSC84_0164.
DR   EnsemblGenomes-Tr; SSUSC84_0181.
DR   EnsemblGenomes-Tr; SSUSC84_0198.
DR   EnsemblGenomes-Tr; SSUSC84_0199.
DR   EnsemblGenomes-Tr; SSUSC84_0243.
DR   EnsemblGenomes-Tr; SSUSC84_0244.
DR   EnsemblGenomes-Tr; SSUSC84_0245.
DR   EnsemblGenomes-Tr; SSUSC84_0304.
DR   EnsemblGenomes-Tr; SSUSC84_0308.
DR   EnsemblGenomes-Tr; SSUSC84_0326.
DR   EnsemblGenomes-Tr; SSUSC84_0327.
DR   EnsemblGenomes-Tr; SSUSC84_0351.
DR   EnsemblGenomes-Tr; SSUSC84_0399.
DR   EnsemblGenomes-Tr; SSUSC84_0410.
DR   EnsemblGenomes-Tr; SSUSC84_0413.
DR   EnsemblGenomes-Tr; SSUSC84_0436.
DR   EnsemblGenomes-Tr; SSUSC84_0438.
DR   EnsemblGenomes-Tr; SSUSC84_0488.
DR   EnsemblGenomes-Tr; SSUSC84_0489.
DR   EnsemblGenomes-Tr; SSUSC84_0490.
DR   EnsemblGenomes-Tr; SSUSC84_0514.
DR   EnsemblGenomes-Tr; SSUSC84_0521.
DR   EnsemblGenomes-Tr; SSUSC84_0524.
DR   EnsemblGenomes-Tr; SSUSC84_0526.
DR   EnsemblGenomes-Tr; SSUSC84_0527.
DR   EnsemblGenomes-Tr; SSUSC84_0528.
DR   EnsemblGenomes-Tr; SSUSC84_0529.
DR   EnsemblGenomes-Tr; SSUSC84_0530.
DR   EnsemblGenomes-Tr; SSUSC84_0531.
DR   EnsemblGenomes-Tr; SSUSC84_0538.
DR   EnsemblGenomes-Tr; SSUSC84_0585.
DR   EnsemblGenomes-Tr; SSUSC84_0603.
DR   EnsemblGenomes-Tr; SSUSC84_0608.
DR   EnsemblGenomes-Tr; SSUSC84_0610.
DR   EnsemblGenomes-Tr; SSUSC84_0619.
DR   EnsemblGenomes-Tr; SSUSC84_0625.
DR   EnsemblGenomes-Tr; SSUSC84_0645.
DR   EnsemblGenomes-Tr; SSUSC84_0677.
DR   EnsemblGenomes-Tr; SSUSC84_0678.
DR   EnsemblGenomes-Tr; SSUSC84_0694.
DR   EnsemblGenomes-Tr; SSUSC84_0720.
DR   EnsemblGenomes-Tr; SSUSC84_0721.
DR   EnsemblGenomes-Tr; SSUSC84_0725.
DR   EnsemblGenomes-Tr; SSUSC84_0785.
DR   EnsemblGenomes-Tr; SSUSC84_0786.
DR   EnsemblGenomes-Tr; SSUSC84_0822.
DR   EnsemblGenomes-Tr; SSUSC84_0848.
DR   EnsemblGenomes-Tr; SSUSC84_0856.
DR   EnsemblGenomes-Tr; SSUSC84_0857.
DR   EnsemblGenomes-Tr; SSUSC84_0925.
DR   EnsemblGenomes-Tr; SSUSC84_0941.
DR   EnsemblGenomes-Tr; SSUSC84_0948.
DR   EnsemblGenomes-Tr; SSUSC84_0971.
DR   EnsemblGenomes-Tr; SSUSC84_1001.
DR   EnsemblGenomes-Tr; SSUSC84_1002.
DR   EnsemblGenomes-Tr; SSUSC84_1004.
DR   EnsemblGenomes-Tr; SSUSC84_1087.
DR   EnsemblGenomes-Tr; SSUSC84_1159.
DR   EnsemblGenomes-Tr; SSUSC84_1185.
DR   EnsemblGenomes-Tr; SSUSC84_1186.
DR   EnsemblGenomes-Tr; SSUSC84_1281.
DR   EnsemblGenomes-Tr; SSUSC84_1282.
DR   EnsemblGenomes-Tr; SSUSC84_1294.
DR   EnsemblGenomes-Tr; SSUSC84_1295.
DR   EnsemblGenomes-Tr; SSUSC84_1301.
DR   EnsemblGenomes-Tr; SSUSC84_1418.
DR   EnsemblGenomes-Tr; SSUSC84_1455.
DR   EnsemblGenomes-Tr; SSUSC84_1475.
DR   EnsemblGenomes-Tr; SSUSC84_1479.
DR   EnsemblGenomes-Tr; SSUSC84_1502.
DR   EnsemblGenomes-Tr; SSUSC84_1561.
DR   EnsemblGenomes-Tr; SSUSC84_1619.
DR   EnsemblGenomes-Tr; SSUSC84_1683.
DR   EnsemblGenomes-Tr; SSUSC84_1691.
DR   EnsemblGenomes-Tr; SSUSC84_1713.
DR   EnsemblGenomes-Tr; SSUSC84_1716.
DR   EnsemblGenomes-Tr; SSUSC84_1746.
DR   EnsemblGenomes-Tr; SSUSC84_1756.
DR   EnsemblGenomes-Tr; SSUSC84_1895.
DR   EnsemblGenomes-Tr; SSUSC84_1896.
DR   EnsemblGenomes-Tr; SSUSC84_1906.
DR   EnsemblGenomes-Tr; SSUSC84_r0001-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0002-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0003-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0004-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0005-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0006-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0007-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0008-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0009-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0010-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0011-1.
DR   EnsemblGenomes-Tr; SSUSC84_r0012-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0001-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0002-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0003-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0004-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0005-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0006-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0007-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0008-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0009-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0010-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0011-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0012-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0013-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0014-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0015-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0016-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0017-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0018-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0019-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0020-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0021-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0022-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0023-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0024-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0025-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0026-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0027-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0028-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0029-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0030-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0031-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0032-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0033-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0034-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0035-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0036-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0037-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0038-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0039-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0040-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0041-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0042-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0043-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0044-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0045-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0046-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0047-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0048-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0049-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0050-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0051-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0052-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0053-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0054-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0055-1.
DR   EnsemblGenomes-Tr; SSUSC84_t0056-1.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC3227697; 22026465.
DR   EuropePMC; PMC3421841; 22710115.
DR   EuropePMC; PMC3486358; 23105076.
DR   EuropePMC; PMC3623174; 23416996.
DR   EuropePMC; PMC3911220; 24271178.
DR   EuropePMC; PMC4735348; 26870017.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FM252031.
DR   SILVA-SSU; FM252031.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2095898
FT                   /organism="Streptococcus suis SC84"
FT                   /strain="SC84"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Sichuan Province"
FT                   /isolation_source="human case of meningitis"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:568813"
FT   CDS_pept        1..1374
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUSC84_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0001"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50777"
FT                   /protein_id="CAZ50777.1"
FT                   /translation="MNQEQLFWQRFIELAKVNFKPSIYDFYVADAKLLGINQQVANIFL
FT                   NRPFKKDFWEKNFEELMIAASFESYGEPLTIQYQFTEDEQEIRNTTNTRSSIVHQVQTL
FT                   EPATPQETFKPVHSDIKSQYTFANFVQGDNNHWAKAAALAVSDNLGELYNPLFIFGGPG
FT                   LGKTHILNAIGNKVLADNPQARIKYVSSETFINEFLEHLRLNDMESFKKTYRNLDLLLI
FT                   DDIQSLRNKATTQEEFFHTFNALHEKNKQIVLTSDRNPDHLDNLEERLVTRFKWGLTSE
FT                   ITPPDFETRIAILRNKCENLPYNFTNETLSYLAGQFDSNVRDLEGALKDIHLIATMRQL
FT                   SEISVEVAAEAIRSRKQTNPQNMVIPIEKIQTEVGNFYGVSLKELKGSKRVQHIVHARQ
FT                   VAMFLAREMTDNSLPKIGKEFGNRDHTTVMHAYNKIKTLLLDDENLEIEITSIKNKLR"
FT   misc_feature    358..1014
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUSC84_0001"
FT                   /note="HMMPfam hit to PF00308, Bac_DnaA, score 6e-111"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    1096..1305
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUSC84_0001"
FT                   /note="HMMPfam hit to PF08299, Bac_DnaA_C, score 3.9e-33"
FT                   /inference="protein motif:HMMPfam:PF08299"
FT   misc_feature    1246..1305
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUSC84_0001"
FT                   /note="ScanRegExp hit to PS01008, DNAA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01008"
FT   CDS_pept        1528..2664
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SSUSC84_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0002"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50778"
FT                   /protein_id="CAZ50778.1"
FT                   /translation="MIQFSINKNIFLQALSITKRAISTKNAIPILSTVKITVTSEGITL
FT                   TGSNGQISIEHFISIQDENAGLLISSPGSILLEAGFFINVVSSMPDLVLDFNEIEQKQI
FT                   VLTSGKSEITLKGKEAEQYPRLQEVPTSKPLVLETKVLKQTINETAFAASTQESRPILT
FT                   GVHFVLTENKNLKTVATDSHRMSQRKLVLDTSGDDFNVVIPSRSLREFTAVFTDDIETV
FT                   EVFFSNNQILFRSEHISFYTRLLEGTYPDTDRLIPTEFKTTAIFDTANLRHSMERARLL
FT                   SNATQNGTVKLEIANNVVSAHVNSPEVGRVNEELDTVEVSGEDLVISFNPTYLIEALKA
FT                   TTSEQVKISFISSVRPFTLIPNNEGEDFIQLVTPVRTN"
FT   misc_feature    1531..1908
FT                   /gene="dnaN"
FT                   /locus_tag="SSUSC84_0002"
FT                   /note="HMMPfam hit to PF00712, DNA_pol3_beta, score
FT                   1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    1933..2280
FT                   /gene="dnaN"
FT                   /locus_tag="SSUSC84_0002"
FT                   /note="HMMPfam hit to PF02767, DNA_pol3_beta_2, score
FT                   5e-39"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    2284..2655
FT                   /gene="dnaN"
FT                   /locus_tag="SSUSC84_0002"
FT                   /note="HMMPfam hit to PF02768, DNA_pol3_beta_3, score
FT                   3.8e-33"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   CDS_pept        2756..3637
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0003"
FT                   /product="diacylglycerol kinase protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0003"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50779"
FT                   /protein_id="CAZ50779.1"
FT                   /translation="MTLYILANPNAGSHTAEHIIFKIKESYPQLAVNIFMTVGPEDEKS
FT                   QIEAILKEFVSSEDQLMILGGDGTLSKALRFWPASLPFAYYPTGSGNDFAKAMNITSLY
FT                   RSVDAILERKTSRIYVLNSSYGTVVNSMDFGFAAQVINGSTNSILKKILNKVKLGKLTY
FT                   LFFGIKTLFSKQAINLELTLDEKSYQLDNLFFISVANSLYFGGGIMIWPTASAKKKEVD
FT                   IVYFKNGNFYQRLQSLLALLTKRHESSHTIQHLTGVDVVLKSKEKLLLQIDGETCTANE
FT                   VTLTYQERSMYL"
FT   misc_feature    2759..3127
FT                   /locus_tag="SSUSC84_0003"
FT                   /note="HMMPfam hit to PF00781, DAGK_cat, score 1.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00781"
FT   CDS_pept        3647..3850
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0004"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50780"
FT                   /protein_id="CAZ50780.1"
FT                   /translation="MYQLGTFVEMKKPHACVIKSTGKKANKWEVIRLGADIKIRCTNCD
FT                   HVVMMSRHDFERKMKQVLPSEA"
FT   misc_feature    3647..3838
FT                   /locus_tag="SSUSC84_0004"
FT                   /note="HMMPfam hit to PF06107, DUF951, score 4e-44"
FT                   /inference="protein motif:HMMPfam:PF06107"
FT   CDS_pept        3954..4313
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0005"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0005"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50781"
FT                   /protein_id="CAZ50781.1"
FT                   /translation="MKQLAQQIRVLRTAKNLSQDELAEKLYISRQAVSKWENGEATPDI
FT                   DKLVQLAEIFGVSLDYLVLGKEPEKEIVVEQRGKMNGWEFLNEESKRPLTRGDVVLLIF
FT                   LAVMLLGGLFIKHYF"
FT   misc_feature    3975..4139
FT                   /locus_tag="SSUSC84_0005"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 5.4e-21"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    4002..4067
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2317.000, SD 7.08 at aa 17-38, sequence
FT                   LSQDELAEKLYISRQAVSKWEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    4248..4307
FT                   /locus_tag="SSUSC84_0005"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0005 by TMHMM2.0 at aa 99-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        4399..5514
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0006"
FT                   /product="putative GTP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0006"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50782"
FT                   /protein_id="CAZ50782.1"
FT                   /translation="MSLTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELIIPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKDS
FT                   VAEFAVLEKIKPVLEDGKSARTVEFTDEEQKIVKQLFLLTTKPVLYVANVDEDKVADPE
FT                   AISYVQQIRDFAATENAEVVVISARAEEEISELDDEDKGEFLEALGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQCAGIIHSDFEKGFIRAVTMSYDDLMTYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   misc_feature    4405..4863
FT                   /locus_tag="SSUSC84_0006"
FT                   /note="HMMPfam hit to PF01926, MMR_HSR1, score 4.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    5257..5508
FT                   /locus_tag="SSUSC84_0006"
FT                   /note="HMMPfam hit to PF06071, DUF933, score 6.4e-62"
FT                   /inference="protein motif:HMMPfam:PF06071"
FT   CDS_pept        5672..6241
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SSUSC84_0007"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0007"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50783"
FT                   /protein_id="CAZ50783.1"
FT                   /translation="MTRLIIGLGNPGDRYFETKHNVGFMLLDKIAKRENVTFNHDKIFQ
FT                   ADIATTFIDGEKIYLVKPTTFMNESGKAVHALMTYYGLDATDILVAYDDLDMAVGKIRF
FT                   RQKGSAGGHNGIKSIVKHIGTQEFDRIKIGIGRPKGKMSVVNHVLSGFDIEDRIEIDLA
FT                   LDKLDKAVNVYLEEDDFDTVMRKFNG"
FT   misc_feature    5681..6235
FT                   /gene="pth"
FT                   /locus_tag="SSUSC84_0007"
FT                   /note="HMMPfam hit to PF01195, Pept_tRNA_hydro, score
FT                   4.1e-79"
FT                   /inference="protein motif:HMMPfam:PF01195"
FT   misc_feature    5714..5755
FT                   /gene="pth"
FT                   /locus_tag="SSUSC84_0007"
FT                   /note="ScanRegExp hit to PS01195, PEPT_TRNA_HYDROL_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01195"
FT   misc_feature    5996..6028
FT                   /gene="pth"
FT                   /locus_tag="SSUSC84_0007"
FT                   /note="ScanRegExp hit to PS01196, PEPT_TRNA_HYDROL_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS_pept        6241..9735
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SSUSC84_0008"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0008"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50784"
FT                   /protein_id="CAZ50784.1"
FT                   /translation="MNILDLLHKNKQINQWQSGLNQSTRQLLLGLSGTSKSLIMATAYD
FT                   CLAEKIMIVTATQNDAEKLVADLTAIIGSENVYNFFTDDSPIAEFVFASKERTQSRIDS
FT                   LNFLTDSTSSGILVASIVACRVLLPSPETYKGSKIQLEVGQEIEVDKLVKNLVNIGYKK
FT                   VSRVLTQGEFSQRGDILDIFDMQSETPYRIEFFGDEIDGIRIFDVDSQKSLENLDEISI
FT                   SPASDIILSSEDYSRASQYIQTAIEQSTLEEQQSYLREVLADMQTEYRHPDLRKFLSCI
FT                   YEQSWTLLDYLPKSSPLFLDDFHKIADKQAQFEKEIADLLTDDLQKGKTVSSLKYFAST
FT                   YAELRKYKPATFFSSFQKGLGNVKFDALYQFTQHPMQEFFHQIPLLKDELTRYAKSNNT
FT                   VVIQASSDVSLQTLQKNLQEYDIHLPVHAADKLVEGQQQVTIGQLASGFHLMDEKLVFI
FT                   TEKEIFNKKMKRKTRRTNISNAERIKDYSELAVGDYVVHHVHGIGQYLGIETIEISGIH
FT                   RDYLTVQYQNSDRISIPVEQIDLLSKYLASDGKAPKVNKLNDGRFQRTKQKVQKQVEDI
FT                   ADDLIKLYAERSQLKGFAFSPDDENQVEFDNYFTHVETDDQLRSIDEIKKDMEKDSPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDGKQVAILVPTTVLAQQHYANFQERFAEFPVNVDV
FT                   MSRFKTKAEQEKTLEKLKKGQVDILIGTHRLLSKDVVFADLGLLVIDEEQRFGVKHKER
FT                   LKELKKKIDVLTLTATPIPRTLQMSMLGIRDLSVIETPPTNRYPVQTYVMETNPSVIRD
FT                   AMLREIDRGGQVYYLYNKVDTIEQKVSELKELVPEATIGYVHGQMSEIQLENTLYAFVE
FT                   GEYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSSRIAYAYLMYRP
FT                   DKSLTEVAEKRLEAIKGFTELGSGFKIAMQDLSIRGAGNILGAAQSGFIDSVGYEMYSQ
FT                   LLEQAILEKQGKATQRQKSNSEVNLQIDAYLPSDYIGDQRQKIEIYKRIKNIDSRVNYQ
FT                   ELQEELIDRFGEYPDVVAYLLEIGLLKSFLDQVFCHTVLRRQHQVTVTFEPMAGQIFLT
FT                   QDYFEALSVTNLKAQITENKGKLAVVFNIQQKKEYEILEELISFAEKLKEIKARKAE"
FT   misc_feature    7702..7995
FT                   /gene="trcF"
FT                   /locus_tag="SSUSC84_0008"
FT                   /note="HMMPfam hit to PF02559, CarD_TRCF, score 2.4e-52"
FT                   /inference="protein motif:HMMPfam:PF02559"
FT   misc_feature    8080..8574
FT                   /gene="trcF"
FT                   /locus_tag="SSUSC84_0008"
FT                   /note="HMMPfam hit to PF00270, DEAD, score 5.2e-41"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    8764..8997
FT                   /gene="trcF"
FT                   /locus_tag="SSUSC84_0008"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 2.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    9277..9603
FT                   /gene="trcF"
FT                   /locus_tag="SSUSC84_0008"
FT                   /note="HMMPfam hit to PF03461, TRCF, score 5.3e-36"
FT                   /inference="protein motif:HMMPfam:PF03461"
FT   CDS_pept        9785..10057
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0009"
FT                   /product="S4 domain containing protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0009"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50785"
FT                   /protein_id="CAZ50785.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIQFGNKLLTVKVLEMKDSTKKEDALKMYEIISEKRIEKDEEI"
FT   misc_feature    9785..9925
FT                   /locus_tag="SSUSC84_0009"
FT                   /note="HMMPfam hit to PF01479, S4, score 8.9e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        10044..10412
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0010"
FT                   /product="putative septum formation initiator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0010"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50786"
FT                   /protein_id="CAZ50786.1"
FT                   /translation="MKKSKILQLNNAFIQSERKKTQHQLAERQQKNRFMGAILILVIFL
FT                   FMLPAYNLVGTYTNIQQQEKKLAELEKNYEELTKEQKQEAEMVAKLKNEEYAAKYVRAK
FT                   YQYSKEGEFVYNIPGLPK"
FT   misc_feature    10155..10223
FT                   /locus_tag="SSUSC84_0010"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0010 by TMHMM2.0 at aa 38-60"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    10167..10403
FT                   /locus_tag="SSUSC84_0010"
FT                   /note="HMMPfam hit to PF04977, DivIC, score 3.6e-16"
FT                   /inference="protein motif:HMMPfam:PF04977"
FT   CDS_pept        10409..10522
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0011"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50787"
FT                   /protein_id="CAZ50787.1"
FT                   /translation="MTESIFKIVEQFLQHSDEKLEELNQKNRELKLEENES"
FT   CDS_pept        10535..11815
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0012"
FT                   /product="putative exported protein"
FT                   /EC_number="3.5.2.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0012"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50788"
FT                   /protein_id="CAZ50788.1"
FT                   /translation="MQKKLLVWLLPVLFGWQVVDSTEIPFELTAQEEYELTHTIYDQYF
FT                   QTIPQNPNVFQTENLYSDEELTIAGGQLQPNQHFSITDVLVNSKKELVFQIDDKGYILA
FT                   SRHLLFDDVIVTETTVEQTYWTKKGFTLLTSPIANEATEIKNDLQPYQAVMVSKIVTTS
FT                   LGDFAYVTDKGWIAVNNLSKTDNRVEAVQELLTNKYSKDTIGIYVKQLSTGQTAGVNQE
FT                   KLFYSASIAKLPILYYVQEQLNAGYIDLTTKVKYTAESISFPGAYVAGGSGSLSKTPDN
FT                   KDYSVEELINKTAKESDNVASNLLSYYVANKFDSNFYQVITAKTGSEWSMVTRETSAEI
FT                   AGKMMEALYIQNGYVLESLLSTQFDNQRISKDISVPVAHKIGDADDVKHDVAIVYAGSP
FT                   FVLSIFTDKSNYDEITQIANDIYRILK"
FT   CDS_pept        11816..13084
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0013"
FT                   /product="PP-loop family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0013"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50789"
FT                   /protein_id="CAZ50789.1"
FT                   /translation="MKDRFLKVTLDGHFFDKHKKVLVAVSGGLDSMNLFHLLYECKQVL
FT                   GIELGIAHINHGQREESVIEEKYLRQLAEESNVPFYLSYFEGVFSEEAARKWRYGFFAT
FT                   IMEKEGYTALVTAHHADDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKK
FT                   ADFEKLFHFEDCSNADFKYFRNRVRNDYLPKLKQENPKIELTLNNLAVDTNNLFQALRD
FT                   LTQDLSVTDVMSFQQQTPAVQSYLLEEYLEKFPDLQLSRPQFNEVLHILRSKANYYHLL
FT                   KNDYMLEKDYHRFQIYKIGPETDSQPEKIMIESEGIFSYGSYIFSLNHPLEEADSILYF
FT                   PTENPIVVRRRQAGDTILINGVNKKLRRWFIDNKISQKVRQNALIIEQNGEIYGITNLV
FT                   SSDLSKSVKNDIIKATLYIKMKE"
FT   misc_feature    11873..12385
FT                   /locus_tag="SSUSC84_0013"
FT                   /note="HMMPfam hit to PF01171, ATP_bind_3, score 1.4e-78"
FT                   /inference="protein motif:HMMPfam:PF01171"
FT   CDS_pept        13092..13634
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SSUSC84_0014"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0014"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50790"
FT                   /protein_id="CAZ50790.1"
FT                   /translation="MLDKDIKKILVSEEEIVAKCKELGQILATDYADKNPILVGILKGS
FT                   IPFMAELMKHIDAHVETDYMVVSSYHGGTESCGTVKIIKDLDNSVAGRYIIFVEDIIDT
FT                   GRTLKELKELFALRQAASIKIATLLDKPEGRVVEIEPDYTCFTIPNEFVVGFGLDYDEN
FT                   YRNLPYVGVLKEEVYTK"
FT   misc_feature    13104..13538
FT                   /gene="hpt"
FT                   /locus_tag="SSUSC84_0014"
FT                   /note="HMMPfam hit to PF00156, Pribosyltran, score 1.6e-29"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS_pept        13656..15629
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /product="putative cell division protease FtsH"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0015"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50791"
FT                   /protein_id="CAZ50791.1"
FT                   /translation="MNNQPNKGFIKNPFLIILVIATIVTAFQFFNAGQQVATQEISYSQ
FT                   VVTELKNNNVSEITYQPNSSVIEITGKYKTEQEAKDELASSIKLFQVSSKVKYKNFKSL
FT                   ILPSETNLSELQALANENGVKVAIKPESSNGLWLNIIFNLLPLVIAGVFFMMMMNQGGG
FT                   GARGAMNFGRNKAKALEQSNIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIP
FT                   AGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAA
FT                   PAIIFIDEIDAVGRQRGVGMGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVL
FT                   DPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAADVDLKLVAQQTPGFVGADLE
FT                   NVLNEAALVAARRNKTVIDASDIDEAEDRVIAGPSKKDRQVSAKEREIVAYHEAGHTIV
FT                   GLVLSNAREVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIF
FT                   NTQTTGASNDFEQATQMARAMVAEYGMSDKMGPMQYEGSHAMFGGQTTQKHISEQTAYE
FT                   LDNEVRDLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSVQIKSLYETGKMPENIE
FT                   RDDEDVHPLSYEEVKEKINTKE"
FT   sig_peptide     13656..13769
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /note="Signal peptide predicted for SSUSC84_0015 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.974) with cleavage
FT                   site probability 0.589 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(13698..13754,14058..14126)
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0015 by TMHMM2.0 at aa 15-33 and 135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    13770..14249
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /note="HMMPfam hit to PF06480, FtsH_ext, score 1.4e-30"
FT                   /inference="protein motif:HMMPfam:PF06480"
FT   misc_feature    14325..14888
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /note="HMMPfam hit to PF00004, AAA, score 4.9e-98"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    14637..14693
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /note="ScanRegExp hit to PS00674, AAA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    14907..15527
FT                   /gene="ftsH"
FT                   /locus_tag="SSUSC84_0015"
FT                   /note="HMMPfam hit to PF01434, Peptidase_M41, score
FT                   2.2e-104"
FT                   /inference="protein motif:HMMPfam:PF01434"
FT   CDS_pept        15967..16437
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="SSUSC84_0016"
FT                   /product="putative competence-specific global transcription
FT                   modulator"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0016"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50792"
FT                   /protein_id="CAZ50792.1"
FT                   /translation="MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEA
FT                   QPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKRKFDRMPHEDIYELSHAIQSPGLIN
FT                   DELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR"
FT   rRNA            16977..18520
FT                   /locus_tag="SSUSC84_r0001"
FT                   /note="16S rRNA"
FT   tRNA            18572..18644
FT                   /locus_tag="SSUSC84_t0001"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:18605..18607,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            18924..21828
FT                   /locus_tag="SSUSC84_r0002"
FT                   /note="23S rRNA"
FT   rRNA            21906..22034
FT                   /locus_tag="SSUSC84_r0003"
FT                   /note="5S rRNA"
FT   tRNA            22035..22107
FT                   /locus_tag="SSUSC84_t0002"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:22068..22070,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            22110..22182
FT                   /locus_tag="SSUSC84_t0003"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:22143..22145,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            22228..22300
FT                   /locus_tag="SSUSC84_t0004"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:22261..22263,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.85"
FT   tRNA            22304..22385
FT                   /locus_tag="SSUSC84_t0005"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:22338..22340,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 45.48"
FT   tRNA            22400..22472
FT                   /locus_tag="SSUSC84_t0006"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:22433..22435,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            22485..22556
FT                   /locus_tag="SSUSC84_t0007"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:22517..22519,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            22564..22647
FT                   /locus_tag="SSUSC84_t0008"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:22598..22600,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 51.48"
FT   tRNA            22666..22739
FT                   /locus_tag="SSUSC84_t0009"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:22700..22702,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 72.48"
FT   tRNA            22787..22860
FT                   /locus_tag="SSUSC84_t0010"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:22821..22823,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   tRNA            22873..22946
FT                   /locus_tag="SSUSC84_t0011"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:22907..22909,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 69.60"
FT   tRNA            22963..23036
FT                   /locus_tag="SSUSC84_t0012"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:22997..22999,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 81.31"
FT   tRNA            23043..23132
FT                   /locus_tag="SSUSC84_t0013"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:23079..23081,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            23143..23216
FT                   /locus_tag="SSUSC84_t0014"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:23177..23179,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            23232..23304
FT                   /locus_tag="SSUSC84_t0015"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:23265..23267,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            23336..23409
FT                   /locus_tag="SSUSC84_t0016"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:23370..23372,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.63"
FT   tRNA            23422..23509
FT                   /locus_tag="SSUSC84_t0017"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:23456..23458,aa:Ser)"
FT                   /note="tRNA Ser anticodon GCT, Cove score 31.75"
FT   CDS_pept        23569..24405
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0017"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0018"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50793"
FT                   /protein_id="CAZ50793.1"
FT                   /translation="MNKFSKLVVVVSIFLLLSFSLLFVTFSKGLQVPYLNNIVRVVVTP
FT                   IQSVISVPTRFFSEQKDVLTDLMNAYEENKQLKETIMSLEGMAAENTSLKEENASLRSS
FT                   LGVVSDFPEKQLIPGSVLVRTPSSWSEHISINIGETSGVTYNALVVANGGLVGIVSSLS
FT                   SDSAVVTLFTNSDEFTKLPVKISVDSKEIYGILSGYDADTNSFIINQLNSADEIAVGSN
FT                   VVTSDLAGETPANVQIGKVLSVKSNSNSLNREVYVEPTASFSNIYSVLVVGQTNAQ"
FT   sig_peptide     23569..23655
FT                   /locus_tag="SSUSC84_0017"
FT                   /note="Signal peptide predicted for SSUSC84_0017 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.685 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    23587..23646
FT                   /locus_tag="SSUSC84_0017"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0017 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    23923..24396
FT                   /locus_tag="SSUSC84_0017"
FT                   /note="HMMPfam hit to PF04085, MreC, score 1.4e-31"
FT                   /inference="protein motif:HMMPfam:PF04085"
FT   CDS_pept        24395..24910
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0018"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0019"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50794"
FT                   /protein_id="CAZ50794.1"
FT                   /translation="MRNKMIEIFMFPILFFILLLDGQISTLVTNWSVGLFTISSHLVLM
FT                   LAIFYANYVSLGFSLFIFTLLGLVYDISYLNLIGIATTTLPLVLYCIYFFFQGAVSKRG
FT                   INILILLVAIFQFEFISYSFARIFHITNLSVFIFVFNKLLPSLLFNLVLFFVLQPLFER
FT                   LFGITNKT"
FT   misc_feature    join(24407..24475,24533..24601,24614..24682,24710..24778,
FT                   24797..24865)
FT                   /locus_tag="SSUSC84_0018"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0018 by TMHMM2.0 at aa 5-27, 47-69, 74-96, 106-128
FT                   and 135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        24995..26251
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0019"
FT                   /product="putative amidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0020"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50795"
FT                   /protein_id="CAZ50795.1"
FT                   /translation="MKKKILATIMLSTVVLSNANYVAVISANDVDSQIATKNQQISELT
FT                   AQQAEAQQQVDAIQGQVDAIVSEQAKLTEENTRLEAESQTLAADIERLSADIVSRDGAL
FT                   KEQARSAQVDGSASSYINTILDSKSIIDAVSRVNAMREIISANNRMLEQQKADKEAIVE
FT                   KQKANQEAITTLAANRQKLEDDAQVLQVRQAELEAAKLNLAVQKATAEDEKNSLLVQKA
FT                   AAEEAARQAAARQAEYQAQQAALAQQQVASVSAPVVSTLVETTVTETVAAPTQTVSQST
FT                   PTVSTPTTSTSSGSGSSAAANNARYDASSYPVGECTWGVKSQLSWVGPYWGDAKQWLAS
FT                   ARAEGFSTGSTPQVGAIAVWTGGYYGHVAVVTAVQSSTSIQVVESNYMGRRYIGNHRGG
FT                   YFNPTTTSEGAVYYIYPPY"
FT   sig_peptide     24995..25075
FT                   /locus_tag="SSUSC84_0019"
FT                   /note="Signal peptide predicted for SSUSC84_0019 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.995) with cleavage
FT                   site probability 0.891 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    25880..26239
FT                   /locus_tag="SSUSC84_0019"
FT                   /note="HMMPfam hit to PF05257, CHAP, score 8e-36"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS_pept        26354..27322
FT                   /transl_table=11
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUSC84_0020"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0021"
FT                   /note="Similar to SSU0918, 52.077% identity (52.751%
FT                   ungapped) in 313 aa overlap (5-317:9-317)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50796"
FT                   /protein_id="CAZ50796.1"
FT                   /translation="MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVN
FT                   IEESIRGTHVYILQSTSSPVNDNLMEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEVMNIIGDIKDKTCIL
FT                   IDDMIDTAGTICHAADALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEI
FT                   AEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEASRVK"
FT   misc_feature    26741..26788
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUSC84_0020"
FT                   /note="ScanRegExp hit to PS00114, PRPP_SYNTHETASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    26774..27175
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUSC84_0020"
FT                   /note="HMMPfam hit to PF00156, Pribosyltran, score 5.3e-31"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    27011..27049
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUSC84_0020"
FT                   /note="ScanRegExp hit to PS00103, PUR_PYR_PR_TRANSFER,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        27409..28587
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0021"
FT                   /product="putative aminotransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0022"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50797"
FT                   /protein_id="CAZ50797.1"
FT                   /translation="MDLLNRFNKNLNRIEVSMIRQFDQSISDVPGILKLTLGEPDFTTP
FT                   DHVKEAAKAAIDADQSYYTGMAGLLELRQAAAEFVAEKYNLHYNPENEILSTIGATEAL
FT                   SASLVAILEAGDTVLLPAPAYPGYEPIVNMVGADIVEIDTTANDFVLTPEMLEEAIIEQ
FT                   GDKLKAVILNYPANPTGVTYSREQIQAFADVLRNYPVFVLSDEVYAELTYTGQPHTSIA
FT                   EFLPEQTILIQGLSKSHAMTGWRIGLIMSQAPIIAQIIKSHQYLVTAASTAMQYGAVEA
FT                   LKNGKDDALPMRAEYVKRRDYIIEKMTDLGFKIIKPDGAFYIFAKIPAGYNQDSFSFLQ
FT                   DFARKKAVAFIPGAAFGQYGEGYVRISYAASMEKIQTAMARLKEYLEENGTN"
FT   misc_feature    27496..28554
FT                   /locus_tag="SSUSC84_0021"
FT                   /note="HMMPfam hit to PF00155, Aminotran_1_2, score
FT                   2.6e-56"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    28108..28149
FT                   /locus_tag="SSUSC84_0021"
FT                   /note="ScanRegExp hit to PS00105, AA_TRANSFER_CLASS_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS_pept        28574..29356
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SSUSC84_0022"
FT                   /product="DNA repair protein RecO"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0023"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50798"
FT                   /protein_id="CAZ50798.1"
FT                   /translation="MERIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASKSKL
FT                   VASIQPLTYADFIVKINDDGLSYIEDFHQVQPFKNINGDIFKLSYATYILALADAALQD
FT                   KVYDPALFAFLVKTLDLMESGLDYEVLTNIFEIQLLGRFGISLNFHECAFCHRVGLPFD
FT                   YSYKYSGVLCPQHYQQDERRAYLDPNVPYLLDQFQAISFDELETISIKPEMKRKLRFFI
FT                   DQLYEEYVGIHLKSKKFIDDLSSWGQIMKPRTENEETE"
FT   misc_feature    28574..29311
FT                   /gene="recO"
FT                   /locus_tag="SSUSC84_0022"
FT                   /note="HMMPfam hit to PF02565, RecO, score 1.8e-19"
FT                   /inference="protein motif:HMMPfam:PF02565"
FT   CDS_pept        29353..30360
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SSUSC84_0023"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0024"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50799"
FT                   /protein_id="CAZ50799.1"
FT                   /translation="MKRIAVDAMGGDHAPQAVVEGVNQALAAFPDIEIQLYGDEAKIKQ
FT                   YLTATERVSIVHTTEKINSDDEPVKAIRRKKEASMVLATKAVKDGQADAVLSAGNTGAL
FT                   LAAGVFVVGRIKNIDRPGLMSTLPTMDGKGFDMMDLGANAENIAHHLYQYGILGSFYAE
FT                   HVRGVKQPRVGLLNNGTEDTKGTPVHQEAYKLLAEDKSINFIGNVEARELLNSVADVVV
FT                   TDGFTGNAVLKTIEGTAKSIVGQLTGSIKNGGLRAKLGGLLVKPTLKKALGAMDYKTAG
FT                   GAVLLGLKAPVIKAHGSSDAQSIFYTIKQTRSILEAGIVEKSVAKFSVVEESHD"
FT   misc_feature    29356..30318
FT                   /gene="plsX"
FT                   /locus_tag="SSUSC84_0023"
FT                   /note="HMMPfam hit to PF02504, FA_synthesis, score
FT                   4.9e-135"
FT                   /inference="protein motif:HMMPfam:PF02504"
FT   CDS_pept        30353..30601
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0024"
FT                   /product="putative acyl carrier protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0025"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50800"
FT                   /protein_id="CAZ50800.1"
FT                   /translation="MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFV
FT                   LNLEDEFHVDVPDAAIEHFEVLSDIVDFIYKEVKKRS"
FT   CDS_pept        30719..31426
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SSUSC84_0025"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0026"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50801"
FT                   /protein_id="CAZ50801.1"
FT                   /translation="MKTDLLYSGKAKDIYATADSDQIVAVYKDQATAFNGGKKEQIVGK
FT                   GRLNNLISSLIFEKLNEAGVPTHFIKRLSDSEQLNKKVEIIPLEVVLRNVTAGSFSKRF
FT                   GVEEGITLSTPIVEFYYKKDELDDPFINDEHIAFLELASQDQIAYIKEETRRINEFLKD
FT                   LFAQIGLTLVDFKLEFGIDSSGQILLADEFSPDNCRLWDADGNHLDKDVFRRGLGELTE
FT                   VYEVVLAKLQEVK"
FT   misc_feature    30722..31423
FT                   /gene="purC"
FT                   /locus_tag="SSUSC84_0025"
FT                   /note="HMMPfam hit to PF01259, SAICAR_synt, score 5e-118"
FT                   /inference="protein motif:HMMPfam:PF01259"
FT   misc_feature    30971..31015
FT                   /gene="purC"
FT                   /locus_tag="SSUSC84_0025"
FT                   /note="ScanRegExp hit to PS01057, SAICAR_SYNTHETASE_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01057"
FT   misc_feature    31232..31258
FT                   /gene="purC"
FT                   /locus_tag="SSUSC84_0025"
FT                   /note="ScanRegExp hit to PS01058, SAICAR_SYNTHETASE_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01058"
FT   misc_feature    31250..31297
FT                   /gene="purC"
FT                   /locus_tag="SSUSC84_0025"
FT                   /note="ScanRegExp hit to PS00012, PHOSPHOPANTETHEINE, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        31439..35158
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0026"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase protein"
FT                   /EC_number="6.3.5.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0027"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50802"
FT                   /protein_id="CAZ50802.1"
FT                   /translation="MAKRIFVEKKAAFQIKAEALRKELTHNLQLTSLSSLRLVQVYDVF
FT                   NLEEDLLEQAIKHIFTEQVTDKVLSDEELGLEGAVYFAIEALPGQFDQRAASSQEALLL
FT                   LGSRQEVRVNTGQLYILNGDVQEEELVAIKNYLLNPVDSRFKDMDAPLVAQEFSVSDTV
FT                   IPSLDFFDSYGVEEFASYKREAGLAMEVEDLLFIQDYFKSIGRVPTETELKVLDTYWSD
FT                   HCRHTTFETELRSIDFSASKFQKQLQATYDKYLAMRTELGRTDKPQTLMDMATIFGRYE
FT                   RANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATCIG
FT                   GAIRDPLSGRSYVYQAMRISGAGDITQPLTATRSGKLPQQIISKTAAHGYSSYGNQIGL
FT                   ATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPVAGDVVILLGGKTGRDGIGGAT
FT                   GSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGAVTRLIKKSNDFGAGGVCVAIGE
FT                   LADGLEIDLDKVPLKYAGLNGTEIAISESQERMSVVVRPEDVDAFIAACRQENIHAVVV
FT                   AKVTEKPNLVMTWNGQTIVDLERSFLDTNGVRVVVDAKVVDSPVNLPETRTTSAQTLRE
FT                   DLKDLLSDLNHASQKGLQTIFDSSVGRSTVNHPLGGRHQLTPTESSVQKLPVQQGVTTT
FT                   ASVMAQGYHPYLADWSPYHGAAYAVIEATARLVATGANWSKARFSYQEYFQRMDKQAER
FT                   FGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPTLVAFGVTTADSCKVLSPE
FT                   FKATGEHIYYLPGQILSEDIDFTLIKSNFKAFEKWQSDYVITAASAVKYGGVLESLALM
FT                   SFGNQVGARVELADFETSLTGQLGGFVFTSQEDIPDAVKIGQTTTDFTLVVNGVNLSGQ
FT                   DLQVAFEGKLEEVYPTEFEQATELQDVPAVTSSAVIKAKETVEVPVVYIPVFPGTNSEY
FT                   DSAKAFEQAGAKVNLVPFVTLDAESIENSVDTMVDNIAKANILFFAGGFSAADEPDGSA
FT                   KFIVTILRNAKVRSAIDQFIEKRGLIIGICNGFQALVKSGLLPYGNFEEAGDTSPTLFY
FT                   NDANQHIAKMVETRIANVNSPWLAGVQVGDIHAIPVSHGEGKFVVTDEEFATLRDNGQI
FT                   FSQYVDFTGQPSMDSKYNPNGSSHAIEGITSRNGQIIGKMGHSERYEDGLFQNIPGKKD
FT                   QGLFVSAVRYFTGK"
FT   misc_feature    32372..32473
FT                   /locus_tag="SSUSC84_0026"
FT                   /note="HMMPfam hit to PF00586, AIRS, score 5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    32747..33208
FT                   /locus_tag="SSUSC84_0026"
FT                   /note="HMMPfam hit to PF02769, AIRS_C, score 5e-35"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   misc_feature    33635..33709
FT                   /locus_tag="SSUSC84_0026"
FT                   /note="ScanRegExp hit to PS01159, WW_DOMAIN_1, score NA"
FT                   /inference="protein motif:Prosite:PS01159"
FT   CDS_pept        35161..36615
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SSUSC84_0027"
FT                   /product="putative amidophosphoribosyltransferase
FT                   precursor"
FT                   /EC_number="2.4.2.14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0028"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50803"
FT                   /protein_id="CAZ50803.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIL
FT                   ANDGGQLCRHRGTGLIAEVFKNPADLEALTGTAAIGHVRYATSGSASINNIQPFLFDFA
FT                   DMQVGLAHNGNLTNAVSLKAELEKNGSIFSSSSDTEILMHLIRRSHNPDFMGKIKEALN
FT                   TVKGGFAYLILLEDKLVAALDPNGFRPLSIGKMKNGAWVVASETCAFEVVGADWVRDVE
FT                   PGEIVVIDDSGIQYDSYTRDTQLAVCSMEYVYFARPDSVIHGVNVHTARKNMGRRLAQE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSSVVKGKRVVMIDDSIVRGTTSRRIVQLLRDAGAKEVHVAIGSPELKYPCFYGID
FT                   IQTRRELISANHTVEEVCEIIGADSLTYLSLEGMIEAIGIETDAPKGGLCVAYFDGEFP
FT                   TPLYDYEEEYLRSLEEKTSFYIENVK"
FT   misc_feature    35161..35208
FT                   /gene="purF"
FT                   /locus_tag="SSUSC84_0027"
FT                   /note="ScanRegExp hit to PS00443, GATASE_TYPE_II, score NA"
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    35194..35781
FT                   /gene="purF"
FT                   /locus_tag="SSUSC84_0027"
FT                   /note="HMMPfam hit to PF00310, GATase_2, score 9.9e-43"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    35926..36363
FT                   /gene="purF"
FT                   /locus_tag="SSUSC84_0027"
FT                   /note="HMMPfam hit to PF00156, Pribosyltran, score 2.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    36217..36255
FT                   /gene="purF"
FT                   /locus_tag="SSUSC84_0027"
FT                   /note="ScanRegExp hit to PS00103, PUR_PYR_PR_TRANSFER,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        36671..37693
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SSUSC84_0028"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0029"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50804"
FT                   /protein_id="CAZ50804.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERLGVMGALGGFGG
FT                   MFDLTKLDVKEPVLVSGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNEPAKLEQVVAGVAEGCVQAGCGLIGGETAEMPGMYGEDDYDLAGFAVGIA
FT                   EKSQIIDGSKVQEGDILLGLASSGIHSNGYSLVRRVFADVSGDALLPELNGRALKDVLL
FT                   EPTRIYVQQVLPLVKAGLVNGIAHITGGGFIENVPRMFADNLAAEIEEDKIPVLPIFTA
FT                   LETYGQIKHEEMFEIFNMGIGMVLAVSPGKVEKVRELVGEEVYEIGRIITKEDKSVVIK
FT                   "
FT   misc_feature    36677..37162
FT                   /gene="purM"
FT                   /locus_tag="SSUSC84_0028"
FT                   /note="HMMPfam hit to PF00586, AIRS, score 2.4e-70"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    37193..37690
FT                   /gene="purM"
FT                   /locus_tag="SSUSC84_0028"
FT                   /note="HMMPfam hit to PF02769, AIRS_C, score 1.8e-46"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   CDS_pept        37690..38241
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SSUSC84_0029"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0030"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50805"
FT                   /protein_id="CAZ50805.1"
FT                   /translation="MKRIAVFASGNGSNFQVIAEQFEVAFVFSDRRNAYVLERAEKLGV
FT                   PTFAFELKEFADKQAYEEAIIQLLDQHQIDLVVLAGYMKIVGPTLLAQYEGRIINIHPA
FT                   YLPEFPGAHGIEDAWNAGVAESGVTVHWVDSGIDTGQIIKQVRVPRLADDILETFEARI
FT                   HEAEYQLYPAVLEELGAVKK"
FT   misc_feature    37693..38214
FT                   /gene="purN"
FT                   /locus_tag="SSUSC84_0029"
FT                   /note="HMMPfam hit to PF00551, Formyl_trans_N, score
FT                   1.4e-60"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   CDS_pept        38251..39798
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SSUSC84_0030"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase]"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0031"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50806"
FT                   /protein_id="CAZ50806.1"
FT                   /translation="MTKRALISVSDKNGIVEFAQELTKLGWEIISTGGTKVALDNAGVA
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDHEIGLIDLVVVNLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYPTVLGEIAEQGQT
FT                   TYPTRQRLAAKVFRHTAAYDALIADYFTKQVGEDKPEKLTITYDLNQPMRYGENPQQNA
FT                   DFYQNALPTDYSIAAAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALKHMNPCGI
FT                   GQAETIEKAWDYAYEADPVSIFGGIVVLNREVDAATAEKMHPIFLEIIIAPSYSAEALA
FT                   ILTNKKKNLRILELAFDAQDASEVEKEFTGVVGGLLVQDQDVVVESPADWQVVTERQPS
FT                   EQEWAAMEFAWKSSKYVKSNGIIITNDKMTLGVGPGQTNRVASVRIAIEQAKDRLEGAV
FT                   LASDAFFPFADNVEEIAAAGIKAIIQPGGSVRDQDSIDMANKYGLTMVFTGVRHFRH"
FT   misc_feature    38290..38637
FT                   /gene="purH"
FT                   /locus_tag="SSUSC84_0030"
FT                   /note="HMMPfam hit to PF02142, MGS, score 4.4e-56"
FT                   /inference="protein motif:HMMPfam:PF02142"
FT   misc_feature    38650..39600
FT                   /gene="purH"
FT                   /locus_tag="SSUSC84_0030"
FT                   /note="HMMPfam hit to PF01808, AICARFT_IMPCHas, score
FT                   4.8e-148"
FT                   /inference="protein motif:HMMPfam:PF01808"
FT   CDS_pept        39924..41186
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SSUSC84_0031"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0032"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50807"
FT                   /protein_id="CAZ50807.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESEQVEQVFVAPGNDGMTLDGIELV
FT                   NIGISEHSAIINFAKENDVAWTFVGPDDALAAGIVDDFEQAGLKAFGPSRLAAELEWSK
FT                   DFAKQIMVKYGIPTAAFGTFSNFEEAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAREMLLDNKFGDSGARVVIEEFLAGEEFSLFALVNGDQFYILPTAQDHKRAFDGDQ
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPILEGMIADGRSYLGVLYAGLILTDQGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNIDDILHKRPTQLTWLDSGVTLGVVVASNGYPL
FT                   DYEKGVELPAKTEGDITTYYAGARFAENSRALLSNGGRVYMLVTTADTVQDAQEKIYSE
FT                   LKNQDTTGLFYRTDIGSKAVK"
FT   misc_feature    39924..40226
FT                   /gene="purD"
FT                   /locus_tag="SSUSC84_0031"
FT                   /note="HMMPfam hit to PF02844, GARS_N, score 8.4e-44"
FT                   /inference="protein motif:HMMPfam:PF02844"
FT   misc_feature    40230..40805
FT                   /gene="purD"
FT                   /locus_tag="SSUSC84_0031"
FT                   /note="HMMPfam hit to PF01071, GARS_A, score 4e-119"
FT                   /inference="protein motif:HMMPfam:PF01071"
FT   misc_feature    40785..40808
FT                   /gene="purD"
FT                   /locus_tag="SSUSC84_0031"
FT                   /note="ScanRegExp hit to PS00184, GARS, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    40902..41180
FT                   /gene="purD"
FT                   /locus_tag="SSUSC84_0031"
FT                   /note="HMMPfam hit to PF02843, GARS_C, score 3.2e-14"
FT                   /inference="protein motif:HMMPfam:PF02843"
FT   CDS_pept        41212..41700
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SSUSC84_0032"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0033"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50808"
FT                   /protein_id="CAZ50808.1"
FT                   /translation="MNIPISIIMGSSSDWKTMKKAADMLDKFGVAYEKKVVSAHRTPDL
FT                   MFRHAEEARGHGFKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDQTIAAQLADFAKEQEKIAEAMTDDLI"
FT   misc_feature    41218..41694
FT                   /gene="purE"
FT                   /locus_tag="SSUSC84_0032"
FT                   /note="HMMPfam hit to PF00731, AIRC, score 1.7e-87"
FT                   /inference="protein motif:HMMPfam:PF00731"
FT   CDS_pept        41687..42766
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SSUSC84_0033"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   ATPase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0034"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50809"
FT                   /protein_id="CAZ50809.1"
FT                   /translation="MTSSKTIGIIGGGQLGQMMAISAIYMGHKVITLDPAADCPASKVS
FT                   EVIVAPYHDVAALKQLAERCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLAKKAGVQVAPYKVVTSSLDLEGLDLSKNYVLKTATGGYDGHGQKVIREEADLVE
FT                   ASQLANSAECVLEEFVNFDLEISVLVSGNGSDYTVFPVQENIHRNNILYKTIVPARIFD
FT                   ELAEKAKTMALQIADKLHLVGTLCVEMFVAGQEILVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHIRGILGEPLPPIRLLSPAVMINVLGQDMETVQTFLQENPTAHPHFYGKLEAKHNRK
FT                   MGHVTVLGEDAESVEEFEN"
FT   misc_feature    41987..42514
FT                   /gene="purK"
FT                   /locus_tag="SSUSC84_0033"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp, score 1.6e-66"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   CDS_pept        42810..43571
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0034"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0035"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50810"
FT                   /protein_id="CAZ50810.1"
FT                   /translation="MPLPQKIQEEIKRYCNNHLPNNDWYEKEFDFIHDVSLKNRIIREF
FT                   KSIRYAYKLYEGITAEEEHLIFEIRSQILAYASIYEAVVEYVLETYYSDTQVYDDLVHQ
FT                   NNVMTKIDIPEEKRKKLERELIHLVDNGTKNIEIHTFFYQRKRKASTSIRFDAKCRAAE
FT                   ELNIISKIYQKGNKVVADLPSDIIEIYEYRNAIHLIAEQRKNIDYELELSQRAYRRMKP
FT                   FIEQIKDRLITDNKLIIKNTKDTLTDSSIKN"
FT   CDS_pept        join(43644..44078,44082..44870)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0035"
FT                   /product="hypothetical protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0036"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   145. Similar to Streptococcus suis (strain 98HAH33)
FT                   putative uncharacterized protein UniProt:A4VYL0
FT                   (EMBL:CP000408) (408 aa) fasta scores: E()=6.3e-154,
FT                   99.510% id in 408 aa"
FT                   /db_xref="PSEUDO:CAZ50811.1"
FT   CDS_pept        44872..46164
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SSUSC84_0036"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0037"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50812"
FT                   /protein_id="CAZ50812.1"
FT                   /translation="MIERYSRPEMAAIWSEENKYEAWLEVEILADEAWAELGEIPKEDV
FT                   ALIREKATFDIDRILEIEEETRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTTIIADKAREHKYTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NMERFDVAAKGVEAGKISGAVGNFANIPPFVEEYVCGKLGIRPQEISTQVLPRDLHAEY
FT                   FSALALIATSIERMATEIRGLQKSEQREVEEYFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVVRGHLVTAFENVALWHERDISHSSAERIITPDTTILINYMLNRFGNIVKNLTVFPEN
FT                   MKRNMESTFGLIYSQRVMLSLIEKGMTREEAYDLVQPKTAQSWDNQVDFKPLLEADERV
FT                   TAKLSQEEIDELFNPDYYAKRVDDIFERLGL"
FT   misc_feature    44878..45729
FT                   /gene="purB"
FT                   /locus_tag="SSUSC84_0036"
FT                   /note="HMMPfam hit to PF00206, Lyase_1, score 1.8e-91"
FT                   /inference="protein motif:HMMPfam:PF00206"
FT   misc_feature    45652..45681
FT                   /gene="purB"
FT                   /locus_tag="SSUSC84_0036"
FT                   /note="ScanRegExp hit to PS00163, FUMARATE_LYASES, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS_pept        47101..47829
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0037"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0039"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50813"
FT                   /protein_id="CAZ50813.1"
FT                   /translation="MNMFRSIFKSVIHRRDVALFYAFAGLPILVPILSKFLVGVKAEYT
FT                   DNFLDFLGAALATQDGIVLPVLLLSLIISAVFRDEIDSGILFLYKDLNRTRLFNAKIIS
FT                   LVVMYASYVLLTVLTSAIAYFGFLNASGKVVSDDWSNVQSTFLSIFATISINVIGILLV
FT                   STVSIKAKSLQAVLAGVFWSLFTTTAPLLIGVRYVVPNGYAKMSLDQPLLAWSLVVAIT
FT                   TFYTVATYLKGRSNFEKLEF"
FT   sig_peptide     47101..47226
FT                   /locus_tag="SSUSC84_0037"
FT                   /note="Signal peptide predicted for SSUSC84_0037 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.884) with cleavage
FT                   site probability 0.882 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(47149..47217,47260..47328,47410..47478,47536..47604,
FT                   47623..47691,47734..47793)
FT                   /locus_tag="SSUSC84_0037"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0037 by TMHMM2.0 at aa 17-39, 54-76, 104-126,
FT                   146-168, 175-197 and 212-231"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        47839..48417
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0038"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0040"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50814"
FT                   /protein_id="CAZ50814.1"
FT                   /translation="MVVRYMRPVALSLALIVLASISYLLATSLVLFSSSQFLQLAYLFS
FT                   IMVGMPIGFILLPSMITKRYQLCQELSEVKFSWKSFVLLAIAIFLVNFWFIQSDEYVNQ
FT                   FIIATCEEFLFRYLIYRILKSEYPTWLAMLVTSLLFGVLLHMNYSLLDNLIIRTPLGLL
FT                   FSVLATRFGLQYAIGGHWIYNLLVSRFPF"
FT   sig_peptide     47839..47937
FT                   /locus_tag="SSUSC84_0038"
FT                   /note="Signal peptide predicted for SSUSC84_0038 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.997) with cleavage
FT                   site probability 0.946 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(47863..47931,47941..48009,48067..48126,48223..48291,
FT                   48316..48384)
FT                   /locus_tag="SSUSC84_0038"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0038 by TMHMM2.0 at aa 9-31, 35-57, 77-96, 129-151
FT                   and 160-182"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    48130..48411
FT                   /locus_tag="SSUSC84_0038"
FT                   /note="HMMPfam hit to PF02517, Abi, score 1.9e-12"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS_pept        48429..48860
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0039"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0041"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50815"
FT                   /protein_id="CAZ50815.1"
FT                   /translation="MMIFILLLSLFYICLTVASSQLLLSLSVPVLLLLTYLLPPIVNSI
FT                   CMGLQKDKSWKAWSAGIFPTMSMIFYAAFAYITSSNGQWEQFAQLHTVSDDVMSVELAG
FT                   ELLVPSQMLFVAVLYYGTAIATYFIQQAGRKKEKGATYA"
FT   misc_feature    join(48432..48500,48510..48578,48597..48665,48747..48815)
FT                   /locus_tag="SSUSC84_0039"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0039 by TMHMM2.0 at aa 2-24, 28-50, 57-79 and
FT                   107-129"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        48853..49725
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0040"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0042"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50816"
FT                   /protein_id="CAZ50816.1"
FT                   /translation="MLKINHLSKQFAGNEFYSLKDVSLEINKGEIVGLIGKNGAGKSTL
FT                   MKLMAKSLKPSSGTITYKGTDIFSQDNLLADFGIMIDPVFYPEMTVMDNLKFYLDLHGK
FT                   KDLYPNIEKTLKLVELWDARNRKPKGFSFGMKQRTALAIALVAEPDFLILDEPFVGLDP
FT                   IGVQKLIDILKQWSSERQISMLISSHQLGELEALCSRYVYIESGELADAFEGKSHPSVL
FT                   VQLDTTKNLDSVKDLLNDHVVLEGEVLEISTATPTSELNQIFGVLTRQELIVKLEVKEN
FT                   HLKEIFTKG"
FT   misc_feature    48937..49473
FT                   /locus_tag="SSUSC84_0040"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.8e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        49731..50498
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0041"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0043"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50817"
FT                   /protein_id="CAZ50817.1"
FT                   /translation="MKQIFPAVFRTIWKRKETQVYLLFTLFPFIYLVTSFIEGSNFMQI
FT                   HAGEGYKVSLVAFTNMMVSSADSFILPSLTLYFLAISVFRKEVDEHTMFLYRDLGRKQI
FT                   FWSKYLGLLATIVIFYGLFFVTSAFVHYVRVIHLPFGSPAVFEASLAESLSNVFCIVAY
FT                   LLKDILSISLATALCLYLKNITTMITGFLVTITMMILAIVGGPVAMLFPTSYMTLASEG
FT                   LAGLAYLGAICVTIIYVLVFTKIAAKKFKNLEF"
FT   misc_feature    join(49788..49856,49914..49982,50040..50108,50205..50273,
FT                   50292..50360,50388..50456)
FT                   /locus_tag="SSUSC84_0041"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0041 by TMHMM2.0 at aa 20-42, 62-84, 104-126,
FT                   159-181, 188-210 and 220-242"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        50501..52213
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0042"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0044"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50818"
FT                   /protein_id="CAZ50818.1"
FT                   /translation="MNKRLVGVLLKSLNKTMFLFGIVLSALGVGMGLFLPQFIGKLLDQ
FT                   TYLSNLLTRPELLAGFILFFVSVYAVQALSNYFIGRSGSNALKQLQQYIYESLLTTSVK
FT                   DLDQYQSGDLASRLTNDMSVVLNFITVILPNFLMNGLMVMGSIYFLWTISPWLTGLSLF
FT                   LLPLLSMVMIPMNQRLEGYYSAYQEGLGQVSSRISHKFTTIRLMKAFQGEKHEQREMGK
FT                   SFQYLSQTFEKMIGLSAVQHTLVSSLMTGFIILMLLIAGIEVTKGVMTMATLTTFVLYM
FT                   MQLIDPVTDIAASLNELTEFHAVSKRLVELLELNKEEQVDTELVDATSIQLEKVRFSYH
FT                   TDPILNGVSVRIPEGAHVAIVGPSGAGKSTIFALLMKYYQDYKGKIRIGQQCLSDISTK
FT                   EMRRLISFIPQDNTLFHGTIRENLLYGKNESVSEERIAYILKELGLSPLVAELEDGLDT
FT                   RISENGTGLSEGQKQRFSIARALLLEHPIYLLDEATASLDTVTERVISKAIDRLTAGKT
FT                   RLTIAHRLHTVREADAILVLDKNGQVADYGHHQQLVERNHLYQDFLRGLPQAS"
FT   misc_feature    join(50549..50617,50669..50737,50870..50929,50939..51007,
FT                   51227..51295)
FT                   /locus_tag="SSUSC84_0042"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0042 by TMHMM2.0 at aa 17-39, 57-79, 124-143,
FT                   147-169 and 243-265"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    50552..51364
FT                   /locus_tag="SSUSC84_0042"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 6.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    51563..52123
FT                   /locus_tag="SSUSC84_0042"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 7.5e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        52783..53784
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SSUSC84_0043"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0046"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50819"
FT                   /protein_id="CAZ50819.1"
FT                   /translation="MTNRILDMEQMQDEEYVERTLRPQKLNEYIGQDKVKDQLKIFIEA
FT                   AKLRDEALDHTLLFGPPGLGKTTMAFVIANELGVNIKQTSGPVIEKAGDLVALLNDLEP
FT                   GDVLFIDEIHRMPMAVEEILYSAMEDFYIDIMIGAGEASRSVHLELPPFTLIGATTRAG
FT                   MLSNPLRARFGITGHMEYYELADLTEIVERTADIFDMEITHEAAIELARRSRGTPRIAN
FT                   RLLKRVRDFAQIMGDGLIDDSITDKALTMLDVDREGLDYVDQKILRTMIEMYGGGPVGL
FT                   NTLSVNIAEERETVEDMYEPYLIQQGFLMRTRTGRVATAKAYEHLGYPYTEK"
FT   misc_feature    52789..52944
FT                   /gene="ruvB"
FT                   /locus_tag="SSUSC84_0043"
FT                   /note="HMMPfam hit to PF05496, RuvB_N, score 5.7e-28"
FT                   /inference="protein motif:HMMPfam:PF05496"
FT   misc_feature    52945..53484
FT                   /gene="ruvB"
FT                   /locus_tag="SSUSC84_0043"
FT                   /note="HMMPfam hit to PF00004, AAA, score 7.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    53533..53769
FT                   /gene="ruvB"
FT                   /locus_tag="SSUSC84_0043"
FT                   /note="HMMPfam hit to PF05491, RuvB_C, score 1.5e-53"
FT                   /inference="protein motif:HMMPfam:PF05491"
FT   CDS_pept        53784..54530
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0044"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0047"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50820"
FT                   /protein_id="CAZ50820.1"
FT                   /translation="MAEQMRQAARLFGDWPETIIWTCLEGVMGDIYVDDSQLPQSALAL
FT                   YGRQSFFGFLAGQPHRDLLKICEGKDMILVPQNQNWSDLIEGTYGDGIRSFTRYATKKD
FT                   TEFDLGHLQKLVDDLPESFDMKRIDRNLYEACLVEEWSRDLVGNYIDVEQFLDLGLGYV
FT                   ILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDA
FT                   HTLTSLKLAEKLGYQLDKPYQAYEWR"
FT   misc_feature    54267..54494
FT                   /locus_tag="SSUSC84_0044"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   1.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        54532..55167
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0045"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0048"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50821"
FT                   /protein_id="CAZ50821.1"
FT                   /translation="MTPTFIWDLDGTLLDSYEAILAGIQETYQEYVLPFDRAEVRKFIL
FT                   RYSVKDLLVRDADKYGLDSDELNRVRATSLKEKNTQIPLMAGAVEILNWTAEQGIQNFV
FT                   YTHKSDNAFQVLEDLGVRHHFTEILTSDSGFARKPSPEALLFLIEKYGLDKENTYYIGD
FT                   RLLDVETAVNAGIHSINLQIDGVEQNWKIVSLLDIKQILTDKSSHNNL"
FT   misc_feature    54535..55068
FT                   /locus_tag="SSUSC84_0045"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 8.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        55414..56313
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0046"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0049"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50822"
FT                   /protein_id="CAZ50822.1"
FT                   /translation="MNDKEFGQRVRQLRESASMTREQFCDDELELSVRQLTRIEAGASK
FT                   PTFSKIQYIATRLGMGLYELMPDYVSLPERYSKLKFDVLRTPTYGNEDLAEKRDAMMTE
FT                   IYDDYYDELPEEEKIAIDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYELNDLLI
FT                   VRLHLEYVRLSSCDSEIFRQFLKIIEHLHEQINIINSNDLFVLRDTLLSCVNILGSKKY
FT                   YEPIPKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDKDRDEAEKHYLDAVLFAKLI
FT                   ENRELEQKIEEDWRVDNQ"
FT   misc_feature    55441..55608
FT                   /locus_tag="SSUSC84_0046"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 7.6e-06"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   repeat_region   56468..57987
FT                   /note="putative IS element, novel IS"
FT   CDS_pept        56718..57881
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0047"
FT                   /product="transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0051"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50823"
FT                   /protein_id="CAZ50823.1"
FT                   /translation="MDVLYQSCAGIDVHQANIVVCILHGPLTSTRPKREMATFDTTTKG
FT                   LRACHDFLSQFHVEAVGMESTGVYWRPVWHALCDDFELILAQPAHMKAIPGQKTDKKDA
FT                   HWIAKLTRIGLLPRSFVPDETIQELRELTRQRKHYVESRNRETNRIHKFLQSGGIKLTT
FT                   YIEDIMGLSGRNLLQLLVDGTPITPRIVHQSVYTSLKKKVPQLLEALDGYFSDHHRFML
FT                   KQSLEIYDFYQKQIELLEERITVYLSQYENHVETLDSIPGIDVITASVIISEVGVDMSQ
FT                   FPTSGHLASWAGLCPGNNESAGKKRSTKIRHGNSYLKKCLCQAAFAARNQKGSTLADRF
FT                   YQIQSRRGSQKATIALAHQLLKIAYILLKEQMTYPEFLAQKRLLGTS"
FT   misc_feature    56991..57218
FT                   /locus_tag="SSUSC84_0047"
FT                   /note="HMMPfam hit to PF01548, Transposase_9, score
FT                   1.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01548"
FT   misc_feature    57480..57740
FT                   /locus_tag="SSUSC84_0047"
FT                   /note="HMMPfam hit to PF02371, Transposase_20, score
FT                   5.9e-24"
FT                   /inference="protein motif:HMMPfam:PF02371"
FT   CDS_pept        complement(58133..58231)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0048"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0052"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50824"
FT                   /protein_id="CAZ50824.1"
FT                   /translation="MVDLFVFYTPNLTITTDANRVRLISNLQQSLL"
FT   repeat_region   complement(58284..59446)
FT                   /note="IS element, novel IS"
FT   repeat_region   58284..58304
FT                   /note="Inverted repeat"
FT   CDS_pept        complement(58419..59357)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0049"
FT                   /product="putative transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0053"
FT                   /note="CDS is possibly truncated in comparison to some
FT                   proteins. Similar to the C-terminal region of Lactococcus
FT                   lactis subsp. lactis (Streptococcus lactis) putative
FT                   transposase UniProt:O34116 (EMBL:U91581) (439 aa) fasta
FT                   scores: E()=6e-31, 37.456% id in 283 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50825"
FT                   /protein_id="CAZ50825.1"
FT                   /translation="MLDQIKAHLLDSINDIVSTANQFLLHPKKDFSRKSQLTRNLDERA
FT                   AFIDMLKTSSFKQALVIMDRGYESYNVMVHCQERNWSYIIRIRVGNHSMKSGFNLPDTP
FT                   CFDEAFDLNICRKQTNEMKQLYRDFPNHYRCLPNHTSFDFLPNSSRKRDPLQFYDLHFR
FT                   MVRLEIKPGFFETLVTNTDYSPEKLKDLYAYRWGIETSFRDLKYSIGLTHFHAKKKEGI
FT                   LQEIYARFINFNVCKWLTSHVTIKTSKLKQTYKICFSDAVYACRKFLREELTSFQLETY
FT                   IAKHLSIIRPNRTFQRKIKSQAPVSFTYRIS"
FT   misc_feature    complement(58653..59339)
FT                   /locus_tag="SSUSC84_0049"
FT                   /note="HMMPfam hit to PF01609, Transposase_11, score
FT                   1.7e-05"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   complement(59426..59446)
FT                   /note="Inverted repeat"
FT   CDS_pept        59497..60717
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0050"
FT                   /product="putative folylpolyglutamate synthase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0054"
FT                   /note="Weakly similar to SSU0136, 35.680% identity (37.789%
FT                   ungapped) in 412 aa overlap (5-402:9-411)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50826"
FT                   /protein_id="CAZ50826.1"
FT                   /translation="MLENWLNTKQGQVFHYKMEKIEYALELLGNPQFAVPVIHVAGTNG
FT                   KGSTIAFMRKLFQAHGMRVGSFVSPHMVSVHDRICIDSQPISDHDFQHYLQKVYDLEQE
FT                   IATRYEPFRYFEVMVLIMFLYFEAQQPDVALVEVGIGGLLDTTNVVAPALSVITSIGMD
FT                   HQDLLGSTLREIAEQKAGIIKESVPVVLGPLSPETTAICRQIAQDNQAPVYQFGQEFTY
FT                   KAGQFSNPDIDLSELVLGLAGHHQEENAAVALQTFLLYMTNIQKDIQPQLIQQALAQTS
FT                   WPGRLELVVQEPKIYLDGAHNVPAIERLLEFIQVQEEPVTILFSALRRKDFQEMLELLE
FT                   EKLPHTPLVLTSFAYDGALAEENRQGRDYVENYQQFIEDWQSSKQGILIVTGSLYFISE
FT                   VRRIFKK"
FT   misc_feature    59608..60267
FT                   /locus_tag="SSUSC84_0050"
FT                   /note="HMMPfam hit to PF08245, Mur_ligase_M, score 0.00013"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    59899..59946
FT                   /locus_tag="SSUSC84_0050"
FT                   /note="ScanRegExp hit to PS01012, FOLYLPOLYGLU_SYNT_2,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS01012"
FT   misc_feature    60340..60597
FT                   /locus_tag="SSUSC84_0050"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        60742..60855
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0051"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0055"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50827"
FT                   /protein_id="CAZ50827.1"
FT                   /translation="MTHAEKVAFLKEFQENKRHTFRQLEQFAKISRTPDRK"
FT   CDS_pept        60908..62431
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0052"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0056"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50828"
FT                   /protein_id="CAZ50828.1"
FT                   /translation="MTELDVVSDVVTHPEETYRRSRRASRRQQVQLNGEFHERVLKTKY
FT                   WPALVWSLVLSVFSVANPLLMPFATNIQTQNLYAGMAMANGQIPYGDFFGTSGLLFYLL
FT                   AFLGHLGGTFIIFGILQFIALLIAGVYFYKIVAYFSQSEHLAISSSHWFYVFIFALGFG
FT                   GMYAEMFALPFLLTSVWFLVRYFENAVRDEAFILYGIDAALVFLIYPKSLILWLVAGLV
FT                   LFIFNIQHRQVTRGIYQLLATIFGFLLILYAVGYYAFEAQILGTAIQQTFLYNLQLDFH
FT                   HSYLYLALAIVSVFLLLSGFFKSFIQMVFSFKQGRHTYIKVLLLLTFLVQCVFIIGNAN
FT                   FQWSQLILLLPYGFAMSVVYLRDEDVEDYSGYLRRQFFLPLAICLGIIAQPVYLYLVQG
FT                   DLRTDREQVANYIDEQTKDSDKIYVWDNSASIYLSSQRLSAATITTAEPYLNTDDNKNS
FT                   LMYDINKNEAKFVVVNKNLPILDEIKTNLESQYQSVQTTDYFTIYQKNE"
FT   misc_feature    join(61046..61114,61175..61243,61256..61324,61361..61456,
FT                   61514..61582,61616..61684,61757..61825,61862..61930,
FT                   62039..62098)
FT                   /locus_tag="SSUSC84_0052"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUSC84_0052 by TMHMM2.0 at aa 47-69, 90-112, 117-139,
FT                   152-183, 203-225, 237-259, 284-306, 319-341 and 378-397"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        62549..64486
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="SSUSC84_0053"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0057"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50829"
FT                   /protein_id="CAZ50829.1"
FT                   /translation="MSHIIELPEILANQIAAGEVIERPASVVKELVENSIDAGASQIEI
FT                   SVEEAGLKMIQITDNGEGIAPDEVALALRRHATSKIKNQSDLFRIRTLGFRGEALPSIA
FT                   SVSHMIIETATADSAHGLHLEAKGGVIEKEEPVSRPVGTQITVSDLFYNTPARLKYVRS
FT                   QQAELSHIVDVVNRLSLAHPEIAFVLVNEGRELIRTAGTGKLRQAISGIYGIASAKKMV
FT                   EIEAEDLDFQISGYVSLPELTRANRNYISIFINGRYIKNFLLNRAILEGYGSKLMVGRF
FT                   PLAVISIEIDPYLADVNVHPTKQEVRISKEKELMTLIREAISQALKEQDLIPDALENLA
FT                   QSSTRPKVKAEQGTLPLREPKIYYDTIKQDFFLKPDVVAEDVKPLEEDRQEIVESPVEN
FT                   RPTSVQFAERQSVESEDQEHPNLSAKELAKLADKLDREETSTFPELEYFGQMHGTYLFA
FT                   QGKTGLYIIDQHAAQERVKYEYYREKIGQVDNSAQQLLVPYIFEFPQNDALDLVHKMDA
FT                   LRQVGVNLEEYGSNQFILREHPIWMKEEEIESGIYEMCDMLLLTDQVSIKQYRAELAIM
FT                   MSCKRSIKANHALDDYSARDLLRQLSYCQNPYNCPHGRPVLVHFSKSDMEKMFRRIQEN
FT                   HTSLRELGKY"
FT   misc_feature    62603..62788
FT                   /gene="mutL"
FT                   /locus_tag="SSUSC84_0053"
FT                   /note="HMMPfam hit to PF02518, HATPase_c, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    62828..62848
FT                   /gene="mutL"
FT                   /locus_tag="SSUSC84_0053"
FT                   /note="ScanRegExp hit to PS00058, DNA_MISMATCH_REPAIR_1,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00058"
FT   misc_feature    63188..63529
FT                   /gene="mutL"
FT                   /locus_tag="SSUSC84_0053"
FT                   /note="HMMPfam hit to PF01119, DNA_mis_repair, score
FT                   9.7e-47"
FT                   /inference="protein motif:HMMPfam:PF01119"
FT   misc_feature    63887..64315
FT                   /gene="mutL"
FT                   /locus_tag="SSUSC84_0053"
FT                   /note="HMMPfam hit to PF08676, MutL_C, score 2.6e-54"
FT                   /inference="protein motif:HMMPfam:PF08676"
FT   CDS_pept        64525..65115
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SSUSC84_0054"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0058"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50830"
FT                   /protein_id="CAZ50830.1"
FT                   /translation="MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVT
FT                   VYTHQVIREDAHLLYGFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQK
FT                   NITYLTKFPKIGKKTAQQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALG
FT                   YRPAELKKIKKFFEGTNDTAENYIKSALKMLMK"
FT   misc_feature    64525..64707
FT                   /gene="ruvA"
FT                   /locus_tag="SSUSC84_0054"
FT                   /note="HMMPfam hit to PF01330, RuvA_N, score 1.3e-29"
FT                   /inference="protein motif:HMMPfam:PF01330"
FT   misc_feature    64972..65109
FT                   /gene="ruvA"
FT                   /locus_tag="SSUSC84_0054"
FT                   /note="HMMPfam hit to PF07499, RuvA_C, score 4.1e-08"
FT                   /inference="protein motif:HMMPfam:PF07499"
FT   CDS_pept        complement(65272..65679)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0055"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0059"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50831"
FT                   /protein_id="CAZ50831.1"
FT                   /translation="MSLRRSHNEISCKISVRPSIFSLSFTPFVSGHDMSHKNRHYFCGE
FT                   LVRYLGKSQIAIAVVGAGKNSTGRKRIRLPAPAQLIRPDLMCGTRTNLPINHCAEMLTQ
FT                   TLSNKTKLFNHHTGTLVEHGYDTLKNCQTES"
FT   CDS_pept        65840..66409
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SSUSC84_0056"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0060"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50832"
FT                   /protein_id="CAZ50832.1"
FT                   /translation="MSRCAWVNPNNPLYIAYHDEEWGKPLHDEQSLFELLCLESYQAGL
FT                   SWEIVLNKRQAFRSAFFNYDIQKVAAMTDSELDSLLTNPDIIRHKAKLYATRANAQAFL
FT                   RVQEEFGTFDTYLWEWVNFTSIDNPVKSFRELPTKNDLSERISKDLKKRGFKFVGPVCI
FT                   YSYLQAAGLLNEHEETCEIGKKLRTN"
FT   misc_feature    65855..66394
FT                   /gene="tag"
FT                   /locus_tag="SSUSC84_0056"
FT                   /note="HMMPfam hit to PF03352, Adenine_glyco, score
FT                   5.6e-93"
FT                   /inference="protein motif:HMMPfam:PF03352"
FT   CDS_pept        66446..67627
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="SSUSC84_0057"
FT                   /product="CinA-like protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0061"
FT                   /note="CDS contains internal deletions relative to
FT                   orthologues, residues 240 to 310"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50833"
FT                   /protein_id="CAZ50833.1"
FT                   /translation="MKAELIAVGTEILTGQIINTNAQFLSEKCAELGIDVYFHTAVGDN
FT                   EGRLLSTLEVASKRSNMVVLCGGLGPTEDDLTKQTLATFLGRNLVFDELAMAKLDRFFA
FT                   SRPGRVRTPNNERQAQIVEGSQALQNPAGLAVGGMIEQDGVTYIVLPGPPSELKAMFSE
FT                   SLLPLLSQSQQQLYSRVLRFFGIGESQLVTVLADVIDKQTDPTLAPYAKVGEVTLRLST
FT                   KATSQEEANLRLNQLEEDILQHDKLADYFYAYGEDNSLVKTVATRLAEKRQTIAIVEQG
FT                   TGGLLQAELSLALADQPYFSGGKVVGQLGIESGWLSEEADCIRQELQADLGLAVSVLIK
FT                   PESTEDNVLAKVYLTLATPSGISQKEIDLGGYSWQYLRQLACLQAWDFVRNTL"
FT   misc_feature    66455..66958
FT                   /gene="cinA"
FT                   /locus_tag="SSUSC84_0057"
FT                   /note="HMMPfam hit to PF00994, MoCF_biosynth, score
FT                   2.6e-51"
FT                   /inference="protein motif:HMMPfam:PF00994"
FT   misc_feature    67214..67624
FT                   /gene="cinA"
FT                   /locus_tag="SSUSC84_0057"
FT                   /note="HMMPfam hit to PF02464, CinA, score 0.00013"
FT                   /inference="protein motif:HMMPfam:PF02464"
FT   CDS_pept        67679..68830
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="SSUSC84_0058"
FT                   /product="RecA recombinase (recombinase A)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0062"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50834"
FT                   /protein_id="CAZ50834.1"
FT                   /translation="MAKKPGKKLEDITKKFGDERKKALDDALKSIEKDFGKGAVMRLGE
FT                   RAEQKVQVMSSGSLSIDIALGAGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKDGGIA
FT                   AFIDAEHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDSVAAL
FT                   VPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTVAIFINQLREKVGVMFGNPET
FT                   TPGGRALKFYASVRMDVRGNTQIKGTGDKKDQNVGKETKVKIVKNKVAPPFKEAVVEIM
FT                   YGEGISRTGELIEIGSNLGIIQKAGAWYSYNGEKIGQGSENAKKFLADNPAIFDEIDRK
FT                   IRVHYGLIEADGVEEVATEEAPVVAEEIQDVILDLDGGIELED"
FT   misc_feature    67742..68719
FT                   /gene="recA"
FT                   /locus_tag="SSUSC84_0058"
FT                   /note="HMMPfam hit to PF00154, RecA, score 1.5e-239"
FT                   /inference="protein motif:HMMPfam:PF00154"
FT   misc_feature    68360..68386
FT                   /gene="recA"
FT                   /locus_tag="SSUSC84_0058"
FT                   /note="ScanRegExp hit to PS00321, RECA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00321"
FT   CDS_pept        69066..69464
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0059"
FT                   /product="regulatory protein Spx"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0063"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50835"
FT                   /protein_id="CAZ50835.1"
FT                   /translation="MIKIYTVSSCTSCKKAKNWLNAHQLSYNEHNLAKEAITKEEILNI
FT                   LTKTENGIASIVSSKNRYAKSLDFDIEELSVNEVIDLITSNPRILKSPILIDEKRLQVG
FT                   YKEDDIRAFLPRAVRNVENAQARMRAAL"
FT   misc_feature    69078..69410
FT                   /locus_tag="SSUSC84_0059"
FT                   /note="HMMPfam hit to PF03960, ArsC, score 3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   CDS_pept        69564..69830
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0064"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50836"
FT                   /protein_id="CAZ50836.1"
FT                   /translation="MGFTEETVRFRLDDTDKQEISKTLTSVYRSLEEKGYNPINQIIGY
FT                   VLSGDPAYIPRYNDARNQIRKHERDEIIEELVRYYLKGNGIDL"
FT   misc_feature    69573..69809
FT                   /locus_tag="SSUSC84_0060"
FT                   /note="HMMPfam hit to PF06135, DUF965, score 1.9e-50"
FT                   /inference="protein motif:HMMPfam:PF06135"
FT   CDS_pept        69830..70249
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0061"
FT                   /product="putative Holliday junction resolvase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0065"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50837"
FT                   /protein_id="CAZ50837.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERL
FT                   TELVEQYKVDKFVVGLPKNMNNTSGPRVEASQAYGDLLTERYKLPVDYQDERLTTVAAE
FT                   RMLIEQADISRGKRKKVIDKLAAQLILQNYLDRTF"
FT   misc_feature    69830..70240
FT                   /locus_tag="SSUSC84_0061"
FT                   /note="HMMPfam hit to PF03652, UPF0081, score 2.2e-50"
FT                   /inference="protein motif:HMMPfam:PF03652"
FT   CDS_pept        70261..70581
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0066"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50838"
FT                   /protein_id="CAZ50838.1"
FT                   /translation="MAHHHDHEHDHNHDERELITLVDDQGNETLFEILLTIDGQEEFGK
FT                   NYVLLIPASAEEDENGEVEIQAYSYIENENGTEGDLQPIPEDATAEWDMIEEVFNSFME
FT                   EE"
FT   misc_feature    70306..70575
FT                   /locus_tag="SSUSC84_0062"
FT                   /note="HMMPfam hit to PF06949, DUF1292, score 2.6e-50"
FT                   /inference="protein motif:HMMPfam:PF06949"
FT   CDS_pept        70789..71367
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0067"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50839"
FT                   /protein_id="CAZ50839.1"
FT                   /translation="MKDSFTERSKKLSEELERCLLADKNILVILDIMDRLNLSDCWLCA
FT                   GTIRNFIWNQYSFDEETDVDLVFFDENISYEETMEIESNLYQNYPAYQWELKNQVYMHI
FT                   HSPNTKPYQSSRDAIEKFPERCTAIGICRTERNKLEIFAPFGLDDIYAYQVRPTPHFLA
FT                   DPNRMELYRQRILKKQWKKRWLSLTVKEI"
FT   misc_feature    70876..71361
FT                   /locus_tag="SSUSC84_0063"
FT                   /note="HMMPfam hit to PF06042, DUF925, score 2.3e-77"
FT                   /inference="protein motif:HMMPfam:PF06042"
FT   CDS_pept        71440..71706
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0064"
FT                   /product="putative competence-specific global transcription
FT                   modulator (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0068"
FT                   /note="Probable gene remnant. Weakly similar to an internal
FT                   region of Streptococcus pneumoniae transcriptional
FT                   regulator ComX2 UniProt:Q97CV2 (EMBL:AE007319) (159 aa)
FT                   fasta scores: E()=0.0002, 35.802% id in 81 aa. Similar to
FT                   an internal region of SSU0016, 68.421% identity (71.233%
FT                   ungapped) in 76 aa overlap (15-87:55-130)"
FT                   /db_xref="PSEUDO:CAZ50840.1"
FT   CDS_pept        72030..72338
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SSUSC84_0065"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0069"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50841"
FT                   /protein_id="CAZ50841.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTE
FT                   RSFYTIIRATHKYKDSREQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   misc_feature    72042..72329
FT                   /gene="rpsJ"
FT                   /locus_tag="SSUSC84_0065"
FT                   /note="HMMPfam hit to PF00338, Ribosomal_S10, score
FT                   1.4e-60"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    72114..72161
FT                   /gene="rpsJ"
FT                   /locus_tag="SSUSC84_0065"
FT                   /note="ScanRegExp hit to PS00361, RIBOSOMAL_S10, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS_pept        72435..73061
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SSUSC84_0066"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0070"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50842"
FT                   /protein_id="CAZ50842.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YAAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGQEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GNRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   misc_feature    72459..73037
FT                   /gene="rplC"
FT                   /locus_tag="SSUSC84_0066"
FT                   /note="HMMPfam hit to PF00297, Ribosomal_L3, score 3.1e-94"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    72732..72803
FT                   /gene="rplC"
FT                   /locus_tag="SSUSC84_0066"
FT                   /note="ScanRegExp hit to PS00474, RIBOSOMAL_L3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS_pept        73086..73709
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SSUSC84_0067"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0071"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50843"
FT                   /protein_id="CAZ50843.1"
FT                   /translation="MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVNSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNIPGVKVATATTASVLDIANADKLLVTQAAISKIEEVLA"
FT   misc_feature    73131..73700
FT                   /gene="rplD"
FT                   /locus_tag="SSUSC84_0067"
FT                   /note="HMMPfam hit to PF00573, Ribosomal_L4, score 5.7e-76"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS_pept        73709..74008
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SSUSC84_0068"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0072"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50844"
FT                   /protein_id="CAZ50844.1"
FT                   /translation="MNLYDVIKKPVITESSMGQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKTKRVGRYVGRTNKVKKAIITLAADSKAIELFATADAE"
FT   misc_feature    73718..73993
FT                   /gene="rplW"
FT                   /locus_tag="SSUSC84_0068"
FT                   /note="HMMPfam hit to PF00276, Ribosomal_L23, score
FT                   2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   misc_feature    73937..73984
FT                   /gene="rplW"
FT                   /locus_tag="SSUSC84_0068"
FT                   /note="ScanRegExp hit to PS00050, RIBOSOMAL_L23, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00050"
FT   CDS_pept        74026..74859
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SSUSC84_0069"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0073"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50845"
FT                   /protein_id="CAZ50845.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDGVEAIVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTVVHNIELKPGRGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK"
FT   misc_feature    74149..74379
FT                   /gene="rplB"
FT                   /locus_tag="SSUSC84_0069"
FT                   /note="HMMPfam hit to PF00181, Ribosomal_L2, score 2.6e-47"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    74395..74784
FT                   /gene="rplB"
FT                   /locus_tag="SSUSC84_0069"
FT                   /note="HMMPfam hit to PF03947, Ribosomal_L2_C, score
FT                   1.3e-86"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    74677..74712
FT                   /gene="rplB"
FT                   /locus_tag="SSUSC84_0069"
FT                   /note="ScanRegExp hit to PS00467, RIBOSOMAL_L2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS_pept        75110..75391
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SSUSC84_0070"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0074"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50846"
FT                   /protein_id="CAZ50846.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   misc_feature    75116..75358
FT                   /gene="rpsS"
FT                   /locus_tag="SSUSC84_0070"
FT                   /note="HMMPfam hit to PF00203, Ribosomal_S19, score
FT                   3.2e-51"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    75266..75340
FT                   /gene="rpsS"
FT                   /locus_tag="SSUSC84_0070"
FT                   /note="ScanRegExp hit to PS00323, RIBOSOMAL_S19, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS_pept        75409..75753
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SSUSC84_0071"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0075"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50847"
FT                   /protein_id="CAZ50847.1"
FT                   /translation="MAEITSAKATARTVRVSPRKSRLVLDNIRGKSVADAIAILKFTPN
FT                   KAAGIIEGVLNSAIANAENNFGLEKANLVVSEAFANEGPTLKRFRPRAKGSASPINKRT
FT                   AHITVVVAEK"
FT   misc_feature    75433..75747
FT                   /gene="rplV"
FT                   /locus_tag="SSUSC84_0071"
FT                   /note="HMMPfam hit to PF00237, Ribosomal_L22, score
FT                   1.3e-59"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    75667..75741
FT                   /gene="rplV"
FT                   /locus_tag="SSUSC84_0071"
FT                   /note="ScanRegExp hit to PS00464, RIBOSOMAL_L22, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS_pept        75766..76419
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SSUSC84_0072"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0076"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50848"
FT                   /protein_id="CAZ50848.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRNFIKKE
FT                   LADASTSTIEIERAVNKVIVSIHTAKPGMVIGKAGSNVDALRAQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGESIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEALTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   misc_feature    75766..75948
FT                   /gene="rpsC"
FT                   /locus_tag="SSUSC84_0072"
FT                   /note="HMMPfam hit to PF00417, Ribosomal_S3_N, score
FT                   3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    75949..76113
FT                   /gene="rpsC"
FT                   /locus_tag="SSUSC84_0072"
FT                   /note="HMMPfam hit to PF07650, KH_2, score 1.4e-22"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    76117..76368
FT                   /gene="rpsC"
FT                   /locus_tag="SSUSC84_0072"
FT                   /note="HMMPfam hit to PF00189, Ribosomal_S3_C, score 1e-50"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    76249..76353
FT                   /gene="rpsC"
FT                   /locus_tag="SSUSC84_0072"
FT                   /note="ScanRegExp hit to PS00548, RIBOSOMAL_S3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS_pept        76423..76836
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SSUSC84_0073"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0077"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50849"
FT                   /protein_id="CAZ50849.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKQVDFGQYGLQATTSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EVAGVSEEIAREAFRLAGHKLPVKVKFVKREAE"
FT   misc_feature    76423..76818
FT                   /gene="rplP"
FT                   /locus_tag="SSUSC84_0073"
FT                   /note="HMMPfam hit to PF00252, Ribosomal_L16, score
FT                   2.6e-80"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    76597..76632
FT                   /gene="rplP"
FT                   /locus_tag="SSUSC84_0073"
FT                   /note="ScanRegExp hit to PS00586, RIBOSOMAL_L16_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    76666..76701
FT                   /gene="rplP"
FT                   /locus_tag="SSUSC84_0073"
FT                   /note="ScanRegExp hit to PS00701, RIBOSOMAL_L16_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS_pept        76846..77052
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SSUSC84_0074"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0078"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50850"
FT                   /protein_id="CAZ50850.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFELRFQAAAGQLE
FT                   QTARLNEVKKQIARIKTVQSETK"
FT   misc_feature    76873..77046
FT                   /gene="rpmC"
FT                   /locus_tag="SSUSC84_0074"
FT                   /note="HMMPfam hit to PF00831, Ribosomal_L29, score
FT                   1.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   misc_feature    76981..77025
FT                   /gene="rpmC"
FT                   /locus_tag="SSUSC84_0074"
FT                   /note="ScanRegExp hit to PS00579, RIBOSOMAL_L29, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00579"
FT   CDS_pept        77076..77336
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SSUSC84_0075"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0079"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50851"
FT                   /protein_id="CAZ50851.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   misc_feature    77106..77312
FT                   /gene="rpsQ"
FT                   /locus_tag="SSUSC84_0075"
FT                   /note="HMMPfam hit to PF00366, Ribosomal_S17, score
FT                   6.2e-37"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   misc_feature    77244..77282
FT                   /gene="rpsQ"
FT                   /locus_tag="SSUSC84_0075"
FT                   /note="ScanRegExp hit to PS00056, RIBOSOMAL_S17, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS_pept        77361..77729
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SSUSC84_0076"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0080"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50852"
FT                   /protein_id="CAZ50852.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDIIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRADGSYIKFDENAAVIIREDKNPRGTRIFGPVAR
FT                   ELRDGGFMKIVSLAPEVL"
FT   misc_feature    77361..77726
FT                   /gene="rplN"
FT                   /locus_tag="SSUSC84_0076"
FT                   /note="HMMPfam hit to PF00238, Ribosomal_L14, score 7e-77"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   misc_feature    77538..77618
FT                   /gene="rplN"
FT                   /locus_tag="SSUSC84_0076"
FT                   /note="ScanRegExp hit to PS00049, RIBOSOMAL_L14, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS_pept        77868..78173
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SSUSC84_0077"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0081"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50853"
FT                   /protein_id="CAZ50853.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGVEAVVVTALPKVNKVIVEGVNIVKKHQ
FT                   KSNSENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   misc_feature    77874..77975
FT                   /gene="rplX"
FT                   /locus_tag="SSUSC84_0077"
FT                   /note="HMMPfam hit to PF00467, KOW, score 5.5e-08"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    77883..77936
FT                   /gene="rplX"
FT                   /locus_tag="SSUSC84_0077"
FT                   /note="ScanRegExp hit to PS01108, RIBOSOMAL_L24, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS_pept        78197..78739
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SSUSC84_0078"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0082"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50854"
FT                   /protein_id="CAZ50854.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGDAV
FT                   SNAKNLEKAAQELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VTVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGMDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   misc_feature    78269..78439
FT                   /gene="rplE"
FT                   /locus_tag="SSUSC84_0078"
FT                   /note="HMMPfam hit to PF00281, Ribosomal_L5, score 7.5e-30"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    78368..78418
FT                   /gene="rplE"
FT                   /locus_tag="SSUSC84_0078"
FT                   /note="ScanRegExp hit to PS00358, RIBOSOMAL_L5, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    78449..78733
FT                   /gene="rplE"
FT                   /locus_tag="SSUSC84_0078"
FT                   /note="HMMPfam hit to PF00673, Ribosomal_L5_C, score
FT                   2.1e-52"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS_pept        78754..78939
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SSUSC84_0079"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0083"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50855"
FT                   /protein_id="CAZ50855.1"
FT                   /translation="MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   DLAYLGQIPGVTKASW"
FT   misc_feature    78766..78933
FT                   /gene="rpsN"
FT                   /locus_tag="SSUSC84_0079"
FT                   /note="HMMPfam hit to PF00253, Ribosomal_S14, score
FT                   3.6e-18"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   misc_feature    78820..78888
FT                   /gene="rpsN"
FT                   /locus_tag="SSUSC84_0079"
FT                   /note="ScanRegExp hit to PS00527, RIBOSOMAL_S14, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00527"
FT   CDS_pept        79070..79240
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0080"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0084"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50856"
FT                   /protein_id="CAZ50856.1"
FT                   /translation="MTDKVKIGTLAKNACVLDRVIFFTQAVARVQMLGCNSIILANSNF
FT                   ALPIRHTLTSK"
FT   CDS_pept        79276..79674
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SSUSC84_0081"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0085"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50857"
FT                   /protein_id="CAZ50857.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIATILKNEGF
FT                   VKNVEFIEDDKQGIIRVFLKYGPNGEKVITNLKRVSKPGLRVYSKREDIPKVLNGLGIA
FT                   IISTSEGLLTDKQARQKNVGGEVIAYVW"
FT   misc_feature    79288..79671
FT                   /gene="rpsH"
FT                   /locus_tag="SSUSC84_0081"
FT                   /note="HMMPfam hit to PF00410, Ribosomal_S8, score 5.8e-75"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    79579..79632
FT                   /gene="rpsH"
FT                   /locus_tag="SSUSC84_0081"
FT                   /note="ScanRegExp hit to PS00053, RIBOSOMAL_S8, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00053"
FT   CDS_pept        79818..79958
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0082"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0086"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50858"
FT                   /protein_id="CAZ50858.1"
FT                   /translation="MFKSDLLIIWYHATKLEQDSLIEHAYNSLKKVKSVSEILTLFVVN
FT                   V"
FT   CDS_pept        80006..80053
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0083"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0087"
FT                   /note="Possible gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pyogenes (serotype M3) pure
FT                   putative phosphoribosylaminoimidazole carboxylase I
FT                   UniProt:Q8K8Y3 (EMBL:AE014136) (203 aa) fasta scores:
FT                   E()=0.041, 81.250% id in 16 aa"
FT   CDS_pept        80140..80676
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SSUSC84_0084"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0088"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50860"
FT                   /protein_id="CAZ50860.1"
FT                   /translation="MSRIGNKVITLPAGVELAQNNGVVTVKGPKGELTREFPTAIEIRV
FT                   EGAEVTLHRPNDSKEMKTIHGTSRANLNNMVVGVSEGFKKELEMRGVGYRAQLAGNKLT
FT                   LAVGKSHPDEVVAPEGITFEVPTPTQIVVSGINKEVVGQTAAYIRSLRAPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   misc_feature    80170..80385
FT                   /gene="rplF"
FT                   /locus_tag="SSUSC84_0084"
FT                   /note="HMMPfam hit to PF00347, Ribosomal_L6, score 8.3e-24"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80407..80634
FT                   /gene="rplF"
FT                   /locus_tag="SSUSC84_0084"
FT                   /note="HMMPfam hit to PF00347, Ribosomal_L6, score 1.8e-29"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80599..80625
FT                   /gene="rplF"
FT                   /locus_tag="SSUSC84_0084"
FT                   /note="ScanRegExp hit to PS00525, RIBOSOMAL_L6_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS_pept        80765..81121
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SSUSC84_0085"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0089"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50861"
FT                   /protein_id="CAZ50861.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKISGTAARPRLNIFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALAESARENGLKF"
FT   misc_feature    80780..81118
FT                   /gene="rplR"
FT                   /locus_tag="SSUSC84_0085"
FT                   /note="HMMPfam hit to PF00861, Ribosomal_L18p, score
FT                   1.3e-54"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS_pept        81140..81634
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SSUSC84_0086"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0090"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50863"
FT                   /protein_id="CAZ50863.1"
FT                   /translation="MAFKDNAVEIEERVVAINRVTKVVKGGRRLRFAALVVVGDRNGRV
FT                   GFGTGKAQEVPEAIRKAVESAKKNMIEVPMVGTTIPHEVRSEFGGARVLLKPASEGSGV
FT                   AAGGATRAVIELAGIADVTSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   misc_feature    81164..81364
FT                   /gene="rpsE"
FT                   /locus_tag="SSUSC84_0086"
FT                   /note="HMMPfam hit to PF00333, Ribosomal_S5, score 1.2e-40"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    81218..81316
FT                   /gene="rpsE"
FT                   /locus_tag="SSUSC84_0086"
FT                   /note="ScanRegExp hit to PS00585, RIBOSOMAL_S5, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    81389..81610
FT                   /gene="rpsE"
FT                   /locus_tag="SSUSC84_0086"
FT                   /note="HMMPfam hit to PF03719, Ribosomal_S5_C, score
FT                   4.3e-34"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS_pept        81649..81831
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SSUSC84_0087"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0091"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50864"
FT                   /protein_id="CAZ50864.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNPAILG
FT                   MVNAISHLVTVEEVK"
FT   misc_feature    81652..81810
FT                   /gene="rpmD"
FT                   /locus_tag="SSUSC84_0087"
FT                   /note="HMMPfam hit to PF00327, Ribosomal_L30, score
FT                   5.9e-16"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   misc_feature    81712..81810
FT                   /gene="rpmD"
FT                   /locus_tag="SSUSC84_0087"
FT                   /note="ScanRegExp hit to PS00634, RIBOSOMAL_L30, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00634"
FT   CDS_pept        81967..82407
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SSUSC84_0088"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0092"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50865"
FT                   /protein_id="CAZ50865.1"
FT                   /translation="MKLHELQPATGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRPGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNAFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITSKGGSVEVI"
FT   misc_feature    81967..82272
FT                   /gene="rplO"
FT                   /locus_tag="SSUSC84_0088"
FT                   /note="HMMPfam hit to PF01305, Ribosomal_L15, score
FT                   6.1e-61"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    82294..82389
FT                   /gene="rplO"
FT                   /locus_tag="SSUSC84_0088"
FT                   /note="HMMPfam hit to PF00256, L15, score 3e-11"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    82294..82386
FT                   /gene="rplO"
FT                   /locus_tag="SSUSC84_0088"
FT                   /note="ScanRegExp hit to PS00475, RIBOSOMAL_L15, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS_pept        82421..83731
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SSUSC84_0089"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0093"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50866"
FT                   /protein_id="CAZ50866.1"
FT                   /translation="MFFKLLKDALKVKLVRSKILFTIFILFVFRVGTHITVPGVNAKSL
FT                   EALSNLPFLNMLSLVSGNAMRNFSVFALGVSPYITASIIVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFVQSIGITAGFNALSGAKLTNMPLNWQTYLLIGAILTTGSI
FT                   IVTWLGEQISEKGYGNGTSMIIFAGIISSLPGTFHEIYIDRFVNIESSRLGESAIFVAA
FT                   LVVLIFFVVYFTTFVQQAEYKLPIQYTKRAQGAPSSSYLPLKLNPAGVIPVIFAGSITA
FT                   VPTSLIQYFASQNKSAGWLLTVQEYFDYSTAKGMIVYAGLIIAFTFFYTFVQVNPEKTA
FT                   ESLQKSAAYIHGVRPGNGTEQFLSKLLTRLAVIGALFLSFVALLPILAQNLFGLSSSIA
FT                   FLGTSLIIVISTSIEGIKQLEGYLLKRKYVGFLEITE"
FT   sig_peptide     82421..82546
FT                   /gene="secY"
FT                   /locus_tag="SSUSC84_0089"
FT                   /note="Signal peptide predicted for SSUSC84_0089 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.948) with cleavage
FT                   site probability 0.919 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(82478..82546,82616..82684,82766..82834,82862..82927,
FT                   82946..83014,83072..83131,83225..83293,83363..83416,
FT                   83516..83584,83612..83668)
FT                   /gene="secY"
FT                   /locus_tag="SSUSC84_0089"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUSC84_0089 by TMHMM2.0 at aa 20-42, 66-88, 116-138,
FT                   148-169, 176-198, 218-237, 269-291, 315-332, 366-388 and
FT                   398-416"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    82625..83674
FT                   /gene="secY"
FT                   /locus_tag="SSUSC84_0089"
FT                   /note="HMMPfam hit to PF00344, SecY, score 5.8e-152"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    82625..82684
FT                   /gene="secY"
FT                   /locus_tag="SSUSC84_0089"
FT                   /note="ScanRegExp hit to PS00755, SECY_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00755"
FT   CDS_pept        83825..84466
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SSUSC84_0090"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0094"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50867"
FT                   /protein_id="CAZ50867.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEKFNVAHISTGDMFRAAMANQTEM
FT                   GILAKSYIDKGDLVPDEVTNGIVKERLVQDDIKEKGFLLDGYPRTIEQAHALDENLADL
FT                   GIELQGVINIEIDPSKLVERLSGRIIHKETGETFHKVFNPPVGDYKEEDFYQREDDKPE
FT                   SVKRRLEVNIAQGQPIIDHYRAKGLVHDIEGDQDIDLVFQAIDTVLSKLQ"
FT   misc_feature    83837..84388
FT                   /gene="adk"
FT                   /locus_tag="SSUSC84_0090"
FT                   /note="HMMPfam hit to PF00406, ADK, score 1.1e-89"
FT                   /inference="protein motif:HMMPfam:PF00406"
FT   misc_feature    84068..84103
FT                   /gene="adk"
FT                   /locus_tag="SSUSC84_0090"
FT                   /note="ScanRegExp hit to PS00113, ADENYLATE_KINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00113"
FT   misc_feature    84206..84259
FT                   /gene="adk"
FT                   /locus_tag="SSUSC84_0090"
FT                   /note="HMMPfam hit to PF05191, ADK_lid, score 0.0003"
FT                   /inference="protein motif:HMMPfam:PF05191"
FT   CDS_pept        84588..84806
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SSUSC84_0091"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0095"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50868"
FT                   /protein_id="CAZ50868.1"
FT                   /translation="MAKEDVIEIEGKVVDTMPNAMFTVELENGHQVLATVSGKIRKNYI
FT                   RILVGDRVTVELSPYDLTRGRITYRFK"
FT   misc_feature    84600..84797
FT                   /gene="infA"
FT                   /locus_tag="SSUSC84_0091"
FT                   /note="HMMPfam hit to PF01176, eIF-1a, score 1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01176"
FT   CDS_pept        84831..84947
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SSUSC84_0092"
FT                   /product="50S ribosomal protein L36"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0096"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50869"
FT                   /protein_id="CAZ50869.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   misc_feature    84831..84944
FT                   /gene="rpmJ"
FT                   /locus_tag="SSUSC84_0092"
FT                   /note="HMMPfam hit to PF00444, Ribosomal_L36, score
FT                   3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00444"
FT   misc_feature    84861..84941
FT                   /gene="rpmJ"
FT                   /locus_tag="SSUSC84_0092"
FT                   /note="ScanRegExp hit to PS00828, RIBOSOMAL_L36, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS_pept        84967..85332
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SSUSC84_0093"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0097"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50870"
FT                   /protein_id="CAZ50870.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   misc_feature    84973..85290
FT                   /gene="rpsM"
FT                   /locus_tag="SSUSC84_0093"
FT                   /note="HMMPfam hit to PF00416, Ribosomal_S13, score
FT                   4.2e-55"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    85225..85266
FT                   /gene="rpsM"
FT                   /locus_tag="SSUSC84_0093"
FT                   /note="ScanRegExp hit to PS00646, RIBOSOMAL_S13_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS_pept        85350..85733
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SSUSC84_0094"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0098"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50871"
FT                   /protein_id="CAZ50871.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   misc_feature    85398..85727
FT                   /gene="rpsK"
FT                   /locus_tag="SSUSC84_0094"
FT                   /note="HMMPfam hit to PF00411, Ribosomal_S11, score
FT                   5.4e-72"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   misc_feature    85632..85700
FT                   /gene="rpsK"
FT                   /locus_tag="SSUSC84_0094"
FT                   /note="ScanRegExp hit to PS00054, RIBOSOMAL_S11, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS_pept        85778..86716
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SSUSC84_0095"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0099"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50872"
FT                   /protein_id="CAZ50872.1"
FT                   /translation="MIEFEKPTITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSIKIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKKIELDVVGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIADGATFKAVLTVNSGRGYVPAEDNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTLEINTNGTIIPEDALGLSARILMEHLGLF
FT                   TDLTEVAKSAEVMKEAEVASDDRMLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKTEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKKDK"
FT   misc_feature    85817..86449
FT                   /gene="rpoA"
FT                   /locus_tag="SSUSC84_0095"
FT                   /note="HMMPfam hit to PF01193, RNA_pol_L, score 3.3e-26"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    85937..86284
FT                   /gene="rpoA"
FT                   /locus_tag="SSUSC84_0095"
FT                   /note="HMMPfam hit to PF01000, RNA_pol_A_bac, score
FT                   1.1e-56"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    86483..86686
FT                   /gene="rpoA"
FT                   /locus_tag="SSUSC84_0095"
FT                   /note="HMMPfam hit to PF03118, RNA_pol_A_CTD, score 2e-30"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS_pept        86731..87117
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SSUSC84_0096"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0100"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50873"
FT                   /protein_id="CAZ50873.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSATALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   misc_feature    86776..87114
FT                   /gene="rplQ"
FT                   /locus_tag="SSUSC84_0096"
FT                   /note="HMMPfam hit to PF01196, Ribosomal_L17, score
FT                   3.2e-62"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    86818..86886
FT                   /gene="rplQ"
FT                   /locus_tag="SSUSC84_0096"
FT                   /note="ScanRegExp hit to PS01167, RIBOSOMAL_L17, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01167"
FT   rRNA            87768..89311
FT                   /locus_tag="SSUSC84_r0004"
FT                   /note="16S rRNA"
FT   tRNA            89363..89435
FT                   /locus_tag="SSUSC84_t0018"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:89396..89398,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            89715..92619
FT                   /locus_tag="SSUSC84_r0005"
FT                   /note="23S rRNA"
FT   rRNA            92697..92823
FT                   /locus_tag="SSUSC84_r0006"
FT                   /note="5S rRNA"
FT   tRNA            92826..92898
FT                   /locus_tag="SSUSC84_t0019"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:92859..92861,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            92904..92974
FT                   /locus_tag="SSUSC84_t0020"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:92936..92938,aa:Gly)"
FT                   /note="tRNA Gly anticodon TCC, Cove score 69.41"
FT   tRNA            93005..93078
FT                   /locus_tag="SSUSC84_t0021"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:93039..93041,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.63"
FT   tRNA            93085..93156
FT                   /locus_tag="SSUSC84_t0022"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:93118..93120,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   tRNA            93165..93254
FT                   /locus_tag="SSUSC84_t0023"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:93201..93203,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            93264..93337
FT                   /locus_tag="SSUSC84_t0024"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:93298..93300,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            93353..93425
FT                   /locus_tag="SSUSC84_t0025"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:93386..93388,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            93446..93526
FT                   /locus_tag="SSUSC84_t0026"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:93480..93482,aa:Tyr)"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 55.83"
FT   tRNA            93534..93604
FT                   /locus_tag="SSUSC84_t0027"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:93566..93568,aa:Trp)"
FT                   /note="tRNA Trp anticodon CCA, Cove score 50.14"
FT   tRNA            93612..93684
FT                   /locus_tag="SSUSC84_t0028"
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:93645..93647,aa:His)"
FT                   /note="tRNA His anticodon GTG, Cove score 60.96"
FT   tRNA            93696..93767
FT                   /locus_tag="SSUSC84_t0029"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:93728..93730,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 49.54"
FT   tRNA            93779..93862
FT                   /locus_tag="SSUSC84_t0030"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:93813..93815,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAA, Cove score 62.17"
FT   repeat_region   93810..93898
FT                   /note="Direct repeat region flanking genomic island"
FT   misc_feature    93899..99890
FT                   /note="Putative genomic island"
FT   CDS_pept        complement(93949..95082)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0097"
FT                   /product="putative integrase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0101"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50874"
FT                   /protein_id="CAZ50874.1"
FT                   /translation="MTVKKAKNGTWTVDISDGFHPVTKKRIRIIRKGFKTKKEALELEQ
FT                   YIRVVELKEKRFDFLVTTDMLFDILEEEDRQNNRKISYISTQRNNYERHIKPYFINTNL
FT                   NKLSYEHIFEFREYLKIKPKKQNDSSTLSHNTVNKIMILLKKIFDTGVRKSLIDKNPVE
FT                   NIRKLPISKPTINFWNVEEFNEFRKLITSDEISYDLFFTIAFFTGMRLGEIVALTWYDI
FT                   NLITNSIHITKTAYFVNGTNHINSTKTRAGTRRITINHKLARMLADWKEKQKDLLKEFT
FT                   TDTENLQVIQSTPLPMTKNMIDKKFKQILARNDYLKKIRIHDLRHSHASLLINQGEDYL
FT                   VVKERLGHASITTTIDTYSHLYPSKQKTLANKLDDIF"
FT   misc_feature    complement(93979..94536)
FT                   /locus_tag="SSUSC84_0097"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(95072..95278)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0102"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50875"
FT                   /protein_id="CAZ50875.1"
FT                   /translation="MIATVNKNDLVALGFSEGTSKRIIRQGKELLIARGFRVYQNKRVG
FT                   TIPASIATELLGFDVSLGAHHDS"
FT   CDS_pept        complement(95339..96355)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0099"
FT                   /product="replication initiation factor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0103"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50876"
FT                   /protein_id="CAZ50876.1"
FT                   /translation="MNTVRIDYFAVTVKNIPPESVLTDILLIPLEDFTLNNWGINKYQR
FT                   HYACSEIKVYFNEDRPSMGVFIELKGQGCRQYEEFLDGNENNWIALIGRLYQYSVNFTR
FT                   LDIAHDIFDGSLDVQRVYDYCKKGLCISKAKHFEYHEKSVLENGERVGETVAIGSRGNQ
FT                   QWCIYNKRMEQLSKQELVEYPSWIRAELRCWQDKANIIAEQLFLKRPLSSIYFEAINGH
FT                   YRFVKPNATDTNRWRRKKVKWWLDYLKTENQTVLSVERTKPTLRQSEAWTEKQVAKTLA
FT                   KVYTAKYQAYDVQKAEDYIQGLLKEGLSRLTDNDEKDIEQYIREQNSSPLWGQKKTT"
FT   misc_feature    complement(95387..96058)
FT                   /locus_tag="SSUSC84_0099"
FT                   /note="HMMPfam hit to PF02486, Rep_trans, score 4.4e-11"
FT                   /inference="protein motif:HMMPfam:PF02486"
FT   CDS_pept        complement(96360..96779)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0104"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50877"
FT                   /protein_id="CAZ50877.1"
FT                   /translation="MTYNMTDTTLKIGQLDLDMTQFEVPKKIVILSAKVNNRYNEVNGE
FT                   KIKTEEVTKITCTALDADKVKVLTEMGISTDDLKAINLEIVGNVDKVATLAQNESLLNV
FT                   PIELVKPKVRLAWNMARSNWAGVKLVCEDIKILGA"
FT   CDS_pept        complement(97115..98437)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0101"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0106"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50878"
FT                   /protein_id="CAZ50878.1"
FT                   /translation="MRFNPYIITSKRLFLSRVGMDLFLGMLLINTWVSPYSIPIKSVLS
FT                   LIFIGIICSIEKFFKSVFISKIQNILYVRESLFDMLIGLNLYEESDNVVTNSATLNFEI
FT                   LPNDIVMVEVPLFGNKFLKLLKNLEEYLVPTLGLPLLSKYEFPDHVIYKLGKIEEIEQY
FT                   IFNSQTLTRDFFEDIPTPIVKLSNTQQFSLKQNTNLGVYGRTGTGKTIALQWYLFNALA
FT                   KGCGIDTYLAIVDGKGADLYALGALLQEELGKQISVGSSPTSLAKLSRQFVKIMDERFE
FT                   VIKQNSSLNADAYDLGMTPNFLFIDELASIRDSCGSSKQGKELWNEILQNLGLIARKGR
FT                   QAGCHLCLSTQDPNAENIPVELRNQISAVLYLGNIGDDRLKMAFSMCELENVPTISDRK
FT                   GEALFYADGLNSVEPVLTIVPFVDVKTKQDFLQVVRNILPN"
FT   misc_feature    complement(97148..97183)
FT                   /locus_tag="SSUSC84_0101"
FT                   /note="ScanRegExp hit to PS00327, BACTERIAL_OPSIN_RET,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00327"
FT   misc_feature    complement(97373..97963)
FT                   /locus_tag="SSUSC84_0101"
FT                   /note="HMMPfam hit to PF01580, FtsK_SpoIIIE, score 3.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01580"
FT   misc_feature    complement(98333..98401)
FT                   /locus_tag="SSUSC84_0101"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0101 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98427..98663)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0102"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0107"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50879"
FT                   /protein_id="CAZ50879.1"
FT                   /translation="MKIYKFMFNITYPALVISLYIIFQMKGTMSPWFDTLFVAGGFLVI
FT                   PLLLLLLGYLSENDHGGTDNEANQAESCSTSEV"
FT   misc_feature    complement(join(98499..98567,98595..98651))
FT                   /locus_tag="SSUSC84_0102"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0102 by TMHMM2.0 at aa 5-23 and 33-55"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98718..99038)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0103"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0108"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50880"
FT                   /protein_id="CAZ50880.1"
FT                   /translation="MKTFKDIFLSEGMEMPNINGIKRVQSFNSDKSVNFTLDDESRDFL
FT                   KENLPIEGVIYEPTLKKLAENIIILNRQKHRISDEFRISLMNKEIYQGYRETSFYTSII
FT                   EA"
FT   CDS_pept        complement(99217..99738)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0104"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0109"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50881"
FT                   /protein_id="CAZ50881.1"
FT                   /translation="MCISNTTKLIIGVKMRSHLGVRLSYEAKYWLESIQAVIQEKLDAK
FT                   INEQDIENLEHATKSYLKEVDNELGATSVTLILKASASSVLEEAFEKTKSLSLKDWHKL
FT                   DNEMKHSISSIPKDKDVGTLSVRFFLENSIITSLESYQKEFMTSEMVRQVRLSYVLKLV
FT                   IFAYYKEIMQ"
FT   repeat_region   99882..99970
FT                   /note="Direct repeat flanking genomic island, partial tRNA"
FT   CDS_pept        100066..100848
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0110"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50882"
FT                   /protein_id="CAZ50882.1"
FT                   /translation="MKTLYHYTTVETLLLILNYKTLRFKSLLYVDDPLEPSTSDFGNLG
FT                   GFKYVSCWTDTPNSIPQWTMYSDNMTGVCIGISFDKETDVFLTEKFSLSESSEPIDMVN
FT                   ALHPLKSGLLVTNNKYVPSLEQIRYTDDVSLITPRVVSSDDKSTTINLASNGIYKTTDW
FT                   SFQNEQRFSFQIFPLPIDLVLELMNANKGDLTEIINSFISVKPKEYFDLDLNPTIFSNM
FT                   TITFGKRCSAEDKLKVSKFLEDNKFHIPLFDSTVNIKP"
FT   CDS_pept        complement(join(100845..101183,101214..101360,
FT                   101364..101486))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0106"
FT                   /product="putative integrase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0111"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus mutans tyrosine recombinase XerC
FT                   UniProt:O69155 (EMBL:AE014942) (356 aa) fasta scores:
FT                   E()=0.00011, 27.717% id in 184 aa"
FT                   /db_xref="PSEUDO:CAZ50883.1"
FT   misc_feature    complement(join(100875..101183,101214..101360,
FT                   101364..101441))
FT                   /locus_tag="SSUSC84_0106"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   5.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        101569..102012
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0107"
FT                   /product="MarR-family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0112"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50884"
FT                   /protein_id="CAZ50884.1"
FT                   /translation="MNRIALEIEKYLHEIVLSSENQLEILVGSCQSTVKLTNTQEHILM
FT                   LIEKAAYTNTEIAKELNVSQAAITKATKSLVAQGLLVAVRDDKDARIVRFSLTEAAKPI
FT                   AAEHAHHHAHTLEAYEELLENYSLEEQESIARFLSELVEKIRK"
FT   misc_feature    101674..101880
FT                   /locus_tag="SSUSC84_0107"
FT                   /note="HMMPfam hit to PF01047, MarR, score 1.5e-13"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    101722..101787
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1850.000, SD 5.49 at aa 54-75, sequence
FT                   YTNTEIAKELNVSQAAITKATK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        102013..102717
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0108"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0113"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50885"
FT                   /protein_id="CAZ50885.1"
FT                   /translation="MRYITVEDLSFYYDKEPVLEHIHYYLDSGEFVTLTGENGAAKTTL
FT                   IKATLGILKPKQGKVSIAEKSIKGKKLRMAYLPQQIASFNAGFPSTVYEFVKSGRYPRQ
FT                   GWFRRLTAHDEEHVRISLESVGMWEHRDKRLGALSGGQKQRAVIARMFASDPDIFILDE
FT                   PTTGMDAGTKDAFYQLMHHSAKKHGKSVLMITHDPDELNKYADRNIHLVRDQQSPWRCF
FT                   NVHEADEEVAHV"
FT   misc_feature    102097..102657
FT                   /locus_tag="SSUSC84_0108"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 3.7e-45"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    102424..102468
FT                   /locus_tag="SSUSC84_0108"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        102710..103522
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0109"
FT                   /product="ABC transporter permease protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0114"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50886"
FT                   /protein_id="CAZ50886.1"
FT                   /translation="MFDLSVFHYDFMQRAFLAIIAMSLFSPILGVFLILRRQSLMSDTL
FT                   SHVSLAGVAFGLVLGISPTLSTVLVVIVAAVFLEYLRTIYKNFMEIGTAILMSTGLAIS
FT                   LIVMNKSGGKSGLSLEQYLFGSIVTISQEQVIALFTIAVIVIVLTLLFLRPMYILTFDE
FT                   DTAFVDGLPVRAMSIAFNVVTGVAIALMIPAAGALLVSTIMVLPASIALRLGKSFKAVI
FT                   FTGMGIGFFGMVMGLLTSYYAETPASASITLIFISIFLLVNVVQKFKK"
FT   misc_feature    102731..103507
FT                   /locus_tag="SSUSC84_0109"
FT                   /note="HMMPfam hit to PF00950, ABC-3, score 2.3e-102"
FT                   /inference="protein motif:HMMPfam:PF00950"
FT   misc_feature    join(102752..102814,102875..102943,102971..103030,
FT                   103115..103183,103241..103309,103370..103438,
FT                   103451..103504)
FT                   /locus_tag="SSUSC84_0109"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUSC84_0109 by TMHMM2.0 at aa 15-35, 56-78, 88-107,
FT                   136-158, 178-200, 221-243 and 248-265"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        103532..105043
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="SSUSC84_0110"
FT                   /product="zinc-binding protein AdcA precursor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0115"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50887"
FT                   /protein_id="CAZ50887.1"
FT                   /translation="MKKVGLLFLSVSALLLGACGNSTASEDGKLNIVTTFYPVYEFTKQ
FT                   VAGDEANVDLLVKAGTEVHGYEPSAKDIARIQEADAFVYENENMETWVHDVEKSLDTTK
FT                   VNVISATEGMLLLPGGEEEHEGHDHSEEGHSHAYDPHVWLSPERAITLVENIRDSLVAK
FT                   YPEKKDAFETNAAAYIEKLDALDAKYSETLSAAKQKYFVTQHTAFAYLALDYGLKQVSI
FT                   TGVAADEDPTPSRLAELTEYINKYGIKYIYFEENASKSVAETLAKETGVQLDVLNPLES
FT                   LTDEDMKNGKDYISVMEDNLIALEKTTSQEGSEILPEEGAETAQTVYNGYFEDSAVKDR
FT                   TLSDYAGEWQSVYPYLLDGTLDQVWDYKAKIKGGMTAEEYKTYYDTGYKTDVDQINITD
FT                   NTMEFVVGDKKEKFTYKYVGYKILTYKKGNRGVRFLFEATDANAGNYKYVQFSDHNIAP
FT                   VKTGHFHIYFGGESQEKLLEELENWPTYYPVGLTGLEIGQEMLAH"
FT   sig_peptide     103532..103603
FT                   /gene="adcA"
FT                   /locus_tag="SSUSC84_0110"
FT                   /note="Signal peptide predicted for SSUSC84_0110 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.459 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    103553..104458
FT                   /gene="adcA"
FT                   /locus_tag="SSUSC84_0110"
FT                   /note="HMMPfam hit to PF01297, SBP_bac_9, score 9.6e-101"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   misc_feature    104495..105040
FT                   /gene="adcA"
FT                   /locus_tag="SSUSC84_0110"
FT                   /note="HMMPfam hit to PF09223, YodA, score 2e-136"
FT                   /inference="protein motif:HMMPfam:PF09223"
FT   CDS_pept        105128..105616
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="SSUSC84_0111"
FT                   /product="putative negative regulator of copper transport
FT                   operon"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0116"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50888"
FT                   /protein_id="CAZ50888.1"
FT                   /translation="MLGGECVEQTISAAEWQVMRVLWAHPGATSQEIIQALQEGFDWQA
FT                   TTIKTLLGRLRKKNYLRMAKETSKYHYYPLISEEEHLQGQVELLLAAICSTKQGQLVEK
FT                   LLDTGTFSKKSLENLASKISQLQRTAPEQIACRCLAGQCTCGHHHTLRKSTSDVVDLT"
FT   misc_feature    105158..105502
FT                   /gene="copY"
FT                   /locus_tag="SSUSC84_0111"
FT                   /note="HMMPfam hit to PF03965, Pencillinase_R, score 5e-36"
FT                   /inference="protein motif:HMMPfam:PF03965"
FT   CDS_pept        105633..105800
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0112"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0117"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50889"
FT                   /protein_id="CAZ50889.1"
FT                   /translation="MELYSLLPENAKVVGFYLLLEKRRRSLYFQPSKVPRTFEASLNLI
FT                   FIEYKKGERT"
FT   CDS_pept        105797..106006
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="SSUSC84_0113"
FT                   /product="putative copper chaperone CopZ"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0118"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50890"
FT                   /protein_id="CAZ50890.1"
FT                   /translation="MKQTLKLKNLSCQNCVKHVTNHLLDLDGVEEVKIQLEEQLAEVAT
FT                   SVAYDLERYQEVLEDTIYEVEELV"
FT   misc_feature    105806..105997
FT                   /gene="copZ"
FT                   /locus_tag="SSUSC84_0113"
FT                   /note="HMMPfam hit to PF00403, HMA, score 4.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    105815..105904
FT                   /gene="copZ"
FT                   /locus_tag="SSUSC84_0113"
FT                   /note="ScanRegExp hit to PS01047, HMA_1, score NA"
FT                   /inference="protein motif:Prosite:PS01047"
FT   CDS_pept        complement(106034..106411)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0114"
FT                   /product="putative histidine triad (HIT) protein"
FT                   /EC_number="3.6.1.17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0119"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50891"
FT                   /protein_id="CAZ50891.1"
FT                   /translation="MTCIFCHQIEEIDILYQTEYFKVVWDIDPIQTGHLLIISKDHYDT
FT                   LSQVPPTIRYELSDLEVFLTEKLCQTLAIDGVTTACNDRLFNAGTHFHVHLIPRFRSDG
FT                   FWDQISLAQAQLDLTHFLKAL"
FT   misc_feature    complement(106106..106387)
FT                   /locus_tag="SSUSC84_0114"
FT                   /note="HMMPfam hit to PF01230, HIT, score 5e-06"
FT                   /inference="protein motif:HMMPfam:PF01230"
FT   CDS_pept        complement(106469..107725)
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SSUSC84_0115"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0120"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50892"
FT                   /protein_id="CAZ50892.1"
FT                   /translation="MNIFEELKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKDTVDGWVTKIQGQ
FT                   LSRFLDFENGDNKAEMVNNYDWFSDISFIDFLRDVGKYYTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRRKADKSGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   KQFDAARHERLAQKILAKEVVTLVHGEEAYNQALNITEQLFAGNIKNLSAKELKQGLSN
FT                   VPNYAVQAEDNLNIVELLVTSGIVNSKRQAREDVQNGAIYVNGERVQDLDYTLSDSDKI
FT                   DGELTVIRRGKKKYSVLTY"
FT   misc_feature    complement(106529..106672)
FT                   /gene="tyrS"
FT                   /locus_tag="SSUSC84_0115"
FT                   /note="HMMPfam hit to PF01479, S4, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    complement(106757..107650)
FT                   /gene="tyrS"
FT                   /locus_tag="SSUSC84_0115"
FT                   /note="HMMPfam hit to PF00579, tRNA-synt_1b, score
FT                   2.6e-110"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   misc_feature    complement(107579..107611)
FT                   /gene="tyrS"
FT                   /locus_tag="SSUSC84_0115"
FT                   /note="ScanRegExp hit to PS00178, AA_TRNA_LIGASE_I, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        107879..110302
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUSC84_0116"
FT                   /product="putative penicillin-binding protein 1B"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0121"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   orthologues, for example Streptococcus pneumoniae Pbp1B
FT                   penicillin-binding protein 1B UniProt:Q75YI4
FT                   (EMBL:AB119810) (820 aa) fasta scores: E()=2.5e-164,
FT                   57.755% id in 793 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50893"
FT                   /protein_id="CAZ50893.1"
FT                   /translation="MATKSDKQDFKKKISALGLGDVVGVFLRTLKLLFNSVAVLVFLFG
FT                   LFGAGIGIGFVVSLFDDVKIPKTEELVAKVSEVSRISTVTYSDGSLVSEVNSDLLRVPI
FT                   TSEEVSNYLKQAVIATEDETFETHNGVVPKAVLRAALGSVGLGSSSGGSTLTQQLIKQQ
FT                   LVGDAPTFTRKANEIVSALALERNMTKEEILTIYLNVSPFGRNNQGRNIAGVEAAAQGI
FT                   FGKPAKDLTVPQAAFIAGLPQSPIVYSPYASDGTRKSDEDMVYGIERYQDVLFNMYRAS
FT                   FLTKEEYETYKAYDIKQDFIAPAPVMADTKDYLYYKVMEEAQEVMFDYLVKRDKVSKND
FT                   LKNDETKASYEELAKQELSQGGYTIKSTVDQKIYAAMQSVVANYGSVLDDGNEYVETGS
FT                   VLIDNATGAILGFVGGRDYATNQNNHAFDTLRSPASTIKPLLAYGIAIDQGLIGSASIL
FT                   SDYPTNFSSGQPIMYGSGRGTGMMNLQTAIDRSVNIPAFWTYKMMRNAGVDAKAYMDKM
FT                   NYHIPMYDIESVPLGGGVEISVLTNTNAYQTLANGGVYNKHYIVESITASDGTVVYQHE
FT                   ATPVQVYSKATASIMNQLLRQVVNSGYTTTFKSRLSGLNPQAASSDFVGKTGTSNEVND
FT                   VWLMLSTPRVTLGTWAGNDDNSEMYVWTGYHNNSQYVAHMVDALYNVNADMFAGKFELD
FT                   SSVIASSVVASTGQRAGTTQVNGRQVTVGGAMTTSYWAKNGAPVTSYNFMVGGTDSDRA
FT                   QAWNTIIGSQTATSSSSTQRSSSTRSSTSSSANNTNQSSETQTATSEQANNDSP"
FT   misc_feature    107987..108055
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUSC84_0116"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0116 by TMHMM2.0 at aa 37-59"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    108122..108640
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUSC84_0116"
FT                   /note="HMMPfam hit to PF00912, Transgly, score 2.8e-79"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    109067..109765
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUSC84_0116"
FT                   /note="HMMPfam hit to PF00905, Transpeptidase, score
FT                   1.8e-24"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    109310..109360
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUSC84_0116"
FT                   /note="ScanRegExp hit to PS00237, G_PROTEIN_RECEP_F1_1,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00237"
FT   CDS_pept        complement(110572..110691)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0116a"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0121B"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pyogenes (serotype M6) hypothetical
FT                   protein UniProt:Q5XCE9 (EMBL:CP000003) (95 aa) fasta
FT                   scores: E()=9.1e-06, 71.875% id in 32 aa"
FT   CDS_pept        110748..114320
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0122"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50895"
FT                   /protein_id="CAZ50895.1"
FT                   /translation="MAGHEVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDYGL
FT                   KEVFEDVLPVSNFTDTMELEFVGYELKEPKYTLEEARAHDANYSAPIYVTFRLVNKETG
FT                   EIKTQEVFFGEFPIMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTIE
FT                   KDIHKNPADSRTDEALKEIYERLRPGEPKTAESSRSLLTARFFDPRRYDLAPVGRYKIN
FT                   KKLNLRTRLLNQTLAEHVINGETGEIVLEAGTVLSRDVLEKVEAQFDELNLVEYIPNDN
FT                   AVLLEPVLLQKFKIVAPKDPERVVTVIGNANPAENVRTVTPADILAEMSYFLNLAEGLG
FT                   RVDDIDHLGNRRIRAVGELLANQVRIGLTRMERNLRERMSVQDNEVLTPQQIINIRPVT
FT                   AAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRM
FT                   CPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKIDRATGTVTNEIVWLTADEEDAYI
FT                   VAQSTSPLDENNRFVDKIVMGRHQGNNQEFPADSADFMDVSPKQVVAVATACIPFLEND
FT                   DSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAIIAQHDGKVVYADADKVE
FT                   VRREDGSLDVYHISKFRRSNSGTAYNQRTLVKLGDIVEKGDFIADGPSMENGEMALGQN
FT                   PIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVG
FT                   EDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTS
FT                   LRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVV
FT                   SRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFDG
FT                   ASSEDLWSTVKEAGMDSDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSV
FT                   GPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEA
FT                   ITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDNNEVELRDLDEGEDDDIIHVDDL
FT                   EKARAKAAADAAAAFAAEEAEGKE"
FT   misc_feature    110829..112151
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="HMMPfam hit to PF04563, RNA_pol_Rpb2_1, score 1e-49"
FT                   /inference="protein motif:HMMPfam:PF04563"
FT   misc_feature    111165..111725
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="HMMPfam hit to PF04561, RNA_pol_Rpb2_2, score
FT                   2.1e-15"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    111852..111986
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="HMMPfam hit to PF04561, RNA_pol_Rpb2_2, score
FT                   1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    112161..112370
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="HMMPfam hit to PF04565, RNA_pol_Rpb2_3, score
FT                   4.7e-40"
FT                   /inference="protein motif:HMMPfam:PF04565"
FT   misc_feature    112773..113939
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="HMMPfam hit to PF00562, RNA_pol_Rpb2_6, score
FT                   9e-215"
FT                   /inference="protein motif:HMMPfam:PF00562"
FT   misc_feature    113496..113534
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="ScanRegExp hit to PS01166, RNA_POL_BETA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    113943..114173
FT                   /gene="rpoB"
FT                   /locus_tag="SSUSC84_0117"
FT                   /note="HMMPfam hit to PF04560, RNA_pol_Rpb2_7, score
FT                   2.9e-49"
FT                   /inference="protein motif:HMMPfam:PF04560"
FT   CDS_pept        114498..118145
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SSUSC84_0118"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0123"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50896"
FT                   /protein_id="CAZ50896.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERDG
FT                   LFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPISHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEHKSIMTEREYRERLREYG
FT                   YGSFVAKMGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKAVRRLDVLDAFYKSGN
FT                   KPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARDIAGNVKAAKRLIERGDDRIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVF
FT                   KDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKVMMTTVGKILFNAIMPEGLP
FT                   YLQEPNNANLTEGTPDKYFLEPGSDIKAAIAELPINPPFKKKNLGNIIAEIFKRFRTTE
FT                   TSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQIKKQFRRGMITD
FT                   DERYAAVTDEWRSAKEKLEKRLVEKQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMSA
FT                   PNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLDIRSITDGKEMIEPLEERLQGRYTKKTVKHPETGAVIIGPNQLITED
FT                   IAREIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEP
FT                   GTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKGEAVITEVKGEVIAIEEDASTR
FT                   TKKVFVKGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGSIQPKRLLEVRDVLAVETY
FT                   LLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDLLMGTLMDITDFTDANAE
FT                   VVIAGGIPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDNLLGLKEN
FT                   VIIGKIIPAGTGMARYRNLEPQAINEVEIIEDTVAEELAAEAELEAVTE"
FT   misc_feature    114507..115493
FT                   /gene="rpoC"
FT                   /locus_tag="SSUSC84_0118"
FT                   /note="HMMPfam hit to PF04997, RNA_pol_Rpb1_1, score
FT                   1e-150"
FT                   /inference="protein motif:HMMPfam:PF04997"
FT   misc_feature    115497..115925
FT                   /gene="rpoC"
FT                   /locus_tag="SSUSC84_0118"
FT                   /note="HMMPfam hit to PF00623, RNA_pol_Rpb1_2, score
FT                   3.3e-83"
FT                   /inference="protein motif:HMMPfam:PF00623"
FT   misc_feature    115932..116486
FT                   /gene="rpoC"
FT                   /locus_tag="SSUSC84_0118"
FT                   /note="HMMPfam hit to PF04983, RNA_pol_Rpb1_3, score
FT                   1.8e-68"
FT                   /inference="protein motif:HMMPfam:PF04983"
FT   misc_feature    116571..116801
FT                   /gene="rpoC"
FT                   /locus_tag="SSUSC84_0118"
FT                   /note="HMMPfam hit to PF05000, RNA_pol_Rpb1_4, score 1e-25"
FT                   /inference="protein motif:HMMPfam:PF05000"
FT   misc_feature    116805..117911
FT                   /gene="rpoC"
FT                   /locus_tag="SSUSC84_0118"
FT                   /note="HMMPfam hit to PF04998, RNA_pol_Rpb1_5, score
FT                   4.1e-79"
FT                   /inference="protein motif:HMMPfam:PF04998"
FT   CDS_pept        118295..118660
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0124"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50897"
FT                   /protein_id="CAZ50897.1"
FT                   /translation="MYQVIKMYGDFEPWWFLDGWEEDVTSRAAFDRYEDALNAFQKEWV
FT                   RLSEDFPMKKSKNGTMVAFWDESDQHWCEECDEYLQRYHSLMLVEARENLPAGFIKQPT
FT                   QPRVRPCKLKQNNCVNE"
FT   misc_feature    118295..118642
FT                   /locus_tag="SSUSC84_0119"
FT                   /note="HMMPfam hit to PF06279, DUF1033, score 8.7e-58"
FT                   /inference="protein motif:HMMPfam:PF06279"
FT   CDS_pept        complement(join(118695..119027,119027..119638))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0120"
FT                   /product="putative microcin immunity protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0125"
FT                   /note="CDS contains a frameshift after codon 204. Similar
FT                   to Escherichia coli MccF microcin C7 self-immunity protein
FT                   MccF UniProt:Q47511 (EMBL:ECPMC7A) (344 aa) fasta scores:
FT                   E()=1.2e-10, 31.776% id in 321 aa"
FT                   /db_xref="PSEUDO:CAZ50898.1"
FT   misc_feature    complement(join(118725..119027,119027..119611))
FT                   /locus_tag="SSUSC84_0120"
FT                   /note="HMMPfam hit to PF02016, Peptidase_S66, score 6e-99"
FT                   /inference="protein motif:HMMPfam:PF02016"
FT   CDS_pept        119724..120674
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0121"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0126"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50899"
FT                   /protein_id="CAZ50899.1"
FT                   /translation="MIQEKARKMIEEAVADRVSDIYLVPRGECYQVYHRIMDDREFVQD
FT                   LAEEEVTAIISHFKFLAGLNVGEKRRSQQGSCDYDYGSGEISLRLSTVGDYRGKESLVI
FT                   RLLYDNDKELKFWFEAAERLAEEIKGRGLYLFSGPVGSGKTTLMYHLARLKFPDKQILT
FT                   IEDPVEIKQEDMLQLQLNEAIGATYDNLIKLSLRHRPDLLIIGEIRDAETARAVIRASL
FT                   TGATVFSTVHARSISGVYARMLELGVGPEELNNALQGIAYQRLIGGGGVVDFAKGNYQN
FT                   HSADQWNAQIDRLFAAGHISLRQAETEKITLGSPA"
FT   misc_feature    119724..120530
FT                   /locus_tag="SSUSC84_0121"
FT                   /note="HMMPfam hit to PF00437, GSPII_E, score 2.5e-38"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    120309..120353
FT                   /locus_tag="SSUSC84_0121"
FT                   /note="ScanRegExp hit to PS00662, T2SP_E, score NA"
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS_pept        120595..121623
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0122"
FT                   /product="putative competence protein"
FT                   /product="competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0127"
FT                   /note="CDS differs in the length of the N-terminus in
FT                   comparison to orthologues, for example, similar to Bacillus
FT                   subtilis ComG operon protein 2 UniProt:P25954
FT                   (EMBL:BSJH6421) (323 aa) fasta scores: E()=5.6e-08, 25.000%
FT                   id in 324 aa. Possible alternative translational start site
FT                   after codons 5 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50900"
FT                   /protein_id="CAZ50900.1"
FT                   /translation="MIGFLQQDISVFGRQKQKKLPLARQRKVIELFNNLFASGFHLGEI
FT                   VDFLKRSQLLADPYTQVLSDGLLAGKPFSSLLADLRFSDAVVTQVALAEVHGNTSLSLI
FT                   HIQSYLENVSKVRKKLIEVATYPIILLGFLLLIMLGLKNYLLPQLEEGNAATVLINHLP
FT                   TIFLSLSGLSLVAVLAGMVWFRKTNKIKVFSCLAALPFFGKLIQTYLTAYYAREWGSLI
FT                   GQGLDLPQIVGLMQEQQSQLFREIGQDLEQSLSNGQSFHEHIKTYAFFKRELSLIVEYG
FT                   QVKSKLGSELTVYAAECWEDFFSRVNRAMQLIQPLVFLFVALMVVLIYAAMLLPIYQNM
FT                   EL"
FT   misc_feature    120676..121035
FT                   /locus_tag="SSUSC84_0122"
FT                   /note="HMMPfam hit to PF00482, GSPII_F, score 4.6e-13"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   misc_feature    join(120952..121020,121078..121146,121537..121605)
FT                   /locus_tag="SSUSC84_0122"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0122 by TMHMM2.0 at aa 120-142, 162-184 and
FT                   315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    121234..121599
FT                   /locus_tag="SSUSC84_0122"
FT                   /note="HMMPfam hit to PF00482, GSPII_F, score 3.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   CDS_pept        121625..121906
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SSUSC84_0123"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0128"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50901"
FT                   /protein_id="CAZ50901.1"
FT                   /translation="MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKK
FT                   GDAAVVKVVESQMELYELEHDEEATVADLQAKGYITEKQAKQYATAKK"
FT   sig_peptide     121625..121768
FT                   /gene="comYC"
FT                   /locus_tag="SSUSC84_0123"
FT                   /note="Signal peptide predicted for SSUSC84_0123 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.602) with cleavage
FT                   site probability 0.602 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121652..121723
FT                   /gene="comYC"
FT                   /locus_tag="SSUSC84_0123"
FT                   /note="HMMPfam hit to PF07963, N_methyl, score 7.4e-07"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    121652..121714
FT                   /gene="comYC"
FT                   /locus_tag="SSUSC84_0123"
FT                   /note="ScanRegExp hit to PS00409, PROKAR_NTER_METHYL, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00409"
FT   misc_feature    121661..121729
FT                   /gene="comYC"
FT                   /locus_tag="SSUSC84_0123"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0123 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        121887..122294
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0124"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0129"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50902"
FT                   /protein_id="CAZ50902.1"
FT                   /translation="MLRRKNKAFTLFESLLTLLVVSFLAVSLSGTVQTVFRSVQEEIFL
FT                   WEFEAIYKDSQKLAASSHKKVNLAIGGQEVTNGYQAVEVPRNVEVLEEKTIQFEEDGGN
FT                   SSLTKIRFHLSQKIVTYQLYIGSGRYKKTEE"
FT   sig_peptide     121887..121988
FT                   /locus_tag="SSUSC84_0124"
FT                   /note="Signal peptide predicted for SSUSC84_0124 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.963) with cleavage
FT                   site probability 0.732 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121920..121988
FT                   /locus_tag="SSUSC84_0124"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0124 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122266..122559
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0125"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0130"
FT                   /note="Possible alternative translational start site after
FT                   codon 13"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50903"
FT                   /protein_id="CAZ50903.1"
FT                   /translation="MVAIRKQKNKAYILLESLVALATLVTICSLILSAVDAGRRRQVWE
FT                   LEQQEVFNLAQMAVQTKQDDLALNGVAVQVQRTAERVAVFHEGKEVLSVVKK"
FT   sig_peptide     122266..122367
FT                   /locus_tag="SSUSC84_0125"
FT                   /note="Signal peptide predicted for SSUSC84_0125 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.947) with cleavage
FT                   site probability 0.710 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    122302..122370
FT                   /locus_tag="SSUSC84_0125"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0125 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122546..122980
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0126"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0131"
FT                   /note="Possible upstream alternative translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50904"
FT                   /protein_id="CAZ50904.1"
FT                   /translation="MLKSKIPAFTLLECLVVLVILSGSLLIFEGLSKLLVQEAHYQGQT
FT                   VQKEWLVFSSQLRSEWDQAELVKVENGKVYVNKGEQALAFGKSWSDDFRKTNDRGQGYQ
FT                   PMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS"
FT   misc_feature    122561..122629
FT                   /locus_tag="SSUSC84_0126"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0126 by TMHMM2.0 at aa 6-28"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122958..123368
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0127"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0132"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50905"
FT                   /protein_id="CAZ50905.1"
FT                   /translation="MLLKKKVKAGILLYALLMLAVFSLLLQFYLHRQEAESRLVQVARQ
FT                   ETTAYIMAQMVLDKVEQDLQVEKIVTGAVVNEKEANLTTGSKQKENRGRVSFQEGQARY
FT                   QLKGDQLLVTVELTSDGLYTYQFPFGLSSEGG"
FT   misc_feature    122982..123050
FT                   /locus_tag="SSUSC84_0127"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0127 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        123425..124378
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0133"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50906"
FT                   /protein_id="CAZ50906.1"
FT                   /translation="MNFEKIEQAYDLLLENVQTIQNQLGTNIYDAMIEQNATYVAGQHE
FT                   TDLVVKNNQTLKQLDLTKEEWRRAYQFLLIKANQTEPMQYNHQFTPDSIGFILSFLVDQ
FT                   LVPTQKVTVLEIGSGTGNLAQTILNASQKELDYLGIEVDDLLIDLSASIADVMQADISF
FT                   AQGDAVRPQILKESQVILGDLPIGYYPDDQIASRYQVASPKEHTYAHHLLMEQSLKYLE
FT                   KDGFAILLAPNDLLTSPQSDLLKGWLQEQANIVAMIALPPNLFGKTAMAKSIFVLQKKA
FT                   ARSLTPFVYPLQSLQEPEAIQKFMLNFKNWKQENAI"
FT   misc_feature    123911..123955
FT                   /locus_tag="SSUSC84_0128"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        124428..125615
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SSUSC84_0129"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0134"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50907"
FT                   /protein_id="CAZ50907.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEETVLAAGIIERIGLNDSISTVK
FT                   YDGKKESEVLDIPNHTVAVKILLEDLLKHNIIAAYEEITGIGHRVVAGGEYFKESAVIS
FT                   QQEIEQIEELSALAPLHNPAHVAAMRAFEEVLPEVLNVAVFDTAFHTTMPKHAYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHYYVAHEAAKVLGRPIEELKLITAHIGNGVSITANYHGESV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIANVEELKDAADVVNMLNKQSGLFGVSGFS
FT                   SDMRDIEAGIQAHNPDAVLAYNIFIDRIKKFIGQYLAVLNGADAIVFTAGMGENAPLMR
FT                   NDVVEGLSWFGIELDLEKNVFGNYGDISTAESKVRVLVISTDEELVIAREVERLK"
FT   misc_feature    124434..125594
FT                   /gene="ackA"
FT                   /locus_tag="SSUSC84_0129"
FT                   /note="HMMPfam hit to PF00871, Acetate_kinase, score
FT                   5e-197"
FT                   /inference="protein motif:HMMPfam:PF00871"
FT   misc_feature    124437..124472
FT                   /gene="ackA"
FT                   /locus_tag="SSUSC84_0129"
FT                   /note="ScanRegExp hit to PS01075, ACETATE_KINASE_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01075"
FT   misc_feature    125031..125084
FT                   /gene="ackA"
FT                   /locus_tag="SSUSC84_0129"
FT                   /note="ScanRegExp hit to PS01076, ACETATE_KINASE_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01076"
FT   CDS_pept        125930..126481
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0130"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0135"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50908"
FT                   /protein_id="CAZ50908.1"
FT                   /translation="MEKKIPKLTVQLLAAIAMTLALVMIVENYFSIRISDTLQVQFTFI
FT                   PNTILGAIAGPVWAAVFAAISDPVFVLFSGQTVLFTWILIEAVSAFIYGWFFYRKPLDT
FT                   KNKADWLYVAGVVVLIQVVISFIMTPIALHFHFGTPWIVLYSSRLIKAVFEIPLRIVVT
FT                   MLVLPSLQKIPELAKLMGIK"
FT   sig_peptide     125930..126106
FT                   /locus_tag="SSUSC84_0130"
FT                   /note="Signal peptide predicted for SSUSC84_0130 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.752) with cleavage
FT                   site probability 0.383 between residues 59 and 60"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(125957..126025,126059..126127,126155..126223,
FT                   126257..126325)
FT                   /locus_tag="SSUSC84_0130"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0130 by TMHMM2.0 at aa 10-32, 44-66, 76-98 and
FT                   110-132"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        126537..127793
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SSUSC84_0131"
FT                   /product="folypolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0136"
FT                   /note="Weakly similar to SSU0054, 35.680% identity (37.789%
FT                   ungapped) in 412 aa overlap (9-411:5-402)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50909"
FT                   /protein_id="CAZ50909.1"
FT                   /translation="MNYQETRRWLSSRPASDLENGVARVNWILERLDNPQLQVPTVHFV
FT                   GTNGKGSTLNALQSILQSSDYTVGRFTSPSIIDFREQIVYQQEMISEEDFARIVTDLQP
FT                   LIEDLDQTAGLDAISEFEIVVVAMFVYFAHYQRPDILLVEAGMGGLQDATNVLAPLAVV
FT                   CPSIGLDHQAFLGETHAAIARHKVAVLREGVPLIYATDQPEVETVFEEHACQLQSPTYA
FT                   VGREILLENSRAGFAVSSPLGRVEELTLQMQGRHQEVNAALAVTTAQLIKPHFPTITNE
FT                   TIRQGLSQAIWPGRLELIRPNLMIDGAHNNESIAVLTQLLEEKYADRDIEILFAAINTK
FT                   PVDQMLSQLSQFGPVSVTTFDDFRAVQLEDYPSGYERVQTYQEWVEQADLDNPKKLYLI
FT                   TGSLYFITYVRKYILEELV"
FT   misc_feature    126960..127007
FT                   /gene="folC"
FT                   /locus_tag="SSUSC84_0131"
FT                   /note="ScanRegExp hit to PS01012, FOLYLPOLYGLU_SYNT_2,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS01012"
FT   misc_feature    127410..127640
FT                   /gene="folC"
FT                   /locus_tag="SSUSC84_0131"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 0.0047"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        complement(127840..128901)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SSUSC84_0132"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0137"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50910"
FT                   /protein_id="CAZ50910.1"
FT                   /translation="MTLFGKIKEVTELQSLPGFEGQVRNHIRQKITPHVDRIETDGLGG
FT                   IFGIKDTAVENAPRILVVAHMDEVGFMISQIKPDGTFRVVELGGWNPLVVSSQAFTLQL
FT                   QDGRTIPAISGSVPPHLSRGANAPGMPAIADIIFDAGFANYDEAWAFGVRPGDVLVPKN
FT                   ETILTANGKNVISKAWDNRFGVLMVTELLESLSGHALPNQLIAGANVQEEVGLRGAHAS
FT                   TTKFNPDIFLAVDCSPAGDIYGDQGKIGDGTLLRFYDPGHIMLKNMKDFLLTTAEEAGV
FT                   KFQYYCGKGGTDAGAAHLKNHGVPSTTIGVCARYIHSHQTLYSMDDFLEAQAFLQTIVK
FT                   KLDRSTVDLIKNY"
FT   misc_feature    complement(127900..128772)
FT                   /gene="pepA"
FT                   /locus_tag="SSUSC84_0132"
FT                   /note="HMMPfam hit to PF05343, Peptidase_M42, score 8e-128"
FT                   /inference="protein motif:HMMPfam:PF05343"
FT   CDS_pept        129719..130003
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0133"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0139"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50911"
FT                   /protein_id="CAZ50911.1"
FT                   /translation="MKKKKTALLAGLLGAGVLTASAQFYRKIQEDRKKAQALQEVRDFF
FT                   ADLGEIATVYVDETASTQTTLIGGVVMEAGQVFLFENTKGSIQYREEER"
FT   sig_peptide     129719..129784
FT                   /locus_tag="SSUSC84_0133"
FT                   /note="Signal peptide predicted for SSUSC84_0133 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.959 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    129737..129793
FT                   /locus_tag="SSUSC84_0133"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0133 by TMHMM2.0 at aa 7-25"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        130000..130320
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0134"
FT                   /product="putative thioredoxin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0140"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50912"
FT                   /protein_id="CAZ50912.1"
FT                   /translation="MIFPTNHEEVAALIEDGKPTVFLFVTTWCGDCHYIKPHVPAIEEA
FT                   FPDLRFVQLDRDDFMPLAQEWAILGIPSLVVLENGKEIGRFVDKNRKTKEEIMNFLSGL
FT                   GR"
FT   misc_feature    130000..130311
FT                   /locus_tag="SSUSC84_0134"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 3e-05"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   CDS_pept        130365..131321
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0135"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0141"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50913"
FT                   /protein_id="CAZ50913.1"
FT                   /translation="MKKSLGKILLAPVVLGLSLSLAPLVQAEIQTDVINEKWGKPTLVY
FT                   GGGLSDAQATEVNNLFGISDVNNVSRQVVVGTDMDQYLGTSEADTASLYSSVLVQKQDA
FT                   GKGVVVDIKTPQNITLITETQYANAAITAGATDVLIDVASPIQVTGESALTGVYKALAA
FT                   NGETVDTARTEVAQQELETVNEVATAHTGDTNFDSSALDKAVAEIKTALADYKKSNGQV
FT                   ASEADINTIINDVLAQNGLENVITADEVSKLVTFAKAYQETSAIDSAEVAAQLNQFKQQ
FT                   AEQQISEAYKNLQDSGILEKIGAFFENLWKGLTGLFA"
FT   sig_peptide     130365..130445
FT                   /locus_tag="SSUSC84_0135"
FT                   /note="Signal peptide predicted for SSUSC84_0135 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.996 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    130497..131201
FT                   /locus_tag="SSUSC84_0135"
FT                   /note="HMMPfam hit to PF06207, DUF1002, score 4.5e-47"
FT                   /inference="protein motif:HMMPfam:PF06207"
FT   CDS_pept        131340..131963
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0136"
FT                   /product="putative tRNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0142"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50914"
FT                   /protein_id="CAZ50914.1"
FT                   /translation="MIFTYNKEHVGDVLMVIVAEDKGQAVQFERKGQVARVFLEETGKT
FT                   VAWNIFEASSLVELDGNGQVFLTDEQVATLNAELAKEGFTESLVNDNAPKFVVGQIVEL
FT                   VPHPDSDHLNICQVNVGDKTVQIVAGAPNAAQGLKTIVALPGAMMPSGSLIFPGKLRGE
FT                   DSFGMMCSPRELALPNAPQVRGIIELDDSAVVGEAFDPAKHWKG"
FT   misc_feature    131625..131933
FT                   /locus_tag="SSUSC84_0136"
FT                   /note="HMMPfam hit to PF01588, tRNA_bind, score 3.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01588"
FT   CDS_pept        complement(131996..132775)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0143"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50915"
FT                   /protein_id="CAZ50915.1"
FT                   /translation="MKEFLMEKIQTSQPYTNAELDWLLENIGHPDPTIRDELVYASFCH
FT                   IFLEGLITREQAQSLLQFSQETKPFSLEGPTQKRSFTCLLYCLLLSVDNEPESIYHAFL
FT                   STDDHELLFQQALDYLTIENDWSGYDEKLGWIHTAAHGADFLLATSCHDQFPAEKSKEV
FT                   WQTIVTCLTKQSKVFSAGEEIRLAQIPVYLLLNEKVSSQELTEWISKLDFPNQEPVDYF
FT                   RWLNLQHFLSSLYFQLKSQQASTEEIEQAIEGKIEPA"
FT   CDS_pept        132830..133225
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0138"
FT                   /product="putative single stranded DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0144"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50916"
FT                   /protein_id="CAZ50916.1"
FT                   /translation="MYNKTILIGRLTAQPELTQTPTGKNLTRVTVAVNRRFKTENGERE
FT                   ADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTRKYEKDGSNHYVTEILGQSFQLLES
FT                   RAQRAMRENNTGDDLADLVLEEEELPF"
FT   misc_feature    132833..133135
FT                   /locus_tag="SSUSC84_0138"
FT                   /note="HMMPfam hit to PF00436, SSB, score 1.1e-26"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS_pept        complement(133344..133490)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0139"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0145"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50917"
FT                   /protein_id="CAZ50917.1"
FT                   /translation="MGKMIFAYLLWLVWWLLFSHPHYIIFFFYGVLLLSLIIMLIEWWK
FT                   YRK"
FT   misc_feature    complement(133359..133427)
FT                   /locus_tag="SSUSC84_0139"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0139 by TMHMM2.0 at aa 22-44"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        133787..134068
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSUSC84_0140"
FT                   /product="10 kDa chaperonin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0146"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50918"
FT                   /protein_id="CAZ50918.1"
FT                   /translation="MLKPLGDRIAVKIEEKEQTVGGFVLAGASQEKTKEASVLAIGQGI
FT                   RTLNGDLVAPAVAVGDTVLIDAHAGLEVKDGDQNVHIIRETDILAIVE"
FT   misc_feature    133787..134062
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSUSC84_0140"
FT                   /note="HMMPfam hit to PF00166, Cpn10, score 5.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00166"
FT   misc_feature    133790..133861
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSUSC84_0140"
FT                   /note="ScanRegExp hit to PS00681, CHAPERONINS_CPN10, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00681"
FT   CDS_pept        134079..135701
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSUSC84_0141"
FT                   /product="60 kDa chaperonin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0147"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50919"
FT                   /protein_id="CAZ50919.1"
FT                   /translation="MAKEIKFAADARESMVRGVDILADTVKVTLGPKGRNVVLEKAYGS
FT                   PLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLK
FT                   NVTAGANPIGIRRGIEAAVATAVEALKAQASPVSNKAEIAQVAAVSSRSEKVGEYISEA
FT                   MERVGTDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELENPFILITD
FT                   KKISHIQDILPLLESILQANRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGTVITEDLGLDLKDATIEALGQAAKVVVDKDGATIVEGAGNPEAI
FT                   ANRVAVIKSQIEVTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALN
FT                   ATRAAVEEGIVAGGGTALVNVIDSVAKLELKGDDETGRNIVLRALEEPVRQIAYNAGYE
FT                   GSVIIDKLKNSELGTGFNAATGEWVNMMDAGIIDPVKVTRSALQNAASVASLILTTEAV
FT                   VANKPEPAAPAMPQGMDGMGMGY"
FT   misc_feature    134142..135644
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSUSC84_0141"
FT                   /note="HMMPfam hit to PF00118, Cpn60_TCP1, score 7.5e-197"
FT                   /inference="protein motif:HMMPfam:PF00118"
FT   misc_feature    135285..135320
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSUSC84_0141"
FT                   /note="ScanRegExp hit to PS00296, CHAPERONINS_CPN60, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00296"
FT   CDS_pept        135933..136346
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SSUSC84_0142"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0148"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50920"
FT                   /protein_id="CAZ50920.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKG"
FT   misc_feature    135936..136340
FT                   /gene="rpsL"
FT                   /locus_tag="SSUSC84_0142"
FT                   /note="HMMPfam hit to PF00164, Ribosomal_S12, score 3e-65"
FT                   /inference="protein motif:HMMPfam:PF00164"
FT   misc_feature    136098..136121
FT                   /gene="rpsL"
FT                   /locus_tag="SSUSC84_0142"
FT                   /note="ScanRegExp hit to PS00055, RIBOSOMAL_S12, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS_pept        136363..136833
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SSUSC84_0143"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0149"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50921"
FT                   /protein_id="CAZ50921.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTAASIVYG
FT                   AFDQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARNRGEHTMIDRLAKEIMDAANNTGAAVKKREDTHKMAEANRAFAHFRW"
FT   misc_feature    136363..136809
FT                   /gene="rpsG"
FT                   /locus_tag="SSUSC84_0143"
FT                   /note="HMMPfam hit to PF00177, Ribosomal_S7, score 1.8e-82"
FT                   /inference="protein motif:HMMPfam:PF00177"
FT   misc_feature    136420..136500
FT                   /gene="rpsG"
FT                   /locus_tag="SSUSC84_0143"
FT                   /note="ScanRegExp hit to PS00052, RIBOSOMAL_S7, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS_pept        137390..139471
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="SSUSC84_0144"
FT                   /product="elongation factor G (EF-G)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0151"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50922"
FT                   /protein_id="CAZ50922.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHERLQANAHPIQ
FT                   LPIGSEDEFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAEEYREKLVEAVAETD
FT                   EELMMKYLEGEEITNDELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGVNPDTDAEEERHASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   IHVPEPVIQLMVEPKSKADQDKMGIALSKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSS
FT                   ETAFKVAASLALKEAAKSAQPTILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAR
FT                   GNTQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQDEIIKKNGGNA"
FT   misc_feature    137411..138235
FT                   /gene="fus"
FT                   /locus_tag="SSUSC84_0144"
FT                   /note="HMMPfam hit to PF00009, GTP_EFTU, score 1.1e-114"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    137540..137587
FT                   /gene="fus"
FT                   /locus_tag="SSUSC84_0144"
FT                   /note="ScanRegExp hit to PS00301, EFACTOR_GTP, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    138353..138556
FT                   /gene="fus"
FT                   /locus_tag="SSUSC84_0144"
FT                   /note="HMMPfam hit to PF03144, GTP_EFTU_D2, score 2.7e-18"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    138818..139177
FT                   /gene="fus"
FT                   /locus_tag="SSUSC84_0144"
FT                   /note="HMMPfam hit to PF03764, EFG_IV, score 6.3e-66"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    139181..139444
FT                   /gene="fus"
FT                   /locus_tag="SSUSC84_0144"
FT                   /note="HMMPfam hit to PF00679, EFG_C, score 2.9e-48"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   repeat_region   complement(139548..139651)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        140460..142451
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0145"
FT                   /product="putative endopeptidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0152"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50923"
FT                   /protein_id="CAZ50923.1"
FT                   /translation="MRKKLKFSLVAVACATFLTACGTSNSSAPKAGEATPQTDFHSYIN
FT                   AQWLKNTKLGAGESQIDNLSQLSEKTQEAIQEMIDQLDMDYSKLQAGSDEKKLIDFYRL
FT                   AADFDTRNKLGLEPIKPYLEEIKKASTMEELNKILVALYGKNIRNLLHINVTQDIKDSN
FT                   KNTIYVDPHELSFPKENYDGTDEFSLKNQKAFKAYLQEVFSLSGETSKEASSKADLLFN
FT                   LEKEMAAVQRPKEEANNFEAMYNEKTWDEVKALVPNLPIAELVSELGLQNAPTTVVSDP
FT                   DALKNLNELYQEKNLDALKALLQYRVIAHYNAYLSSNLIEAKAKYDGVATGAVDTPSQK
FT                   EVAQAAIDANFSDMIGKVYVKHHFSEESKANILSMVQEIKATYAERIKAVQWMSEETKM
FT                   RALKKLDTLVVKIGYPDQWKDYSQLAIQSKEEGGSLLSNFDMVKTLELREEMGQFGKPF
FT                   DKSQFGMPSHTVNAYYSPTNNEIVFPAGILQAPLYDPKASPEENLGGIGAVIGHEISHA
FT                   FDKAGSQFDEKGNLVNWWKPEDLEKFNKKVQQAADIYSKLEVAPGYYVNGEISTGEIMA
FT                   DLGGLTVAIDIAQKKGYDTKKVFESYGKAWREVTTKEFAIANISDEHPPAKYRVNNIVN
FT                   QIDQFYTDFNVKEGDPMYVKPEDRLRVW"
FT   sig_peptide     140460..140552
FT                   /locus_tag="SSUSC84_0145"
FT                   /note="Signal peptide predicted for SSUSC84_0145 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.460 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    140562..141704
FT                   /locus_tag="SSUSC84_0145"
FT                   /note="HMMPfam hit to PF05649, Peptidase_M13_N, score
FT                   9.3e-83"
FT                   /inference="protein motif:HMMPfam:PF05649"
FT   misc_feature    141870..142439
FT                   /locus_tag="SSUSC84_0145"
FT                   /note="HMMPfam hit to PF01431, Peptidase_M13, score 3e-66"
FT                   /inference="protein motif:HMMPfam:PF01431"
FT   misc_feature    141984..142013
FT                   /locus_tag="SSUSC84_0145"
FT                   /note="ScanRegExp hit to PS00142, ZINC_PROTEASE, score NA"
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS_pept        142818..143828
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUSC84_0146"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0153"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50924"
FT                   /protein_id="CAZ50924.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLL
FT                   KYDTTQGRFDGTVEVKDGGFEVNGKFVKVSAEREPGNIDWATDGVDIVLEATGFFASKE
FT                   KAEQHIHANGAKKVVVTAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGVQKGLMTTIHGYTGDQMVLDGPHRGGDLRRARAAAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVATLDKKVTAEEVNAAMKAAATESFGYTEDQLVSS
FT                   DIVGISFGSLFDATQTKVIEVDGEQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   misc_feature    142824..143273
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUSC84_0146"
FT                   /note="HMMPfam hit to PF00044, Gp_dh_N, score 1.6e-79"
FT                   /inference="protein motif:HMMPfam:PF00044"
FT   misc_feature    143265..143288
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUSC84_0146"
FT                   /note="ScanRegExp hit to PS00071, GAPDH, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00071"
FT   misc_feature    143286..143759
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUSC84_0146"
FT                   /note="HMMPfam hit to PF02800, Gp_dh_C, score 1e-100"
FT                   /inference="protein motif:HMMPfam:PF02800"
FT   CDS_pept        144084..145283
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SSUSC84_0147"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0154"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50925"
FT                   /protein_id="CAZ50925.1"
FT                   /translation="MAKLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YILEQGGRAILFSHLGRVKEEADKEGKSLAPVAADLAAKLGQDVAFIAGATRGAELEAA
FT                   INALEDGQVLLVENTRFEDVDGKKESKNDEELGKYWASLGDGIFVNDAFGTAHRSHASN
FT                   VGISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADK
FT                   VLIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKTLLEKANGKLILPVDSKEANAFAGYT
FT                   EVRDTDGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVM
FT                   DAIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK
FT                   "
FT   misc_feature    144084..145271
FT                   /gene="pgk"
FT                   /locus_tag="SSUSC84_0147"
FT                   /note="HMMPfam hit to PF00162, PGK, score 6.6e-177"
FT                   /inference="protein motif:HMMPfam:PF00162"
FT   misc_feature    144126..144158
FT                   /gene="pgk"
FT                   /locus_tag="SSUSC84_0147"
FT                   /note="ScanRegExp hit to PS00111, PGLYCERATE_KINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00111"
FT   CDS_pept        146090..146605
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0148"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0155"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50926"
FT                   /protein_id="CAZ50926.1"
FT                   /translation="MFKKYTFDPKKFRLGMRTFKSGLAVFLVILLFGFMGWQGIQIAAL
FT                   TAVFSLREDFDQSVHFGASRILGNSIGGFYALLFFILDRLFLDHFWVTAVFVPIFVMLT
FT                   IMTNVAMNNKAGIIGGVSALLIITLSIPAGDTIQYVFIRVFETFIGVFIAILVNYDVNV
FT                   IKKRFQDK"
FT   sig_peptide     146090..146221
FT                   /locus_tag="SSUSC84_0148"
FT                   /note="Signal peptide predicted for SSUSC84_0148 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.997) with cleavage
FT                   site probability 0.784 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(146150..146218,146276..146335,146354..146422,
FT                   146432..146491,146504..146572)
FT                   /locus_tag="SSUSC84_0148"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0148 by TMHMM2.0 at aa 21-43, 63-82, 89-111,
FT                   115-134 and 139-161"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        146681..147052
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="SSUSC84_0149"
FT                   /product="MerR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0156"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50927"
FT                   /protein_id="CAZ50927.1"
FT                   /translation="MREKEFRRSLAIFPIGSVMKLTDLTARQIRYYEDQGLIKPDRNEG
FT                   NRRLYSLNDMDLLLEIKDFLDEGLNIAAIKKEYANREAKAKVQKQQKTLTDEDVRRILH
FT                   DEFSRQGRFSSPSSIFRSS"
FT   misc_feature    146720..146830
FT                   /gene="glnR"
FT                   /locus_tag="SSUSC84_0149"
FT                   /note="HMMPfam hit to PF00376, MerR, score 5.5e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    146726..146794
FT                   /gene="glnR"
FT                   /locus_tag="SSUSC84_0149"
FT                   /note="ScanRegExp hit to PS00552, HTH_MERR_1, score NA"
FT                   /inference="protein motif:Prosite:PS00552"
FT   CDS_pept        147081..148427
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SSUSC84_0150"
FT                   /product="putative glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0157"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50928"
FT                   /protein_id="CAZ50928.1"
FT                   /translation="MTFTVADIKRDIKEKNVTFLRLMFTDIMGVMKNVEIPATDEQVEK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTIFPWGDENGRVAGLICDIYTTDAKP
FT                   FAGDPRGNLKKSLRHMEEAGFSSFNLGPEPEFFLFKMDEQGNPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTEMGFEVEASHHEVAVGQHEIDFKYADVLKACDNIQIFKLVVKTI
FT                   ARKHGMYATFMAKPKFGIAGSGMHCNMSLFDKDGNNAFFDPEDPRGMQLSQTAYHFLGG
FT                   LIKHAYNYTAITNPTVNSYKRLVPGFEAPVYIAWAGKNRSPLVRVPASRGMGTRLELRS
FT                   VDPTANPYLAMAVLLEVGLEGIQNKIEAPAPVESNIYAMSDEERREAGITDLPSTLHNA
FT                   LKALREDEVVRAALGDHIYTNFLEAKKIEWASYATYVSQWEIDNYLDMY"
FT   misc_feature    147126..147380
FT                   /gene="glnA"
FT                   /locus_tag="SSUSC84_0150"
FT                   /note="HMMPfam hit to PF03951, Gln-synt_N, score 1e-15"
FT                   /inference="protein motif:HMMPfam:PF03951"
FT   misc_feature    147237..147293
FT                   /gene="glnA"
FT                   /locus_tag="SSUSC84_0150"
FT                   /note="ScanRegExp hit to PS00180, GLNA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00180"
FT   misc_feature    147396..148166
FT                   /gene="glnA"
FT                   /locus_tag="SSUSC84_0150"
FT                   /note="HMMPfam hit to PF00120, Gln-synt_C, score 1.3e-149"
FT                   /inference="protein motif:HMMPfam:PF00120"
FT   CDS_pept        complement(148650..150329)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0151"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0158"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50929"
FT                   /protein_id="CAZ50929.1"
FT                   /translation="MSSVNLKPHEVGVFAIGGLGEIGKNTYGIEYKDEILIVDAGIKFP
FT                   EDDLLGIDYVIPDYSYIVENLDRVKGLVITHGHEDHIGGIPFLLKQANVPIYAGPLALA
FT                   LIRGKLEEHGLLRDATLHEINHNTELTFKHLKVSFFRTTHSIPEPLGIVVDTPQGKIVC
FT                   TGDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKLIE
FT                   GIHGRIIFASFASNIFRLQQAADAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVPKDTF
FT                   IEPNEIKEYPASEIMILCTGSQGEPMAALSRIAHGTHRQVQLQPGDTVIFSSSPIPGNT
FT                   TGVNKLINILIEAGVDVIHGKINNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRMQK
FT                   IHASLAVDTGVPKDNIFIMENGDVLALTKDSARLAGQFNAQDIYVDGNRIGEIGAAVLK
FT                   DRRDLSEDGVVLAVATVDFNSKMILAGPDILSRGFIYMRESGELIRESQRVLFNAIRIA
FT                   MRNKDANIQTVNGAIVNALRPFLYEKTEREPIIIPMILTPDR"
FT   misc_feature    complement(149142..149264)
FT                   /locus_tag="SSUSC84_0151"
FT                   /note="HMMPfam hit to PF07521, RMMBL, score 3.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07521"
FT   misc_feature    complement(149148..149234)
FT                   /locus_tag="SSUSC84_0151"
FT                   /note="ScanRegExp hit to PS01292, UPF0036, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01292"
FT   misc_feature    complement(149658..150263)
FT                   /locus_tag="SSUSC84_0151"
FT                   /note="HMMPfam hit to PF00753, Lactamase_B, score 3.6e-30"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        complement(150333..150563)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0159"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50930"
FT                   /protein_id="CAZ50930.1"
FT                   /translation="MIYKVFYQESKISPRREQTRALYLDIDAASELEGRIIARELVETN
FT                   RPEYNIEFIDLLSDNHLEYEKEHADFKITEF"
FT   misc_feature    complement(150336..150560)
FT                   /locus_tag="SSUSC84_0152"
FT                   /note="HMMPfam hit to PF07288, DUF1447, score 4.5e-39"
FT                   /inference="protein motif:HMMPfam:PF07288"
FT   CDS_pept        151170..151853
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0153"
FT                   /product="glycoprotease family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0160"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50931"
FT                   /protein_id="CAZ50931.1"
FT                   /translation="MKILALDSSNQALSVALVEDGRLQAETLLAVKKNHSISLMPVVDF
FT                   LVAQVGWTPKDLDRIVVAQGPGSYTGLRVAVATAKTLAYTLKIDLVGLSSLQSLVPPSL
FT                   TGLVVPLIDARRNCVYAGVYENGRAVEPDRYWSFEDLLSSLSGKENITFVGEVENFMEQ
FT                   IEQALPTAQYQASLPSAYQLAVIGQDLPAVDVTSFEPNYLKHVEAEENWLKDNQVGSES
FT                   YIKRV"
FT   misc_feature    151233..151805
FT                   /locus_tag="SSUSC84_0153"
FT                   /note="HMMPfam hit to PF00814, Peptidase_M22, score
FT                   1.4e-53"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS_pept        151850..152290
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0154"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0161"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50932"
FT                   /protein_id="CAZ50932.1"
FT                   /translation="MIEIKHYDGQENLAEAVLAVMQSVYDQSPWTLEQIVSSMTSQYED
FT                   YYLAYEGQELVGFLAVQTVLDEMEILQIAVKTDFQRLGIASQLMAAVMDWDGDIFLEVR
FT                   ESNSAAQALYTRQHFTKIGKRKDYYRHPVEDAVIMKRERDER"
FT   misc_feature    151988..152209
FT                   /locus_tag="SSUSC84_0154"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        152280..153287
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0155"
FT                   /product="putative glycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0162"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50933"
FT                   /protein_id="CAZ50933.1"
FT                   /translation="MKDRLILAIETSCDETSVAVLRNDAELLSNVIASQIASHQRFGGV
FT                   VPEVASRHHVEVITACIEEALLEAEVTAEDLTAVAVTYGPGLVGALLVGISAAKAFAWA
FT                   NGLPLIPVNHMAGHLMAARAVKELEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLPYPAGRVIDELAHEGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   YHNAQQKGETLSNADLSASFQACVMDILMAKTKKALEQYPVKTLVVAGGVAANQGLRER
FT                   LAAEITDVEVIIPPLRLCGDNAGMIALAAVSEYNKENLAGWDLNAKPSLAFENL"
FT   misc_feature    152355..153203
FT                   /locus_tag="SSUSC84_0155"
FT                   /note="HMMPfam hit to PF00814, Peptidase_M22, score
FT                   3.1e-77"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS_pept        complement(153324..154160)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0156"
FT                   /product="AraC-family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0163"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50934"
FT                   /protein_id="CAZ50934.1"
FT                   /translation="MKIQPEFYVFNNRSYVDFYPIQFGMEACKPLHSFGPTMKQHYLFH
FT                   YIISGSGTFYDTSDQREYHLTAGQGFLISPDAICSYEADEKDPWTYIWLEFDGLKTEHF
FT                   LRQAGLSKEQPIFSQREMPTSSPVYHEMKQILALHHQKSALVLGHLYLFISCLIDCSLT
FT                   KTSSKHDENKEFYIREAINFVERNYEKAISVDDLAQVCNLNRHYFSRLFKEQMNISPQQ
FT                   FIIQYRLSEACELLKNTTKTLQEIAEEIGYSNQFNFSTAFKRHYQISPNRWRKIHK"
FT   misc_feature    complement(153336..153470)
FT                   /locus_tag="SSUSC84_0156"
FT                   /note="HMMPfam hit to PF00165, HTH_AraC, score 2.5e-12"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(153351..153479)
FT                   /locus_tag="SSUSC84_0156"
FT                   /note="ScanRegExp hit to PS00041, HTH_ARAC_FAMILY_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(153486..153626)
FT                   /locus_tag="SSUSC84_0156"
FT                   /note="HMMPfam hit to PF00165, HTH_AraC, score 2.8e-11"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(153522..153587)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1250.000, SD 3.44 at aa 192-213, sequence
FT                   ISVDDLAQVCNLNRHYFSRLFK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(153681..154106)
FT                   /locus_tag="SSUSC84_0156"
FT                   /note="HMMPfam hit to PF02311, AraC_binding, score 4.4e-22"
FT                   /inference="protein motif:HMMPfam:PF02311"
FT   CDS_pept        154375..155649
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0157"
FT                   /product="extracellular solute-binding lipoprotein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0164"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50935"
FT                   /protein_id="CAZ50935.1"
FT                   /translation="MKKIGRYVTLLAAAGLLAACSTSTESSKTTGGSSSGKTEISYAIW
FT                   DSGQEPGLRKIADEFEKKNPDIKINIQVSDWDSYWTMLEAGATGGSLPDTFWMHSNEIY
FT                   RYGSNEMLLPLDEYLAKSEDAKLANFPDGLNEIYNINGKQYAIPKDFDTIGLWYNKKLF
FT                   DEAGIPYPDDTWDWNKLKEVAKKLTKPDGSQYGFGAGLSNQEGYYNFIYQNGGKVITDD
FT                   LKSGYADPKTIEALDYYFSFVKEKISPAITVDKERAEAFQNGQVAMSVFGSWNLSGFTA
FT                   NDYIRENADVAVLPKGPDGTRATIFNGLGHAIAATTKHPDAAWKWVEYLSSKEAQEMQA
FT                   TLGVAISAYKGAADTWVDSNKNFTIKNYVDMVDYAQIRPYSQTTIKWEDKAYELLKPAY
FT                   LGEKATEEAAKETADMMNAELATEK"
FT   sig_peptide     154375..154455
FT                   /locus_tag="SSUSC84_0157"
FT                   /note="Signal peptide predicted for SSUSC84_0157 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.759 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    154393..155385
FT                   /locus_tag="SSUSC84_0157"
FT                   /note="HMMPfam hit to PF01547, SBP_bac_1, score 1.4e-40"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   CDS_pept        155718..156611
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0158"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0165"
FT                   /note="Possible alternative upstream translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50936"
FT                   /protein_id="CAZ50936.1"
FT                   /translation="MFRKKGSLNEAIWGWGMVAPTIIGLIVLNIIPIFQTMKMSFHKSG
FT                   DFGKGDIFVGLANYQRMLGDAQVWQATWNTLKYTILVVPATVALAMLLAVLLNSKIKGK
FT                   HIYRTIFFLPMVAAPAAVTMVWKWLYNTDFGLINYILRRLGLGAVNWIEDPKIALYSIA
FT                   LIGIWSTVGYSMILILAGLQEIPTDFYEAARIDGASPAKQFFSITLPLVSPTLFFVVVT
FT                   SVIQSMQVFDVIYMMEDVRSPAYDKTVSLVYLFYNNSFKYSDKGYGSTIVMLLLLIILV
FT                   ITFVQMKVQKKWVHYR"
FT   misc_feature    join(155751..155819,155949..156008,156045..156104,
FT                   156195..156263,156324..156392,156513..156572)
FT                   /locus_tag="SSUSC84_0158"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0158 by TMHMM2.0 at aa 12-34, 78-97, 110-129,
FT                   160-182, 203-225 and 266-285"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    155919..156602
FT                   /locus_tag="SSUSC84_0158"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 2.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        156622..157452
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0159"
FT                   /product="putative transport system permease"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0166"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50937"
FT                   /protein_id="CAZ50937.1"
FT                   /translation="MKQSAFKSTIWMHAFLILVAMGMLIPFVWMVLTSFKTVTESTQMN
FT                   PFHFLPSNWMVSNYTEAIRTNNFPILYLNTILMMLWRIFSSVMFSAMAAYAFARLEFPG
FT                   RNFLFGLVLFQMMVPPQLFVIPQYLMIDQLGMRNTIFALVFPGIVSAFGTFLLRQFFMG
FT                   LPKELEESAKLDGCNIGQTFFKVMLPLAKSGLIALAIFTALFAFKDLLWPLIINSEADK
FT                   ATLSSALSKIQGAYAVNYPQLMAASVLAIWPMLVLYVIFQKQFIQGIATSGGKL"
FT   misc_feature    join(156658..156726,156853..156921,156940..157008,
FT                   157036..157104,157165..157233,157336..157404)
FT                   /locus_tag="SSUSC84_0159"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0159 by TMHMM2.0 at aa 13-35, 78-100, 107-129,
FT                   139-161, 182-204 and 239-261"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    156835..157434
FT                   /locus_tag="SSUSC84_0159"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        157462..159663
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0160"
FT                   /product="putative alpha-galactosidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0167"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50938"
FT                   /protein_id="CAZ50938.1"
FT                   /translation="MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETAS
FT                   YQYVREDEYRALTSFVEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFV
FT                   YQGHAIYAGRSALKGLPHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAVTRS
FT                   ARFEQLGEKSVCLNRALSMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLK
FT                   GASSAEHNPFMALKRPTADEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERF
FT                   SWTLDKGEEFQTPEVVMVYSEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAM
FT                   SFDFDEETILSLAKEAAGLGVELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGII
FT                   DQVHAMGMKFGLWIEPEMVNRDSELYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQ
FT                   NIHDQLHRLLAEHDIDYIKWDMNRYMTEVFTCTREADRQGETFHRYILNLYRLYDSLIA
FT                   AFPTVLFESCSSGGARFDPGMLYYAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHV
FT                   SASPNQQLGRATPLNTRANVAFFGSFGYELDLFECSQEELEEMKEQIAFYKTHRKIFQQ
FT                   GIFTRLKSPFDGEITAWQVQSSDGQQVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLD
FT                   GEVYTGSQLMHTGLSIRHGDHVGDNKDFTSCLMVLQKQQ"
FT   misc_feature    158329..159525
FT                   /locus_tag="SSUSC84_0160"
FT                   /note="HMMPfam hit to PF02065, Melibiase, score 1.8e-233"
FT                   /inference="protein motif:HMMPfam:PF02065"
FT   misc_feature    158539..158586
FT                   /locus_tag="SSUSC84_0160"
FT                   /note="ScanRegExp hit to PS00512, ALPHA_GALACTOSIDASE,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00512"
FT   repeat_region   complement(159743..159846)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        159938..160639
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0161"
FT                   /product="AzlC family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0168"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50939"
FT                   /protein_id="CAZ50939.1"
FT                   /translation="MKKYAFREGMRDAIPTVLGYASIGLACGVVSVNSGISTVEMGLMS
FT                   LLIYAGSAQFVMCAMIFAGAPLLSIAVTVFFVNLRNFLMCLHATTIFQGNRLGSNILIG
FT                   SFVTDESYAVLLRKQIEHHTITPEWMYGNNFASYASWVTFTTLGNLIGGLIPNPEQFGL
FT                   DFALVAMFVGIFAGQLEAMVRTIPLKKIGLILLAVGLAYIGLSMMVSSYVAVLLATLLG
FT                   CFVGVMIDDKN"
FT   misc_feature    join(159974..160042,160100..160168,160337..160405,
FT                   160433..160501,160520..160624)
FT                   /locus_tag="SSUSC84_0161"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0161 by TMHMM2.0 at aa 13-35, 55-77, 134-156,
FT                   166-188 and 195-229"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    159977..160405
FT                   /locus_tag="SSUSC84_0161"
FT                   /note="HMMPfam hit to PF03591, AzlC, score 3.4e-60"
FT                   /inference="protein motif:HMMPfam:PF03591"
FT   CDS_pept        160626..160949
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0162"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0169"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50940"
FT                   /protein_id="CAZ50940.1"
FT                   /translation="MIKTNILLIILMAALVTWVPRVLPFVLTQNKSLPPKLVKFLSFLP
FT                   ITIIFALTLSSIMDEKVGSLPSFLPVESLAILPTFFVVLKTKNILLAVLVGVVTTALLR
FT                   LIF"
FT   sig_peptide     160626..160778
FT                   /locus_tag="SSUSC84_0162"
FT                   /note="Signal peptide predicted for SSUSC84_0162 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.769) with cleavage
FT                   site probability 0.486 between residues 51 and 52"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(160638..160706,160743..160796,160809..160877,
FT                   160890..160943)
FT                   /locus_tag="SSUSC84_0162"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0162 by TMHMM2.0 at aa 5-27, 40-57, 62-84 and
FT                   89-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    160641..160940
FT                   /locus_tag="SSUSC84_0162"
FT                   /note="HMMPfam hit to PF05437, AzlD, score 3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF05437"
FT   CDS_pept        160959..161981
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0163"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0170"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50941"
FT                   /protein_id="CAZ50941.1"
FT                   /translation="MVKENAKGVGLCFLLALVGQWLGHLFPLVGGPVFALLIGMGLYPY
FT                   FSSKNAFQSGLTFTSKKILQYAVICLGFGLNLSAVLAVGRQSLPIILSTISFALILAFL
FT                   MWKILPISSHLATLIGVGTSICGGSAIAATAPIIQADDEDVAQAISVIFLFNVLAALVF
FT                   PSLATWLGFSTDSGQAFGMFAGTAVNDTSSVTAAASTWDSLYGLGSQTLDTAVTVKLTR
FT                   TLAIIPITTVLAIWQTRGKGLKADKKSLLAGFPTFILYFILASLITTIAGGFGIGADWF
FT                   APLKSLSKFFICMAMVAIGLRTNVFALVKNGRAALMVGLVCWLGVTVLTLVWQAILGIW
FT                   "
FT   misc_feature    160977..161915
FT                   /locus_tag="SSUSC84_0163"
FT                   /note="HMMPfam hit to PF03601, Cons_hypoth698, score
FT                   2.7e-90"
FT                   /inference="protein motif:HMMPfam:PF03601"
FT   misc_feature    join(161019..161087,161145..161204,161217..161276,
FT                   161304..161372,161409..161477,161598..161666,
FT                   161703..161771,161814..161882,161901..161969)
FT                   /locus_tag="SSUSC84_0163"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUSC84_0163 by TMHMM2.0 at aa 21-43, 63-82, 87-106,
FT                   116-138, 151-173, 214-236, 249-271, 286-308 and 315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        join(162444..164939,164939..165541,165545..166138)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0171"
FT                   /note="N-terminal region is highly similar to previously
FT                   sequenced as Streptococcus suis extracellular protein
FT                   factor EF UniProt:Q07290 (EMBL:SSEPFAA) (1822 aa) fasta
FT                   scores: E()=0, 75.041% id in 1222 aa. CDS contains a
FT                   frameshift after codon 832, and a nonsense mutation (ochre)
FT                   after codon 1033. N-terminal region of pseudogene is
FT                   expressed"
FT                   /db_xref="PSEUDO:CAZ50942.1"
FT   sig_peptide     162444..162575
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /note="Signal peptide predicted for SSUSC84_0164 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.993 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    162462..162542
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /note="HMMPfam hit to PF04650, YSIRK_signal, score 1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF04650"
FT   misc_feature    162501..162569
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0164 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    164760..164936
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 1.2e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    165047..165259
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 4.7e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    166004..166123
FT                   /gene="epf"
FT                   /locus_tag="SSUSC84_0164"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        complement(166358..167980)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0165"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0173"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50943"
FT                   /protein_id="CAZ50943.1"
FT                   /translation="MKTILRYSWYQEKYNLHRSVNGFFYYLRKLPLVGKCIPESIFKSY
FT                   SFKSSLFLVLHILSIPSRFLIKGFWLLFHFYHASFWMNMLVNGELTFWKILPNTWLLGF
FT                   MFWLLFVGLSYRLGKSLDPVISKADREFMQNFSLSQSSFLQSQLFIEPILTTIYYLPAS
FT                   TIFCMITKEWLVFPIGLMTVLAGHLAGHALNRLLFERRIFSRRNSWHAWLWIAFVFVLY
FT                   VLAIVFRNQLSSGMLVPILLVQPFLIWFSYGYLKQQTNHLDYLSYCMDESLQMDKKLFE
FT                   MTKGNEYTRQGLQMQAKLNAKTGKDLSHLSGMTYLNALLFDRYKKVLYKKVQNWVLAVV
FT                   VILAALEGIRYFLDPFTFTEAYLLQFLPLSFMIMYVASSGKVVAQMVFVNCDISMLHYP
FT                   FYREAKTIIAGFNYRFLQTCKLNLIFATSLFLAIMVLGRFAFSLETILLTALLLISLTA
FT                   LFSFHDLFIYYILQPFTNDMDVVNPLYKFLSGALYWVAYLNTRINVGSHTYILLVSLAM
FT                   IAYVSIGYWILLKKAPQTFRLKA"
FT   misc_feature    complement(join(166394..166462,166490..166543,
FT                   166580..166648,166661..166720,166832..166900,
FT                   166928..166987,167216..167284,167297..167356,
FT                   167390..167458,167471..167539,167636..167704,
FT                   167762..167830))
FT                   /locus_tag="SSUSC84_0165"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SSUSC84_0165 by TMHMM2.0 at aa 51-73, 93-115, 148-170,
FT                   175-197, 209-228, 233-255, 332-351, 361-383, 421-440,
FT                   445-467, 480-497 and 507-529"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(167990..168688)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0166"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0174"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50944"
FT                   /protein_id="CAZ50944.1"
FT                   /translation="MQLKLSSISKKFDHKSILEDASFQFEQGKIYGLLGRNGAGKTTLF
FT                   NCIARNLTLDNGSIQFVKGEETLDYDNTDIGFTQTYPQLPAFMTAYEFVRFYMDIHKDK
FT                   LKSPRSPEEWLNLVGIGEEDQHRLLKDFSHGMQNKVQLLLSLIVQPPVLLLDEPLTSFD
FT                   PVAAHEFKQLIREAKKDSVIIFSTHILQLAQDLCDEIVLLHHQELQAVPSDKLHDPDFE
FT                   QEVVALLTAD"
FT   misc_feature    complement(168071..168607)
FT                   /locus_tag="SSUSC84_0166"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 9.8e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(168251..168295)
FT                   /locus_tag="SSUSC84_0166"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(169044..170219)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0167"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0175"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50945"
FT                   /protein_id="CAZ50945.1"
FT                   /translation="MNTVDTIIIGAGPAGMMAAISSSFYGKKTLLLEKNKRLGKKLSGT
FT                   GGGRCNVTNNGTLEDLLAGIPGNGRFLYSVFSQFDNHDIMNFFQENGVKLKVEDHGRVF
FT                   PTTDRSQTIIKCLEMKMLENGVDIRTGTEVVSVRKMDDLFHVKTSEEVFTAPQLIVTTG
FT                   GKTYPSTGSTGFGHDIARHFKLEVTEIEAAESPVLTDFPHKKLQGISLDDVTLTYGKHV
FT                   ITHDLLFTHFGLSGPAALRLSSFVKGGETAFLDVLPTHSDQDLFEHLEKNREKSVKNTL
FT                   SELMPDRLADFFAENYDSKVKQVSQKDLTELVTLLKVLPIKITGKMSLAKSFVTKGGVD
FT                   LKEINPKTLESKKVPGLHFAGEVLDINAHTGGFNITYCLATGWVAGSSYSS"
FT   misc_feature    complement(169056..170210)
FT                   /locus_tag="SSUSC84_0167"
FT                   /note="HMMPfam hit to PF03486, HI0933_like, score 1.8e-203"
FT                   /inference="protein motif:HMMPfam:PF03486"
FT   misc_feature    complement(170142..170201)
FT                   /locus_tag="SSUSC84_0167"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0167 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        170457..171857
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0168"
FT                   /product="putative beta-glucosidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0176"
FT                   /note="Similar to SSU1861, 74.464% identity (74.464%
FT                   ungapped) in 466 aa overlap (1-466:1-466)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50946"
FT                   /protein_id="CAZ50946.1"
FT                   /translation="MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQ
FT                   EPELFHQQIGPEQTSTFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQAVE
FT                   FYRAVFAGIRERGIKLLVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLV
FT                   DHWITFNEPIVPVECGYLGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHPDHKI
FT                   SIVLNLTPAYPRSQSPEDLQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPET
FT                   TEEELTIIKENRVDFLGVNYYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDKKINPHR
FT                   GWEIYEEGLYDIAKNIQENYGNIEWLVTENGMGVEGEGVFEENGMIQDDYRIHFMEDHL
FT                   IQLHRGIDEGANCKGYMVWTFIDCWSWLNTYKNRYGLVSLDLQTQKRTVKKSGYWFKQV
FT                   SAKNGFIR"
FT   misc_feature    170472..171848
FT                   /locus_tag="SSUSC84_0168"
FT                   /note="HMMPfam hit to PF00232, Glyco_hydro_1, score
FT                   6.9e-113"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   CDS_pept        172027..172521
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0169"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0177"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50947"
FT                   /protein_id="CAZ50947.1"
FT                   /translation="MGIEKTVSELAEILGVSRQAMNNRVKSLPEEFVDKNDKGVTVVNR
FT                   AGLIKLEEIYKTTIFEDEPISDEVKHRELMEILVDEKNAEIIRLYSQLKAKDKQLAEKD
FT                   EQLKVKDVQIAEKDKQLDQQQQLTLKAMADKEVLKLELDEVKAQAEEVQAKGFFARLFG
FT                   K"
FT   misc_feature    172039..172104
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1683.000, SD 4.92 at aa 29-50, sequence
FT                   KTVSELAEILGVSRQAMNNRVK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    172324..172467
FT                   /locus_tag="SSUSC84_0169"
FT                   /note="HMMPfam hit to PF04394, DUF536, score 2.1e-11"
FT                   /inference="protein motif:HMMPfam:PF04394"
FT   CDS_pept        172789..174831
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0170"
FT                   /product="putative PTS multi-domain regulator"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0178"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50948"
FT                   /protein_id="CAZ50948.1"
FT                   /translation="MVDNRTMAILMELFATRKESLYELSIQTGIEKEQLHSNLELVNQL
FT                   LQEHSFPQIQYKDSEFVISTELYNQKESVFSLFRNRQIYLSQEERQLLIYLYTFIRKEF
FT                   VSNVHYQELLSVSRNTTLTDIKNVKELCLDFQVRLEYTRAKGYHLIGREEDKHRLALYA
FT                   LSNCLQSSIGVWALDYILKSWGEENPIEELKIVSQQACNYYKVSALEERLDEYLYFLIF
FT                   LFIRQARVGNRINWNFEGKGGFVKDFLQRLWKLLRLKSTSTLELNAATQEYLSHLLQGC
FT                   LEGESGEKDDLFYHLTVEIVEEMERLSLITFEHRSEMIEGLQRHLIPAYYRLTSRLVNV
FT                   NSYTETIKEEHADLFYLVKKALRPLEEHLGFTIPDSEVSYFVIHFGGYIEAGQQRSYRY
FT                   RALVVCPNGVSSSLIVKENLRQLFPNIYFADTHSLQDWKMLDMTDYDMVFGTIKLNIEL
FT                   PFFLVSQLMTSNHKKELFHLVNQHFPNAAYFPIEIEQLLSLVGKHATIHQEQALKYELV
FT                   QFLNQRSHEQRGRSPMLEELITKETFQWSEEVLDWQKAVALAARPLVDKGAIETRYIDA
FT                   MIAKVEEFGPFIDLGKGIAIPHARPEDGVNEVGMSMLVLDKPVYLLDDPSHEIRLFICI
FT                   AAVDNQTHLRALSHLTKILREEENIQQLVGTKEFADVQHLLKEEQ"
FT   misc_feature    173680..173952
FT                   /locus_tag="SSUSC84_0170"
FT                   /note="HMMPfam hit to PF00874, PRD, score 4.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    174394..174825
FT                   /locus_tag="SSUSC84_0170"
FT                   /note="HMMPfam hit to PF00359, PTS_EIIA_2, score 4.6e-28"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   misc_feature    174535..174585
FT                   /locus_tag="SSUSC84_0170"
FT                   /note="ScanRegExp hit to PS00372, PTS_EIIA_TYPE_2_HIS,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00372"
FT   CDS_pept        174833..175117
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0171"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB subunit protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0179"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50949"
FT                   /protein_id="CAZ50949.1"
FT                   /translation="MLRIGTACGSGLGSSFMVQMNIESILRDLGVSDVHVEHYDLGGAN
FT                   PSEADVWIVGRDLADSATHLGDVRILNSIIDMNELRELVTAICQEKGLV"
FT   misc_feature    174839..175099
FT                   /locus_tag="SSUSC84_0171"
FT                   /note="HMMPfam hit to PF02302, PTS_IIB, score 1.3e-24"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS_pept        175171..176517
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0172"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0180"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50950"
FT                   /protein_id="CAZ50950.1"
FT                   /translation="MILDFLIDIAKTPAILVALIAILGLALQKKPAADLVKGGLKTFVG
FT                   FIVVGGGANIIVGSLEPFGQMFEQAFNLKGVVPNNEAIVAMALDKYGTATSLIMLLGMV
FT                   FNIAIARFTRFKYIFLTGHHTLYMACMIAVIMSVAGFTSVGLIVMGGLALGLIMTLSPA
FT                   FVQKYMIQLTGNDHVALGHFSALGYWLSGVVGGLVGDKSKSTEDINFPKGLAFLRDSTV
FT                   SIAISMSLIYMIVALFAGGDYIKENLSGGTNSMIYALTLGGTFAAGVFVILSGVRLILA
FT                   EIVPAFKGISEKLVPNSKPALDCPVVYPYAPNAVLIGFISSFAGGIVSMIILALTGGVV
FT                   ILPGVVPHFFCGATAGVMGNASGGVRGAVCGAFMQGVLISFLPVFLLPVLGDLGFAGST
FT                   FSDADFGLSGIFLGVLAKNGGILTVSVGIFAVLALMLGLSLVKKEQKEG"
FT   misc_feature    175171..176394
FT                   /locus_tag="SSUSC84_0172"
FT                   /note="HMMPfam hit to PF04215, SgaT_UlaA, score 1.6e-120"
FT                   /inference="protein motif:HMMPfam:PF04215"
FT   misc_feature    join(175183..175251,175285..175353,175441..175500,
FT                   175519..175587,175597..175665,175834..175902,
FT                   175945..176013,176107..176175,176185..176253,
FT                   176272..176340,176425..176493)
FT                   /locus_tag="SSUSC84_0172"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSUSC84_0172 by TMHMM2.0 at aa 5-27, 39-61, 91-110,
FT                   117-139, 143-165, 222-244, 259-281, 313-335, 339-361,
FT                   368-390 and 419-441"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        176519..177367
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0173"
FT                   /product="putative transketolase subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0181"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50951"
FT                   /protein_id="CAZ50951.1"
FT                   /translation="MTSGTADLKRFAKEIRYHTLATLNQLGFGHYGGSLSIVEVLAALY
FT                   GEILDIRVQNFSSKERDHFILSKGHAGPALYSTLYLKGFFDRDFLLSLNQNGTHLPSHP
FT                   DRNLTPGVDMTTGSLGQGMSVATGVAYGKKIEQSPYYTYTLVGDGELNEGQCWEAAQFA
FT                   AHHELSKMILFVDDNKKQLDGRTHDICQTFDFVEKFQAFGWESVRVNGADIDAIINAIL
FT                   TMKSSKSPQPKCIVLDTTKGQGVTFLEELESNHHLRLSGQLREDLEQVTLVLARELEVT
FT                   E"
FT   misc_feature    176537..177283
FT                   /locus_tag="SSUSC84_0173"
FT                   /note="HMMPfam hit to PF00456, Transketolase_N, score
FT                   1.4e-37"
FT                   /inference="protein motif:HMMPfam:PF00456"
FT   CDS_pept        177364..178290
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0174"
FT                   /product="putative transketolase subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0182"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50952"
FT                   /protein_id="CAZ50952.1"
FT                   /translation="MRQTKEMRLVYSDFLAQVGQEDTTIAAIEADLSSSMATNKLSSVL
FT                   GGRYVNVGIMEQEMVGVAAGLSLLGYKPYIHTFGPFASRRVYDQVFISLAYAQLNATIV
FT                   GSDAGVSAEMNGGTHMPFEELGLMRLIPKARVYEVSDDVLFQAVLKETIKVDGLKYIRT
FT                   IRKAPTPIYQGGEDFSKGYCVLRQGEDMTLLASGIMVEQALKAADQLEAQGVSVQVIDL
FT                   FRIKPIHEDISALLSGRPVLTVENHNRIGGLGSSICELMATDLTTPVHRIGIEESFGQV
FT                   GQQAYLMDVYGLTAEYIVKQAQLMLQQ"
FT   misc_feature    177370..177771
FT                   /locus_tag="SSUSC84_0174"
FT                   /note="HMMPfam hit to PF02779, Transket_pyr, score 3.5e-17"
FT                   /inference="protein motif:HMMPfam:PF02779"
FT   misc_feature    177904..178257
FT                   /locus_tag="SSUSC84_0174"
FT                   /note="HMMPfam hit to PF02780, Transketolase_C, score
FT                   5.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02780"
FT   CDS_pept        178481..180241
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0175"
FT                   /product="putative glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0183"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50953"
FT                   /protein_id="CAZ50953.1"
FT                   /translation="MKKIQREFQKIYYNLDKILLLFFTLFTFMEFVWIPLNSWISEGLL
FT                   AMTGHAYLSPTNLLSVFAENLLVTGLFILLFFVNIAIAYLELALLFTGVWQLLDEKVKH
FT                   LTDYLRDVRDSMVAIIRHSSLPKVLFLLFYSVILLPFLRRVLNIYYFNKIVVPQFIVDY
FT                   LSNTVWLGILILIFLLLFFWLAARFMYALPNIYFEHRGVKESIAYSWEKTRGRKQIGSL
FT                   FRLIWLVTFPVLLFTGVGGLFYLVQLLAEHFVPSASYWLAVVCYALLKLAYYGVVALFM
FT                   MGFVSLLTGKQLPIYRRKRLRHHLRLAILLVSGLVFGTQGALALYFPFDTLPVTISHRG
FT                   VDDGNAVQNSIEALEKTSQLKPDYIEMDVQETKDGQFIVMHDTDLLALTGNPGGTHDYT
FT                   LAELTGMTASENGMAAPVPSFDEYLEKADELGQKLLVEIKVTKADSPKLTQNFLKKYGQ
FT                   RLIAKGHQMQSLDYRTIIEIKQYSEKLVSFFILPFNSIYPTTVADGYTMEYTSLDQNFM
FT                   TKSWIRGKSVYAWTPNEEESMTKMLLLQVDGIITDNMTDLQSLMEEMKENRRYPDLFFQ
FT                   QFQSLIYNFE"
FT   misc_feature    join(178535..178603,178661..178729,178862..178921,
FT                   178979..179038,179144..179212,179255..179323,
FT                   179399..179467)
FT                   /locus_tag="SSUSC84_0175"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUSC84_0175 by TMHMM2.0 at aa 19-41, 61-83, 128-147,
FT                   167-186, 222-244, 259-281 and 307-329"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    179492..180148
FT                   /locus_tag="SSUSC84_0175"
FT                   /note="HMMPfam hit to PF03009, GDPD, score 5.4e-15"
FT                   /inference="protein motif:HMMPfam:PF03009"
FT   CDS_pept        complement(180285..180584)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0184"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50954"
FT                   /protein_id="CAZ50954.1"
FT                   /translation="MMNMQNMMRQAQKLQKQMEKSQAELAATQFTGSSVQDLVTATFTG
FT                   DKKLVSIDFKADVVDADDLETLQEMTIQAVNAALTKVDEATQKKLGAFAGKLPF"
FT   misc_feature    complement(180288..180563)
FT                   /locus_tag="SSUSC84_0176"
FT                   /note="HMMPfam hit to PF02575, DUF149, score 4.9e-33"
FT                   /inference="protein motif:HMMPfam:PF02575"
FT   CDS_pept        180851..182020
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SSUSC84_0177"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0185"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50955"
FT                   /protein_id="CAZ50955.1"
FT                   /translation="MFRLAKEELEKLGAIITATEIYQQPGLWKEAYQLYFDQLEKIESF
FT                   LKSIKEKHDFVHVVFTGAGTSDFVGQSIANYLNQVNDLKHIRFSAIGTVELVSRPHDYL
FT                   QADVPTVLVSFARSGNSPESVAAVEVAKQLVDKLYQVTITCAPEGKLALAAEGDAENLL
FT                   LLQPAGSNDKGFAMTGSYSCMALTALLVFSSASQEEKAAWVEIIARLGQDVLDREDYVQ
FT                   DLINLDFERVIYLGSGGFYGLAHEAQLKILELTAGKIATMYESPLGFRHGPKSFINEKT
FT                   LIFLFASNDAYTRQYDVDLLNEVHGDGIAERIVALSADKLVGTEAANFVLAEGGADLPD
FT                   VFLTFPYILFAQTVSIMAAIKCNNLPDTPSPTGTVNRVVQGVIIHPLEK"
FT   misc_feature    181001..181441
FT                   /gene="agaS"
FT                   /locus_tag="SSUSC84_0177"
FT                   /note="HMMPfam hit to PF01380, SIS, score 0.0063"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    181523..181933
FT                   /gene="agaS"
FT                   /locus_tag="SSUSC84_0177"
FT                   /note="HMMPfam hit to PF01380, SIS, score 0.0065"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS_pept        182150..183835
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0178"
FT                   /product="putative surface-anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0186"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50956"
FT                   /protein_id="CAZ50956.1"
FT                   /translation="METANKKFRYSIRKFKVGVGSVLIATCLLGAGVSTPTAFATTETS
FT                   TATQVEAMAKVEEVQKLVKELEKELGELDKVPSYGDAQDYSYQKALWEEFLRIGKDNMD
FT                   YASKMKADDKFFHKVKGDLNDFKYQIKVENYIRQVAELRKKYPGDNTIEEEYNAHLKQD
FT                   EGKSIASQEGATLRDYVDREASEAMGRIKQRVAELEKSKQPQPSPADEPAPAPKEEETP
FT                   APKEEDTPAPDAAPAPAPTPEVDPAPTPIPDTPKAEEEAPTPVPDTPAPKEDEVPAPIP
FT                   DAPTPKVEEETQEPKTEEKAPETKEETPTPVPDTPAPKEDEVPAPMPDAPAPKAEEEVP
FT                   APTPMPETPMDKPKTDKVESDKQMPEAKQPEMEQPKAEDMPKEEMPKSEQPKSEDSAPK
FT                   TAVPEVAPKTAEKPKLDFTTKERKVEEALPIKEEIRYDASLPLGKSYLLQEGKAGKKVS
FT                   VYQDVIVDGKVVATNLLSETVVEGQNRILVKGSLEMKKEEVKTTPSVQSNPTLSHKGAP
FT                   SANKATLPATGEQRNNLALVGLGLAGISLAVVATAINKKSKDQI"
FT   sig_peptide     182150..182269
FT                   /locus_tag="SSUSC84_0178"
FT                   /note="Signal peptide predicted for SSUSC84_0178 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.797 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    182159..182239
FT                   /locus_tag="SSUSC84_0178"
FT                   /note="HMMPfam hit to PF04650, YSIRK_signal, score 7.3e-11"
FT                   /inference="protein motif:HMMPfam:PF04650"
FT   misc_feature    join(182198..182266,183749..183808)
FT                   /locus_tag="SSUSC84_0178"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0178 by TMHMM2.0 at aa 17-39 and 534-553"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    183395..183628
FT                   /locus_tag="SSUSC84_0178"
FT                   /note="HMMPfam hit to PF07501, G5, score 1.6e-14"
FT                   /inference="protein motif:HMMPfam:PF07501"
FT   misc_feature    183695..183817
FT                   /locus_tag="SSUSC84_0178"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   0.00033"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        complement(184112..186379)
FT                   /transl_table=11
FT                   /gene="pepXP"
FT                   /locus_tag="SSUSC84_0179"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0187"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50957"
FT                   /protein_id="CAZ50957.1"
FT                   /translation="MRFNQFSFIKKETSVYLQELDTLGFQLIPDASSKTNLETFVRKCH
FT                   FLTANTDFALSNMIAEWDTDLLTFFQSDRELTDQIFYQVAFQLLGFVPGMDYTDVMDFV
FT                   EKSNFPIVYGDIIDNLYQLLNTRTKSGNTLIDQLVSDDLIPEDNHYHFFNGKSMATFST
FT                   KNLIREVVYVETPVDTAGTGQTDIVKLSILRPHFDGKIPAVITNSPYHQGVNDVASDKA
FT                   LHKMEGELAEKQVGTIQVKQASITKLDLDQRNLPVSPATEKLGHITSYSLNDYFLARGF
FT                   ASLHVSGVGTLGSTGYMTSGDYQQVEGYKAVIDWLNGRTKAYTDHTRSLEVKADWANGK
FT                   VATTGLSYLGTMSNALATTGVDGLEVIIAEAGISSWYDYYRENGLVTSPGGYPGEDLDS
FT                   LTALTYSKSLQAGDFLRNKAAYEKGLAAERAALDRTSGDYNQYWHDRNYLLHADRVKCE
FT                   VVFTHGSQDWNVKPIHVWNMFHALPSHIKKHLFFHNGAHVYMNNWQSIDFRESMNALLS
FT                   QKLLGYENNYQLPTVIWQDNSGEQTWTTLDTFGGENETVLPLGTGSQTVANQYTQEDFE
FT                   RYGKSYSAFHQDLYAGKANQISIELPVTEGLLLNGQVTLKLRVASSVAKGLLSAQLLDK
FT                   GNKKRLAPIPAPKARLSLDNGRYHAQENLVELPYVEMPQRLVTKGFMNLQNRTDLMTVE
FT                   EVVPGQWMNLTWKLQPTIYQLKKGDVLELILYTTDFECTVRDNSQWQIHLDLSQSQLIL
FT                   PH"
FT   misc_feature    complement(184124..184843)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUSC84_0179"
FT                   /note="HMMPfam hit to PF08530, PepX_C, score 1.7e-85"
FT                   /inference="protein motif:HMMPfam:PF08530"
FT   misc_feature    complement(184373..184405)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUSC84_0179"
FT                   /note="ScanRegExp hit to PS00133, CARBOXYPEPT_ZN_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00133"
FT   misc_feature    complement(184883..185836)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUSC84_0179"
FT                   /note="HMMPfam hit to PF02129, Peptidase_S15, score
FT                   2.3e-130"
FT                   /inference="protein motif:HMMPfam:PF02129"
FT   misc_feature    complement(185951..186379)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUSC84_0179"
FT                   /note="HMMPfam hit to PF09168, PepX_N, score 7.7e-82"
FT                   /inference="protein motif:HMMPfam:PF09168"
FT   CDS_pept        186561..187295
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0188"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50958"
FT                   /protein_id="CAZ50958.1"
FT                   /translation="MLRKNEAIVPILRINNRAINQGFLEENLGMKTKLEDGPFADFGDR
FT                   TSPEAKLVLTESPGNRTRAVEGLKKLNKIVIKVDNASEIEALLAQGSQYSKLYQGKNGY
FT                   GFEALSPEGDTFLLHAEASVDDLKAILPPVPFKVQDDFSGLTAFTVESVWINTPQASIS
FT                   QDYYEAILPQQAFLRFVGAEGKDLLTPAEQVWDLEGLRFPVEQDFDWAHLESRLERPFF
FT                   KDKKASFIQTVDPSGIELWFEK"
FT   CDS_pept        join(187292..187369,187369..188238)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0181"
FT                   /product="putative beta-lactamase (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0189"
FT                   /note="CDS contains a frameshift after codon 24. Frameshift
FT                   occurs at a poly T heptamer. Similar to Streptococcus
FT                   pneumoniae hypothetical protein sp1448 UniProt:Q97PZ0
FT                   (EMBL:AE007441) (311 aa) fasta scores: E()=3.2e-69, 60.526%
FT                   id in 304 aa"
FT                   /db_xref="PSEUDO:CAZ50959.1"
FT   misc_feature    join(187304..187369,187369..188193)
FT                   /locus_tag="SSUSC84_0181"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   4.8e-46"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   repeat_region   complement(188237..188342)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(188645..190990)
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUSC84_0182"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0191"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50960"
FT                   /protein_id="CAZ50960.1"
FT                   /translation="MSTKVKTKNVAEDIFAQAWEGFKGTDWQDKASVTHFVQANYTPYD
FT                   GDESFLAGPTERSLHIKKIIEETKAGYEDTRFPMDVDRATSIADIPAGFIDKENELIFG
FT                   IQNDELFKLNFMPRGGIRMAETTLIENGYTPDPLLHEIYTKHATTVNDGIFRAYTADIR
FT                   RARHSHHVSGLPDAYSRGRIIGMYARLALYGADYLMEEKVADWNAITEIDEESIRLREE
FT                   INMQYQALQQVVRLGDHYGVDVRKPAMNTKEAIQWTNIAFMAVCRVINGAATSLGRVPI
FT                   VLDIYAERDLARGTFTEAEIQEFVDDFVLKLRTVKFARTKAFDEIYSGDPTFLTTSMAG
FT                   MGNDGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWSDQLPYSFRRYCMAMSHKHSSIQY
FT                   EGVTTMAKDGYGEMSCISCCVSPLDPESEDQRHNIQYFGARVNVLKALLSSWNNGYDDV
FT                   HKDYKVFDGVEPNTSEVFDYDQVVKNFEIALDWLTDTYVDAMNIIHYMTDKYNYEAVQM
FT                   AFLPTHLRANMGFGICGFANTVDSLSAIKYAQVKPIRDEDGFIYDYEVTGDFPRYGEDD
FT                   DRVDDIAKWLMEAFFTRLNKHKLYKNAEATVSILTITSNVAYSKQTGNSPVHRGVFLNE
FT                   DGSVNTTKVEFFPPGANPTSKARGGWLQNLNTLSKLNFKHANDGISLTTQVSPKALGKT
FT                   FDEQVNNLVTILDGYFEQGGQHVNLNVMDLNDVYEKIMAGEDVIVRISGYCVNTKYLTK
FT                   EQKTELTQRVFHEVLSMDDHAAEVSGQA"
FT   misc_feature    complement(188744..189052)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUSC84_0182"
FT                   /note="HMMPfam hit to PF01228, Gly_radical, score 6.7e-41"
FT                   /inference="protein motif:HMMPfam:PF01228"
FT   misc_feature    complement(188753..188779)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUSC84_0182"
FT                   /note="ScanRegExp hit to PS00850, GLY_RADICAL_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00850"
FT   misc_feature    complement(189134..190939)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUSC84_0182"
FT                   /note="HMMPfam hit to PF02901, PFL, score 7.5e-297"
FT                   /inference="protein motif:HMMPfam:PF02901"
FT   CDS_pept        191306..192373
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="SSUSC84_0183"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0192"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50961"
FT                   /protein_id="CAZ50961.1"
FT                   /translation="MLIFPLINDLSRKIIHVDMDAFFAAIEVRDSPALKGKPVIIGADP
FT                   RLSGGRGVVSTCNYEARAFGIHSAMSSKEAYERCPQAIFISGNYEKYQEVGRQVREIFH
FT                   RYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKFLAK
FT                   IASDMEKPHGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLDVPEM
FT                   VLIDRFGRFGFDLYRKARGISNSPVKVDRVRKSSGKERTYRKLLYREEDVLKELISLCQ
FT                   RVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIEEIGKIE
FT                   KGIRLLGVTVTNFQT"
FT   misc_feature    191354..192370
FT                   /gene="dinB"
FT                   /locus_tag="SSUSC84_0183"
FT                   /note="HMMPfam hit to PF00817, IMS, score 1e-103"
FT                   /inference="protein motif:HMMPfam:PF00817"
FT   CDS_pept        192416..192835
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0184"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0193"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50962"
FT                   /protein_id="CAZ50962.1"
FT                   /translation="MQISSRFTIASHILVLLALEGEKEKQTSTSIAGSVGVNPVIIRNI
FT                   LSQLKEAGLVEVARGIGGARLAQGPDQITLLHVYQAVELFGEKGQLFAFHEQPNPSCQV
FT                   GRNIHPLLDSRLENAQSALENELAKTRLADLLAEL"
FT   misc_feature    192416..192796
FT                   /locus_tag="SSUSC84_0184"
FT                   /note="HMMPfam hit to PF02082, Rrf2, score 4.4e-42"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   CDS_pept        193074..193700
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0194"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50963"
FT                   /protein_id="CAZ50963.1"
FT                   /translation="MKIAIIAANGQAGQTIAKEAVERGHQVTAIVRSENKSVAQEVIQK
FT                   DAFALTKEDLAGFDVVVNAFGAWTPETLPDHARLAEHLATILAGSPTRLLVVGGAGSLY
FT                   LDESQTAMLKDTPDFPAEYLPIAEAMGTGLDLYRQATAVNWTYISPAADFDAEGQKSGA
FT                   YTLAGEVFQVNAQGESYISYADYAVALVDIAEKGGYQQERISVLA"
FT   CDS_pept        193802..194722
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0186"
FT                   /product="putative tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0195"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50964"
FT                   /protein_id="CAZ50964.1"
FT                   /translation="MIHLICPNPALDRTLLVEKIEKNIPLRPTEVRDYPGGKSFNVAYA
FT                   LRENGVTDYTIHTILGGQIGRYIQELNADGGNALRVVENSQNTRTCNIYVETSTGDVVL
FT                   FYEKGFELTEDLLNQFTQQIENSLQAGDILVFSGSLMKGMSDDYIQRFIEKYPEVLTIV
FT                   DTSGPALRAAYQARPALIKINNEELKDIYPELDEESPEAILGILKEVTPHENIIITMGD
FT                   KGSLAKIGQRFFRIQSPKKETRNPIAAGDFYLGLLVKGISQGQAPEIFLKEAAAFATAN
FT                   CLNYFPEVEAEQFEAIVDTIVLEEL"
FT   misc_feature    194276..194647
FT                   /locus_tag="SSUSC84_0186"
FT                   /note="HMMPfam hit to PF00294, PfkB, score 8e-11"
FT                   /inference="protein motif:HMMPfam:PF00294"
FT   CDS_pept        194788..195408
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0187"
FT                   /product="HhH-GPD superfamily base excision DNA repair
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0196"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50965"
FT                   /protein_id="CAZ50965.1"
FT                   /translation="MEQLTVLYQNLKRRYGEFHWWNDENPIKDLVSMILIQQTTEANAK
FT                   RALEQLEGRLTIHSLLEMPVEDLQECIRPAGFFKQKSLYIRSVVEWANQFDGDFSRLDR
FT                   VETAVLRKELLSLKGVGNETADVILLYLCRRSVFVADQYALRLFNRLGLSQSQDYLSLR
FT                   QEFTEQIKDWSVKDAQELHALIDEHGKQFRLTKGQLDESWLMI"
FT   misc_feature    194878..195303
FT                   /locus_tag="SSUSC84_0187"
FT                   /note="HMMPfam hit to PF00730, HhH-GPD, score 1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00730"
FT   misc_feature    195118..195180
FT                   /locus_tag="SSUSC84_0187"
FT                   /note="HMMPfam hit to PF00633, HHH, score 3.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS_pept        complement(195409..195507)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0188"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0197"
FT                   /note="Similar to SSU0385, 62.500% identity (62.500%
FT                   ungapped) in 32 aa overlap (1-32:1-32);SSU1880, 59.375%
FT                   identity (59.375% ungapped) in 32 aa overlap
FT                   (1-32:1-32);SSU1884, 54.839% identity (56.667% ungapped) in
FT                   31 aa overlap (2-32:1-30); and to an internal region of
FT                   SSU0853, 53.125% identity (53.125% ungapped) in 32 aa
FT                   overlap (1-32:43-74)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50966"
FT                   /protein_id="CAZ50966.1"
FT                   /translation="MKIKIKLGDANADRTEVHQIMSTTSDFDFRRV"
FT   CDS_pept        complement(195691..196890)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0189"
FT                   /product="putative repressor protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0198"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50967"
FT                   /protein_id="CAZ50967.1"
FT                   /translation="MGKKEETIRNISGNILKTLFRHQKSSRTRISKSLKITPATITNMI
FT                   SYLVAEKKVIETGDEVRDYIGSGRSRRLITVNSQYRHYIGIEINANGIYLAVTDTIGNL
FT                   ITNSNIKITEYDSKQINEIIIQLVTETLDKFSYLEFGALGIAVPGHFDSKSGHIISNNV
FT                   KWIYFDLAVIKQSISIPIFLENNINCMAIGSYLFHPESSPEQFLFIHIGPGLFCSFFDS
FT                   EHILQNKNFYIGEIGHTVVDLNGPSCECGKRGCLQTYISDTWLINNARFLFENVQGSII
FT                   KTLVEKPEDITLDVVYNAYRLGDGFIIEKIESGIDFLTTSIANTLIIYDSKKIFINSQL
FT                   LNYPGFSEKVNNLVDNQLQFIPSKNNLDIEFLSFNIFRGAIGAASLAVYNHFILENNSN
FT                   "
FT   misc_feature    complement(196096..196191)
FT                   /locus_tag="SSUSC84_0189"
FT                   /note="HMMPfam hit to PF00480, ROK, score 8.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   misc_feature    complement(196753..196818)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1405.000, SD 3.97 at aa 25-46, sequence
FT                   SSRTRISKSLKITPATITNMIS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        197083..198411
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0190"
FT                   /product="sugar phosphotransferase system (PTS), IIC
FT                   component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0199"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50968"
FT                   /protein_id="CAZ50968.1"
FT                   /translation="MNGLMHFLEHKLAPFGTKVGNQRHLKAVRDGFMMAMPLVLVGSFF
FT                   LLLISWPDQASGGFSVVGFLEQIGLLGILNRLNQSTMAIISLIATFGIAYRLSESYETD
FT                   GPSAGVIALSSFILLAPRFSTMVFNESGEQINQVFAGAIPFGSLNASALFVAIAVGLVS
FT                   AEIYRFFIQRGITIKMPKNVPDVVGKSFAALLPALTTLIFWACVFQGLEAAGVEGGLGA
FT                   VLGLIVGKPLGLIAGSLGGMVLVVLVNSLFWFTGVNGGQVLNAFVDPVWLQFTEANQLA
FT                   AAAGEKLPHIITLPFKDLFVFMGGGGATVGLALCLLVFSKSRTFKSLGRISFIPSLFNI
FT                   NTAILFSFPTVLNPIMMIPFILTPTVNAIITYFAMATGLVPMTTGVVLPWTMPPILGGF
FT                   LATGGSIQGAILQIILIGVSFIIYYPFFKVADNKNLELEESGE"
FT   misc_feature    197167..198174
FT                   /locus_tag="SSUSC84_0190"
FT                   /note="HMMPfam hit to PF02378, PTS_EIIC, score 1.2e-86"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    join(197173..197241,197299..197367,197401..197469,
FT                   197527..197595,197653..197721,197779..197847,
FT                   197977..198042,198100..198168,198187..198255,
FT                   198298..198363)
FT                   /locus_tag="SSUSC84_0190"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUSC84_0190 by TMHMM2.0 at aa 31-53, 73-95, 107-129,
FT                   149-171, 191-213, 233-255, 299-320, 340-362, 369-391 and
FT                   406-427"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        198416..200302
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0200"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50969"
FT                   /protein_id="CAZ50969.1"
FT                   /translation="MKLTIFDKVQNKTSQFAIDELTYYLKAIFDFELGKTTVEEDANVL
FT                   LSKEYLDNNDTIGIEMKNGNAILTGNSDVSILIAVYRLLSEFGAVFTRPGRKHELIPSL
FT                   TITDWNEKELSIHETASYKHRGVCIEGADSYQNTKEFLDWLPKINMNSFFIQFENPYSF
FT                   LKRWYEHEFNPYADKEDFNTEIAQQMSDLLDEELSKRGLIHHRVGHGWTGEVLGYSSKY
FT                   GWESGLKLPEEKKPLVAELNGKRELFNTAPILTSLCFSNPDVGERMCELIVNYAKERKD
FT                   VDYLHVWLSDARNNICECEKCKQEIPSDQYVRILNQLDRKLSEEGLNTKICFLLYHELL
FT                   FAPKHEVLENPERFTMMFAPITRTFEMSYADVDYENDVPLPNEYSRNNIVLPNSLEENL
FT                   SYLFSWQKVFNGDSFVYDYPLGRAHYGDLGYMKISKVIFRDVVYLKKLGLNGYISCQEL
FT                   RAGFPHNFPNFVMGQMLWNRNLEYDELKALYFSSLYGSEWKSVVTYLEKLSDYSSCDYF
FT                   NSIGDRQNAELSMKYNISSKLAFNFINTLEENVAKNNGIQRDAWRQLGYHREYVVKLAN
FT                   ALHLMASGDHLDGQIRWKDFLDYIRNHEPDFQQYLDVYRIIEVAKNYAGFKL"
FT   CDS_pept        200422..204138
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0192"
FT                   /product="putative surface-anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0201"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50970"
FT                   /protein_id="CAZ50970.1"
FT                   /translation="MNKKIFLKSAIILLSVTCLINAIKALDSSGVSSSTGEIVNQDRIY
FT                   NITLKVKTDGVYNDLGGNVISENNVLSGISGTKINLKVSTNSGYRFVGYQSFLESGNST
FT                   DGLLPIENDSFEISDKTGNVTVVAMFEKIPIDETIYFSDEFSTENINNYLLSENLIGKI
FT                   AVSNGKLNIHAPGVSSIKPILSRQIDESSTLGYEIQFSIQQIGEVKQWNTFRVVFKENS
FT                   DGSVYALEFTGKAVSIKKLSSIDAPNQTGEKYAETGHNLGSEEHRIRLVVRGDTVTVSD
FT                   NEIPLLSYSSPENWEGATASIVFTPISNRSVSLDDIIIRQTRALRSLLVVSRIDGQEVT
FT                   DIQPGSIRGNTSQVFVGDSLPLEVIEKPGYQFIGFKDEFGNVVDLSTFSVPNDESDLVI
FT                   YADFQTAEVVNRETKTFYIDSIEGNDTNSGESETNAWKTLEQLRKNTLIAGDRVLLKRG
FT                   SRFVGEDAALTFKGSGLEDAPILISSYGEGELPLLEAQGKIESVIKLYNQEYITIENLE
FT                   ITNLDPNFSTSFELNSNNNRSKILRGVHVIAEDYGVVHDIVLRNMYLHDINGNLNSKWN
FT                   GGIFFDVYGTTVPTKYDGILIENNYLERVDRSGIKLVGSTWANQNLKNNKNIPLNWYPS
FT                   TNVVVRGNRIEKAGGDSITVRDTDGALIEYNISADARYQDTGYNAGIWPFQASNTVIQY
FT                   NESFRTHGVQDGQGLDLDHVSNNSVMQYNYSHDNEGGFMLIMNWYEQTSPTVRYNISQN
FT                   DKDKILELARGGAQGTAIYNNTIFSDSKLTGRAGVIDMPSTSGGTGVKDIFLFNNIFYF
FT                   TDGEKMFVEASDAGKYKDSIHFYNNAYVGVEVPDDPKAITEGITLKGVGTGPTENKSMI
FT                   ANAGKFLTGQLDGYRLPENSSLAKLGVSKEEAISYFYKKLGVQPTIDFQDNGSLTMSPT
FT                   EAFALARQTNSVDAIARVYPAIEGVTYDTDFFGETLSSENLSVGAAQEKKSVFEEKISD
FT                   IEISDVKTGIGMRYKRSNQLADVNLSIRLINKDELQYTINANNPTFSYEIQLQKNFGEY
FT                   MDLSESVTITIPIEADKKILNVLKINKNEQTESVKELPYRIENNKIILETDELGSFIIE
FT                   YQMEKIKKENNTNATISESGKSSLGLQNKENSDVQAVGDKDYFSGLELSNKGEELSRED
FT                   SKLMGNSINNLQTIKESESIFEGNLGRNKELSDMYQKSLPKTGESNQAYIVLIGLFSLF
FT                   VVLICQIFKKSID"
FT   sig_peptide     200422..200496
FT                   /locus_tag="SSUSC84_0192"
FT                   /note="Signal peptide predicted for SSUSC84_0192 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.997) with cleavage
FT                   site probability 0.584 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    204061..204120
FT                   /locus_tag="SSUSC84_0192"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0192 by TMHMM2.0 at aa 1214-1233"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        204157..204918
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0193"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0202"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50971"
FT                   /protein_id="CAZ50971.1"
FT                   /translation="MTKKIIFILLFFVVCVYFYSFIPLVQTVPSVFQTPYRTLVQSEFE
FT                   AIYKYNGIEISERNFWNKPINGRKPQDTLNEKATILFKKYNLLEKEAKKHEYKKEALDF
FT                   NKVDWKTVSNRYIELKQIVIDEKIKDINQDEIERYYLANTENFERQDFISGNISIWNDG
FT                   IIISTESVDITEETVRNITERYPDLELELKNIEVGHQVSWGQNGVYYTFTCLSREEKGI
FT                   IPLSEITDAVAMQCAEELVDNWLNKEIDSLK"
FT   sig_peptide     204157..204237
FT                   /locus_tag="SSUSC84_0193"
FT                   /note="Signal peptide predicted for SSUSC84_0193 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.751) with cleavage
FT                   site probability 0.605 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    204169..204237
FT                   /locus_tag="SSUSC84_0193"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0193 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        205135..205899
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0194"
FT                   /product="binding-protein-dependent transport system
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0203"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50972"
FT                   /protein_id="CAZ50972.1"
FT                   /translation="MKMKSNKEQKYFWLTFSLIVALMIWWFLSNYDRTSRSFPNIILVW
FT                   NALLIMIDKGFIFEDIFSSLTSVFFGFTSGFLLSAPNALLMAWYSPYRNIVKPWIQFIR
FT                   NIPPLAYVPLVVISAGVGLLPQVIVIAIATFLTMTVTIYQGIINIDPNLIKAARILGAS
FT                   DFEIFKRILVPSSIPFIMTAVRLGTSISLTTIIAAESTGATSGMGMRIRSLNNSFDSSG
FT                   MLLYIILIGVIGLLLNKLVDLIERKLTGWQQK"
FT   misc_feature    join(205168..205221,205336..205404,205438..205506,
FT                   205516..205575,205660..205728,205798..205866)
FT                   /locus_tag="SSUSC84_0194"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0194 by TMHMM2.0 at aa 12-29, 68-90, 102-124,
FT                   128-147, 176-198 and 222-244"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    205315..205884
FT                   /locus_tag="SSUSC84_0194"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 6.2e-29"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        205884..206666
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0195"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0204"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50973"
FT                   /protein_id="CAZ50973.1"
FT                   /translation="MATEVKKIKVKIEDVSKSFQTNHGEVVALNQINLEIFENEIVTVV
FT                   GPSGCGKSTLLNLVAGLEPVTSGKIYCDDNEIVGIGVERGVVFQQYALFPWMSVLQNVM
FT                   FGPEMQGKSKLEASEIANKYIKMVGLQEFSNHYPKELSGGMKQRVAIARAYAVNPSILL
FT                   MDEPFGALDALTRIQLQEELIEMLGQEQKTCFFITHDIEEAVLLGNRVIVMSPRPGEIK
FT                   EIVNVDLPFSRNQLTKFEKNFMDIKNHIWSLVYKDFLI"
FT   misc_feature    205998..206534
FT                   /locus_tag="SSUSC84_0195"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    206304..206348
FT                   /locus_tag="SSUSC84_0195"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        206705..207736
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0196"
FT                   /product="extracellular solute binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0205"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50974"
FT                   /protein_id="CAZ50974.1"
FT                   /translation="MAKYMKYKNFIWFICSIITLIFLSSCSSIQTSSSGHSAKVDTIRI
FT                   AYMPNFASLHDIITGINSGIFKEEGLEVELIEFADGPTIIASLESGSIDIGNIGPGAHK
FT                   LAIEGRAEVVAFSQLGNADELIARSDRGIDSIEDLRGKKIGTASGTSAETILKLALLEA
FT                   DLSEKDVEIIDMDASAIVTAMLSGSIDVAATWSPNTTFIKRELKEKVVVLADNSRYREQ
FT                   SPAIASYVTFPGYSEKNNEKISKFLKGLYRAMDYRAEHMKEVSKWVATQIGSDITAVQD
FT                   QLQDGEWLTSRQMIQLINTGILQQYYEKQQKNLIESEIVDTSRNINEYVLIDQMNSILM
FT                   EIK"
FT   sig_peptide     206705..206806
FT                   /locus_tag="SSUSC84_0196"
FT                   /note="Signal peptide predicted for SSUSC84_0196 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.560 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    206729..206797
FT                   /locus_tag="SSUSC84_0196"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0196 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    206846..207496
FT                   /locus_tag="SSUSC84_0196"
FT                   /note="HMMPfam hit to PF09084, NMT1, score 3.7e-18"
FT                   /inference="protein motif:HMMPfam:PF09084"
FT   CDS_pept        207830..208639
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0197"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0206"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50975"
FT                   /protein_id="CAZ50975.1"
FT                   /translation="MIEYYNFSKSELENHSRIPLIIKKNNEEIFISLALEMVELIKENN
FT                   KKNEKTVIICPVGPVGHYPHFVRLVNQFKIDLSDVWFINMDEYLSEDLHWIDVVHPLSF
FT                   RGFMQKTVYSQIHPTLIMPEEQRIFPDPLDIDLISNKIKELGKIDLCIGGIGLNGHIAF
FT                   NEPDSTLTVQEFLKLESRVLPISVETKVMNCLTELKGAVEEVPNYCVTIGMSEIFQAKK
FT                   IRLAVFRDWHHAVIRKTVCSKPDTGFPSTLMQIHTNCSIYLNESLAN"
FT   misc_feature    207926..208630
FT                   /locus_tag="SSUSC84_0197"
FT                   /note="HMMPfam hit to PF01182, Glucosamine_iso, score
FT                   1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF01182"
FT   misc_feature    208253..208309
FT                   /locus_tag="SSUSC84_0197"
FT                   /note="ScanRegExp hit to PS01161, GLC_GALNAC_ISOMERASE,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01161"
FT   CDS_pept        join(208801..208971,208970..209725,209725..209925,
FT                   209929..210708)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0198"
FT                   /product="copper-transporting P-type ATPase CopA
FT                   (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0207"
FT                   /note="Probable gene remnant. CDS contains frameshifts
FT                   after codons 57 and 309, and a nonsense mutation (amber)
FT                   after codon 376. Similar to an internal region of Bacillus
FT                   subtilis copper-transporting P-type ATPase CopA
FT                   UniProt:O32220 (EMBL:BSUB0018) (803 aa) fasta scores:
FT                   E()=1.2e-88, 43.396% id in 636 aa"
FT   misc_feature    join(208813..208970,208971..209005)
FT                   /locus_tag="SSUSC84_0198"
FT                   /note="HMMPfam hit to PF00403, HMA, score 4.6e-16"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    208822..208911
FT                   /locus_tag="SSUSC84_0198"
FT                   /note="ScanRegExp hit to PS01047, HMA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01047"
FT   misc_feature    join(209075..209134,209162..209230,209288..209356,
FT                   209384..209437,209845..209913,209929..209997)
FT                   /locus_tag="SSUSC84_0198"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0198 by TMHMM2.0 at aa 93-112, 122-144, 164-186,
FT                   196-213, 350-372 and 377-399"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    join(209411..209725,209725..209925,209929..210075)
FT                   /locus_tag="SSUSC84_0198"
FT                   /note="HMMPfam hit to PF00122, E1-E2_ATPase, score 3.3e-88"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    210085..210708
FT                   /locus_tag="SSUSC84_0198"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 4.9e-27"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    210103..210123
FT                   /locus_tag="SSUSC84_0198"
FT                   /note="ScanRegExp hit to PS00154, ATPASE_E1_E2, score NA"
FT                   /inference="protein motif:Prosite:PS00154"
FT   CDS_pept        210712..210891
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="SSUSC84_0199"
FT                   /product="probable thiol peroxidase (fragment)"
FT                   /EC_number="1.11.1.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0207A"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus parasanguis Tpx probable thiol
FT                   peroxidase UniProt:P31307 (EMBL:SSSTRA) (163 aa) fasta
FT                   scores: E()=8.6e-16, 72.881% id in 59 aa"
FT                   /db_xref="PSEUDO:CAZ50977.1"
FT   misc_feature    210712..210885
FT                   /gene="tpx"
FT                   /locus_tag="SSUSC84_0199"
FT                   /note="HMMPfam hit to PF08534, Redoxin, score 5.7e-10"
FT                   /inference="protein motif:HMMPfam:PF08534"
FT   CDS_pept        complement(210930..213419)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0211"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50978"
FT                   /protein_id="CAZ50978.1"
FT                   /translation="MNEVYFTGTIDRIIFENPSNFYKILLLEIEETDADYDDYEIIVTG
FT                   TIADVIEGEDYRFYGNLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSEHFKGIGRKTA
FT                   EKIVELYGEDTIDKILAEPEKLTQITGLSSKNMQAFVEKLRLNYGTELILAKLAEYGIP
FT                   NKLAFQIQDQYKEKTLQIIEENPYQLVEDVQGLGFTIADRIAENLGIASDSPQRFRAGM
FT                   LFSLIHRSMETGDTYVEARDLLEATLELLEKSRHTELDPAAVAKELTGLIADDKVQQEG
FT                   TKIFDNSLYFAEHGIHTNLTRLMGKNGFKPFPRADVEAAIAELESISSLTYDNIQKEAI
FT                   VQAITNPLFILTGGPGTGKTTVINGIIAVYAILHKIDLTRNREECPVLLAAPTGRATRR
FT                   MNELTGLPSATIHRHLGLVEGQEESYRDDYLDADFIIVDEFSMVDTWLANQLFQNISSQ
FT                   TQVLIVGDAEQLPSVSPGQVLADLLKIDKLPSITLERIYRQSDDSTIVTLASQIRQGAL
FT                   PSDFREKKADRSYFEAQNEQIPALIERIVGAAIKSGIPANEVQILAPMYRGAAGIDQLN
FT                   TMTQALLNPLEEGELEFLHNEQAFRQGDRVIHLVNDAEANVFNGDLGYITDLLPAKYTD
FT                   SKQDEITINFDGSEVTYPRNEWYKITLAYAMSIHKSQGSEFQVVILPITRTSHRMLQRN
FT                   LVYTAITRSKSKLILLGEISAFDYAVKNAGTVRKTYLVPRFQGEMAEQESKESLIKKDE
FT                   SKTATTTQTQPPTQPDRKEQVKVVKENNQQLSLLDQDQPEKTSPQPTEYILTVDNLLTI
FT                   DPMIGIEQADIEEFFKA"
FT   CDS_pept        complement(213660..214289)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0201"
FT                   /product="putative signal peptidase I 4"
FT                   /EC_number="3.4.21.89"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0212"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50979"
FT                   /protein_id="CAZ50979.1"
FT                   /translation="MGAIQKTKRSPLVAFLAEWGIFLLFMAAFFASRYFIWNPVSVDGH
FT                   SMDPTLQHQEKLIMLKTSSIDRFDIVVASETDSDGKEKLIVKRVIGMPGDTIRYENDVL
FT                   YVNDQKVDEPYLDEYLAAFQKDKLQEVYSYNKQFQAVAQSAEAFTQDANGYVDFTVTVP
FT                   EGQYYLMGDDRLVSLDSRSVGTFSRENIKGEVVFRMWPLNRIGTVD"
FT   misc_feature    complement(213963..214169)
FT                   /locus_tag="SSUSC84_0201"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score
FT                   3.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    complement(213993..214031)
FT                   /locus_tag="SSUSC84_0201"
FT                   /note="ScanRegExp hit to PS00760, SPASE_I_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00760"
FT   misc_feature    complement(214137..214160)
FT                   /locus_tag="SSUSC84_0201"
FT                   /note="ScanRegExp hit to PS00501, SPASE_I_1, score NA"
FT                   /inference="protein motif:Prosite:PS00501"
FT   misc_feature    complement(214197..214256)
FT                   /locus_tag="SSUSC84_0201"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0201 by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(214299..215189)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0202"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0213"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50980"
FT                   /protein_id="CAZ50980.1"
FT                   /translation="MNTVVLKASAQQKQAMMAHYDRYRQTSKNPYIEAFFKLTGASLSI
FT                   YTSGKVVFQGEMAEQEASRWGYEPESSGQATIPGQNLPMIGTDEVGNGSYFGGLAVVAG
FT                   FVRPEDHSFLKSLGVDDSKKMTDQKICQIAPLLKEKIPHQALLLSPKKYNEVIEQGYNA
FT                   VSVKVALHNQAIFLLLQKGVQPEKIVIDAFTSSQNYQKYLKKEANQFANPVTLEEKAEG
FT                   RYLAVAVSSIIARSMFLENLVQLGQLVGMHLPSGAGSKSDQVAASILKQYGMAGLNQTA
FT                   KLHFANTQKAQKLLK"
FT   misc_feature    complement(214326..214937)
FT                   /locus_tag="SSUSC84_0202"
FT                   /note="HMMPfam hit to PF01351, RNase_HII, score 4.6e-64"
FT                   /inference="protein motif:HMMPfam:PF01351"
FT   CDS_pept        215274..216257
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0203"
FT                   /product="putative oxidoreductase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0214"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50981"
FT                   /protein_id="CAZ50981.1"
FT                   /translation="MEVQMKYKWATLGTGVIANELVQALQAMGGNLYSVANRTYDKGVE
FT                   FAQKYGIEKVYREIDEVFEDPEVDIIYISTPHNTHINYLRKALKAGKHVLCEKSITLNS
FT                   EELAEAIQLAEENQVVLAEAMTIFHMPIYRQLSEVVASGKLGELKMIQMNFGSYKEYDM
FT                   TNRFFNKNLAGGALLDIGVYALSFVRWFMIEKPNQVLSQVKLAPTGVDEQVGILLSNDA
FT                   GEMATIALTLHAKQPKRGTIAYDKGYIELYEYPRGQKAVITYTEDGSQEVIEAGETAKA
FT                   LSYEVADMEKAVAGIENTMHLAYTQDVMEIMTQLRKEWGLVYPEEM"
FT   misc_feature    215292..215648
FT                   /locus_tag="SSUSC84_0203"
FT                   /note="HMMPfam hit to PF01408, GFO_IDH_MocA, score 3.5e-25"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   misc_feature    215682..216014
FT                   /locus_tag="SSUSC84_0203"
FT                   /note="HMMPfam hit to PF02894, GFO_IDH_MocA_C, score 0.011"
FT                   /inference="protein motif:HMMPfam:PF02894"
FT   misc_feature    215784..215852
FT                   /locus_tag="SSUSC84_0203"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0203 by TMHMM2.0 at aa 171-193"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        216666..217637
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0204"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0215"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50982"
FT                   /protein_id="CAZ50982.1"
FT                   /translation="MKNNKKMLYTSSLALSLFSTGMISTNVLAIEWAPRTVSEISPEIV
FT                   QEEGMMTYTVQYGDTLSAIASAMNIDMDLLAKINQIADINLIFPDTVLTTTVDQNNQVT
FT                   QVEIEAPVQGNTNETVQATVDLTTNQVTVEDTVVPLDQISSVTDSAPVEEVVEQPVAEA
FT                   PVVEAPVEEVVEQPVVEAPVEEVVEQPVVETPQVTALSTTTTSTSAYDVGLQPQVAAFR
FT                   AEVANAFGITSFSGYRPGDSGDHGKGLAIDFMVPESSALGDQVAAYAVANLASKNINYI
FT                   IWKQRFYAPYDSIYGPAYTWNLMPDRGSITENHYDHVHVSFN"
FT   sig_peptide     216666..216752
FT                   /locus_tag="SSUSC84_0204"
FT                   /note="Signal peptide predicted for SSUSC84_0204 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.981 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    216822..216953
FT                   /locus_tag="SSUSC84_0204"
FT                   /note="HMMPfam hit to PF01476, LysM, score 3.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01476"
FT   CDS_pept        complement(218051..219676)
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /gene_synonym="treC"
FT                   /locus_tag="SSUSC84_0205"
FT                   /product="putative trehalose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.93"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0216"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50983"
FT                   /protein_id="CAZ50983.1"
FT                   /translation="MTIDKRKVVYQIYPKSYKDTTGNGVGDLRGIIEKLPYLKELGIDM
FT                   IWLNPFYPSPQRDNGYDISDYTAVNPDFGTMADFEEMVTVGKELGIEFMLDMVLNHCST
FT                   DHEWFQKALAGDKYYQDFFILRDQPTDWVSKFGGNAWAPFGDTGKYYLHLFDVTQADLN
FT                   WRNPHIREELFKVVNFWKDKGVKGFRFDVINLIGKDEVLEDCPINDGKPAYTDRPITHD
FT                   YLKMMNNATFGSEKGFMTVGEMSATTIENCILYTAPERKELSMAFNFHHLKVDYKDGQK
FT                   WTIMDFDFEELKHLFHTWGEEMSVGNGWNALFYNNHDQPRALNRFVDVENFRKEGATML
FT                   AASIHLSRGTPYIYMGEEIGMIDPDYDSMDDYVDVESINAYQMLLDQGHTPKQAFKIIQ
FT                   AKSRDNSRTPMQWDASDNAGFSTGTPWLKAGKSYQTINVEQEKTGPIFTFYQELIRLRK
FT                   ELPLISEGDYKAAYKDSQKVYAFERLLNDEKLLVLNNFFAEEVELDLADDYAHGQVLIS
FT                   NYPDNKLGKKIILKPYQALAIQVK"
FT   misc_feature    complement(218456..219646)
FT                   /gene="treA"
FT                   /gene_synonym="treC"
FT                   /locus_tag="SSUSC84_0205"
FT                   /note="HMMPfam hit to PF00128, Alpha-amylase, score
FT                   1.8e-107"
FT                   /inference="protein motif:HMMPfam:PF00128"
FT   CDS_pept        complement(219757..221751)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0206"
FT                   /product="sugar phosphotransferase system (PTS), IIABC
FT                   component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0217"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50984"
FT                   /protein_id="CAZ50984.1"
FT                   /translation="MGKFEKEAKQLLEAIGGKENVNAVTHCATRMRFVLADEKKANVKV
FT                   IEDIPAVKGTFTNAGQFQVIIGNDVPIFYNDFTAVSGIEGVSKEAAKSAAKSNQNAIQR
FT                   VMTMLAEIFTPIIPALIVGGLILGFRNVLEGVQMEWLGQAMKDGQLVFDADGNPVWNTI
FT                   VQVSPFWNGVNHFLWLPGEAIFHFLPVGITWSVSRKMGTSQILGIVLGICLVSPQLLNA
FT                   YAVPGTDAATIASDWSWNFGAFSIARIGYQAQVIPALLAGLALSYLEIFWRKVVPEVVS
FT                   MIFVPFLSLLPAIILAHTVLGPIGWTIGQWLSTVVLAGLTGPLKWLFGAVFGALYAPFV
FT                   ITGLHHMTNAIDTQLIADAGGTGLWPMIALSNIAQGSAVFAYFLMNRKNEKEAQVSLPA
FT                   TISAYLGVTEPALFGVNVKYIYPFVAAMIGSSIAGLLSVTFNIQAASIGIGGLPGILSI
FT                   KAEYWGAFFMTMVVAIVVPMILTAVFKRTGAFSKKEETVEEVVAPTEAVVETGAAIELI
FT                   SPLTGQTKELSQATDPVFASGVMGQGVLIDPSEGILVAPVDGEVSVLFPTNHAVGITAT
FT                   NGVELLMHIGMDTVGLEGKGFTAHVKQGDKVKAGDKLISFDIDVIKAAGLIAETPVIVT
FT                   NQTDFDTQVIGNLPRAISQGEAILTVTKN"
FT   misc_feature    complement(219823..220221)
FT                   /locus_tag="SSUSC84_0206"
FT                   /note="HMMPfam hit to PF00358, PTS_EIIA_1, score 1.9e-61"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    complement(219982..220020)
FT                   /locus_tag="SSUSC84_0206"
FT                   /note="ScanRegExp hit to PS00371, PTS_EIIA_TYPE_1_HIS,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00371"
FT   misc_feature    complement(join(220300..220368,220426..220494,
FT                   220507..220575,220603..220671,220708..220776,
FT                   220834..220902,220939..221007,221071..221139,
FT                   221158..221226,221365..221433))
FT                   /locus_tag="SSUSC84_0206"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUSC84_0206 by TMHMM2.0 at aa 107-129, 176-198, 205-227,
FT                   249-271, 284-306, 326-348, 361-383, 393-415, 420-442 and
FT                   462-484"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(220462..221424)
FT                   /locus_tag="SSUSC84_0206"
FT                   /note="HMMPfam hit to PF02378, PTS_EIIC, score 3.2e-38"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    complement(221626..221730)
FT                   /locus_tag="SSUSC84_0206"
FT                   /note="HMMPfam hit to PF00367, PTS_EIIB, score 3.1e-16"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    complement(221641..221694)
FT                   /locus_tag="SSUSC84_0206"
FT                   /note="ScanRegExp hit to PS01035, PTS_EIIB_TYPE_1_CYS,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS01035"
FT   CDS_pept        221985..222698
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0207"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0218"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50985"
FT                   /protein_id="CAZ50985.1"
FT                   /translation="MKKYQEIYNDLKEKIRTNVYPAESSLPTEQQLQEIYGVSRDTVRK
FT                   ALAILTEGGLIQKVQGRGSMVLKQEILNFPVSGLTSYQELTNVLQLSTKTDVVSLDMIT
FT                   VNSSLSHLTGFEPYSKVWKVVRTRSIDGKVSVVDTDYLAVDVVPELTTAIAEKSIYEYL
FT                   ENKLGLDIAYAQKEITVEPTNREERELMQSKDDYLVLIKSRVYLGDTQQFQYTESKHKI
FT                   DKFRFVDFARRKHSL"
FT   misc_feature    221991..222182
FT                   /locus_tag="SSUSC84_0207"
FT                   /note="HMMPfam hit to PF00392, GntR, score 6.9e-22"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    222063..222128
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1371.000, SD 3.86 at aa 27-48, sequence
FT                   PTEQQLQEIYGVSRDTVRKALA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    222246..222662
FT                   /locus_tag="SSUSC84_0207"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 6.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   CDS_pept        222756..223067
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0219"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50986"
FT                   /protein_id="CAZ50986.1"
FT                   /translation="MANLNRYKFTFGEKQLTLTTEHDNLFMEEIERIAQEKYQAIKEKM
FT                   PTADPETLALLLAINALSVQLTREMAFEQKEQELASVKEKVLKKNVTLIDLDELEDKV"
FT   CDS_pept        223064..223612
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0209"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0220"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50987"
FT                   /protein_id="CAZ50987.1"
FT                   /translation="MISLAIILILAWSFYIGYSRGLVLQAFYSMGSIIALVVATATYKK
FT                   LASFLYLWVPFANATQGSSNYYFDEKYLFDLDMVFYAGLAFLLIYVLVYAIVRFIGIFV
FT                   HLLEAFNPDTKTTNLISGALAVLVTFISLQIVMVLLSTIPLAMIQDKLHSSFLANIMIQ
FT                   YTPFTSSFLKSLWLSNIAG"
FT   misc_feature    223064..223585
FT                   /locus_tag="SSUSC84_0209"
FT                   /note="HMMPfam hit to PF02674, Colicin_V, score 9.3e-36"
FT                   /inference="protein motif:HMMPfam:PF02674"
FT   misc_feature    join(223124..223192,223295..223354,223415..223483,
FT                   223526..223594)
FT                   /locus_tag="SSUSC84_0209"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0209 by TMHMM2.0 at aa 21-43, 78-97, 118-140 and
FT                   155-177"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        223763..226099
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="SSUSC84_0210"
FT                   /product="putative DNA mismatch repair protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0221"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50988"
FT                   /protein_id="CAZ50988.1"
FT                   /translation="MNNKIIETLEFHKVRQKIEPYLLTEQGFEELRQLEPMVEVHRIQQ
FT                   AFDELTDIAQIFVENPYFSLAATSDIGPAMRRLELDTDLNIAELLAVKKVLEVSKSLLD
FT                   FYGNLENVSLSQQLDKLFEKIELFPHLQGSLQSINDAGFVEDFASEKLARIRRKIREAE
FT                   DQVRQVMQDILKTKGDMLSDSILASRNGRNVLPVKNTYRNKIAGVVHDISASGSTVYIE
FT                   PRAVVTLNEEISHLRAEERHELNRILQELSDMLRPHGGVIRNNAWLIGHIDFVRAKHLF
FT                   ARDHQAVVPKLSEKQDIALLNVRHPLIAKPVPNDLYFGSQLTAIVITGPNTGGKTIMLK
FT                   TLGLTHLMAQSGLPILADKGSRVAIFKEIFADIGDEQSIEQSLSTFSSHMTHTVEILRA
FT                   ADQDSLILFDELGAGTDPQEGASLAMAILDDLRLRGIKTMATTHYPELKAYGIETSGIE
FT                   NASMEFDSNSLRPTYKFMQGVPGRSNAFEIARRLGLSDIIIQSAQSWTDTDSDVNRIIE
FT                   KLESQTVESRQRLDKIRDVEQENYKMNRALRKLYDELNRERENELNKARLEAKEIVDMA
FT                   LAESEDILKNLHAAASLKPHQIIEAKAELKKLAPEVVDLSKNKVLKKAKIKREAKVGDD
FT                   IIVTAYGQRGTLTNQLKDGRWEAQVGLIKMTLAKDEFELVKAEKAEQPKKRQVHTVKRA
FT                   NVRGPKARLDLRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTGVIREGVTKYLRR
FT                   NKQIKEFGYAPQNAGGSGCTIVTFK"
FT   misc_feature    224621..225328
FT                   /gene="mutS2"
FT                   /locus_tag="SSUSC84_0210"
FT                   /note="HMMPfam hit to PF00488, MutS_V, score 5e-16"
FT                   /inference="protein motif:HMMPfam:PF00488"
FT   misc_feature    224972..225022
FT                   /gene="mutS2"
FT                   /locus_tag="SSUSC84_0210"
FT                   /note="ScanRegExp hit to PS00486, DNA_MISMATCH_REPAIR_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00486"
FT   misc_feature    225869..226096
FT                   /gene="mutS2"
FT                   /locus_tag="SSUSC84_0210"
FT                   /note="HMMPfam hit to PF01713, Smr, score 2.9e-33"
FT                   /inference="protein motif:HMMPfam:PF01713"
FT   CDS_pept        226123..226776
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0211"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0222"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50989"
FT                   /protein_id="CAZ50989.1"
FT                   /translation="MIIRKYQTSDEKGWVYCKALSYLFSPFFDDRETEKPELMTDVYDH
FT                   RVEWVAEVDGQIVGLIDIDIYTEECSQSYIYAPSKRTAYFTNLAVHPDFQGQGIAQALF
FT                   EKAEQELRAQGVEKLAIFTREDDAANHLYQKWGGEVVCSDYLVVGAPQDVPTFRFGIDL
FT                   ERGRLSFSDMEGQPVPYYLREGVYVVSEEAGLDLFDIEDVYQELTYVVDLTEKS"
FT   misc_feature    226267..226539
FT                   /locus_tag="SSUSC84_0211"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   1.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        226983..227297
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0212"
FT                   /product="putative thioredoxin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0223"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50990"
FT                   /protein_id="CAZ50990.1"
FT                   /translation="MVQVITDANFEVETQEGVVLVDFWAPWCGPCRMQAPILEQLADEV
FT                   DEDGLRIYKMDVDENPNTARQFGIMSIPTLLFKKDGQVVKQVAGVHTKDQIKAILAEIG
FT                   "
FT   misc_feature    226983..227291
FT                   /locus_tag="SSUSC84_0212"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 2.5e-36"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   misc_feature    227040..227096
FT                   /locus_tag="SSUSC84_0212"
FT                   /note="ScanRegExp hit to PS00194, THIOREDOXIN, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        227565..229094
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0213"
FT                   /product="AMP-binding enzyme"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0224"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50991"
FT                   /protein_id="CAZ50991.1"
FT                   /translation="MSTISYKPLNLYRQFKTAAQEFPNVAIYFDKPYASFPELGLENTY
FT                   QTVFEAIQKRAAQFAAAGIGYGDKVILYKSPAFDTYLLAVAVTALGAVPVMISYHLPSS
FT                   NLDVFAERLEKSFIVYDQETEERVAGMTRTDLVTKIFLPQVLVQEAVAFEENLLPEDVI
FT                   QYMTHTSGTTGVPKLICHTAQTMGWRVAWQQTIFDKMTERGLLAFHISPVHSRYNIGVS
FT                   SAIGLGFPLYPLSSARKDDVERALALHRPSALETHPNNFVQWARLAKEKPEVFSSIRYY
FT                   HSTFDAINIGTLRAFLEASKEQDPVFMQVYGQSECGPMILRYHRLENLGTVSGRDMGIG
FT                   LEGYTEARITDAQGNPLPAGENGHIQFLSKGRAVTYYKEDARFQDNVYGAWWDSGDYGC
FT                   MTPEGTLLLKDRQVDLIEHIDSNLALEDLLLDKLDFLSEVVIIRDVNGAPQPIIALAED
FT                   AEMNWEAWWAMVADLPLLKEPILMAYDDIPRTATMKVQRLKMEAEMKEKNL"
FT   misc_feature    227694..228797
FT                   /locus_tag="SSUSC84_0213"
FT                   /note="HMMPfam hit to PF00501, AMP-binding, score 3.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    228060..228095
FT                   /locus_tag="SSUSC84_0213"
FT                   /note="ScanRegExp hit to PS00455, AMP_BINDING, score NA"
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        229134..230072
FT                   /transl_table=11
FT                   /gene="msrAB"
FT                   /locus_tag="SSUSC84_0214"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0225"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50992"
FT                   /protein_id="CAZ50992.1"
FT                   /translation="MKEIYLAGGCFWGMEGYFSQIDGILDTSVGYANGQVETTNYQLLK
FT                   QTDHAETLYLAYDETRINLREILLYYFRVIDPFSVNQQGPDKGRQYRTGIYYTDEADLP
FT                   TIEQVMTEQSQLFGGRPLAVEVEPLAHYIPAEDYHQDYLKKNPQGYCHIDLGQAKIPLI
FT                   DVADYQKPDQQVLKDSLTDLQYQVTQEAATERPFENEFWNSEQAGIYVDITTGEPLFLS
FT                   TDKFDSGCGWPSFTKPISKEVATYFQDKSHGMNRIEVRSRAGHAHLGHVFDDGPRDKGG
FT                   LRYCINSAALRFIPREEMEEAGYGLFLDLLK"
FT   misc_feature    229137..229601
FT                   /gene="msrAB"
FT                   /locus_tag="SSUSC84_0214"
FT                   /note="HMMPfam hit to PF01625, PMSR, score 7.1e-82"
FT                   /inference="protein motif:HMMPfam:PF01625"
FT   misc_feature    229650..230021
FT                   /gene="msrAB"
FT                   /locus_tag="SSUSC84_0214"
FT                   /note="HMMPfam hit to PF01641, SelR, score 6.1e-85"
FT                   /inference="protein motif:HMMPfam:PF01641"
FT   CDS_pept        230211..231068
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0215"
FT                   /product="putative transcriptional regulator"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0226"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50993"
FT                   /protein_id="CAZ50993.1"
FT                   /translation="MILSKRFKNRRKELGFTQKELAEGICEQSLISRVEKLGVAPTSDI
FT                   LFALSQRLQVSMDYFFDESVSDKAPDITVFKRLVDKALFTRSYDQLAYLVEAEKQKEAV
FT                   HSQESSEYLTYLACIVDFHHYHKEDIAIGCMEELSHRISKKSSFYLDVYNSLVNFYALA
FT                   SRDEDLDGLYEGISEKLSHLDISNTECFHKYIKIRYNHAHYLFKRKRQSQAIDELTDLI
FT                   ETLRDKKSCYFLADMLCLIANVGEGFLSKDEILSYYREAECLFKFFGPQNSYLSLKEYL
FT                   SKVI"
FT   misc_feature    230229..230390
FT                   /locus_tag="SSUSC84_0215"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 9e-11"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        231252..233237
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0216"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0227"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50994"
FT                   /protein_id="CAZ50994.1"
FT                   /translation="MKKVFTYLSTFSVCLFCIWLVSLQLDSLIYHYYPSVSILSRGEEV
FT                   TYEEVSDALTNLAEKENSLIAKTITETDDSGRTTTSYDVFGKGELPQGLVKADRLVASQ
FT                   ANLAENYYVVKGNLDIKVVENVLQSLGLVDSYIYRPTLLNSLSLFLGRGAPSLGLIIFI
FT                   LTNLALTVVGQIVYLRSAGIEMLSGVRSWQIASRFLRVDGRDIALATGGALVFGLIAIL
FT                   ILGWPMVYYRFVAIGIAFYACLLFFLSLSTSIGFMIALNISQLQKLIKGALPLKAIFAI
FT                   LLVGQCLAVCIISIGASRTLTYVGVLHTLTIGEKAWQERQDVFSLSLNREAFIADEAMA
FT                   QQQRMAWSHVILESYAKNNVMLVQHHLRHNTIKEHTIIESSKEIPLERVLYVTPNYIQS
FT                   EGGLYDFNQLEEIKQLGKGEIALLLPKSLQNDASVYQAYFEDMVGKLLADGEGSISLHS
FT                   NVYYISDEKRWFIYNHTPINYEQFLQAPLIVVLSPESFEETSYFWENALPDFVFFKDKE
FT                   MLEQLLDKYNLQNTIGSLLSSKQHYNTLRKNVQLEILMTLSPTILGIFTSILLFNTMNL
FT                   LYFETFKREIAIKRIAGMGFIELHGSYLGEQVGSALIGMGLAMFMTKSVIVSLGVVVAL
FT                   LINSWMLLNNQAKREEKIQLSVLNGR"
FT   misc_feature    join(231270..231338,231717..231785,231867..231935,
FT                   231963..232031,232068..232136,232920..232988,
FT                   233046..233114,233124..233183)
FT                   /locus_tag="SSUSC84_0216"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0216 by TMHMM2.0 at aa 7-29, 156-178, 206-228,
FT                   238-260, 273-295, 557-579, 599-621 and 625-644"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    232932..233231
FT                   /locus_tag="SSUSC84_0216"
FT                   /note="HMMPfam hit to PF07242, DUF1430, score 1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF07242"
FT   CDS_pept        233257..235242
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0217"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0228"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50995"
FT                   /protein_id="CAZ50995.1"
FT                   /translation="MKGKFVLVSTIILAVFMIWLGVSQKETMLVHYYPSVTTLSVSEDV
FT                   TYSDVRQRLEDYSQQTDSVIARRVIEPSKSGGRTFSYDNFSQSPLPRGLEEFQASEKVE
FT                   SALLTKYFIFQGKATVEELRSLLVSLGLDEVQIRKPSTIATLLVFLTQGGQFLAVLVFL
FT                   ITYMALVVIANVRQLRTAGIRLIAGDSRWHLFLLSLQENAKEIALTIPFAVLPAVGLAY
FT                   LVGLDGYSVYYLVAALVGYHFLLGLIVLFFAATFTLAIRTYHFLPLLKGKMPLQGILTI
FT                   MVMGQMLALLVVSFGMAQTVYYSGIWQEYQAGAQQWENEGDYYSLAWNISADGRSGLNS
FT                   PENWYPLLRQALEEDGALFVKSNLNAYLMGFQLEDGTRLDSYHPAGNTLYVSPNYLQIQ
FT                   DVDLAEGEVALPLQEGEFQLLLPEKLRPESDAYLHLYQDYINRMVRPANQARSATIKGK
FT                   VAYLKNGQKQFIYNHRSGQHVQYLTDPILVVLAPSSLGKESADFWLNEVDSSMLFKNRD
FT                   KLLRELKARNLFQFVNEVRSSSSLFTELLDRIRIETISTSMGAILGIVTSIVLFNTMNL
FT                   LYFEEFKREIVIKEIAGMGFLGIHKKYLTLQLLSLLLALGASMVVTGHIFISSISFALF
FT                   MVNALCLLRWQARKEGAWNVRILKGA"
FT   misc_feature    join(233269..233322,233692..233760,233872..233931,
FT                   233968..234036,234079..234147,234925..234993,
FT                   235114..235182)
FT                   /locus_tag="SSUSC84_0217"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUSC84_0217 by TMHMM2.0 at aa 5-22, 146-168, 206-225,
FT                   238-260, 275-297, 557-579 and 620-642"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    234937..235236
FT                   /locus_tag="SSUSC84_0217"
FT                   /note="HMMPfam hit to PF07242, DUF1430, score 5.4e-25"
FT                   /inference="protein motif:HMMPfam:PF07242"
FT   CDS_pept        235244..235876
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0218"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0229"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50996"
FT                   /protein_id="CAZ50996.1"
FT                   /translation="MFSVQSIQKKFGKRSLFSDVTLDLQAGKVYALIGASGSGKTTLLN
FT                   ILAKLESYDAGDILYKGKDLKKLKPHLFFREELGYLFQNFGLLESQTIKENLDLGLISQ
FT                   KLSKDERKSRQEAALDAVGLSYLDLSQPIYELSGGEAQRVALAKVILKNPPLILADEPT
FT                   AALDPKSSQEIMDILLSLKSPDRLIVIATHNPLIWERADLIIKMEDL"
FT   misc_feature    235322..235873
FT                   /locus_tag="SSUSC84_0218"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.6e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    235649..235693
FT                   /locus_tag="SSUSC84_0218"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   repeat_region   complement(235883..235986)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   misc_RNA        236089..236193
FT                   /locus_tag="SSUSC84_m0001"
FT                   /note="gcvT element (RF00504) as predicted by Rfam, score
FT                   69.81"
FT   CDS_pept        236300..237634
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0219"
FT                   /product="sodium:alanine symporter family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0230"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50997"
FT                   /protein_id="CAZ50997.1"
FT                   /translation="MLELFKAINNLVWGPPLLLLLVGTGVYFTLRLGVFQIGKLPTAFR
FT                   LIFSSDQSGQGDVSSFAALCTALAATVGTGNIVGVATAITTGGPGALFWMWVAAFFGMA
FT                   TKYAEGFLAIKYRTKDANGQAAGGPMHYITLGMGQKWKPLAVFFAISGVLVALLGIGTF
FT                   SQVNSITASLETSFGLEPPLVSVITAISIAFVVFGGIEKISDVSTKIVPFMAILYILAS
FT                   ITVLAVHWDQLLPTLALVFKSAFTPAAAVGGFAGATVQQAIQRGIARGVFSNESGLGSA
FT                   PIAAAAAKSDNPVEQGLISMTGTFIDTLIICTLTGFTILVTDQWSVEGLAGAPLTQAAF
FT                   ATVFGNTGSIALTISLVLFAFTTILGWSYYGERCIEFLFGTKSILPYRLVFVAMVALGG
FT                   FLKLDLIWTIADIVNGLMALPNLIALLALSPVIIKETRQYFAKKK"
FT   misc_feature    join(236336..236404,236477..236545,236573..236641,
FT                   236729..236797,236825..236893,236927..236980,
FT                   237008..237076,237191..237259,237344..237412,
FT                   237449..237502,237530..237598)
FT                   /locus_tag="SSUSC84_0219"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSUSC84_0219 by TMHMM2.0 at aa 13-35, 60-82, 92-114,
FT                   144-166, 176-198, 210-227, 237-259, 298-320, 349-371,
FT                   384-401 and 411-433"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    236417..237631
FT                   /locus_tag="SSUSC84_0219"
FT                   /note="HMMPfam hit to PF01235, Na_Ala_symp, score 8.6e-180"
FT                   /inference="protein motif:HMMPfam:PF01235"
FT   misc_feature    236558..236605
FT                   /locus_tag="SSUSC84_0219"
FT                   /note="ScanRegExp hit to PS00873, NA_ALANINE_SYMP, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00873"
FT   CDS_pept        237699..238547
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0220"
FT                   /product="mechanosensitive ion channel protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0231"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50998"
FT                   /protein_id="CAZ50998.1"
FT                   /translation="MNDFITKYLSQFNIEAIVTAGLNKVLSLVLLFVAFYIIKKIAKAS
FT                   VKKVLVPSLKVSTQDIGRQKTISRLVESILNYLLYFILIYCILSILGLPVSSLLAGAGI
FT                   AGVAVGLGAQGFLSDLVNGFFILIERQFDVGDVVKLTNGPITISGTIVSMGIRTTQVRD
FT                   ADGTLHFIPNRNILVVSNQSRGDMRAQIDIPLKFNTDLEQVYRVIEEVNLREISNFDQI
FT                   TGVTVLGPQNAISGQFVFRVNLFVANGQQNKIYHQFFGFYQDALRQAGIDLPSSGPTVL
FT                   K"
FT   misc_feature    join(237741..237809,237915..237983,238011..238079)
FT                   /locus_tag="SSUSC84_0220"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0220 by TMHMM2.0 at aa 15-37, 73-95 and 105-127"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    237912..238520
FT                   /locus_tag="SSUSC84_0220"
FT                   /note="HMMPfam hit to PF00924, MS_channel, score 1.9e-47"
FT                   /inference="protein motif:HMMPfam:PF00924"
FT   CDS_pept        238615..239145
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0221"
FT                   /product="putative lipoprotein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0232"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ50999"
FT                   /protein_id="CAZ50999.1"
FT                   /translation="MHKQPLFWTTIAGAVLSFILGVTCFIFMIGLSSANFDNWDTGSDG
FT                   YIDETVEYTEYQVGDSVDFSNGLHVTVTSMGKDDSIELVDSYYSTAYVVEMEVENSTAK
FT                   ELYFDEYYFSLMDPVSQIPFTLDLRTYDVNLVEKLKPGEKVQVKLIYGIDNETNFGFTY
FT                   EDAMWTELVAEGI"
FT   sig_peptide     238615..238716
FT                   /locus_tag="SSUSC84_0221"
FT                   /note="Signal peptide predicted for SSUSC84_0221 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.992) with cleavage
FT                   site probability 0.891 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    238633..238701
FT                   /locus_tag="SSUSC84_0221"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0221 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        239200..239328
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0222"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0233"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51000"
FT                   /protein_id="CAZ51000.1"
FT                   /translation="MVQIVRLGNCTISDLSVIFTFKKGEYVYPLFSSSFNEKYPQN"
FT   CDS_pept        complement(239381..240727)
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="SSUSC84_0223"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0234"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51001"
FT                   /protein_id="CAZ51001.1"
FT                   /translation="MSNAKAYIQASFEAVKARNPHETEFLQAVEELFSTLEPVFEAHPE
FT                   YIEENILARIVEPERIISFRVPWTDKDGNVQVNRGYRVQFNSAVGPYKGGLRFHPTVNQ
FT                   SILKFLGFEQIFKNVLTGLPIGGGKGGSDFDPKGKTDAEIMRFCQSFMTELQKHIGPSL
FT                   DVPAGDIGVGGREIGYMYGQYKRLRQFDAGVLTGKPLGFGGSLIRPEATGYGLVYFTDN
FT                   MLAANGKSFKDQTVLISGSGNVAQYAVQKATELGAKVISVSDSNGYIIDETGIDFDLLV
FT                   DIKEKRRARLTEYAAEKSTAKYFKGSVWNYDGKADIALPCATQNEINGKQAAALVKNGV
FT                   YCVAEGANMPSDLDAIKVYKENGVLYGLAKAANAGGVAVSALEMSQNSLRLSWTREEVD
FT                   GRLKDIMANIFNTAKETAEKYDLGTDYLAGANIAAFEQIADSMIAQGLV"
FT   misc_feature    complement(239390..240121)
FT                   /gene="gdh"
FT                   /locus_tag="SSUSC84_0223"
FT                   /note="HMMPfam hit to PF00208, ELFV_dehydrog, score
FT                   8.6e-137"
FT                   /inference="protein motif:HMMPfam:PF00208"
FT   misc_feature    complement(240164..240556)
FT                   /gene="gdh"
FT                   /locus_tag="SSUSC84_0223"
FT                   /note="HMMPfam hit to PF02812, ELFV_dehydrog_N, score
FT                   1.3e-83"
FT                   /inference="protein motif:HMMPfam:PF02812"
FT   misc_feature    complement(240320..240361)
FT                   /gene="gdh"
FT                   /locus_tag="SSUSC84_0223"
FT                   /note="ScanRegExp hit to PS00074, GLFV_DEHYDROGENASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00074"
FT   CDS_pept        240949..241887
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="SSUSC84_0224"
FT                   /product="putative dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0235"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51002"
FT                   /protein_id="CAZ51002.1"
FT                   /translation="MVSTVTTLGGFTFDNCLMNAAGVWCMTKEELDAVKNSKAGTFVTK
FT                   TATLDYRAGNPEPRYQNVPLGSINSMGLPNQGLAYYLDYLLELQETEPERTFVLSVVGM
FT                   SPDETHEILRTVEASDFKGLTELNLSCPNVPGKPQIAYDFETTETILQEVFTYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNQFPLKFVNCVNSIGNGLYIKDESVVIKPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLKPEIQIVGTGGILTGRDAFEHILCGASMVQVGTTLQKEGVAAF
FT                   GRITAELQAIMAEKGYETIEDFRGKLQHLDD"
FT   misc_feature    240955..241824
FT                   /gene="pyrD"
FT                   /locus_tag="SSUSC84_0224"
FT                   /note="HMMPfam hit to PF01180, DHO_dh, score 1.2e-110"
FT                   /inference="protein motif:HMMPfam:PF01180"
FT   misc_feature    241066..241125
FT                   /gene="pyrD"
FT                   /locus_tag="SSUSC84_0224"
FT                   /note="ScanRegExp hit to PS00911, DHODEHASE_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00911"
FT   misc_feature    241678..241740
FT                   /gene="pyrD"
FT                   /locus_tag="SSUSC84_0224"
FT                   /note="ScanRegExp hit to PS00912, DHODEHASE_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00912"
FT   CDS_pept        242220..243452
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0225"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0236"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51003"
FT                   /protein_id="CAZ51003.1"
FT                   /translation="MERRANYIRRKRYASYRTKMHLFFICGLATIILAIIIVSEHLVPR
FT                   LNQASESMHSDNSVRIMAHGDLLYHLPILRGAEQPDGSYDFSENFTYVKPWIEQADFAI
FT                   ADFEGTISPDIELAGYPLFNAPAIVANNIHDAGYDLVDLAHNHILDSHLSGLISTVNTF
FT                   RDAGVDTVGVYAEGNRATAPLYIREVNGIRIAVLAYAYGFNGMEALLSQEEYDAYLSDF
FT                   DKEKMRAEIERAEKEADITIVMPQTGVEYQLEPTEEQTSLYHQMIDWGADIVLGGHPHV
FT                   VEPTEILEKDGQRKLIIYSMGNFLSNQRIESMEDTPNAQWTERGVLMDLTIQKENGQTS
FT                   IQTAQAHPTWVNRLSKGTYSTDGYEQFSYQTYILEDWVAGGRYYGQLDLDTQARVDTAY
FT                   QEMKDFVNLVW"
FT   sig_peptide     242220..242336
FT                   /locus_tag="SSUSC84_0225"
FT                   /note="Signal peptide predicted for SSUSC84_0225 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.950) with cleavage
FT                   site probability 0.600 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    242280..242348
FT                   /locus_tag="SSUSC84_0225"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0225 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        243464..244291
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0226"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0237"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51004"
FT                   /protein_id="CAZ51004.1"
FT                   /translation="MIVRLIATDMDGTFLDGQGNFDRERFSRVLDQLDQKKIPFVIASG
FT                   NGIGRLLQLCQGFEDRLIFVADNGAHVYQNGKTVIRRAIQQVEVEAILHFFKGRWADVC
FT                   LMLSNDGNIYMQAGAGMPFAGTDLPIELAQMAAFQNRVTYLDNLSAYPVSESIHKVGLW
FT                   VPEARVESITEAFNQGFHGQLVAVTSGYGSVDILPQGIHKAWGLEQVLTGLDIEPEQVM
FT                   AFGDSDNDIELLSYVGYSYAMENATDKVKAVAKYMAPSHLEAGVLQVIEEYIL"
FT   misc_feature    243479..244273
FT                   /locus_tag="SSUSC84_0226"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 5.6e-60"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    244133..244201
FT                   /locus_tag="SSUSC84_0226"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score NA"
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS_pept        complement(244340..245122)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0227"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0238"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51005"
FT                   /protein_id="CAZ51005.1"
FT                   /translation="MKKYISLYLYNIKVYMMAQMSFRVDFFIGLFSSLIEQIVYLIFLN
FT                   ILFGNIKEIAGFNYGQMLFIYGIATVGRSIHLIFFDNLWMFGSRYIRQGEFERLLLMPV
FT                   NPLFQLICERIQPQGIGTTLIGSLALVQASNELGMEWSLGKLALLIFIAICIGLLYAAI
FT                   QLGPTALAFWIVESFPLTMGIFALNQMAQYPLNIYPKIIQILLIFVFPYAFTAYFPALY
FT                   FLDLSMWGLALPLVVVVLFSINYNLFRYGMTKFTSVGN"
FT   misc_feature    complement(244343..245032)
FT                   /locus_tag="SSUSC84_0227"
FT                   /note="HMMPfam hit to PF06182, DUF990, score 2.2e-43"
FT                   /inference="protein motif:HMMPfam:PF06182"
FT   misc_feature    complement(join(244379..244447,244475..244543,
FT                   244562..244621,244634..244702,244883..244951,
FT                   244979..245047))
FT                   /locus_tag="SSUSC84_0227"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0227 by TMHMM2.0 at aa 26-48, 58-80, 141-163,
FT                   168-187, 194-216 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(245124..245903)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0228"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0239"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51006"
FT                   /protein_id="CAZ51006.1"
FT                   /translation="MRKYLYMTRLTMMNAMQYKAFFLATFVSLAVKILVALYVWKTIFF
FT                   TQSEVNGFTLQTFTTYIIFANLLASLNSFSLGEDLSYSILKGSIAGEFLRPYSFILALF
FT                   FKDLGNKLLELIKFAIVFIGILLVHQDFYLPDGKTILLFLVSSILGMFIVQLLDMAFGF
FT                   LAFFTVNAWGVMLLRMGLFNLASGALLPLSFYPQAVENFLKLLPYNYAVNVPVSILLGQ
FT                   ESDLTALGLQVIWIPILACFIAALWSQAKRRIVIFGG"
FT   misc_feature    complement(245127..245828)
FT                   /locus_tag="SSUSC84_0228"
FT                   /note="HMMPfam hit to PF06182, DUF990, score 2.2e-06"
FT                   /inference="protein motif:HMMPfam:PF06182"
FT   misc_feature    complement(join(245160..245228,245316..245384,
FT                   245403..245471,245514..245582,245676..245744,
FT                   245787..245846))
FT                   /locus_tag="SSUSC84_0228"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0228 by TMHMM2.0 at aa 20-39, 54-76, 108-130,
FT                   145-167, 174-196 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(245896..246879)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0229"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0240"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51007"
FT                   /protein_id="CAZ51007.1"
FT                   /translation="MIQAEHLSKTYSIIDKEVGLKGSIKAFFKPKKKSIPAVQDISLQV
FT                   GKGKIIGYIGSNGSGKSTTIKMLTGVLFPDQGQVRINGLNPQENRKAVNKQIGVLFGQK
FT                   SHLDWNLPVQESFILHAKIYDVPDKVFKERLAVLIELLDLADIMKQPIRNLSLGQRVRC
FT                   EFAAIFIHQPAVVFLDEPTIGLDASVKETIRSFIRYMNQEYQTTFLITSHDMKDIESLC
FT                   ERIFIIDKGKKVYDGSLTVLKERFSTVKTILFSTEKPIEKDLQLEGWEFIRKDDFHFEI
FT                   HYQSKVWTSAQVIEQVFNHYSIEDVTMKELEIETMVRQIYEEGIHA"
FT   misc_feature    complement(246187..246738)
FT                   /locus_tag="SSUSC84_0229"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 2.9e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        complement(246964..247497)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0230"
FT                   /product="TetR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0241"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51008"
FT                   /protein_id="CAZ51008.1"
FT                   /translation="MRTDSRKERTRQAILEAMVTCLESQGFNDITTTHLAQTAGISRSS
FT                   FYTHYKDKYELIDSYQQGLFHKLEAIFDHYDGNRQSSFLEIFELLYREKLLSALLTHNG
FT                   TQEIQNFLINKVRLLVANDLAERLGKENLSQLEKEYSSIYFSHAFFGIMQVWIKNGKQE
FT                   SPQYMTDFLIKMLP"
FT   misc_feature    complement(247318..247458)
FT                   /locus_tag="SSUSC84_0230"
FT                   /note="HMMPfam hit to PF00440, TetR_N, score 3.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(247345..247410)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1431.000, SD 4.06 at aa 30-51, sequence
FT                   ITTTHLAQTAGISRSSFYTHYK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        247623..250082
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0231"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0242"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51009"
FT                   /protein_id="CAZ51009.1"
FT                   /translation="MLQKVKNIFKKPMTLITILGIACVPALYNISFLTSMWDPYGRLDQ
FT                   LPVAVVNQDQSASFQDKTLTIGDDMVDNMKESKSLDFHFVSEKNAEKGLEEGDYYMVIT
FT                   LPEDLSEKATSLLTNQPEPITISYQTSKGHSFVASKMGESAMEKLKTSVSETITKTYTT
FT                   AVFDSMREIQTGMIEAADGSQKLTNGASQLESGSQTLSNGLTTLTTSGQVLVTGANQLA
FT                   TGVVSYTDGVNQAATGSQTLSSGLTIYTNGVASLVSGAEQLNANSSQLITGVGQLQSGA
FT                   SQVEQLVTGANQLQAGLEQLANSTSLSAEQSSQIQALLTGLPQLQVAINQLNDSLSSIG
FT                   GLAVDNSTLSSLLTEMGAQAQGLLTAAQADKTASIEALQTTATYQNLTADQQAELVGAL
FT                   QNSPSATATVAQTILDQLSQLSQTLSSLQSLSGMATQMNQLQSAVGQINTAANQALPGA
FT                   TTAIESLSSGLSQVNTALNQQVLPGTQTLTSGVSQLQTQLSSGASQLMFGVTAYTAGVA
FT                   QLAAGGAQLVANNSSIQSGGGQLTSGLATLASNSSQLVSGSEQLASGSQQLIAGADQLA
FT                   SGGQALTSGISSLRTGSETLTNSLSSASQQLSVVSVEDKNAQAVSQPVTLEHSDQDDVK
FT                   TNGVGMAPYMVSVALMVAALSANVIFVKHIDNRSYKNRWDWAKGKLLLNGIIASLAAVI
FT                   LYGVLRLIGIEPAHPMATLGIILLASWTFMALVTALVGWNNRFGSFASLIILLLQLGSS
FT                   AGTYPIELSPRFFQVIQPYLPMTYSVSSLRQTISMVGNSSHQVWMLSLFLVGFMGLGLL
FT                   IYNQKDE"
FT   misc_feature    join(247659..247727,249540..249608,249666..249734,
FT                   249744..249812,249831..249899,250008..250067)
FT                   /locus_tag="SSUSC84_0231"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0231 by TMHMM2.0 at aa 13-35, 640-662, 682-704,
FT                   708-730, 737-759 and 796-815"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    249348..249983
FT                   /locus_tag="SSUSC84_0231"
FT                   /note="HMMPfam hit to PF01061, ABC2_membrane, score 0.0024"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   CDS_pept        complement(250132..251190)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0232"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0243"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51010"
FT                   /protein_id="CAZ51010.1"
FT                   /translation="MKKKLTIAIIIGFVSLIAGLILAGIGFFTGGITRLEEVAAPTEVH
FT                   KTFTDLNTIKIDFIPHSVYIKESSDNNYHVTYANSDNNIQNPLKLSEKDGVLTLSAQEL
FT                   EFAIEGIMQYLGESLAQRRINVFSVTIEVPKGKTLDKLEGHNLHFYDFGGFTIENIHIK
FT                   EANLSGGVTLDKVTIDSGQIEAGYFQATQSTLKDMHINLQGSSVRLYETSLENVTIEGY
FT                   SQLDSRQTTLLGDNRFTPSDTYSSTTFLDVTDKSLADSNLLITNQIDKKKLVEAQGYYY
FT                   EDGNDLGEMVNQDPYLKERLGEVGIFTSDKYTKFPVKTENDLQTLTLENKGSKNKLTIE
FT                   ATNATINLGTPK"
FT   sig_peptide     complement(251071..251190)
FT                   /locus_tag="SSUSC84_0232"
FT                   /note="Signal peptide predicted for SSUSC84_0232 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.989) with cleavage
FT                   site probability 0.452 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(251104..251172)
FT                   /locus_tag="SSUSC84_0232"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0232 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(251187..251942)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0233"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0244"
FT                   /note="CDS contains additional internal amino acids,
FT                   residues 90 to 145, in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51011"
FT                   /protein_id="CAZ51011.1"
FT                   /translation="MTRTEYMEQLEKYLKKLPHKEYFEAISFFNEYFDEVGPERETEII
FT                   EELGSPKEAASELINNMLNKQIQEEKDQQEPIQLNWKLWVGLGALSMTGLFSFFLLFIM
FT                   GEFIGVIPLFATLILGAFFLGRYFRNFSQTKRTLWLAILAVISLPIAIPLLLILLASLL
FT                   GLVALILALIVGAFVLGVGLLTSGGYLIWEAFSLMSEGFNIFLMGFGSGLSLIGGAILI
FT                   YILTGFFAYWSWRLVKACFKWILKRGKRA"
FT   misc_feature    complement(join(251265..251333,251367..251435,
FT                   251463..251531,251568..251621,251634..251702))
FT                   /locus_tag="SSUSC84_0233"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0233 by TMHMM2.0 at aa 81-103, 108-125, 138-160,
FT                   170-192 and 204-226"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(251769..251942)
FT                   /locus_tag="SSUSC84_0233"
FT                   /note="HMMPfam hit to PF08006, DUF1700, score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF08006"
FT   CDS_pept        complement(251929..252255)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0234"
FT                   /product="PadR-like family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0245"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51012"
FT                   /protein_id="CAZ51012.1"
FT                   /translation="MHFPVPAVLTEFLIMAILESDDSYGYEICQTIKLIANIKESALYP
FT                   ILKRLEQNDFLTTYSQEYQGRMRKYYSLTQLGHEELVRLKDDWDTYTNTINGIIEGSVR
FT                   HDKN"
FT   misc_feature    complement(252004..252231)
FT                   /locus_tag="SSUSC84_0234"
FT                   /note="HMMPfam hit to PF03551, PadR, score 1e-18"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        252564..252944
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0235"
FT                   /product="LrgA family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0246"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51013"
FT                   /protein_id="CAZ51013.1"
FT                   /translation="MKLYVQFMIILVFSFLGEAISTIFHLPIPGSIIGLILLFLALEFK
FT                   LIRLRHIHTVGNFLLANMTILFLPAAVGIMERFDAIKDYLLPIIVVILGAIFLNILVIG
FT                   FVVQFVKQKFEGDYIDAEGNHD"
FT   misc_feature    252570..252899
FT                   /locus_tag="SSUSC84_0235"
FT                   /note="HMMPfam hit to PF03788, LrgA, score 5.4e-41"
FT                   /inference="protein motif:HMMPfam:PF03788"
FT   misc_feature    join(252621..252689,252726..252785,252813..252881)
FT                   /locus_tag="SSUSC84_0235"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0235 by TMHMM2.0 at aa 20-42, 55-74 and 84-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        252919..253632
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0236"
FT                   /product="LrgB-like family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0247"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51014"
FT                   /protein_id="CAZ51014.1"
FT                   /translation="MMRREIMTELFSNPIFGIMLSIAAYLIGMLIYRRFPHPITTPLLV
FT                   ATGLIIVFLKMTGISYKEYYAGGSYLNMLIVPSTVALGIPLYRSFHLMKHHIRSILLGI
FT                   FVACIVNTVFTALIAKWFGMDFFLAISLFPKSVTTAMAVGITDKMQGIATVTLVVVVAT
FT                   GILTSVLGPVFLKLLKIEDPVAVGLALGGTGHAIGTGTAIKCGHTQGAMAGLAIGITGI
FT                   MYVVISPIVAQIILQ"
FT   misc_feature    join(252946..253014,253033..253101,253111..253179,
FT                   253216..253284,253294..253353,253372..253440,
FT                   253468..253536,253555..253623)
FT                   /locus_tag="SSUSC84_0236"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0236 by TMHMM2.0 at aa 10-32, 39-61, 65-87,
FT                   100-122, 126-145, 152-174, 184-206 and 213-235"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    252979..253623
FT                   /locus_tag="SSUSC84_0236"
FT                   /note="HMMPfam hit to PF04172, LrgB, score 3.4e-106"
FT                   /inference="protein motif:HMMPfam:PF04172"
FT   CDS_pept        complement(253665..254465)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0237"
FT                   /product="putative formate/nitrite transporter family
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0248"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51015"
FT                   /protein_id="CAZ51015.1"
FT                   /translation="MGANQETLMYTLEKSIKKKADLFEHSFSAYAVRSILASLYLGLGI
FT                   VISLYTADKLNHVAEGLGKFSYGLMFGWGLLMILYMNAELGTSNMMYMTVASHRKTIPT
FT                   KTALKMLATCILFNFVGAVLVCYLVSLTLPYQHVDAHSYLFEATVAKLSKTPLTQFIEG
FT                   IFANIVVNIGVFTFLRIKDDAGRLISVIFIIFIFAFLGYEHVIANFSLFSLAFFANGGP
FT                   VEGMTLLSVLSNFLFSGLGNYVGGGLFIGLLYSWLNNQSKLYVD"
FT   misc_feature    complement(253683..254456)
FT                   /locus_tag="SSUSC84_0237"
FT                   /note="HMMPfam hit to PF01226, Form_Nir_trans, score
FT                   1.1e-16"
FT                   /inference="protein motif:HMMPfam:PF01226"
FT   misc_feature    complement(join(253695..253763,253845..253913,
FT                   253932..254000,254058..254126,254187..254255,
FT                   254313..254381))
FT                   /locus_tag="SSUSC84_0237"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0237 by TMHMM2.0 at aa 29-51, 71-93, 114-136,
FT                   156-178, 185-207 and 235-257"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        254606..255451
FT                   /transl_table=11
FT                   /gene="gla"
FT                   /locus_tag="SSUSC84_0238"
FT                   /product="glycerol facilitator-aquaporin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0249"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51016"
FT                   /protein_id="CAZ51016.1"
FT                   /translation="MDVTWTVKYITEFLATALLIIIGNGTVANVDLKGTKGNNSGWILI
FT                   AIGYGLAVMMPALMFGNVSGNHINPAFTLGLAVSGLFPWAHVAQYIVAQLLGAMFGQLV
FT                   VVAVYKPYFLKTENSNHILGSFSTISALDNGTKESRKAATTNGFLNEFVGSFVLFFGAL
FT                   ALTKHFFGSELVGKLIEQGYDKTVAETMTAPYTSGSIAVAHLGIGFLVMALVAALGGPT
FT                   GPGLNPARDLGPRIVHALLPKSVLGENKADSKWWYAWVGVCAPIIASIAAVALFKFLYL
FT                   "
FT   misc_feature    254606..255433
FT                   /gene="gla"
FT                   /locus_tag="SSUSC84_0238"
FT                   /note="HMMPfam hit to PF00230, MIP, score 3.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    join(254618..254686,254729..254797,254816..254884,
FT                   255059..255127,255188..255256,255374..255442)
FT                   /gene="gla"
FT                   /locus_tag="SSUSC84_0238"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0238 by TMHMM2.0 at aa 5-27, 42-64, 71-93, 152-174,
FT                   195-217 and 257-279"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254804..254830
FT                   /gene="gla"
FT                   /locus_tag="SSUSC84_0238"
FT                   /note="ScanRegExp hit to PS00221, MIP, score NA"
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS_pept        255580..257112
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0250"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51017"
FT                   /protein_id="CAZ51017.1"
FT                   /translation="MSDVIAFGYGSSRAKMQLKRLNRHGIIAGATGTGKTVTLKVLAEQ
FT                   LSDAGIPVFLSDIKGDLNSLVAANTKEIDPSRLEKTHYLDYSPVGYPVELWDVLGENGT
FT                   PIRMTISELGPVLLTRLLGLNDTQESILNIVFSVADERGLLLIDLMDLRAMLNFVAENA
FT                   AELSQYYGNIPARSVGAILRSLVVLEQQGGKIFFGEPSLDIADLMRTAEDGRGVINVLQ
FT                   ATQLFNQPTLYSTVLLSLLSELYEVLPEVGDLDKPKMVFFFDEAHVLFKDAPKVLLEKI
FT                   ELIVRLIRSKGVGVFFVTQNPTDIPDSVAAQLGNRIQHGLRAFTPKELKTVATVAETFR
FT                   QEGDEDLAKVIQELQVGEAVVSTLQADGTPSFADRVLIYPPKSMLGTVEPSALLSVINN
FT                   SPLMEKYADAVNRESAHEQILAMTEAKEAELIKKAEQAEAEKQAEKEAKAAAKMEEKAQ
FT                   KEAAKTAQKTSQPASRKTDSMMDRFTKNLMSQVGREVGRVVTRGIMGMLKGK"
FT   misc_feature    255583..257106
FT                   /locus_tag="SSUSC84_0239"
FT                   /note="HMMPfam hit to PF05872, DUF853, score 6e-248"
FT                   /inference="protein motif:HMMPfam:PF05872"
FT   CDS_pept        257224..257832
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0240"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0251"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51018"
FT                   /protein_id="CAZ51018.1"
FT                   /translation="MTDQLQALLKDYQPQPLGEKRSYAVFLPLVWSDNQWQVLYEIRSE
FT                   SISQPGEVSFPGGGVEVGETPQQAAVREVMEELNIQPEQIDILGEIDYLVLECSTVHCF
FT                   VGRLNLDWTTILPNEEVARIFTVPLSTLLTTQPVYYQLDSQIVPDCDFPFERLRGGVDY
FT                   PFSHHKRSVPFYENLSENIWGMTAQFTHRFTEIVKSNLS"
FT   misc_feature    257371..257622
FT                   /locus_tag="SSUSC84_0240"
FT                   /note="HMMPfam hit to PF00293, NUDIX, score 1.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    257395..257460
FT                   /locus_tag="SSUSC84_0240"
FT                   /note="ScanRegExp hit to PS00893, NUDIX, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        257834..257959
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0241"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0252"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51019"
FT                   /protein_id="CAZ51019.1"
FT                   /translation="MIGYFWEEKPAFAICINEKNGDKAQCEPMYIKTQKKQMHGR"
FT   CDS_pept        258122..260176
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0242"
FT                   /product="putative surface-anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0253"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51020"
FT                   /protein_id="CAZ51020.1"
FT                   /translation="MSKQKVVSSLLLSTVVLGGLAFYSTTTVKAESLEPDVTSVNASDA
FT                   TNKPVVPNEEGGDFLAEEELEDDDTLEEELNEKAEEVTEPSSPEALLQPRAMMSDSETS
FT                   GMEEIPMNDEPSDNTEEKVEKQQSPLIQTSNADYKSGKDQEKLRTSVSINLLKAEEGQI
FT                   QWKVTFDTSEWSFNVKHGGVYFILPNGLDLTKIVDNNQHDITASFPTDINDYRNSGQEK
FT                   YRFFSSKQGLDNENGFNSQWNWSAGQANPSETVNSWKSGNRLSKIYFINQITDTTELTY
FT                   TLTAKVTEPNQQSFPLLAVMKSFTYTNSKSTEVTSLGAREITLEKEKTLPPKENPKPEP
FT                   EAPKPDAPQAPSAPESPTEEPKKEDAPAPSTPEKQPEVPESPNPETPDAPSTPKDEPQV
FT                   PSIPEEQPKETPAPEEPKKEDTPQTPQAPSTPKEEAPKEEVPTPPAPSVPEEQPKETPT
FT                   PEVPKQEDVQPEAPKSDKVESDKQMPETKKPDMKQPKADDMPKEQKPKADEPKAEQPQM
FT                   DKPQMEAPKKDSEAPKSDKVETDKQLPETKQPDMKQPKADDMPKEQKPKADEPKAEQPQ
FT                   MDKPQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQPKADKPEAEKAQMPRTEGMKPE
FT                   SKASMMPKAEAPKATLPNTGEASSAIGWLGGALATLATGLYLFKNKKEE"
FT   sig_peptide     258122..258211
FT                   /locus_tag="SSUSC84_0242"
FT                   /note="Signal peptide predicted for SSUSC84_0242 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.998 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(258140..258199,260096..260155)
FT                   /locus_tag="SSUSC84_0242"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0242 by TMHMM2.0 at aa 7-26 and 659-678"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    260048..260167
FT                   /locus_tag="SSUSC84_0242"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        join(260611..261327,261331..262650)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0243"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0254"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   239. C-terminal region is simlar to Streptococcus
FT                   pneumoniae surface protein PspC UniProt:Q8RQ77
FT                   (EMBL:AF276620) (612 aa) fasta scores: E()=6.3e-25, 35.897%
FT                   id in 429 aa"
FT                   /db_xref="PSEUDO:CAZ51021.1"
FT   sig_peptide     260611..260700
FT                   /locus_tag="SSUSC84_0243"
FT                   /note="Signal peptide predicted for SSUSC84_0243 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.995 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    260629..260697
FT                   /locus_tag="SSUSC84_0243"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0243 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    262513..262632
FT                   /locus_tag="SSUSC84_0243"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   0.00041"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        join(262758..262787,262791..262850)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0244"
FT                   /product="transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0254A"
FT                   /note="Probable gene remnant. CDS contains a nonsense
FT                   mutation (opal) after codon 10. Similar to an internal
FT                   region of Streptococcus pneumoniae (strain ATCC BAA-255/R6)
FT                   IS861-truncation degenerate transposase (Orf1)
FT                   UniProt:Q8DQ22 (EMBL:AE008462) (65 aa) fasta scores:
FT                   E()=0.58, 40.000% id in 30 aa"
FT   CDS_pept        262893..263027
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0245"
FT                   /product="integrase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0256"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae (serotype V) phage
FT                   integrase family site-specific recombinase UniProt:Q8DWV1
FT                   (EMBL:AE014287) (494 aa) fasta scores: E()=0.00046, 55.814%
FT                   id in 43 aa"
FT                   /db_xref="PSEUDO:CAZ51023.1"
FT   CDS_pept        complement(263121..263270)
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSUSC84_0246"
FT                   /product="50S ribosomal protein L33 1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0257"
FT                   /note="Similar to SSU1221, 44.898% identity (44.898%
FT                   ungapped) in 49 aa overlap (1-49:1-49)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51024"
FT                   /protein_id="CAZ51024.1"
FT                   /translation="MRVNITLEHKESGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVIF
FT                   TEVK"
FT   misc_feature    complement(263124..263267)
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSUSC84_0246"
FT                   /note="HMMPfam hit to PF00471, Ribosomal_L33, score
FT                   5.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00471"
FT   misc_feature    complement(263163..263222)
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSUSC84_0246"
FT                   /note="ScanRegExp hit to PS00582, RIBOSOMAL_L33, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00582"
FT   CDS_pept        complement(263286..263468)
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="SSUSC84_0247"
FT                   /product="50S ribosomal protein L32"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0258"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51025"
FT                   /protein_id="CAZ51025.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHYKVAAPTVKFDETTGDYSRSHRVSLK
FT                   GYYKGRKIAKAASAE"
FT   misc_feature    complement(263301..263465)
FT                   /gene="rpmF"
FT                   /locus_tag="SSUSC84_0247"
FT                   /note="HMMPfam hit to PF01783, Ribosomal_L32p, score
FT                   4.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01783"
FT   CDS_pept        263744..265027
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="SSUSC84_0248"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0259"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51026"
FT                   /protein_id="CAZ51026.1"
FT                   /translation="MKLQKPKGTQDLLPQDSAKWQYVENFTRSIFKQYNYAEIRTPIFE
FT                   HYEVISRSVGDTTDIVTKEMYDFYDKGERHITLRPEGTAPVVRSYVENKLFAPEVQKPA
FT                   KFYYMGPMFRYERPQAGRLRQFHQIGVECFGSNNPATDVETIAMAYHFFEELGIKDIRL
FT                   HLNSLGNPESRAAYRQALIDYLTPLKEQLSKDSQRRLEENPLRVLDSKEKEDKVAVENA
FT                   PSILDYLDEESTVHFEAVRSMLDNLGITYTIDTNMVRGLDYYNHTIFEFMTEVGGNDLT
FT                   ICAGGRYDGLVTYFGGPETPAFGFGMGIERLILVLEKQGIELPLDTQLDVYIAVLGQEA
FT                   NGGALDLVQAIRKQGFRAERDYLDRKLKAQFKSADVFGAKAIITLGGSEIESGQVVVKN
FT                   NQTRSQVETSLEALKTDFASILEELEKQ"
FT   misc_feature    263798..264307
FT                   /gene="hisS"
FT                   /locus_tag="SSUSC84_0248"
FT                   /note="HMMPfam hit to PF00587, tRNA-synt_2b, score 9.9e-58"
FT                   /inference="protein motif:HMMPfam:PF00587"
FT   misc_feature    264731..265003
FT                   /gene="hisS"
FT                   /locus_tag="SSUSC84_0248"
FT                   /note="HMMPfam hit to PF03129, HGTP_anticodon, score
FT                   3.4e-20"
FT                   /inference="protein motif:HMMPfam:PF03129"
FT   CDS_pept        complement(265108..266133)
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="SSUSC84_0249"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0260"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51027"
FT                   /protein_id="CAZ51027.1"
FT                   /translation="MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVA
FT                   NGDFGKVPGRVLGHEGIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPG
FT                   QWIAIYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPG
FT                   YIKEITGGGVHSTVVTAVSKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIK
FT                   VVGSLVGTRKDLEEAFHFGAMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHS
FT                   H"
FT   misc_feature    complement(265228..265650)
FT                   /gene="adhP"
FT                   /locus_tag="SSUSC84_0249"
FT                   /note="HMMPfam hit to PF00107, ADH_zinc_N, score 3.7e-37"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(265738..266061)
FT                   /gene="adhP"
FT                   /locus_tag="SSUSC84_0249"
FT                   /note="HMMPfam hit to PF08240, ADH_N, score 3.2e-47"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    complement(265918..265962)
FT                   /gene="adhP"
FT                   /locus_tag="SSUSC84_0249"
FT                   /note="ScanRegExp hit to PS00059, ADH_ZINC, score NA"
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        266586..269237
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="SSUSC84_0250"
FT                   /product="aldehyde-alcohol dehydrogenase [includes: alcohol
FT                   dehydrogenase; acetaldehyde dehydrogenase]"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0261"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51028"
FT                   /protein_id="CAZ51028.1"
FT                   /translation="MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYI
FT                   VAKASVAALDKHGELAMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDD
FT                   VTGLTLIAEPVGVVCGITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARV
FT                   VYEAAVAAGAPENCIQWVTKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALG
FT                   VGAGNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYK
FT                   TYFVNKKEKALLEEYCFGVKANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILA
FT                   AEVAEIGEKEPLTREKLSPVIAVLKVEGRAEGLEAARQMVEFHGLGHSAAIHTEDAELA
FT                   KEFGTIVRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIK
FT                   KVGRRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLD
FT                   LRRNKVVYQIFSDVEPDPDITTVYKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQ
FT                   PTVDFHDLVQKFMDIRKRAFKFPELGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKY
FT                   PIADYSLTPTVAIVDPALVLTVPAHVTADTGMDVLTHATEAYVSTVANDFTDGLALQAI
FT                   KLVFENLESSVKNADFVSREKMHNASTMAGMAFANAFLGISHSMAHKIGGRFHTVHGRT
FT                   NAILLPYVIRYNGTRPAKTATWPKYNYYKADEKYQDIARLLGLPCSTPEEAVAAYAQAV
FT                   YDLGERIGIQMNLKAQGIDEKELKEHSRELALLAYEDQCTPANPRLAMVDHMQEIIEDA
FT                   YYGYKERPGRIK"
FT   misc_feature    267762..267827
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1186.000, SD 3.23 at aa 393-414, sequence
FT                   TEDAELAKEFGTIVRAIRVIWN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    268002..269177
FT                   /gene="adhE"
FT                   /locus_tag="SSUSC84_0250"
FT                   /note="HMMPfam hit to PF00465, Fe-ADH, score 1.9e-144"
FT                   /inference="protein motif:HMMPfam:PF00465"
FT   misc_feature    268524..268610
FT                   /gene="adhE"
FT                   /locus_tag="SSUSC84_0250"
FT                   /note="ScanRegExp hit to PS00913, ADH_IRON_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00913"
FT   misc_feature    268782..268844
FT                   /gene="adhE"
FT                   /locus_tag="SSUSC84_0250"
FT                   /note="ScanRegExp hit to PS00060, ADH_IRON_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00060"
FT   misc_feature    268938..269003
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1004.000, SD 2.61 at aa 785-806, sequence
FT                   EKYQDIARLLGLPCSTPEEAVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        269651..271135
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0251"
FT                   /product="putative threonine synthase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0262"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51029"
FT                   /protein_id="CAZ51029.1"
FT                   /translation="MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFS
FT                   VLKDASYQDVAKLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELF
FT                   RGSTIAFKDMALSILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQII
FT                   VFYPRDGVSKVQELQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQ
FT                   FSSANSMNIGRLVPQIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQI
FT                   GLPVGKLICASNDNNVLTDFFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGND
FT                   AAKTAELMEALNTAGQYDIQGADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHT
FT                   AVASAVYKQYVEQTGDQTPTVIASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISG
FT                   VDLPPAVDGLETAPVRHNTVVAAADMQTEVERYLGV"
FT   misc_feature    269897..270829
FT                   /locus_tag="SSUSC84_0251"
FT                   /note="HMMPfam hit to PF00291, PALP, score 9.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    269954..269998
FT                   /locus_tag="SSUSC84_0251"
FT                   /note="ScanRegExp hit to PS00165, DEHYDRATASE_SER_THR,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00165"
FT   CDS_pept        271264..273024
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0252"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0263"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51030"
FT                   /protein_id="CAZ51030.1"
FT                   /translation="MAQEQEKISREKKKALLKRLKERIKPKMKLVYLAAFLSWVQFLMR
FT                   IISFYLIAKGFVSYYEGGQVDLVRFVLILLGLNAFGYGVALIAKRLQGLGSQFARDSLK
FT                   QSFFEVLLAKDGQFASKATAADVFNIASQGIDSLDTYYSYYMASSLRTQFNCATVLLLV
FT                   FLIFPLGAVIFILALPLIPISIIAMQKRSKRIMNRYWGSYMDVGNLFLDDLKGLNTLYS
FT                   YQADATYEKTFNEQAEDFRDATMELLSFQLQAVGYMDAVMYLGIGLSGFVAVNSLAAGN
FT                   LSLFSMLFFVLIATEFFAPIREQGYGMHLVMMNTKMADRIFGFLDSMTAEQEIDSVHVP
FT                   AFDSLKLEDLAFAYGEKPVLEDISMTMPAGKVYALAGESGQGKTTLAQLLLGRLRADKG
FT                   AIYLGEQEISGISKLSLNEQVLYVSGQSTLLNQSIYHNLRMACDWSKEDILAWADQHGV
FT                   LQFVKNLPDGLDTIVGDDGAFLSPGQRQQVICARAVLAKRSLYIFDEVTSSVDQDNEGL
FT                   IYDLIDLVAKDAIVIIITHKMKQVEQADDILFLSAEGAVTGNYATLYQTSLAYGQLVDQ
FT                   QRELEEAVYG"
FT   misc_feature    join(271351..271419,271462..271521,271738..271806,
FT                   272011..272079,272098..272166)
FT                   /locus_tag="SSUSC84_0252"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0252 by TMHMM2.0 at aa 30-52, 67-86, 159-181,
FT                   250-272 and 279-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272371..272925
FT                   /locus_tag="SSUSC84_0252"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 5.3e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        273017..274678
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0253"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0264"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51031"
FT                   /protein_id="CAZ51031.1"
FT                   /translation="MDKKEMPTRVLIPRLLQSMKHLLPRIAVAVCFAVLGQVVTIAIPV
FT                   MLVYLAFNALTGNPAPLWTLGILILLALLRGAFRYGEHYFGHYVAFHTLAAYRRLIFAK
FT                   LRALAPGKLDRQDSGSLLKMIGEDIEALEVFFAHTIAPICTGILVALGLTVYFGLSSWG
FT                   LAFLALVTYALLAIAIPNQFAQQLQPLLKEQNASRKGYVSYFIESLKSMKDLMQFQQTD
FT                   ARFANLTQKSQEVNGQERRVAQTNFMQYAVSFLVVGLSIMGFAWLTFDLVGSQSLDLAT
FT                   GVALLVSFISSFAPFLELSRLPLGFKRAMNAGRNIYALLDEKEAERTGELVEVSVTDIA
FT                   IEQLDFDYDVRETGLYRNLSVQFEQGGIIGLVGESGAGKSTLMKLIMRWYDWQQGQIRL
FT                   SGLDSRQVDKAHLQGAFAYVPQVPQIFRQTIRENLVLGRTDISDETIMDLAEKCHMKER
FT                   ILAAPQGLDTLVEASDFSAGEGQRLELMRALLKNADCYIFDEPTSNLDSLNEARFIQLV
FT                   KEHCQGMVFLISHRSSTMACADTIFRLEDGQLVKEK"
FT   misc_feature    273092..273904
FT                   /locus_tag="SSUSC84_0253"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 1.8e-05"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    join(273098..273166,273194..273250,273416..273484,
FT                   273497..273565,273764..273832,273860..273928)
FT                   /locus_tag="SSUSC84_0253"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0253 by TMHMM2.0 at aa 28-50, 60-78, 134-156,
FT                   161-183, 250-272 and 282-304"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274112..274657
FT                   /locus_tag="SSUSC84_0253"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 4.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        274679..275272
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0254"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0265"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51032"
FT                   /protein_id="CAZ51032.1"
FT                   /translation="MKKLQVKDLMVTGAFAALYFVCVGLGTLLSLVFDRSGNMMYAPAG
FT                   AALLAGPVYMLLVAKVGKFGSISLVGAVMACFFFLSGYMTAAFLPSLTFGFLAEMVAKS
FT                   GHYKQKWTNLFSYIIFSFGNLGPIILMWFMRDAYEANLLARGKSAEYIARVMLDFTPEN
FT                   VLWLSTTIILTALISGLFGQYMLQRYFKQSGYLS"
FT   misc_feature    join(274706..274774,274793..274861,274904..274972,
FT                   275009..275077,275168..275236)
FT                   /locus_tag="SSUSC84_0254"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0254 by TMHMM2.0 at aa 10-32, 39-61, 76-98, 111-133
FT                   and 164-186"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        275269..275928
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0255"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0266"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51033"
FT                   /protein_id="CAZ51033.1"
FT                   /translation="MKLDARTKIILVIFTSFTYGMRLTILENAVLVLGLSLLFWFSGKR
FT                   KMAIMSPIAYSIFCLLSYITFLPAWLTHLLLVLTYTWPPLLAGHLLLMTTSGYELIHGL
FT                   RKWHLPEVFLLTLGVMFRFLPAIKQDARTICASLKVRGIFLRKRDVVCKPLQYMEFFLV
FT                   PLMMSLLRTAQELTVASLTKGLAVSTKSPAYIWSSWTVLDWSLCLCCLGFLILVRL"
FT   misc_feature    join(275326..275394,275431..275499,275851..275919)
FT                   /locus_tag="SSUSC84_0255"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0255 by TMHMM2.0 at aa 20-42, 55-77 and 195-217"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    275521..275850
FT                   /locus_tag="SSUSC84_0255"
FT                   /note="HMMPfam hit to PF02361, CbiQ, score 7.5e-11"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   CDS_pept        275892..277319
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0256"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0267"
FT                   /note="Possible alternative translational start sites after
FT                   codons 1 and 11"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51034"
FT                   /protein_id="CAZ51034.1"
FT                   /translation="MLSRFSDSRPAVTVKNVALTYSGADKPALQIEDLTIPEGQCVVLC
FT                   GQSGSGKSSFLKVLNGLTPEYYPAQLSGQIFLGDLDLQKSSLEEISRHIASVFQHPSTQ
FT                   FFHSQVLQELVFPCENQGLSREEIENRLAWVMELFGLASLSQRTISSLSGGQQQRLALA
FT                   VATMQGTDVLVLDEPTANLDQEGIVIVEDILKTLKSQGKTIIIAEHRLSYLSQLADRYL
FT                   YFQDGQVVTDYLADEFLSRTEECRQDMGLRCYDSEPYGRAIAELADQFVNDKEGLLVEN
FT                   LSVSQKENTLYEIEKLCLAPGQVVGLVGANGSGKTSLARYLVGLAEDKKSRISWQGQTL
FT                   SSRQRLEKTAFVMQDVRLQLFAESVERELTLGRKNRAVDEHLVARFGLSDLLERHPVSL
FT                   SGGEQQRVMIVASLLADKEIFIFDEPTSGLDLRRMQQVASALVDLKMKNKLVLLISHDE
FT                   ELLNLVCDKIVDIKQLK"
FT   misc_feature    276006..276572
FT                   /locus_tag="SSUSC84_0256"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.3e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    276015..276056
FT                   /locus_tag="SSUSC84_0256"
FT                   /note="ScanRegExp hit to PS00675, SIGMA54_INTERACT_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00675"
FT   misc_feature    276345..276389
FT                   /locus_tag="SSUSC84_0256"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    276795..277313
FT                   /locus_tag="SSUSC84_0256"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 8e-35"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    277086..277130
FT                   /locus_tag="SSUSC84_0256"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        277325..278602
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0257"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0268"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51035"
FT                   /protein_id="CAZ51035.1"
FT                   /translation="MNKQTYKEILTIAFPAMGENLLQMLMGVVDSYLVASIGIVALSGV
FT                   SLANNILAVYQAVFIALAVAVSSRLAQALGEGGSEGIGGTASESVKFTVFIGLLLGIFS
FT                   VLAGPIVLTSLGAESEVVQAGGLYLILVGGGAPFLGLMTSLSAILRTLGEPRFPMYISL
FT                   LSNVLNALFSAFAVFVLHAGVAGVAIGTVLSRLIGCSLLWSRLPISLKPWTWSFDKELL
FT                   RLALPATGERLMMRVGDVVVVALITSLGTATVAGNAIGETLTQFNYMPALGIATATIIL
FT                   TAKHRQDKAMVRHIFRTSFGLSLLFMFLVAGVTYFAGSFLIDLYTKDIQAAQASQTVLF
FT                   YAMLGVPFTAGTLIMTALWQGLGNARLPFYATTIGMWLVRIGIAYLLVTFFKIGLSAIW
FT                   IATILDNAFRSGVLFFQYRYSKQESI"
FT   misc_feature    277367..277849
FT                   /locus_tag="SSUSC84_0257"
FT                   /note="HMMPfam hit to PF01554, MatE, score 4.1e-31"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    join(277388..277456,277475..277543,277601..277669,
FT                   277703..277771,277835..277903,278042..278101,
FT                   278114..278173,278222..278290,278333..278401,
FT                   278465..278533)
FT                   /locus_tag="SSUSC84_0257"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUSC84_0257 by TMHMM2.0 at aa 22-44, 51-73, 93-115,
FT                   127-149, 171-193, 240-259, 264-283, 300-322, 337-359 and
FT                   381-403"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    278003..278482
FT                   /locus_tag="SSUSC84_0257"
FT                   /note="HMMPfam hit to PF01554, MatE, score 1.4e-20"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   CDS_pept        278792..279727
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="SSUSC84_0258"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0269"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51036"
FT                   /protein_id="CAZ51036.1"
FT                   /translation="MSVVGKANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEA
FT                   LTVACDFYKGLVHKMPKIWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSA
FT                   AVAVAVARALFAYYEKELTDSELWDIVQSSEKIAHGNPSGIDAATTSGKSPVFFIKHQP
FT                   IEPFELKLHAHLVVADTGVTGNTLEAISDVADLLEKKPEAIKLVEELGNLTRQAKEDLA
FT                   TDQAELLGSRMNQAHALLQKLGVSDPSLDKLVSLAQENGALGAKLTGGGRGGCMIALAR
FT                   TAQDAQKLAHILDQAGARQTWIQYLGETND"
FT   misc_feature    279050..279250
FT                   /gene="mvaK1"
FT                   /locus_tag="SSUSC84_0258"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   1.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    279440..279688
FT                   /gene="mvaK1"
FT                   /locus_tag="SSUSC84_0258"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   1.9e-12"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        279720..280745
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SSUSC84_0259"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0270"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51037"
FT                   /protein_id="CAZ51037.1"
FT                   /translation="MTKQIGIARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTD
FT                   TKVVFDPELTADEFYLNGILQKEKEILKISRFLDLFCEYIGERAFARVESLNFVPTAAG
FT                   LASSASAFAALALATATALDLDLSPATLSTLARRGSGSSTRSLFGGFVEWGMGTGSEDS
FT                   MAHPIDDADWDIGMVVLAVNTGPKKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAA
FT                   IASRDFEKLGQITEHNGMKMHATTLSANPPFTYWSADSLVAQEAVRQVREATGLSAYMT
FT                   MDAGPNVKVLCRASQMDELVAGLAKVFPREKIITSKPGPAAYVLSEKDWQASQTAFEKG
FT                   I"
FT   misc_feature    279993..280169
FT                   /gene="mvaD"
FT                   /locus_tag="SSUSC84_0259"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   1.7e-10"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    280374..280649
FT                   /gene="mvaD"
FT                   /locus_tag="SSUSC84_0259"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   0.00032"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        280747..281826
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SSUSC84_0260"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0271"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51038"
FT                   /protein_id="CAZ51038.1"
FT                   /translation="MKVQVKIPGKLFLAGEYAVVEAGYPAVIAAVGQYLTVTIETSDQG
FT                   SLHSSQKADLYLTWERKEGAVRIQGSHPYALIESAMQVTEAYLTAKGYACHGTYSLSVQ
FT                   SDLDDQASGAKYGLGSSGAVTVATVKALLTYYGHQADALLTYKLAALTQSKLGMTGSFG
FT                   DLAASSFGGLIAYHSLDRSWLLGKMAELSLLDVVESDWQSLSISPIQLPQGLDLLVGWT
FT                   GSAASTDSLVSQMESQKSQTEKEQIHSQFLADSKTCVEQLIVACQTNDSVSARQALSAN
FT                   RKLLQDFARGMGLVIETPQLSQLCDLAQTYGAVAKSSGAGGGDCGICLVDSKEQKAAIE
FT                   TAWQEAGIFPLTLNIASRE"
FT   misc_feature    281044..281262
FT                   /gene="mvaK2"
FT                   /locus_tag="SSUSC84_0260"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   7.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    281530..281793
FT                   /gene="mvaK2"
FT                   /locus_tag="SSUSC84_0260"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   2.4e-08"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        281837..282934
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SSUSC84_0261"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0272"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51039"
FT                   /protein_id="CAZ51039.1"
FT                   /translation="MFYLGEFGLDRKDQHVGLANQQYSATPAKDFTETLFVHHSLPQTK
FT                   VDEVDISTSVAGLDFAFPFFINAMTGGSKKTREINRLLGIMGHFGKIALASGSVSAAIK
FT                   DPSVAETFSVMRRENPYGIIFANLGAHHSVENAKRAVDLLEANAIQIHVNAPQEIVMPE
FT                   GDRDFTMWLKNIETLVREMEVPVIVKEVGFGMSRETVAQLASAGVQTIDVSGTGGTDFA
FT                   KIENARRTFNDYAYLEGWGQSTVTSLVEAMSVSEEVCPSLIASGGIKTPLDIVKSLALG
FT                   ADLVGMSNHFLQYVKDGKGHRFDDGLQAIKVYQWQIAEIMTMLGAKNIAELRQKDLVLA
FT                   PNVQNWCEARGIDWKAYARRSANVS"
FT   misc_feature    282617..282700
FT                   /gene="fni"
FT                   /locus_tag="SSUSC84_0261"
FT                   /note="HMMPfam hit to PF01645, Glu_synthase, score 1.8e-06"
FT                   /inference="protein motif:HMMPfam:PF01645"
FT   CDS_pept        complement(283029..284777)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0262"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0273"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51040"
FT                   /protein_id="CAZ51040.1"
FT                   /translation="MLSKTKQASVFLRLLSYLKAYRLLTVLALSFLLLTTVVRSLIPLL
FT                   ASYFIDHYISTISETAVAILAAYFALYLLQMVLQYFGNLWFAKVSYSIVRDIRRDAFGR
FT                   MEKLGMAYFDQTPSGSIVSRITNDTESISEMFSGILSSFISALFIIVTTLSTMFALDWK
FT                   LTSLIVLFLPVIFILVDQYRKRSAPIVAKTRSLLSAINSKLAESIEGIWIIQAFSQEER
FT                   LKEEFEAINQEHLDYASRSMALDSLFLRPALSLVKILAYALLMTYFGLDWSQAGISAGL
FT                   IYAFIQYVNRLFDPLLDVTQHFSTLQTSMVSAGRVFTLMDQTIEEPLQLDRGAKIDKGH
FT                   IVFEDVYFSYDGKRQILDKVSFEVRQGQTIAFVGATGSGKSSIINVFMRFYEFQSGRIL
FT                   IDGQDIRSFSQEELRSAIGLVLQDPFLFHGTIASNIQMYQDISQEEIEEAARFVDAAPF
FT                   IEKLPEKYDHLVTERGSAFSTGQRQLLAFARTMASQPKILILDEATANIDSETEKTVQT
FT                   SLEKMRKGRTTIAIAHRLSTIQDADCIYVLDKGKIIESGNHEELLALKGHYHRMYQLQA
FT                   GQLTAT"
FT   misc_feature    complement(283128..283679)
FT                   /locus_tag="SSUSC84_0262"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 9.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(283890..284705)
FT                   /locus_tag="SSUSC84_0262"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 1.8e-32"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    complement(join(283971..284039,284241..284294,
FT                   284304..284372,284556..284624,284652..284720))
FT                   /locus_tag="SSUSC84_0262"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0262 by TMHMM2.0 at aa 20-42, 52-74, 136-158,
FT                   162-179 and 247-269"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(284658..284777)
FT                   /locus_tag="SSUSC84_0262"
FT                   /note="Signal peptide predicted for SSUSC84_0262 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.915) with cleavage
FT                   site probability 0.419 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(284767..286509)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0263"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0274"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51041"
FT                   /protein_id="CAZ51041.1"
FT                   /translation="MKIIKQLWWFFSLEKKAYLIGILSLCLVSLLNLLPASIMGQLIDQ
FT                   IASGQLTEHRLLLGVAGLILSALAMYGLRYLWRMNILATSYRLGKIMRARLFDHFMHLS
FT                   PSFFQQHRTGDLMAHATNDINALTRLAGGGVMSFVDATVTALVTLITMSLSISWQMTLV
FT                   AILPLPFMTLTTNFLGRRTHENFKASQAAFSELNNKVQEAVSGIKVTKSFGYQEQETAA
FT                   FQEVNQAAFLQNIKTMRYDALFNPAVLFFIGLSYLLTLLVGSHFISQGQVSLGQLVTFM
FT                   TYLDLLVWPLMAIGFLVNISQRGDVSYNRIQTLLSISSEVIETDQPLPAPSNGELVYEI
FT                   SEFAYDNIPVLQDIQFQIKKGQTIGLVGLTGSGKTSLLKLLMREYDVINGQILLNQENI
FT                   KNYKLADLRRLIGYVPQDQFLFATSITENIRFGNPDLSLNQVEEAARAVHVYEDIQDMP
FT                   DRFETMVGEKGISLSGGQKQRLAMARAMILNPDILLLDDSLSAVDAKTEHAILETIKQE
FT                   RLDKTTIITAHRLSAIVHADLILVLEDGKIVERGRHQELLDEKGWYYDTYMMQQLEKEE
FT                   SDAL"
FT   misc_feature    complement(284875..285429)
FT                   /locus_tag="SSUSC84_0263"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 2.1e-53"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(285052..285096)
FT                   /locus_tag="SSUSC84_0263"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(join(285607..285675,285718..285786,
FT                   285976..286044,286054..286122,286279..286338,
FT                   286381..286449))
FT                   /locus_tag="SSUSC84_0263"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0263 by TMHMM2.0 at aa 21-43, 58-77, 130-152,
FT                   156-178, 242-264 and 279-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(285637..286458)
FT                   /locus_tag="SSUSC84_0263"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 1.9e-39"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   sig_peptide     complement(286390..286509)
FT                   /locus_tag="SSUSC84_0263"
FT                   /note="Signal peptide predicted for SSUSC84_0263 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.808) with cleavage
FT                   site probability 0.621 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        286766..287032
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0275"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51042"
FT                   /protein_id="CAZ51042.1"
FT                   /translation="MKAIVTVVGKDKSGIVAGVATKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKKDFTKLRAELEAYGQALNVKINIQSAAIFDAMHNL"
FT   misc_feature    286772..286969
FT                   /locus_tag="SSUSC84_0264"
FT                   /note="HMMPfam hit to PF01842, ACT, score 8e-09"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        287044..288381
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0276"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51043"
FT                   /protein_id="CAZ51043.1"
FT                   /translation="MDIRQVRETIEMIEEQNFDIRTITMGISLLDCIDSDIDKAAEKVY
FT                   TKIVTKAKNLVAVGDEIAAELGIPIVNKRVSVTPIALIGAATDATDYLPLAHALDKAAH
FT                   EIGIDFIGGFSALAQKGYQKGDEILINSIPQALAQTSKVCSSVNIGSTKTGINMTAVRD
FT                   MGRIIKETAEASDMGAAKLVVFANAVEDNPFMAGAFHGVGEADVVINVGVSGPGVVKRA
FT                   LEKVRGESFDVVAETVKKTAFKITRIGQLVGNMASERLGVKFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDAVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPETTPAETIAAMIADEAAIGVINQKTTAVRIIP
FT                   LGKEGDMIEFGGLLGTAPVMKVNQASSVDFINRGGQIPAPIHSFKN"
FT   misc_feature    287044..288378
FT                   /locus_tag="SSUSC84_0265"
FT                   /note="HMMPfam hit to PF05167, DUF711, score 7.5e-278"
FT                   /inference="protein motif:HMMPfam:PF05167"
FT   CDS_pept        288457..289152
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0266"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0277"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51044"
FT                   /protein_id="CAZ51044.1"
FT                   /translation="MADVRLYISRHGKTMFNTIGRVQGWCDTPLTKVGEEGIRELGLGL
FT                   KDAGLDFKLAVSSDLGRTVQTMTIAQRELGILGKIPYYQDKRIREWCFGSFEGMYDAEL
FT                   FQGVLPRLKGTVDATGMSFAEIAAGIQEADTAGWAESWEVLSNRILTGFESIAQDLEKQ
FT                   GGGNALVVSHGMTIATLAHLLEPERGANVFLDNGSITVLKYENGKLLIEAVGDLSYRKR
FT                   GAELIAQGK"
FT   misc_feature    288469..288996
FT                   /locus_tag="SSUSC84_0266"
FT                   /note="HMMPfam hit to PF00300, PGAM, score 7.3e-35"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   repeat_region   complement(289339..289430)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        289471..290505
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SSUSC84_0267"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0278"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51045"
FT                   /protein_id="CAZ51045.1"
FT                   /translation="MITQRQNDILNLIVELFTRHHEPVGSKALQEMIASSSATIRNDMA
FT                   KLEQLGLLEKAHTSSGRMPSRAGFQYFVNHSLNLKHINEEDVYQVVKAFDFEAFKLEDI
FT                   LERASQVLADLTGYTSVILDVEPTSQQLTSFDIVQLSSHDALAVLTLDQSKPVTVQFAI
FT                   PKNFLTRDLEVLKRLVDERFVGQTVLAIHYKLRTEIPQVVQRYFATTDNVLDLMDYIFS
FT                   NLFQESVFISGKVASLTYGNLATYQLLDSPQLLAPELRQGLAPNQQTSISVAEHREPAL
FT                   ADVTVIHHRFPIPYRGMGQMSLLGPVDMDYRRQMSLINIISRILFMKLTDYYRYLSSNH
FT                   YEVN"
FT   misc_feature    289771..290415
FT                   /gene="hrcA"
FT                   /locus_tag="SSUSC84_0267"
FT                   /note="HMMPfam hit to PF01628, HrcA, score 6.2e-53"
FT                   /inference="protein motif:HMMPfam:PF01628"
FT   CDS_pept        290518..291030
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SSUSC84_0268"
FT                   /product="GrpE protein (HSP-70 cofactor)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0279"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51046"
FT                   /protein_id="CAZ51046.1"
FT                   /translation="MSEEIKNEEIVEEVEATEEVVETPEKSELDLANERAEEFENKYLR
FT                   AHAEMQNIQRRANEERQTIQRYRSQDLAKKILPSLDNLERALQVEGLTEDVKKGLEMVQ
FT                   ESLIQALKEEGVEEVATDVFDPNLHMAIQTVPATDDCPAEHIAQVFQKGYKLHERLLRP
FT                   AMVVVSE"
FT   misc_feature    290551..291027
FT                   /gene="grpE"
FT                   /locus_tag="SSUSC84_0268"
FT                   /note="HMMPfam hit to PF01025, GrpE, score 2.8e-60"
FT                   /inference="protein motif:HMMPfam:PF01025"
FT   misc_feature    290887..291021
FT                   /gene="grpE"
FT                   /locus_tag="SSUSC84_0268"
FT                   /note="ScanRegExp hit to PS01071, GRPE, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01071"
FT   CDS_pept        291127..292950
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SSUSC84_0269"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0280"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51047"
FT                   /protein_id="CAZ51047.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTIISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEEY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKDEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDHMVAEFKKENGIDL
FT                   SADKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGAAGPLHLEMTLTRAKFDELTYD
FT                   LVERTKIPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNDVDQAIFATE
FT                   KTLKETEGKGFDAERDQAQAALDELKAAQEANNLDDMKAKLENLNEKAQALAVKLYEQA
FT                   AAAQQAAAGQEGAQTANNADDDVVDGEFTEK"
FT   misc_feature    291136..292848
FT                   /gene="dnaK"
FT                   /locus_tag="SSUSC84_0269"
FT                   /note="HMMPfam hit to PF00012, HSP70, score 0"
FT                   /inference="protein motif:HMMPfam:PF00012"
FT   misc_feature    291145..291168
FT                   /gene="dnaK"
FT                   /locus_tag="SSUSC84_0269"
FT                   /note="ScanRegExp hit to PS00297, HSP70_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00297"
FT   misc_feature    291622..291663
FT                   /gene="dnaK"
FT                   /locus_tag="SSUSC84_0269"
FT                   /note="ScanRegExp hit to PS00329, HSP70_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00329"
FT   misc_feature    292045..292089
FT                   /gene="dnaK"
FT                   /locus_tag="SSUSC84_0269"
FT                   /note="ScanRegExp hit to PS01036, HSP70_3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        293382..294518
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUSC84_0270"
FT                   /product="chaperone protein DnaJ"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0281"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51048"
FT                   /protein_id="CAZ51048.1"
FT                   /translation="MNNTEFYDRLGVSKNASPDEIKKAYRKLSKKYHPDINKDPGAEDK
FT                   YKEVQEAYETLSDPQKRSAYDQYGPAGANGGFGGGAGGFGGFDGAGFGGFEDIFSSFFG
FT                   GGGATRNPNAPRQGDDLQYAVNLKFEEAIFGVEREVSYNREATCRTCTGSGAKPGTSPV
FT                   TCGRCHGSGVINVDTQTPLGTMRRQMTCDVCHGRGKQIKDPCTTCHGTGHEKQAHTVTV
FT                   KVPAGVETGQRIRLAGQGEAGFNGGPYGDLYVVIQVQPSDKFEREGTTIHYKLNLNFVQ
FT                   AALGDTVHVPTVHGDVDMVIPEGTQTGKTFRLKGKGAPSVRGGAIGDQYVTVNIVTPTG
FT                   LNDRQKAALKEFAAAGNIDVKPHKKGFFDKVKYAFEDL"
FT   misc_feature    293394..293579
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUSC84_0270"
FT                   /note="HMMPfam hit to PF00226, DnaJ, score 1.2e-37"
FT                   /inference="protein motif:HMMPfam:PF00226"
FT   misc_feature    293517..293576
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUSC84_0270"
FT                   /note="ScanRegExp hit to PS00636, DNAJ_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00636"
FT   misc_feature    293784..294038
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUSC84_0270"
FT                   /note="HMMPfam hit to PF00684, DnaJ_CXXCXGXG, score
FT                   8.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00684"
FT   misc_feature    294075..294440
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUSC84_0270"
FT                   /note="HMMPfam hit to PF01556, DnaJ_C, score 1.2e-67"
FT                   /inference="protein motif:HMMPfam:PF01556"
FT   CDS_pept        294794..295621
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0282"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51049"
FT                   /protein_id="CAZ51049.1"
FT                   /translation="MKSWVENVTIKKYEDRSGLTGLKQEPLVWTEVFLREVNRQSNTGI
FT                   LHFWPMDQTVILGMMDSQVAQLDKGLASIGQAGYSPIIRSLGGLAVVADEGILNVTLIL
FT                   SNPSGHKVDLRESYQVMVDLIAQALSDFPFEVVSGEVATSYCPGTYDLSIKGRKFAGLA
FT                   QRIYQEAIAISAYISVSGNQVKRGQVVADFYVASFAPQEVSDRFPQVNPDSMANLSDLV
FT                   GQDVTVEDMKKRIEQVLVENGTRLSTFYPSSDNMADFMTFGKTIKQSMEKYGI"
FT   CDS_pept        295631..297079
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0272"
FT                   /product="putative amidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0283"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51050"
FT                   /protein_id="CAZ51050.1"
FT                   /translation="MIWKDATAMAQAVNQKQVFAKELVQETIDRIEKLNPTLNAVVSKQ
FT                   YEEALKEAEKEDYLGKPFAGVPFLLKDLGQNEKGQPSSAGSRLLAGRPAGHTDTYVQRL
FT                   KDLGFIIVGRTNTPEFGFKNISDASLHGPVNLPLDPSRNAGGSSGGAAAALASGMVSIA
FT                   AASDGGGSIRIPASFNGLIGLKTSRGRIPVGPKSYRGWQGASVNFALTKSVRDTQRLLY
FT                   HFQDYQLEAPFPLAKLSEEEVFGKLSRPLKIAYYTKSPVGSKVSLEAVEAVQKACHHLA
FT                   NLGHEVVELTEYPLDGVALMKSFYLMNSVDTAQMFDEIEAAFGRQMTLDDMEVMSWAIY
FT                   QSGQTIPAKLYSKALLDWDQFGASMARFHEEYDLLLTPTVADVAPKHGQFDLPVDLLDR
FT                   LKQTQNYSMEEQQDLIWQMFEDSLALTPFTQQANICGQPAISLPTYVRADSLPIGVQLT
FT                   ASKGREDLLLQLADQMEAAGLLNL"
FT   misc_feature    295694..297034
FT                   /locus_tag="SSUSC84_0272"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 9.6e-70"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    296063..296158
FT                   /locus_tag="SSUSC84_0272"
FT                   /note="ScanRegExp hit to PS00571, AMIDASES, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        297204..298079
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0273"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0284"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51051"
FT                   /protein_id="CAZ51051.1"
FT                   /translation="MLKKVLASALLVSTLTLAACSSSSSNTSSSSAEQTQWEKIQEAGV
FT                   LKVATPGTLFPTSYYNDAKELVGYEIDMINEIGKRLKLEIEYQEIGVAEAFTAVDSGKV
FT                   DISVNNFDMTEARKEKYNFSIPYKYSVGGYIVREDGSSGIEAADLSDWTGKKAGGGAGT
FT                   QYMKIAEKQGAEPVIYDNVTNDVYLRDVSTGRTDFIPNDYYTQVMAIKWANANFPDIKV
FT                   KMGEAKYNPTEQGIVMSKADTSLKEKIDEALEAMKADGTLKAISEKYYAGQDLTVPVEN
FT                   ADKLPVIEVE"
FT   sig_peptide     297204..297299
FT                   /locus_tag="SSUSC84_0273"
FT                   /note="Signal peptide predicted for SSUSC84_0273 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.640 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    297339..298019
FT                   /locus_tag="SSUSC84_0273"
FT                   /note="HMMPfam hit to PF00497, SBP_bac_3, score 3.3e-58"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    297405..297446
FT                   /locus_tag="SSUSC84_0273"
FT                   /note="ScanRegExp hit to PS01039, SBP_BACTERIAL_3, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        298170..298841
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0274"
FT                   /product="transport system membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0285"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51052"
FT                   /protein_id="CAZ51052.1"
FT                   /translation="MDINWQAVFNADIAREAIPQILEGLPYTLSLSLIGFALGTFCGFF
FT                   VALMRMSKFGPLRWLAMAHISLMRGIPLMVLLFFIYFGLPFMGLQLDAISASIIAFTSM
FT                   SSAYISEIIRASLSAIDKGQWEAARSLGLRTNVIHRKIIIPQAFRIALPPLSNVLLDMV
FT                   KSTSLTAMITVPEIFNKAKIVGGAKSDYMTVYICVALIYWVICTLYAFGQLKLEKRLAT
FT                   Y"
FT   misc_feature    298230..298835
FT                   /locus_tag="SSUSC84_0274"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 1.5e-23"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(298248..298316,298377..298436,298740..298808)
FT                   /locus_tag="SSUSC84_0274"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0274 by TMHMM2.0 at aa 27-49, 70-89 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(298965..299174)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0275"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0286"
FT                   /note="Possible alternative translational start site after
FT                   codon 2"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51053"
FT                   /protein_id="CAZ51053.1"
FT                   /translation="MEMIRVNLDKVLKDRQMTSKDLAEQVGITEANLSILKTGKAKGIR
FT                   FNTLMSICRILDCQPGDILEYVEE"
FT   misc_feature    complement(299061..299126)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1554.000, SD 4.48 at aa 17-38, sequence
FT                   MTSKDLAEQVGITEANLSILKT"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(299176..299700)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0276"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0287"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51054"
FT                   /protein_id="CAZ51054.1"
FT                   /translation="MKTNLLKTAGIVAACVRYFFYLLIASYIFFSLAGLGGDSFAIGSW
FT                   EYTFNKPIDQISVWLILLATGLILVVLVALSHIAHLIQKLCKLLLEEDYFASASMELYQ
FT                   KLFISLLVLTAGQFCLTSLITLTNAAGPNNFLNLRWSDFILNALFIFLTYFVWTLVQKG
FT                   QQLETENSEFI"
FT   misc_feature    complement(join(299221..299274,299317..299385,
FT                   299464..299532,299575..299643))
FT                   /locus_tag="SSUSC84_0276"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0276 by TMHMM2.0 at aa 20-42, 57-79, 106-128 and
FT                   143-160"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(299578..299700)
FT                   /locus_tag="SSUSC84_0276"
FT                   /note="Signal peptide predicted for SSUSC84_0276 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.754) with cleavage
FT                   site probability 0.752 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(299835..301703)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0277"
FT                   /product="putative cation-transporting ATPase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0288"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51055"
FT                   /protein_id="CAZ51055.1"
FT                   /translation="MTLVTNLKQHSHIITTALCLALILIGILLFQTGQGWAPILFISAF
FT                   VIGGYQSAKEGISELIFDKHLSVDLLMILAAIGSGLIGYWMEGALLIFIFSLSSTLEEL
FT                   AMKKSKNAIAALMNMTPPTARKIEENGDITVLDTAAIRIGDLLQVRKGDTVPLDATLIS
FT                   PQSIFDESMITGEPLPAEKMAGDAVIGGTINQGPTVTVQVTAEKGDALFDKIVQMVENA
FT                   QESKSKTATFIENMEDTYVKVVLVVVPLFILLAHFALGWDWLTAFYRGMILLTIASPCA
FT                   LVASSSPATLSAISRAARKGMIIKGGDIADNIANLEAIVFDKTGTLTIGKPEVVGATYL
FT                   GDEELIKQVVQAVEKQSSHPIAQALMTYTADSSAIALQSLEDVTGKGLVAGYEGDSWKI
FT                   GKAGFVADSLVSPLSAGLLAQIDEAESTGKTLVYVSQNDVLVAIFMVEDSLKPESKQLI
FT                   AQLKEMGVTPILLTGDQEKTARYVASQVGIDRVIANCLPTDKAAVIQELQTEFASVGMV
FT                   GDGINDAPALAQANVSYAMGSGTDIAMESADIVLMEDLTRIPYSIRLSKKMRGIIKQNI
FT                   IFALSVIALLIISNLFQSINLPLGVVGHEGSTILVILNGLRLLYFK"
FT   misc_feature    complement(join(299841..299909,299919..299978,
FT                   300825..300893,300921..300989,301419..301487,
FT                   301599..301667))
FT                   /locus_tag="SSUSC84_0277"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0277 by TMHMM2.0 at aa 13-35, 73-95, 239-261,
FT                   271-293, 576-595 and 599-621"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(300084..300758)
FT                   /locus_tag="SSUSC84_0277"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 2.9e-32"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    complement(300087..300155)
FT                   /locus_tag="SSUSC84_0277"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score NA"
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    complement(300720..300740)
FT                   /locus_tag="SSUSC84_0277"
FT                   /note="ScanRegExp hit to PS00154, ATPASE_E1_E2, score NA"
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    complement(300768..301436)
FT                   /locus_tag="SSUSC84_0277"
FT                   /note="HMMPfam hit to PF00122, E1-E2_ATPase, score 2.9e-65"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    complement(301317..301382)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1444.000, SD 4.11 at aa 108-129, sequence
FT                   KSKNAIAALMNMTPPTARKIEE"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   sig_peptide     complement(301593..301703)
FT                   /locus_tag="SSUSC84_0277"
FT                   /note="Signal peptide predicted for SSUSC84_0277 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.984) with cleavage
FT                   site probability 0.642 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(301866..302321)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0278"
FT                   /product="ferric uptake regulator family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0289"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51056"
FT                   /protein_id="CAZ51056.1"
FT                   /translation="MELHSHFNAENQTAFEHVIQHLKEKGIRITETRKAVVAYIIESDD
FT                   HPSAEMIYQDLIPNYPNMSLATVYNNLKLLLEEGFVTKLKRTNDNTTYYDFMGHEHLNV
FT                   ICEVCGKITDFMDVEIPSLKKEAHTQTGYKITKEVLSIYGICPDCQN"
FT   misc_feature    complement(301893..302252)
FT                   /locus_tag="SSUSC84_0278"
FT                   /note="HMMPfam hit to PF01475, FUR, score 3.3e-46"
FT                   /inference="protein motif:HMMPfam:PF01475"
FT   CDS_pept        302488..303237
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SSUSC84_0279"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0290"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51057"
FT                   /protein_id="CAZ51057.1"
FT                   /translation="MTRYKAIISYDGHDFSGFQRQPHARTVQEEIEKTLVRLNSGQPVT
FT                   VHGAGRTDAGVHAYGQVIHFDLAGSRDVEKLRFALDTQTSEDIDVVSVEQVADDFHCRY
FT                   AKHSKTYEFLVDIGRPKNPMMRHYATFYPYDLDLSLIEEAIQDLVGTHDFTGFTASGTS
FT                   VEDKVRTITVASMEYDQQRQFLIFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVGQIKRI
FT                   LAEKDRGLAGPTAAGNGLYLKEIIYED"
FT   misc_feature    302503..302802
FT                   /gene="truA"
FT                   /locus_tag="SSUSC84_0279"
FT                   /note="HMMPfam hit to PF01416, PseudoU_synth_1, score
FT                   3.8e-40"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   misc_feature    302917..303231
FT                   /gene="truA"
FT                   /locus_tag="SSUSC84_0279"
FT                   /note="HMMPfam hit to PF01416, PseudoU_synth_1, score
FT                   1.1e-30"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   CDS_pept        303227..303988
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SSUSC84_0280"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0291"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51058"
FT                   /protein_id="CAZ51058.1"
FT                   /translation="MKTKYILALSGNDIFSGGGLHADLTTYTVHGLHGFVAVTCLTAMT
FT                   EKGFEVIPTETAVFAQQLASLKDVPFSAIKIGLLPSVEIAEQALEFIKTHQEIPVVLDP
FT                   VLVCKETHDTEVSQLRDEILKFLPYVSIITPNLAEAQLLLQKDIKTVEEMKQVAVALYD
FT                   LGAKAVVIKGGNRLGGSEAVDVFYDGQEVVVLQSPLLSENNVGAGCTFASSIASQLLLG
FT                   QEPLEAVRLSKDFVHAAIEKSDDYGVVQYEK"
FT   misc_feature    303263..303976
FT                   /gene="thiD"
FT                   /locus_tag="SSUSC84_0280"
FT                   /note="HMMPfam hit to PF08543, Phos_pyr_kin, score 8.8e-74"
FT                   /inference="protein motif:HMMPfam:PF08543"
FT   CDS_pept        303978..304463
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0281"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0292"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51059"
FT                   /protein_id="CAZ51059.1"
FT                   /translation="MRNKQTQELVLLAILTALSLVLAFVHVPTATGFVTLLDVGVYFTA
FT                   FYLGKKEGAIVGGLSGLLIDFLLGYPQWAFFSLVFHGAQGYFAGWTGKKRILGLVLATL
FT                   SMVGGYYLASRLYFNDLKAIESVLSNTLQNTVGLVVGYVLAQAIERIGAVNHVIKGN"
FT   sig_peptide     303978..304073
FT                   /locus_tag="SSUSC84_0281"
FT                   /note="Signal peptide predicted for SSUSC84_0281 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.864 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(304002..304055,304065..304124,304137..304205,
FT                   304263..304331)
FT                   /locus_tag="SSUSC84_0281"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0281 by TMHMM2.0 at aa 9-26, 30-49, 54-76 and
FT                   96-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        304444..305010
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0293"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51060"
FT                   /protein_id="CAZ51060.1"
FT                   /translation="MLLREIKDQTKQVVQEVLELSDLQKGQIFVLGLSSSEVIGGHIGK
FT                   NSSLEVGEVVVETILEILDQKGIYLAVQGCEHLNRALVVERELAIQKDLEIVNVLPTLH
FT                   AGGSGQLAAFKYMKDPVEVEFITAQAGVDIGDTAIGMHIKHVQVPIRPSLREIGQAHVT
FT                   ALASRPKLIGGVRAAYQEDEIRKGS"
FT   misc_feature    304465..304980
FT                   /locus_tag="SSUSC84_0282"
FT                   /note="HMMPfam hit to PF04260, DUF436, score 5.8e-121"
FT                   /inference="protein motif:HMMPfam:PF04260"
FT   CDS_pept        305010..305624
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0294"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51061"
FT                   /protein_id="CAZ51061.1"
FT                   /translation="MKEFTVKDLVWTRPPRQFTISDEEITITTHPQTDLWQKTYYHFVN
FT                   DNAPVLQMETEEDYFSFTVKTDFAGSHTRFDQCGIVLYQDSENWLKCSIEYENDDFQHL
FT                   GSVVTNHGFSDWATTEVSSQIKSMWFRLSRRGADYCFENSEDGIHFKQMRVCHFHQGAG
FT                   KIAFGLYACSPENSSFTARFTNMELSDCKWQAHDGQEPDEI"
FT   misc_feature    305037..305597
FT                   /locus_tag="SSUSC84_0283"
FT                   /note="HMMPfam hit to PF07081, DUF1349, score 4e-53"
FT                   /inference="protein motif:HMMPfam:PF07081"
FT   repeat_region   complement(305668..305771)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        305897..306661
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0284"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0296"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51062"
FT                   /protein_id="CAZ51062.1"
FT                   /translation="MTKGYQQRFSLSILLWMRQDKARQEGMDYWSGGHAQIIAASPGLL
FT                   EYRQQHLSETEHSFWPKATGLETAVPEDRRIDGIAEVTYQKLLAPIGGRRQTALAFEDE
FT                   VNVFRRTLMHMGFPYSSRWYHTSTQAQTQLRDVLYFRRKDGVKSGSFKKFVQDGLASQL
FT                   ATISGVTEVRTQVYLPWNKATWNTPNVAHDNPKEDHLHASIIPGFADQAAREAFYANQA
FT                   PQLNAEVVQYSSAVHAYHIEKTLPFVLDGKRM"
FT   misc_feature    306605..306637
FT                   /locus_tag="SSUSC84_0284"
FT                   /note="ScanRegExp hit to PS00133, CARBOXYPEPT_ZN_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00133"
FT   CDS_pept        306942..307373
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0285"
FT                   /product="putative transcription regulation protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0297"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51063"
FT                   /protein_id="CAZ51063.1"
FT                   /translation="MDTKFSVALHILTMISESKEILSSQALAESVGTNASYIRKVIALL
FT                   KNAGLITSHQGRSGYQLSKSPKDISLLEIYLATQEVEHIRLFQIHQNANLSCPVGQHIE
FT                   GAMVPIFSSVEQELENQLSRQSLDNVITNLYQSAQVTRI"
FT   misc_feature    306942..307307
FT                   /locus_tag="SSUSC84_0285"
FT                   /note="HMMPfam hit to PF02082, Rrf2, score 2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   misc_feature    307005..307070
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1320.000, SD 3.68 at aa 22-43, sequence
FT                   LSSQALAESVGTNASYIRKVIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        307453..308454
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0286"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0298"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51064"
FT                   /protein_id="CAZ51064.1"
FT                   /translation="MKAAQHTSYNKNNIALNLTEIAKPQIKPNQVLVKVTAAGVNPLDN
FT                   MISRGDVKLIVPYKLPQTAGNEVVGLVEEVGSSVTTFAAGDRVFGRLPLDSIGAFAEYV
FT                   AVDAQALAKVPAYLTDEEAAAVPLTALTIMQALDLMGAQSGKTIFISGGTGGVGGMAIP
FT                   IAKAKGLTVITNGDGASAERVLSLGADRFIDYKTEDYTKTLSDVDYVLDTLGGAETEKQ
FT                   MSIMKKGGQLVSLRAMPNGEFAKRMNLPKWKQILFGLAGRSFDKMAKKYGVHYHFIFVE
FT                   SNGRQLQEVADIFNKLEIKPSIDTVYPFEEVNAALDKVANGRSRGKTVLSFN"
FT   misc_feature    307534..307794
FT                   /locus_tag="SSUSC84_0286"
FT                   /note="HMMPfam hit to PF08240, ADH_N, score 1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    307882..308298
FT                   /locus_tag="SSUSC84_0286"
FT                   /note="HMMPfam hit to PF00107, ADH_zinc_N, score 6.7e-13"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   CDS_pept        308480..309325
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0287"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0299"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51065"
FT                   /protein_id="CAZ51065.1"
FT                   /translation="MSYITTKNQYITVSNNKIAYRELSKGKSDIPLVMLVHLAATLDNW
FT                   DPKLLDLLAEKHHVIILDLPGVGASQGKVAPTIPGMAEQAVAIIKALGHEKINLLGLSM
FT                   GGFIAQEIVRLDSQLVNRLILAGTGPRGGFEVDKVTGKTFRYMLKAGLERVDPKRYIFY
FT                   NHDEAGRLEAEKVLGRMGQRSAAHADKDMNVPGFLTQLKAIKRWGREPQDDMTFITQPT
FT                   LIVNGDKDMQVPTENSYTMHEKIKNSQLIIYPNAGHGSIFQNAEEFSKALLAFLEESNA
FT                   "
FT   misc_feature    308648..309301
FT                   /locus_tag="SSUSC84_0287"
FT                   /note="HMMPfam hit to PF00561, Abhydrolase_1, score 7e-22"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        309318..310187
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0288"
FT                   /product="short chain dehydrogenase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0300"
FT                   /note="Similar to the C-terminal region of Homo sapiens
FT                   (Human) RDH13 retinol dehydrogenase 13 UniProt:Q8NBN7
FT                   (EMBL:AY358473) (331 aa) fasta scores: E()=3.4e-16, 32.806%
FT                   id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51066"
FT                   /protein_id="CAZ51066.1"
FT                   /translation="MPKTILITGSTDGIGKHLAMKLASEGHEVILHGRNSEKLRVALSD
FT                   IQLKTGSKKIHGYLADFSKLADVYRFSQEIKRDFEQIDVLLNNAGAYFGDARVATAENI
FT                   EMTFMLSVQVPYILTTELLPLLEKAAGRVIHTSSLMHHFAQTRGLDFGLEQSYSAAMAY
FT                   NNAKLYTIWLAIAQAEALEKQGSSVTVNAYHPGLIATNLGNDGIKRNLRSRILTSLMKP
FT                   FSKDLDQGIETGYYLSLSPEVAGVSGRYFAEKRLANVSLKGFDLAKSQALLAYLDKKIQ
FT                   VFKESYGD"
FT   misc_feature    309324..309590
FT                   /locus_tag="SSUSC84_0288"
FT                   /note="HMMPfam hit to PF00106, adh_short, score 8.7e-09"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    309765..309851
FT                   /locus_tag="SSUSC84_0288"
FT                   /note="ScanRegExp hit to PS00061, ADH_SHORT, score NA"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        310180..311355
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0289"
FT                   /product="NADH:flavin oxidoreductase / NADH oxidase family
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0301"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51067"
FT                   /protein_id="CAZ51067.1"
FT                   /translation="MTKILLENLQLPNGQVLDNRFFKSAMSETLADSQGAPSDDLIALY
FT                   DFWAKQGVGVLVTGNVMVDGRYLGEPGNVVLDSDAHLAQFRKWAAVGKKNGVPIWLQLN
FT                   HPGKQMYRSINQTPIAPSAIPISGGSASAFRPPREMTVFDIKEARDKFIAAGLRAKAAG
FT                   FTGVQLHAAHGYLTNQFLSPADNQRTDRYGGSLDNRMQFLVEVYQGLREKVGPDFTIAL
FT                   KLNASDFKEEGFGFEDCKHVVKIMSDLGIDLIEISGGNYETPVFGSDYENGAGFVTYAL
FT                   ALADLTSVSIVSTGGFRKVTQMEEAIKDGVSMIGLARPFVLRPSLVNDYRQVGDLQADG
FT                   ERTGRYILGGEELVLNSKGESVISYADYAIGMIDEIATGDHLKARISLVSE"
FT   misc_feature    310189..311190
FT                   /locus_tag="SSUSC84_0289"
FT                   /note="HMMPfam hit to PF00724, Oxidored_FMN, score 4.9e-41"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS_pept        311365..311814
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0290"
FT                   /product="putative transcription regulation protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0302"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51068"
FT                   /protein_id="CAZ51068.1"
FT                   /translation="MQISNKFTIAIHALAFIHLFQDQQRVTSKVLANSIQANPVIIRSV
FT                   LSGLKEAGIVDAKQGSGGFRLAKTLDDISLYDIFVTVDNIDKKGLFNFHENPHPDCIVG
FT                   GNIHAAVDDKLVQVQTAMEKELKTMYMSDVLVDLEKAIEEKVKRT"
FT   misc_feature    311365..311742
FT                   /locus_tag="SSUSC84_0290"
FT                   /note="HMMPfam hit to PF02082, Rrf2, score 4.5e-36"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   CDS_pept        complement(312074..312592)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0291"
FT                   /product="TetR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0303"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51069"
FT                   /protein_id="CAZ51069.1"
FT                   /translation="MFRMERVKRKESLFVESVVEALWELLEDKSFEKISVSELVERAGI
FT                   GRVTFYRNFSNKEEVLERSFNLESQAWLTERQIDLSDWSDAHLLLALRQFFDFWYEQQD
FT                   KIRLLTANHLDYLLEEVLDRYFKEKLGDLTDDFHLQFIVGGFFRVLKTWVARGCKESPD
FT                   DIMRLMSEQ"
FT   misc_feature    complement(312401..312541)
FT                   /locus_tag="SSUSC84_0291"
FT                   /note="HMMPfam hit to PF00440, TetR_N, score 2.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(312428..312493)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1126.000, SD 3.02 at aa 34-55, sequence
FT                   ISVSELVERAGIGRVTFYRNFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        312724..313647
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0292"
FT                   /product="putative lipase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0304"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51070"
FT                   /protein_id="CAZ51070.1"
FT                   /translation="MKKVLIGIGILIACFGIGFLYLASKPSVASNYTEVVETGGAVEKK
FT                   YLGQGNYDVSYLEINALQNFKKYELYYPTNIETETRKFPVVIFSNGTGVRASKYASVLK
FT                   HLASWGFIVIGTEEEYSWNGFSSEMSLRLAIKLNDNKTVEGLKSNPFFSKVDLDKIGLS
FT                   GHSQGGVGVFNAVTEQKHGHMIKTIYAASPANLELSSNLEWDYDPSLISVPTFLVSGTG
FT                   GGYEDLVVSGKQLTQIYETLPATITKVMARRKEAGHGDMLRLPNGYMVAWFMWRLQGAP
FT                   EAETAFQGNSPEIVQNKLYQDQRIMN"
FT   sig_peptide     312724..312810
FT                   /locus_tag="SSUSC84_0292"
FT                   /note="Signal peptide predicted for SSUSC84_0292 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.993) with cleavage
FT                   site probability 0.816 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    312733..312792
FT                   /locus_tag="SSUSC84_0292"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0292 by TMHMM2.0 at aa 4-23"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    312970..313065
FT                   /locus_tag="SSUSC84_0292"
FT                   /note="HMMPfam hit to PF07224, Chlorophyllase, score
FT                   0.00047"
FT                   /inference="protein motif:HMMPfam:PF07224"
FT   CDS_pept        313754..314773
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0293"
FT                   /product="putative lipase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0305"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51071"
FT                   /protein_id="CAZ51071.1"
FT                   /translation="MKKFKKIILWTLGIVASLGIIAYVSVTNHPQLVVGVIQSFMYKES
FT                   SPNSYSPLYDPIDGLKENGQYLKSEIAYSKDYPNSFLDITYPDQNLEADRPTLFYFHGG
FT                   GFFGGSKNMGAPLSASQATYLIDDIVSKGYNVVNVDYALVPDHHFPTPVIQMNQAIAYM
FT                   KEHAEEYHLNMDNVVLMGSSAGAIMAAQYGSVLANQEYAQLLNIEPSIAKEDVKALVID
FT                   DAPLDYAKFSLGTKILVGNYVSETIYLSEEEINAYNPISHVNKDYPASFLLGSEDRTDM
FT                   VSLNKALKQAGVENELVDPLAEEGLEKPHGFVANLRTDPVSAKAFERLMIFIDDRTKE"
FT   sig_peptide     313754..313819
FT                   /locus_tag="SSUSC84_0293"
FT                   /note="Signal peptide predicted for SSUSC84_0293 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.954) with cleavage
FT                   site probability 0.656 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    313772..313831
FT                   /locus_tag="SSUSC84_0293"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0293 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    314045..314326
FT                   /locus_tag="SSUSC84_0293"
FT                   /note="HMMPfam hit to PF07859, Abhydrolase_3, score
FT                   3.7e-13"
FT                   /inference="protein motif:HMMPfam:PF07859"
FT   CDS_pept        314995..316278
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SSUSC84_0294"
FT                   /product="trigger factor (prolyl isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0306"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51072"
FT                   /protein_id="CAZ51072.1"
FT                   /translation="MSVSFEAKETNRGVLTFTIGQDAIKPELDRVFNKVKKDINLPGFR
FT                   KGHLPRAVFNQKFGEEALYQDVVNALLPAAYEAAVAEAGLEVVAQPKIDVVSMEKGQDW
FT                   TITAEVVTKPEVKLGDYKNLAVSVEATKEVTDEEVDAKIEAARNNLAELVIKEGPAAEG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEAQLVGHAAGEEVNVEVTFPED
FT                   YQAADLAGKQALFVTKIHEVKAKEVPALDDELAKDIDEEVETLDELKAKYRKELEASKE
FT                   VAFDDAVESAALELAVENAEIVELPEEMIHEEVHRAINEFLGGMQQQGISPDMYFQITG
FT                   TTREDLHKQYEADAEKRTKTNLVVEAVAKAEGFEATEEEINKEIEDLAATYNMEVAQVR
FT                   SLLSPEMLKHDIAVKKAVEVITSTATVK"
FT   misc_feature    314995..315435
FT                   /gene="tig"
FT                   /locus_tag="SSUSC84_0294"
FT                   /note="HMMPfam hit to PF05697, Trigger_N, score 1.6e-64"
FT                   /inference="protein motif:HMMPfam:PF05697"
FT   misc_feature    315454..315714
FT                   /gene="tig"
FT                   /locus_tag="SSUSC84_0294"
FT                   /note="HMMPfam hit to PF00254, FKBP_C, score 3.6e-26"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    315715..316245
FT                   /gene="tig"
FT                   /locus_tag="SSUSC84_0294"
FT                   /note="HMMPfam hit to PF05698, Trigger_C, score 1.3e-66"
FT                   /inference="protein motif:HMMPfam:PF05698"
FT   misc_feature    316138..316203
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1100.000, SD 2.93 at aa 382-403, sequence
FT                   KEIEDLAATYNMEVAQVRSLLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        316329..317213
FT                   /transl_table=11
FT                   /gene="Similar to the c-terminal region of ICAA_STAEQ"
FT                   /locus_tag="SSUSC84_0295"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0307"
FT                   /note="Similar to the C-terminal region of Staphylococcus
FT                   epidermidis biofilm PIA synthesis
FT                   N-acetylglucosaminyltransferase IcaA UniProt:Q8GLC5
FT                   (EMBL:AY138959) (412 aa) fasta scores: E()=3.7e-10, 30.328%
FT                   id in 244 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51073"
FT                   /protein_id="CAZ51073.1"
FT                   /translation="MLQRNSLKNLVRPMQKWENVISVGGVVQVSQGVRITDGEVSHYQL
FT                   PWSVLPCLQAIEYDCSFLGSRILLDYLQSNLIISGAFGLFYKEYVIAVGGYDRQTLGED
FT                   MELVMKLHYFCRNNNIPYRICYETSAICWSQAPSSIGDLCKQRRRWFLGLYQCLKKYRK
FT                   MLSRVRFGAVGYFSYAYYMLFEFLAPFIETFGCFVILLSLIYHQLNISFFISLFFLHSA
FT                   FCSLITFASFLQRVYSQDLFIGPMDLCKAFLATLFRYFFLHWVLNIVRLTSFIGYKKRK
FT                   REWGEIKRVKQFV"
FT   misc_feature    join(316821..316874,316884..316943,316956..317024,
FT                   317082..317150)
FT                   /gene="Similar to the c-terminal region of ICAA_STAEQ"
FT                   /locus_tag="SSUSC84_0295"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0295 by TMHMM2.0 at aa 165-182, 186-205, 210-232
FT                   and 252-274"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        317322..318242
FT                   /transl_table=11
FT                   /gene="lmb"
FT                   /locus_tag="SSUSC84_0296"
FT                   /product="laminin binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0308"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51074"
FT                   /protein_id="CAZ51074.1"
FT                   /translation="MLKKVIRGCFVALFGFVLAACSAQKEASQVQPGMKIVTSFYPIYS
FT                   LVKEVSGNKNDVRMIGSRQGIHSYEPSAADIKAIYDADVFIYHSRILESWAGRLEPNLQ
FT                   GSSVKVLEASTNLPLTKVPGLEDMEAGQGIDEASLYDPHTWLDPVLVGQEAVAIGELLA
FT                   ESDPKNADYYRQNAATLEGKAQKLADKYSPIFLKATSKTFVTQHTAFSYTAQRFGLKQL
FT                   GIAGVSEEEPSPRQLAEIKEFVDTYNVQTIFTEKGASDKLAKALASSTGVDLKVLDPLE
FT                   ADPENNLTYLENLEQVLETLAQELK"
FT   sig_peptide     317322..317405
FT                   /gene="lmb"
FT                   /locus_tag="SSUSC84_0296"
FT                   /note="Signal peptide predicted for SSUSC84_0296 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.776 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    317346..318239
FT                   /gene="lmb"
FT                   /locus_tag="SSUSC84_0296"
FT                   /note="HMMPfam hit to PF01297, SBP_bac_9, score 8.4e-89"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   CDS_pept        318276..321431
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0297"
FT                   /product="Streptococcal histidine triad protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0309"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51075"
FT                   /protein_id="CAZ51075.1"
FT                   /translation="MKKKAVVGSVAALVLGMSLCSYQLGRFQAMEEQKNRVSYIEDSQS
FT                   VQTTVAEQLTPDQVSAKENIDAEQIVVKITDQGYVTSHGDHFHYYNGKVPFDAIFSEEL
FT                   VMKDPNYVLQDSHIINEVQDGYVIKVDGKYYLYLKDPSKHKNVRSKEEVERQKGISSAD
FT                   SKNQAAGNSKDGRYRTDDGYVFNPTDVIEDTGDGFIVPHGDHFHFIPKKDLSAAELKAA
FT                   QDYWNQKGSVSSASGSQYGDRNNRAQQTTISAGQGQDLASLLAQLDATPLSQRHVEADG
FT                   LVFDPRTITKKTAAGVIVPHGDHYHFIPYSQMSPLEEKISRMIGVNGAGVSSGAQASHS
FT                   QHTLTQPNRPVTPIGTVTTQPVSPTQPVLPTQPKQSTGKVVSYKGRQIPAYGKGLDGKA
FT                   YFTSDGYTFSKDSITSVDDQGLIASHGDHFHYVGFGELEDFEIKQVEEWVNEKAGKQVP
FT                   PKTSEQVGNDAKPTTPSQGNDSKPVKPIQEENRPAFEYKQVTAKRKLAGKVVYEMEVGG
FT                   KTYTYGRDELDLMKISFAELTLAEKDKQYIFDIAPLAEGDLKPAMLVGMDQIPMKGANA
FT                   TYDTGQSFIIPHIDHIHVLPYTWLSKEQIATIRYIMQHPEIRPSAWTTSGHGDGEATDL
FT                   VPPILNATPKANRLGLKNWQIIHTAEEVMDARAKGKFATNDGYIFSAEDVLDPASFVFS
FT                   QAFSLPRATGGSLRSISKKDLSKEELEAVQTLLDKRDAEELAKNVTPIEKRAGLKNWQI
FT                   VHSAEELAEAKAAGKYTTKDGYIFDPADLLDPKVKIGTDNYRIPRVITDGYRRINKSDL
FT                   NYLSELIPAEAMVAQREKSNSSLPSTPAPTETGASAGETTTPEQPQVAKETAEEIYNRV
FT                   EAKKVVPFEALTYNAGYATEVRNGTLVIPHQDHYHYVSFKWFDQGSARSPEGYSLEDFL
FT                   ATVKYYMTNPQERPVSDDGWGVFTPNTPSESTEETETEESDEEIISEETEEIDEFTEEL
FT                   KRRAEEFGMDFKTFEQSLVTLSDRYKVSFEAFEYDAASKVVRLVDKDGVKRTISLPSLE
FT                   EQV"
FT   sig_peptide     318276..318338
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="Signal peptide predicted for SSUSC84_0297 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.699) with cleavage
FT                   site probability 0.553 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    318288..318356
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0297 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    318510..318542
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score 4.9"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    318804..318962
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   4.3e-31"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    319101..319259
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   7.8e-05"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    319473..319631
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    320010..320117
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   0.016"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    320289..320465
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   0.00077"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    320580..320759
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   0.00014"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    320967..320999
FT                   /locus_tag="SSUSC84_0297"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score 3.9"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   CDS_pept        321558..322139
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SSUSC84_0298"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0310"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51076"
FT                   /protein_id="CAZ51076.1"
FT                   /translation="MELNVFAGQEKSELSMIEVARAILEERGRDNEMYFNDLVNEIQNY
FT                   LEKSNSEIRAALPTFYSDLNVDGSFIPLGENKWGLRSWYAIDEIDEEVITLEEDDEDAP
FT                   KRKKKRVNAFMDGDDDAIDYGHDDPEDEDNYPGSVSSEYDDENPDDEKDEVESYDSEIN
FT                   EIIPDDELDEEDVDLGEDDDEYSDEEVVDE"
FT   misc_feature    321558..322127
FT                   /gene="rpoE"
FT                   /locus_tag="SSUSC84_0298"
FT                   /note="HMMPfam hit to PF05066, RNA_pol_delta, score
FT                   3.2e-85"
FT                   /inference="protein motif:HMMPfam:PF05066"
FT   CDS_pept        322332..323936
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SSUSC84_0299"
FT                   /product="putative CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0311"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51077"
FT                   /protein_id="CAZ51077.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERK
FT                   GEYLGATVQVIPHITDALKDKIKRAARTTDADVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQGIK
FT                   NKLAQFCDVAPEAVIESLDVEHLYQIPLNMQAQNMDQIVCDHLKLDVPPADMTEWTAMV
FT                   NKVLNLQKKVKIALVGKYVELQDAYISVVEALKHSGYANDAAIELDWVNANDLTAENVA
FT                   ERLGQAQGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCVEFARHVLGLE
FT                   GANSFELDPETKYPIIDIMRDQIGVEDLGGTLRLGLYPSKLKRGSKAAAAYDNQEVVQR
FT                   RHRHRYEFNNDFREQFEKAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELQSRPNR
FT                   PEGLYTAFVSAAMENEK"
FT   misc_feature    322335..323162
FT                   /gene="pyrG"
FT                   /locus_tag="SSUSC84_0299"
FT                   /note="HMMPfam hit to PF06418, CTP_synth_N, score 3.1e-215"
FT                   /inference="protein motif:HMMPfam:PF06418"
FT   misc_feature    323232..323915
FT                   /gene="pyrG"
FT                   /locus_tag="SSUSC84_0299"
FT                   /note="HMMPfam hit to PF00117, GATase, score 1.6e-68"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   tRNA            324217..324302
FT                   /locus_tag="SSUSC84_t0031"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:324251..324253,aa:Leu)"
FT                   /note="tRNA Leu anticodon AAG, Cove score 53.84"
FT   CDS_pept        324537..325418
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SSUSC84_0300"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0312"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51078"
FT                   /protein_id="CAZ51078.1"
FT                   /translation="MPLVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKQAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLIESMNITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLAKAKEVVELAHAKGISVEAEVGTIGGEEDGIVGSGELAPIEDAVAMV
FT                   ATGIDFLAAGIGNIHGPYPANWEGLDLDHLRKLTEAVPGFPIVLHGGSGIPDAQIQEAI
FT                   KLGVAKVNVNTECQIAFANATRKFAAAYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSANKA"
FT   misc_feature    324540..325415
FT                   /gene="fba"
FT                   /locus_tag="SSUSC84_0300"
FT                   /note="HMMPfam hit to PF01116, F_bP_aldolase, score
FT                   4.3e-115"
FT                   /inference="protein motif:HMMPfam:PF01116"
FT   misc_feature    324756..324797
FT                   /gene="fba"
FT                   /locus_tag="SSUSC84_0300"
FT                   /note="ScanRegExp hit to PS00602, ALDOLASE_CLASS_II_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00602"
FT   misc_feature    324933..324968
FT                   /gene="fba"
FT                   /locus_tag="SSUSC84_0300"
FT                   /note="ScanRegExp hit to PS00806, ALDOLASE_CLASS_II_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00806"
FT   CDS_pept        325811..325999
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SSUSC84_0301"
FT                   /product="50S ribosomal protein L28"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0313"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51079"
FT                   /protein_id="CAZ51079.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   misc_feature    325817..325993
FT                   /gene="rpmB"
FT                   /locus_tag="SSUSC84_0301"
FT                   /note="HMMPfam hit to PF00830, Ribosomal_L28, score
FT                   4.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00830"
FT   rRNA            326620..328163
FT                   /locus_tag="SSUSC84_r0007"
FT                   /note="16S rRNA"
FT   tRNA            328215..328287
FT                   /locus_tag="SSUSC84_t0032"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:328248..328250,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            328567..331471
FT                   /locus_tag="SSUSC84_r0008"
FT                   /note="23S rRNA"
FT   rRNA            331549..331676
FT                   /locus_tag="SSUSC84_r0009"
FT                   /note="5S rRNA"
FT   tRNA            331677..331749
FT                   /locus_tag="SSUSC84_t0033"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:331710..331712,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 82.38"
FT   tRNA            331772..331843
FT                   /locus_tag="SSUSC84_t0034"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:331805..331807,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   CDS_pept        331962..333980
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="SSUSC84_0302"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0314"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51080"
FT                   /protein_id="CAZ51080.1"
FT                   /translation="MKRLCDELSVLPGIGPKSAEKFLKISIQNINDLLTYYPFRYEDFE
FT                   SKSIYDLQDGEKAVVVGEVVSPANVQYYGYKRNRLRFSMKQGEVVLAVSFFNQPYLADK
FT                   IVLGQDIAVWGKWDKAKASLTGMKILAQVSDELQPVYHVAQGISQVNLVKAIKTAIDQG
FT                   YLHLLEENLPSVLRERYRLMNRREAVFAMHFPTNLEEYRQALRRMKFEELFYFQLQLQM
FT                   LKANNRDILNGLKIAYDADRLAMQIRQLPFVLTDAQSGALAEILSDMKSYGHMNRLLQG
FT                   DVGSGKTVVAGLAMFAAVTAGMQAAIMVPTEILAEQHFESLRQLFPELSIALLTGGMKA
FT                   AERRTALEAISSGQVDIIVGTHALIQESVTYHKLGLVVTDEQHRFGVKQRRLFREKGDN
FT                   PDVLMMTATPIPRTLAITAFGDMDVSIINQLPAGRKPIITRWVKHQQLPTVLDWLEREL
FT                   EVGAQVYFISPLIEESEALDLKNAVDLQSDLQAHFGEQVTVDLLHGKMKNDEKDAIMQA
FT                   FKERKTNILVSTTVIEVGVNVPNATVMVIMDADRFGLSQLHQLRGRVGRGHKQSYAVLV
FT                   ANPKTESGKERMKIMTETTDGFILAEADLKMRGSGEIFGTRQSGLPEFQVANIIEDYPI
FT                   LEEARRVASQIVSVENWQEDPNWSILLANLKDREELD"
FT   misc_feature    332724..333212
FT                   /gene="recG"
FT                   /locus_tag="SSUSC84_0302"
FT                   /note="HMMPfam hit to PF00270, DEAD, score 5.8e-39"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    333435..333665
FT                   /gene="recG"
FT                   /locus_tag="SSUSC84_0302"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 1.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        complement(334044..335003)
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SSUSC84_0303"
FT                   /product="putative L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0315"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51081"
FT                   /protein_id="CAZ51081.1"
FT                   /translation="MKKILVLHTGGTISMQTNHQGEVAANKTNPMTQIDSPLEETQVTS
FT                   LDFLNVPSPHIRLEHMMTLYQKIKEEQMNFDGFVITHGTDTLEETAYFLDTMAIPEKPI
FT                   VLTGAMRSSNELGSDGIYNYRTALRVATDDKSADKGVLVVMNDEIHAAKYVTKTYTTNV
FT                   STFQTPTHGPLGLVTKREILYFKTAEPRVRFDLSTVTGTVPIIKAYADMDSILLDSLTA
FT                   SSISGLVIEALGAGNLPPTILPAIKKLLDQKIPIILVSRCFNGIAEPVYAYQGGGIQLE
FT                   KDGILFVKELNAQKARLKLLIALNAGLEEQSLADYIQG"
FT   misc_feature    complement(334062..334997)
FT                   /gene="asnB"
FT                   /locus_tag="SSUSC84_0303"
FT                   /note="HMMPfam hit to PF00710, Asparaginase, score
FT                   1.5e-133"
FT                   /inference="protein motif:HMMPfam:PF00710"
FT   misc_feature    complement(334743..334775)
FT                   /gene="asnB"
FT                   /locus_tag="SSUSC84_0303"
FT                   /note="ScanRegExp hit to PS00917, ASN_GLN_ASE_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00917"
FT   misc_feature    complement(334941..334994)
FT                   /gene="asnB"
FT                   /locus_tag="SSUSC84_0303"
FT                   /note="ScanRegExp hit to PS01076, ACETATE_KINASE_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS01076"
FT   misc_feature    complement(334962..334988)
FT                   /gene="asnB"
FT                   /locus_tag="SSUSC84_0303"
FT                   /note="ScanRegExp hit to PS00144, ASN_GLN_ASE_1, score NA"
FT                   /inference="protein motif:Prosite:PS00144"
FT   CDS_pept        join(335073..335912,335911..336438)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0304"
FT                   /product="haloacid dehalogenase-like hydrolase
FT                   (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0316"
FT                   /note="CDS contains a frameshift after codon 280. Similar
FT                   to Streptococcus pneumoniae Cof family protein
FT                   UniProt:Q97NM3 (EMBL:AE007488) (462 aa) fasta scores:
FT                   E()=3.5e-89, 52.772% id in 451 aa"
FT                   /db_xref="PSEUDO:CAZ51082.1"
FT   misc_feature    335085..335120
FT                   /locus_tag="SSUSC84_0304"
FT                   /note="ScanRegExp hit to PS01228, COF_1, score NA"
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    335088..335891
FT                   /locus_tag="SSUSC84_0304"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 8.2e-82"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   CDS_pept        complement(336454..336906)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0305"
FT                   /product="putative universal stress protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0318"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51083"
FT                   /protein_id="CAZ51083.1"
FT                   /translation="MTQSYKTILVAVDGSKGAELALHKAIHVALRNQARLIIAHVIDTR
FT                   ALHNVVAFDASVYESLEREAELLLEEYKQEALNAGLTDVQIRIEFGNPKTLLAIDIPKE
FT                   TGADLMLLGATGLNAFERLLIGSSSEYIMRHATIDLLIVRDGEKSL"
FT   misc_feature    complement(336475..336897)
FT                   /locus_tag="SSUSC84_0305"
FT                   /note="HMMPfam hit to PF00582, Usp, score 1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        337061..338275
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0306"
FT                   /product="putative aminotransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0319"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51084"
FT                   /protein_id="CAZ51084.1"
FT                   /translation="MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAE
FT                   FGFTAPDEVIRDLIHNARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGV
FT                   SELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMES
FT                   KVTSRTKAIVLINPNNPTGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIP
FT                   IATLAPDLFVVTMNGLSKSHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVL
FT                   AQQVVQTSLGGYQSVDELLMPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDR
FT                   EMYRVEDDEQFVLDFLKQEKVLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFL
FT                   RQYRR"
FT   misc_feature    337157..338254
FT                   /locus_tag="SSUSC84_0306"
FT                   /note="HMMPfam hit to PF00155, Aminotran_1_2, score 4e-36"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS_pept        338684..339472
FT                   /transl_table=11
FT                   /gene="codY"
FT                   /locus_tag="SSUSC84_0307"
FT                   /product="GTP-sensing transcriptional pleiotropic
FT                   repressor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0320"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51085"
FT                   /protein_id="CAZ51085.1"
FT                   /translation="MTTLLEKTRNITSILKRSEEQLAEELPYNAIAEHLSAIIDCNSCI
FT                   INSEGEVLGYHMSYETNNDRVEEFFQNKQFPEGYVKAVAQVYDTQVNLPVESELTAIPV
FT                   ESRSTYPNGLTTIAPIHVTGIRFGSLIIWRNDEQFHDDDLILVEIAATVVGIQLLNFQR
FT                   EEDEKNIRRRAAVNMAVNTLSYSEMKAVAAILGELDGNEGQLTASVIADRIGITRSVIV
FT                   NALRKLESAGIIESRSLGMKGTYLKVLIPAIFDEIKKRDY"
FT   misc_feature    338690..339247
FT                   /gene="codY"
FT                   /locus_tag="SSUSC84_0307"
FT                   /note="HMMPfam hit to PF06018, CodY, score 2.5e-105"
FT                   /inference="protein motif:HMMPfam:PF06018"
FT   misc_feature    339284..339466
FT                   /gene="codY"
FT                   /locus_tag="SSUSC84_0307"
FT                   /note="HMMPfam hit to PF08222, HTH_CodY, score 1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF08222"
FT   misc_feature    339296..339361
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1428.000, SD 4.05 at aa 205-226, sequence
FT                   LTASVIADRIGITRSVIVNALR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        join(339462..339482,339482..340015)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0308"
FT                   /product="isochorismatase family protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0321"
FT                   /note="CDS contains a frameshift after codon 7. Possible
FT                   alternative translational start site after codon 4. Similar
FT                   to Streptococcus mutans putative
FT                   pyrazinamidase/nicotinamidase PncA UniProt:Q8DSG2
FT                   (EMBL:AE015009) (183 aa) fasta scores: E()=3.2e-54, 78.022%
FT                   id in 182 aa"
FT                   /db_xref="PSEUDO:CAZ51086.1"
FT   misc_feature    339485..340012
FT                   /locus_tag="SSUSC84_0308"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase, score
FT                   2.6e-08"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        340269..340616
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="SSUSC84_0309"
FT                   /product="50S ribosomal protein L19"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0322"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51087"
FT                   /protein_id="CAZ51087.1"
FT                   /translation="MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGNRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGVGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   misc_feature    340272..340610
FT                   /gene="rplS"
FT                   /locus_tag="SSUSC84_0309"
FT                   /note="HMMPfam hit to PF01245, Ribosomal_L19, score
FT                   1.5e-71"
FT                   /inference="protein motif:HMMPfam:PF01245"
FT   misc_feature    340524..340571
FT                   /gene="rplS"
FT                   /locus_tag="SSUSC84_0309"
FT                   /note="ScanRegExp hit to PS01015, RIBOSOMAL_L19, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01015"
FT   CDS_pept        340777..341451
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0323"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51088"
FT                   /protein_id="CAZ51088.1"
FT                   /translation="MSEQFIPSVLSDLRQDIVQMPEVIKECSGIRIYGRRIRSVLFTTD
FT                   VSIIANHNADAILAVYPFTPSPAIIKSIMLVASVPVLAGVGGGLTTGMRSANMSLLSES
FT                   EGAYAVVVNGPTDVKTIEAINKVVDIPIIYTVVSEKSDLTSRIKAGVDILNVSCGMETP
FT                   RVVKKIREAFPDFPIIATGGPTEDSIRRVIEAGANAVSYTAPSNGELFKGKMEKYRKHA
FT                   KD"
FT   CDS_pept        341668..341970
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SSUSC84_0311"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0324"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51089"
FT                   /protein_id="CAZ51089.1"
FT                   /translation="MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVD
FT                   TTGVAVTTTMADRKNVLRADIAQKGESREELFKNVPESQDNFIKVPAILDGGGDA"
FT   misc_feature    341722..341937
FT                   /gene="gatC"
FT                   /locus_tag="SSUSC84_0311"
FT                   /note="HMMPfam hit to PF02686, Glu-tRNAGln, score 1.2e-15"
FT                   /inference="protein motif:HMMPfam:PF02686"
FT   CDS_pept        341970..343436
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SSUSC84_0312"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0325"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51090"
FT                   /protein_id="CAZ51090.1"
FT                   /translation="MTFNNKTIDELHDLLVKKEISAVELTKATLEDIKSREGAVDAFLT
FT                   ITEDAALAQAAALDEKGIDADNVMAGIPLAVKDNISTKGILTTAASKMLYNYEPIFDAT
FT                   SVAQAYAKDMIIVGKTNMDEFAMGGSNENSAFKPTKNAWDQTKVPGGSSGGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGMKPTYGTVSRFGLIAFGSSLDQIGPFSQTVKENA
FT                   QLLNVISGHDVKDATSTINEIADFTSKIGQDIKGMKIALPKEYMGEGIDPQVKETILKA
FT                   AKHLESLGAIIEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGFRAEDATNLDEI
FT                   YVKTRSQGFGEEVKRRIMLGTFSLSSGYYDAYFKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPTVAFGLDTLNHDPVAMYLADLLTIPVNLAGLPGLSIPAGFVEGLPVGLQLIGPKY
FT                   SEETIYQVAAAFEATTDYHKQQPVIFGGAN"
FT   misc_feature    342039..343361
FT                   /gene="gatA"
FT                   /locus_tag="SSUSC84_0312"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 7.4e-186"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    342417..342512
FT                   /gene="gatA"
FT                   /locus_tag="SSUSC84_0312"
FT                   /note="ScanRegExp hit to PS00571, AMIDASES, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        343436..344875
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SSUSC84_0313"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0326"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51091"
FT                   /protein_id="CAZ51091.1"
FT                   /translation="MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKDMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEIELEDGSTKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFNYV
FT                   RKGLQHEVERQAKILRSGGQIQQETRRYDESTGETILMRVKEGSADYRYFPEPDLPLYE
FT                   IDDSWIEEVRAELPVFPKARRAHYVENLGLTAYDAGQLTSTKALSDFFEAAVAAGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTIEQIALTPENLVEMIALIADGTISSKIAKKVFVHLAKEG
FT                   GSAKAYVEKAGLVQISDPAVLIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVAQQLLAQELAKLLD"
FT   misc_feature    343436..344155
FT                   /gene="gatB"
FT                   /locus_tag="SSUSC84_0313"
FT                   /note="HMMPfam hit to PF02934, GatB_N, score 1e-146"
FT                   /inference="protein motif:HMMPfam:PF02934"
FT   misc_feature    343862..343906
FT                   /gene="gatB"
FT                   /locus_tag="SSUSC84_0313"
FT                   /note="ScanRegExp hit to PS01234, GATB, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01234"
FT   misc_feature    344204..344410
FT                   /gene="gatB"
FT                   /locus_tag="SSUSC84_0313"
FT                   /note="HMMPfam hit to PF01162, GatB, score 4.5e-30"
FT                   /inference="protein motif:HMMPfam:PF01162"
FT   misc_feature    344414..344857
FT                   /gene="gatB"
FT                   /locus_tag="SSUSC84_0313"
FT                   /note="HMMPfam hit to PF02637, GatB_Yqey, score 3.7e-61"
FT                   /inference="protein motif:HMMPfam:PF02637"
FT   CDS_pept        344996..346345
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0314"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0327"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51092"
FT                   /protein_id="CAZ51092.1"
FT                   /translation="MSKDFDDFLREHEENVNKLKKRDKETESDKERARDEFSRDYSRVI
FT                   YSNSFRRQQGKMQLFAVNGRAFHRNRLTHSFEVAQIARGIVDYLKKNTSNNIDIDFNSM
FT                   SVVVETGALVHDIGNPPFGHHGERILNDLAKDIGFEGNAQGLRVLKNIEKKSPDHKGLN
FT                   LTYRTLASILKYYVPYRKSRKTEKFIYKEDYEEFKKRFKEMDVFVRTIDVQIVDLADEI
FT                   AYCAHDLEDALASNYFTIDQFVFLLEQKLGEDQTLEDFKEWIEEAKNKAKRSKSNDDYD
FT                   FYFRRELLSIIVNKFIEDIDIVELNEKDKKKLGTDQDQELGLGHYKKLAGALKKTIFEG
FT                   VTNSDDIILYENVGTKVLTRLFALFMNEEYNRESFLMPIEYRFEKDDTQSDKKRKVLDY
FT                   ISGMMDTYAIEMYIKHFGTDPFLEKYDAAIFKKGTGKKLIECLAQNFLHK"
FT   misc_feature    345206..345670
FT                   /locus_tag="SSUSC84_0314"
FT                   /note="HMMPfam hit to PF01966, HD, score 1.3e-07"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        complement(346404..347402)
FT                   /transl_table=11
FT                   /gene="galR"
FT                   /locus_tag="SSUSC84_0315"
FT                   /product="galactose operon repressor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0328"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51093"
FT                   /protein_id="CAZ51093.1"
FT                   /translation="MVTIKDIAKQAHLSSATVSRVLKGDLTLSVSQETRDRIFNLAQEL
FT                   GYTKHIKKQAPQQKGTIGIVQWYTESEELADLYYYSIRASIEHTASLLGYQIVRSFNDL
FT                   TNPLLQEVDGIIAVGKFSSGQIAELSSLSSKIIFVDSDTLTEGFSCVTTDFEHSVQTVI
FT                   DHFHSQGLTDIGLLVGQEETTDGHQLPTDPRLTAFRDYLDTLGMLQEDYIYQGKFSTQS
FT                   GYELMSQAIEDLGDKLPPAFFMANDTLAVGALRALQERQIAVPDRIQLITFNDTAITRQ
FT                   VYPALSSISVFTEEMGQEAMQLLDRIITSPTPHHPRKIKLGTQLVIRESSY"
FT   misc_feature    complement(346416..347228)
FT                   /gene="galR"
FT                   /locus_tag="SSUSC84_0315"
FT                   /note="HMMPfam hit to PF00532, Peripla_BP_1, score 0.0018"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   misc_feature    complement(347322..347399)
FT                   /gene="galR"
FT                   /locus_tag="SSUSC84_0315"
FT                   /note="HMMPfam hit to PF00356, LacI, score 3.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    complement(347334..347399)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2067.000, SD 6.23 at aa 2-23, sequence
FT                   VTIKDIAKQAHLSSATVSRVLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        347536..348708
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="SSUSC84_0316"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0329"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51094"
FT                   /protein_id="CAZ51094.1"
FT                   /translation="MNTEQLKQAFLDVFGQEADATFFSPGRINLIGEHTDYNGGHVFPA
FT                   AITLGTYGAARKRDDQVLRFYSANFEELGIIEVDLNNLVFDKADNWTNYAKGVLKFLKE
FT                   AGHVIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEELYGLELTRLDLVKIGKQTEN
FT                   HFIGVNSGIMDQFAIGMGADNRAIYLDTNSLEYELVPLDLGDHVIVIMNTNKRRELADS
FT                   KYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIKDENRIKRARHAVLENQRT
FT                   LQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAHTAWEQEGVLGARMTGAG
FT                   FGGCGIAIVHKDKVEAFKENVGKTYTEVVGYAPSFYVAEIAGGSRVLSRK"
FT   misc_feature    347611..347646
FT                   /gene="galK"
FT                   /locus_tag="SSUSC84_0316"
FT                   /note="ScanRegExp hit to PS00106, GALACTOKINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00106"
FT   misc_feature    347875..348081
FT                   /gene="galK"
FT                   /locus_tag="SSUSC84_0316"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   8.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    347896..347931
FT                   /gene="galK"
FT                   /locus_tag="SSUSC84_0316"
FT                   /note="ScanRegExp hit to PS00627, GHMP_KINASES_ATP, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00627"
FT   misc_feature    348385..348636
FT                   /gene="galK"
FT                   /locus_tag="SSUSC84_0316"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   8.4e-15"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        348718..350199
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="SSUSC84_0317"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0330"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51095"
FT                   /protein_id="CAZ51095.1"
FT                   /translation="MMTGLVDRFVEQVIANSDFEEMDAIYLRNRVLALVGDQVLTVQTD
FT                   LEDLIELKDELLAHGVRTGFVGELLEEQDMVGSCLMDLMTPSPSQVNRDFWQTYQDSPE
FT                   QAISDFYELSKRNDYIKMAAIAKNIYYPVSTEYGDLEITINLSKPEKDPKSIAAATKAE
FT                   ASNYPKCLLCMENEGYQGRINHPARANHRIIRLELGQEKWGFQYSPYAYYNEHAIFLNQ
FT                   EHVPMVISPRTFEQLLDLLDLLPGYFVGSNSDLPISGGSILTHNHYQGGRHSFAMDQAP
FT                   IEHQLVFEGFESVSAGIVKWPMSVIRLSSADKPSLLGLAAKILEKWRSYSDDSVQIKAE
FT                   TDGTPHHTITPIARKRGDLYELDLVLRDNQTSEEFPDGIYHPHPDVQHIKKENIGLIEV
FT                   MGLAILPPRLKAELAEVEKFLLGQDSQVADYHQPWAESLKTAHPDVTEETVEQVVRESV
FT                   GQIFARVLEDAGVYKRTPEGQAAFLRFVEFVGLAT"
FT   misc_feature    348766..349395
FT                   /gene="galT"
FT                   /locus_tag="SSUSC84_0317"
FT                   /note="HMMPfam hit to PF01087, GalP_UDP_transf, score
FT                   1.2e-79"
FT                   /inference="protein motif:HMMPfam:PF01087"
FT   misc_feature    349399..350025
FT                   /gene="galT"
FT                   /locus_tag="SSUSC84_0317"
FT                   /note="HMMPfam hit to PF02744, GalP_UDP_tr_C, score
FT                   1.5e-85"
FT                   /inference="protein motif:HMMPfam:PF02744"
FT   misc_feature    349477..349530
FT                   /gene="galT"
FT                   /locus_tag="SSUSC84_0317"
FT                   /note="ScanRegExp hit to PS01163, GAL_P_UDP_TRANSF_II,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01163"
FT   CDS_pept        350275..351183
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0318"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0331"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51096"
FT                   /protein_id="CAZ51096.1"
FT                   /translation="MAEKRLGTLITVIAGIAWGLSGVSGQYLMSRGVSVDMITSLRLLV
FT                   SGLFLVGLAYATAKEQLLAVLKDKNALLGIFIFAMLGLVLNQTAYLQAIYHTNAGTATV
FT                   LQYLCPILVLAYTCLKNREKPSGIELISIILAIAGTFLIATHGKLDELAVTPIGLFWGI
FT                   FSAFTYALYIILPGKLIRQYGSITVIGLGMLMGGFVVTLGLQTWQHRLPIDGGSFLGLL
FT                   GIVGVGTIFAYTAFLKGVSMVGPVNGSLLASIEPIASVFFAVWLVNEQFYAIDFVGMLL
FT                   ILLAVLLISLKDILVAQKSIG"
FT   misc_feature    join(350293..350361,350389..350448,350485..350553,
FT                   350563..350631,350650..350706,350734..350802,
FT                   350821..350889,350917..350985,351004..351072,
FT                   351085..351147)
FT                   /locus_tag="SSUSC84_0318"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUSC84_0318 by TMHMM2.0 at aa 7-29, 39-58, 71-93, 97-119,
FT                   126-144, 154-176, 183-205, 215-237, 244-266 and 271-291"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    350320..350709
FT                   /locus_tag="SSUSC84_0318"
FT                   /note="HMMPfam hit to PF00892, DUF6, score 3.8e-16"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   misc_feature    350773..351147
FT                   /locus_tag="SSUSC84_0318"
FT                   /note="HMMPfam hit to PF00892, DUF6, score 7.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   CDS_pept        351231..351860
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0319"
FT                   /product="CutC family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0332"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51097"
FT                   /protein_id="CAZ51097.1"
FT                   /translation="MIKEFCSENHVGVMKALSLGAKRIELCDNLAVGGTTPSYGVVKHV
FT                   CQLAHENEATVMTMIRPRGGDFCYDKAEVEMMVEDCKAAIELGADGLVYGLLTEENWLD
FT                   EPALERLFAVSQDCQIVFHMAFDQIPRERQFEALDWLVEHGVTRILMRGSLTGSALNNV
FT                   EWLQEIVAYAQGKIEILIGGGLTVDNVPTLLEALPINQVHGTRLFW"
FT   misc_feature    351231..351854
FT                   /locus_tag="SSUSC84_0319"
FT                   /note="HMMPfam hit to PF03932, CutC, score 2.1e-72"
FT                   /inference="protein motif:HMMPfam:PF03932"
FT   CDS_pept        352067..352441
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0320"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0333"
FT                   /note="No significant database matches"
FT                   /note="Possible alternative translational start site after
FT                   codon 7"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51098"
FT                   /protein_id="CAZ51098.1"
FT                   /translation="MNPLRKELRTVAVEVSDLALDYAVRLAQSLNSTLRYHNYDSLIAI
FT                   AKTKGVEPKGKDCQSFSEYRQRYSLYDAKKLIYRALAWRLFDDSHADYGHALTILGLDE
FT                   DESGVEQIGFAFSKFTLDID"
FT   CDS_pept        352625..353152
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0321"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0334"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51099"
FT                   /protein_id="CAZ51099.1"
FT                   /translation="MSLENYMPDFALEKAYDVTVESLKKHGIKVVFVDLDNTLIAWNNP
FT                   DGTPEMRQWLHDLQDAGIPVVVVSNNKYERVKRAVEKFGIEFEAFALKPFTFGINRALK
FT                   RFDVQPYEVIMIGDQLMTDIRAAKRAGLKSVLVKPLIKTDSINTQINRWRERRTMKKII
FT                   AKYGAIDYKREM"
FT   misc_feature    352769..353044
FT                   /locus_tag="SSUSC84_0321"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 4.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        353153..354259
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0322"
FT                   /product="GTP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0335"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51100"
FT                   /protein_id="CAZ51100.1"
FT                   /translation="MEELFCIGCGAQIQTLDKAVAGFTPQSALEKGLETGQLYCQRCFR
FT                   LRHYNEISDVNISDDDFLKLLHSVGESDALVVNVIDIFDFNGSVIPGLPRFISGNDVLL
FT                   VGNKQDILPKSVKTGKVTQWLTERAHEIGMRPVDVVLTSAQNKQAIKDLIEKIEQHRKG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSYIYDTPG
FT                   IIHRHQMAHYLTAKNLKYISPRKEIKPKTYQLNPEQTLFLAGLGRFDFVAGERQGFTAF
FT                   FDNELQLHRTKLQGASEFYQKHAGSLLVPPTSKELKEFPELVRHEFTINEKTDVVFSGL
FT                   GWIRVNEKAKIAAWAPKGVDVVIRKAII"
FT   misc_feature    353642..353959
FT                   /locus_tag="SSUSC84_0322"
FT                   /note="HMMPfam hit to PF01926, MMR_HSR1, score 6.5e-12"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   CDS_pept        354532..354840
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0336"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51101"
FT                   /protein_id="CAZ51101.1"
FT                   /translation="MLTSKQRAFLNSQAHSLKPIIQIGKNGLNDQIKTSVRQALDAREL
FT                   IKVTLLQNTDENIHEVAEILEEEIGVDTVQKIGRILILFKQSSKKENRKISKQVKEI"
FT   misc_feature    354535..354786
FT                   /locus_tag="SSUSC84_0323"
FT                   /note="HMMPfam hit to PF01985, CRS1_YhbY, score 2.6e-33"
FT                   /inference="protein motif:HMMPfam:PF01985"
FT   CDS_pept        354853..355485
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0324"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0337"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51102"
FT                   /protein_id="CAZ51102.1"
FT                   /translation="MAIELLTPFTKVELEVEKKETNRKQVGILGGNFNPVHNAHLIVAD
FT                   QVRQQLKLDQVLLMPEFIPPHVDKKETIDEYHRYSMLKMAIAGIEGLGIETIELERRGV
FT                   SYTYDTMKLLKEKNPDTDYYFIIGADMVDYLPKWHRIDELVQLVQFVGVQRPRYKAGTS
FT                   YPVIWVDVPLMDISSSMVRSFIKQGRVPNFMVPHEVLDYIEEKGLYQ"
FT   misc_feature    354934..355404
FT                   /locus_tag="SSUSC84_0324"
FT                   /note="HMMPfam hit to PF01467, CTP_transf_2, score 5.5e-62"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   CDS_pept        355482..356069
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0325"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0338"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51103"
FT                   /protein_id="CAZ51103.1"
FT                   /translation="MIAADLTFDRQALLEKIRVAMKPARFQHVLGVEQAALVLADQYGC
FT                   DPKKASLAALLHDYAKEVEDQVFLDLIAKYDLDKDLLNWDNNIWHGVVGAYKIAEDFGL
FT                   EDEEIFQAIQRHTVGAGQMTLLDKVLYVADYIEPNRDFPGVDEARRIAKESLDKAVAYE
FT                   TAQTISYLAKKGIPIYPQILETYNGYVVWLKE"
FT   misc_feature    355554..355898
FT                   /locus_tag="SSUSC84_0325"
FT                   /note="HMMPfam hit to PF01966, HD, score 1.5e-21"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        join(356179..356304,356582..356902)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0326"
FT                   /product="acetyltransferase (GNAT) family (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0339"
FT                   /note="CDS lacks a translational start codon, and is
FT                   disrupted by a 277bp DNA region. Similar to Bacillus
FT                   thuringiensis serovar konkukian str. 97-27
FT                   acetyltransferase UniProt:Q5LK91 (EMBL:CP000047) (148 aa)
FT                   fasta scores: E()=6.8e-14, 36.429% id in 140 aa"
FT   misc_feature    356594..356839
FT                   /locus_tag="SSUSC84_0326"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   6.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        join(356899..356985,356989..357072,357074..357409)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0327"
FT                   /product="isochorismatase family protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0341"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   29, and a frameshift after codon 57. Similar to
FT                   Streptococcus agalactiae (serotype III) hypothetical
FT                   protein GBS1704 UniProt:Q8E3Q2 (EMBL:SAG766852) (173 aa)
FT                   fasta scores: E()=1.7e-21, 42.262% id in 168 aa"
FT                   /db_xref="PSEUDO:CAZ51105.1"
FT   misc_feature    join(356902..356985,356989..357072,357074..357400)
FT                   /locus_tag="SSUSC84_0327"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        357411..357770
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0342"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51106"
FT                   /protein_id="CAZ51106.1"
FT                   /translation="MKELDLVKVVVQAADDKRAEDLVVIDVQGVTSLTDYFVIASSMNS
FT                   RQLEAIAENIREKVADVGIKSSRVEGDSNGGWVLLDLGGVVVHIFSEEMRDLYNLEKLW
FT                   HEGSFLEVADFLEEE"
FT   misc_feature    357420..357725
FT                   /locus_tag="SSUSC84_0328"
FT                   /note="HMMPfam hit to PF02410, DUF143, score 4.5e-45"
FT                   /inference="protein motif:HMMPfam:PF02410"
FT   CDS_pept        358072..358815
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0329"
FT                   /product="SAM dependent methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0343"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51107"
FT                   /protein_id="CAZ51107.1"
FT                   /translation="MATYETFAAVYDEIMDDSLYDKWTDFSLRNLPQDTKTILELACGT
FT                   GIQAVRFAQKGYEVTGLDLSYEMLELAQKKAEAAGVMMELAQADMMALEGVGDFDAVTC
FT                   YSDSLCYMSDREAVLRVFEGVHSVLNQGGTFLFDVHSIYQMEEVFAGYSYHENYEDFAF
FT                   VWDTYEGEHAHSIVHELTFFVKDEASQEERFIRRDEVHEERTYPIETYVELLKEAGFAS
FT                   VEVFADFEDEAPTETSQRWFFKCKK"
FT   misc_feature    358186..358482
FT                   /locus_tag="SSUSC84_0329"
FT                   /note="HMMPfam hit to PF08241, Methyltransf_11, score
FT                   4.8e-16"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   CDS_pept        358910..362962
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0330"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0344"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51108"
FT                   /protein_id="CAZ51108.1"
FT                   /translation="MESLHRKISNWGQKIFLQFKNRTPNVEGISFNRLTSNKNIDLERE
FT                   NPSFKQALDFAIQDDELKNVAITGNYGSGKSSLLDSYEAKYSNKKFLHISLADYKENDL
FT                   SGYKENDSSESGKKLNVRQINVIEGKIINQLLHQIHPKHVKKSIFKTLSRTPRRIPLLL
FT                   TVYIVLFFITLSYFLKPNFLKALVTADKVFGWDANTVFSWLFLILLFIGSLTTIWYIVE
FT                   NKTIKSLTIGGKNVSSEIDIFSDQSMRVSYFDKYLDDVLYLLNESRADVIVFEDIDRFE
FT                   NNTIFAKIKELNVLVNNKRKIAKKSSKLVFLYLIRDDLFISKERTKFFDFIIPVLPVIT
FT                   SSNSSDKLTTTLKEMGIKSGLADDFLFRISLYIDDMRLLNNICNEFYSYQLELTHDKTG
FT                   EKNALDLDLKKIFAMIVYKNIFPKDFSELQNNQGFLYSLFNEKEVRRSEKLTKIDSEKL
FT                   HLENKLRKIQSEHIQDEIELYGTIFKIPNGRKVVSVNDKFQDEFTSYHDFISEMLVEGS
FT                   RIISYVDFDDAYRNVGIKTENMDSIFPEKDSPEFKERLDTVRSRNNSKELQQKIASLNQ
FT                   KRSFVEKQLIADIYTNQEIHEFAKSREEFIDIEKNQQFDIIYFLLKNSYIDETYPDYLT
FT                   YFYGNVLTKNDKEFLRNISSGRGAGFDFRLVNISNIYHHLQLKDFRNEEVLNFDLIEYM
FT                   LKNLELQSREENLSAILLQEDNLDFLVELAKKLYDSKSEKYNLEQFGQLMEFWLSTNPQ
FT                   RFIDYMKSTKVEYQAPLKNKFIRALMNQVNLDSVDNEIKALVARYINENNDLISPNEDF
FT                   TSFFKTNLKAINLKFTHFREPDDDAPRTTTFLELIDFIFGNSLYEINKENLRFFMRWFK
FT                   GSTDWSEEDFKHKNFELLHTNDNYSPLLEYSRLKITDYVYAYLEICEGTILDNSEYIVE
FT                   LLQRNEVYESGFNLGTLEEERQIDRILQFLPDNSINFNSDDFRQLVEEDILEEGNYLTL
FT                   LSLLVQTSKAVVDTDIILSYFTENQNYDNSLINFINNARDLKFEEDIFNLLEKEEQRNF
FT                   FTKTVECMELDDTKYELILSTLGWHYTDTFNKSGIESSKLRILIDLEIIQFNSKNIEFF
FT                   RDNYPEDTLYLIKKHLSEYLDTKSKIYKEDELLALLDDDIISDDEKTNIADHILKISIK
FT                   NKQYSEKLTAHILENQFDEEDLSYIISSQFFDNQSLSLKELVKQIAIENLDTIAEEFYA
FT                   QISNNLMRKLIAESQLNTLKKLIYNYYVYTPNLDENEKREQFSKYLNLFALSDNITALK
FT                   ELNVFDEWDSVLKTLNKPGTRWGQVQKTTINLAFARYLDSNNFVSSINERSNDIRLNSY
FT                   KDKTIPL"
FT   misc_feature    join(359384..359443,359504..359572)
FT                   /locus_tag="SSUSC84_0330"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0330 by TMHMM2.0 at aa 159-178 and 199-221"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        363021..364112
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0345"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51109"
FT                   /protein_id="CAZ51109.1"
FT                   /translation="MSISGIIAEYNPFHTGHKYLLEQAEGLKIVVMSGNFMQRGEPAIV
FT                   DKWTRAQMALEHGADLVVEMPFLVSVQSADHFAKGAISILHRLGVEKLVFGTEEMLDYQ
FT                   KIADIYVDKSEEMENFVKNLPDNFSYPQKTQAMWQEFAGLTFTGDTPNHILALAYAKGV
FT                   AGTGIQLSPVQRQGAGFHSEEVETSYASAIAIRKGADQLDLVRDFLPSASLFEEATKVS
FT                   WRNYFPLLRYQITTHPDLSQVFQVNEELASRIRSAIGSVATVEELVEAVTTKRYTKARV
FT                   RRVLTYILINAVETPLPDAVHVLGFSARGQAYLKQVKERVGLVTRIGKEPWDSLTQQAD
FT                   LVYQLGADAMAEQTYGRVPVRVE"
FT   misc_feature    363021..364100
FT                   /locus_tag="SSUSC84_0331"
FT                   /note="HMMPfam hit to PF05636, DUF795, score 1.8e-181"
FT                   /inference="protein motif:HMMPfam:PF05636"
FT   CDS_pept        364208..364927
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0332"
FT                   /product="MerR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0346"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51110"
FT                   /protein_id="CAZ51110.1"
FT                   /translation="MKTVKEMSQLSGISVRTLHYYDEINLLTPSFIAENGYRYYDNEAF
FT                   EKLQEILLFRELEFPLKEIKKIVGNAAYDRESALKDQIRLLELKKKHLEKVIKHAKSLQ
FT                   QKGENYMNFEVFDKSDLLAFQEEAKERWGNTAAFQEFSAKTNQEGFAHISAEMSGIMME
FT                   FGKMKSLSADDSKVHKQVEVLKAYISENFYNCTNEILASLGQMYIADNRFTQFIDQVGG
FT                   EGTASFVSQAIAVYCKE"
FT   misc_feature    364214..364327
FT                   /locus_tag="SSUSC84_0332"
FT                   /note="HMMPfam hit to PF00376, MerR, score 2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    364538..364918
FT                   /locus_tag="SSUSC84_0332"
FT                   /note="HMMPfam hit to PF07739, TipAS, score 1.4e-50"
FT                   /inference="protein motif:HMMPfam:PF07739"
FT   CDS_pept        365023..367557
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0347"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51111"
FT                   /protein_id="CAZ51111.1"
FT                   /translation="MTKIKIISNPFHKSIVFQKQQPITEVWEEITFESNPNSRLVRENI
FT                   QKGVLSFHIQEIVDILVAEYDDGTGIDLLFEGNSDEFQELKTFVQSLNNSSISLKKSAY
FT                   SLTNARDILPEVLSIFDKTQVILPEELEHDAAIQKFQDATKPQIPLLVLGNYSAGKSTF
FT                   INSLVGYELLPASDQPTTAKIIQIEKFAEKWIEIEGTLLRNKVCIRIDEDGFEVEGDRI
FT                   DETIIKDLESIRQSLPQTTPQILARAVLAYLNAREDSDLNIITVKTAFTDSPLSKSSHR
FT                   YIIFDTPGSNSSTNMEHLQLLREAMAGMSNGLPIFISEYTSLDTVDNDKLYQELEQIDG
FT                   IDLRYTILVVNKADTAALSTFQDHQVLNQALPRKLSTKRVYFLSSLMGLGSKTSGLFQE
FT                   PDYERVYQKSLAEFTDASNPYYQQLYTYNILPTQQKLAQELQSKEERNLLYANSGLYSL
FT                   ESEIEVFSTKYAAYNKCVQADQYLQHIISQTQSIIEDSKKTIEQEKDRLEKKLEKDKLA
FT                   LVNDLKRQQADFFNSSSTVYQQNLNEKVRDEKHYAPLQLFIKERDSLWSKAVDDFQLKS
FT                   YQKEMAESPKKALNNIKNSLGKAWDKKNIEILGSAFVNGFNDTGKVFSKVDDYNKMKTK
FT                   AKGQVRDQLITFARFEYIKQVEEVGKDFTTLSIHYWKEQTGLIKDRFSQLIGDASVLSD
FT                   QKRAAIKEIIFQFQQPVLYHDSKQLFDQKSLVEGFRLGDIQIFGDANKIDLQKLEKRYN
FT                   SLLKTAYKHINEQLISHHQATFYKWVEALLHLVTENIVEFSPDLHSTNLLIQDNRVKIE
FT                   ELSTNLQNLHEYSKDLHDLMAWKDDEEVANGY"
FT   CDS_pept        367547..370885
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0348"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51112"
FT                   /protein_id="CAZ51112.1"
FT                   /translation="MVIKKMIKKVATKAADGVSKLSELSPEQLEKVQAQMATYRDQIPD
FT                   LSGEAAEEYFRKQLAIAGVEVYNAYLPQLKDLYLPIDNKTEFRLEDEGVLIDEGEFKSG
FT                   YNIRYINITKWVTDKQENSLEKLVSVYEVLSTTPCNISLVFHRKQEETSVYLAVTNTEN
FT                   ADSNADVDSYRKRLVSAIKGNFPGAAWKEEVGRGSLPCFEDYIPYSVATASNIPTEKSE
FT                   KFISQTIEKLLDGIVPENKEQEYILVLLATPVLDVTDRKLHLSQIYSNLSPYATWQTQF
FT                   QLTESDSRGSSATVGVNIGASVGSQTGHNLTQTHSQGQTESRGTSETETNTKGSGWQAG
FT                   VNIKILNGGHNWNKSKSIAKGITNTIGKTASVANAVGKTVSSSLGANFGANFARTSSVT
FT                   ATIGKNEGISQSFVNHHVQHALKNLDKQMERLELSTALGLWDFSAYVLSEDPTIANNVA
FT                   HSYLALTQGEESHLSQTVVNLWRGDVQMERDKAKALIAYLRDLRHPLFGFNPEILEIDE
FT                   EFAVYPEIVTAATPLSGKELAYALNFPQKSIAGLPVLECAQFGRNISTFEEKDDQEQLP
FT                   LGNIFHMNHEENTAVQLSLPSLASHTFITGSTGTGKSNTVYQLLAQAREKGIKFLVVEP
FT                   AKGEYKQVFGSDEDVAVFGTNPTITPLLKINPFSFPEGIHILEHLDRLVELFNVCWPMY
FT                   AAMPAVLKKAIEQAYQDCGWDLISSVNTYSKTIFPTFADVLRTIREIIDSSEYDNDNKG
FT                   AYKGALLTRLESLTTGIYQLMFTEDEISSEKLFDENVIVDLSRLGSSETKSLIMGLLIL
FT                   KMQEYRMVSSQGMNQQLRHVTVLEEAHNLLKRTSTEQATESSNLLGKSVEMLTNAIAEM
FT                   RTYGEGFIIADQSPGLLDLAVIRNTNTKIILRLPEYSDRELVGKSANLNEEQINELAKL
FT                   PKGVAAVYQNEWLEPVLCKVAKYDSTEMVFQQPTQLVRTESPYHRLAILELLTTSPNLD
FT                   STLSFEELQELTLAVGLDSLTQVRIFNFLRTTSPDNFSMHELAHILGKVYPELVEKIRL
FT                   KAEKGLEPPALTQVLQQEIDSSIPETISEQARRDLVQGLMTCYYLFELKDHKAMQDWLR
FT                   NGDLI"
FT   CDS_pept        370882..371481
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0349"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51113"
FT                   /protein_id="CAZ51113.1"
FT                   /translation="MIEGLKTVAEAVKPVVNEVGKRAIDAFEKPIDSDKRLEAASDNKT
FT                   TFRYDGLSKPQEFLAQAQGFPKEIAKDIYNSQELKHYMDIGMRAVQFGQKENGEPRFCL
FT                   IPKDLSFDRVVDSQGRTNAERLQSGLLPIKDGQPLEVHHIGQKNGGHYALLTKEEHIKN
FT                   GNKEMLHKPGKSDVDHGLDFARDKRSIAKVLMEEQV"
FT   CDS_pept        371478..371888
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0350"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51114"
FT                   /protein_id="CAZ51114.1"
FT                   /translation="MSQLVDKIKVVQGLYSGSPASEQEVAVAESKLQLIFPAEYKDYLK
FT                   EYGVISFYGTEWNGLKGDTWTDVVATTLEARSLYENFPKEKFILEDLHFDDMLVLADST
FT                   GKVFLWHNGLEKEIHSSIASYLEECVARKDTP"
FT   CDS_pept        371885..372295
FT                   /transl_table=11
FT                   /gene="fms"
FT                   /locus_tag="SSUSC84_0337"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0351"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51115"
FT                   /protein_id="CAZ51115.1"
FT                   /translation="MIQPIMKDIFFLQQKSEPATQLDVQVGQDLQDTLAANAHACVGMA
FT                   ANMIGVKKRIIIVNMGFTNLVMYNPVLISKAKPYQTEEGCLSLEGTRPTTRYQEIEVEF
FT                   FDASWKKISLKLTDFQAQIVQHELDHLEGIII"
FT   misc_feature    371900..372292
FT                   /gene="fms"
FT                   /locus_tag="SSUSC84_0337"
FT                   /note="HMMPfam hit to PF01327, Pep_deformylase, score
FT                   2.8e-12"
FT                   /inference="protein motif:HMMPfam:PF01327"
FT   CDS_pept        372600..374699
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="SSUSC84_0338"
FT                   /product="putative ATP-dependent protease ATP-binding
FT                   subunit ClpL"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0352"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51116"
FT                   /protein_id="CAZ51116.1"
FT                   /translation="MNNNFNNFNNMDDIFNQLMGNMGGYSTERRRYSINGREVTPEEFA
FT                   MYRQTGRLPQTEEVAQTQAKGQIKSDGILAKLGRNLTQDAREGKLDPVIGRNKEIQETS
FT                   EILARRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAGTQ
FT                   YRGAFEENVQNLVDEVKKAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSRGE
FT                   LTVIGATTQDEYRNTIHKNAALARRFNEVKVNAPSAEDTYQILKGIKPLYEAHHNIELP
FT                   DEVLRAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDIQTLEAEMAEAKQLQL
FT                   EAAEKEDYEKALNEKVRIDKLQKQIDNHTEQQKVVATVNDVAQAVERMTGIPVSQMGAS
FT                   DIERLKELKNRLAANVIGQDDAVEAVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTE
FT                   LAKQLALDLFGNKDAIIRLDMSEYSDRTAVSKLIGTTAGYIGYDDNSHTLTERVRRNPY
FT                   SIVLMDEIEKADPQVITLLLQVLDDGHLTDGQGNQVNFKNTIIIATSNAGFGYGMAEGE
FT                   ENQDIMDRIAPFFRPEFLNRFNAVIEFKHLDKDDLKAIVELLLAQVNNTLAKKGIQLTV
FT                   TEAAKEFLMEEGYDKAMGARPLRRVIENQIRDKVTDFYLDHVDVKYLEADVVDGSIQIK
FT                   EQSFA"
FT   misc_feature    372939..373403
FT                   /gene="clpL"
FT                   /locus_tag="SSUSC84_0338"
FT                   /note="HMMPfam hit to PF00004, AAA, score 4.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    373920..374399
FT                   /gene="clpL"
FT                   /locus_tag="SSUSC84_0338"
FT                   /note="HMMPfam hit to PF07724, AAA_2, score 6.1e-76"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    374025..374081
FT                   /gene="clpL"
FT                   /locus_tag="SSUSC84_0338"
FT                   /note="ScanRegExp hit to PS00871, CLPAB_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00871"
FT   CDS_pept        374882..376390
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /gene_synonym="malQ"
FT                   /locus_tag="SSUSC84_0339"
FT                   /product="putative 4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0353"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51117"
FT                   /protein_id="CAZ51117.1"
FT                   /translation="MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQI
FT                   LPLTTTSYGDSPYQSFSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALI
FT                   YQVRRPILEKAVQAFLQDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWED
FT                   KKVVARNEEALDKYRLELANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVS
FT                   ADSVEVWTKPQLFKLDSERKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIY
FT                   RIHESFKLYDVLRIDHFKGFSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPI
FT                   IAEDLGNIDAKARKLLADCGYPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNE
FT                   VVNGWYNNLDPEQQEYVDAYSNRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEES
FT                   RMNMPSTIGGNWEWRMKAEDLTQERKDFLTKMTLLYQRGNENHD"
FT   misc_feature    374909..376363
FT                   /gene="malM"
FT                   /gene_synonym="malQ"
FT                   /locus_tag="SSUSC84_0339"
FT                   /note="HMMPfam hit to PF02446, Glyco_hydro_77, score
FT                   5.6e-200"
FT                   /inference="protein motif:HMMPfam:PF02446"
FT   CDS_pept        376383..378647
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="SSUSC84_0340"
FT                   /product="putative glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0354"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51118"
FT                   /protein_id="CAZ51118.1"
FT                   /translation="MTKFTTFAETNTSKKLADLTNEEIYLQLLNYVKDAAASKPKNTGK
FT                   RKVYYISAEFLIGKLLSNNLINLGVYKDVQAELAAAGKSLAQVEDVEPEPSLGNGGLGR
FT                   LASCFVDSMSTLAINGEGVGLNYHCGLFRQVFKKNEQEAEPNFWIENDSWLIPTTISYD
FT                   VPFKNFTLKSKLDRLDILGYKKETKNYLNLFDIESVNYDLITDGISFDKTDIKENLTLF
FT                   LYPDDSDKNGELLRIYQQYFMVSNAAQLLIDEAIERGSNLHDLADYAYVQINDTHPSMV
FT                   IPELIRLLTEKHGIEFAEAVAIVKNMTGYTNHTILAEALEKWPLEFLEEVVPHLVDIIK
FT                   ELDALIRAEIKDPAVQIIDESGRVHMAHMDIHFSNSVNGVAALHTEILKNSELKAFYEL
FT                   YPEKFNNKTNGITFRRWLEFANQDLADYIKELIGDEYLTDATKLEKLLAFADDKEVHAK
FT                   LAEIKFNNKLALKRYLKDNKGIELDENSIIDTQIKRFHEYKRQQMNALYVIHKYLEIKN
FT                   GNLPKRKITVIFGGKAAPAYIIAQDIIHLILCLSELINNDPEVNKYLNVHLVENYNVTV
FT                   AEKLIPATDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELAGMDNIYTF
FT                   GKDSDTIIDLYDKAGYVSADYYNGDANIKRAVDFIVSDEVKALGNEERLGRLHHELISK
FT                   DWFMTLIDLAEYIEVKEQVFADYEDQDSWNKKVVHNIAKAGFFSSDRTIEQYNEDIWHS
FT                   N"
FT   misc_feature    376614..378638
FT                   /gene="glgP"
FT                   /gene_synonym="glgP"
FT                   /locus_tag="SSUSC84_0340"
FT                   /note="HMMPfam hit to PF00343, Phosphorylase, score
FT                   2.3e-190"
FT                   /inference="protein motif:HMMPfam:PF00343"
FT   misc_feature    378168..378206
FT                   /gene="glgP"
FT                   /locus_tag="SSUSC84_0340"
FT                   /note="ScanRegExp hit to PS00102, PHOSPHORYLASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00102"
FT   CDS_pept        complement(378875..379582)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0341"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0355"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51119"
FT                   /protein_id="CAZ51119.1"
FT                   /translation="MSKYKKVYQDIKKKIEEQVWSTGQALPTENELMEVYSYSKDTIRK
FT                   ALSLLEMDGYIQKKQGKSSIVIEHGLMKDQYLSEIKTAGELNKRSQHQIQTQLTSLYII
FT                   QGQEDLMSTFEVDDKVDFYRVSRVRTIDGERLEYDISYFDRRVVPYLSKEIAESSIYRY
FT                   LEEELHLTISHSRREISFRFANEEEKQLMDLGDYDMVVVVTSITYLSNGQAFQYGTISY
FT                   RPDKVSFVSMAKR"
FT   misc_feature    complement(378899..379315)
FT                   /locus_tag="SSUSC84_0341"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 2.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   misc_feature    complement(379385..379576)
FT                   /locus_tag="SSUSC84_0341"
FT                   /note="HMMPfam hit to PF00392, GntR, score 5.4e-17"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   CDS_pept        379781..380572
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0342"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0356"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51120"
FT                   /protein_id="CAZ51120.1"
FT                   /translation="MKLLTINVHAWLEERQDEKLDVLAQTIAEKAYDVIALQEVNQLIT
FT                   ADLVTKDLKADNYGLILLEKLRTLGQFDYSYYWSNSHIGYDKYEEGIAFLTKLPVYEVD
FT                   QFYCSQNKSIDSILSRKIMGLTVFYQDQLIDLYSCHINLPGSEEEDQLDNIRTIVERTG
FT                   NRRFKILMGDFNTDAFSDREAYEAITELGLYDSYNLAMEKDQGITVEKAIDGWAGHSQE
FT                   KRLDYIFLNQKKEVLSSLVIFNGENRPIISDHFGVEVEINV"
FT   misc_feature    379781..380563
FT                   /locus_tag="SSUSC84_0342"
FT                   /note="HMMPfam hit to PF03372, Exo_endo_phos, score
FT                   1.9e-11"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS_pept        380606..382774
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0343"
FT                   /product="putative glucose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0357"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51121"
FT                   /protein_id="CAZ51121.1"
FT                   /translation="MKKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPESE
FT                   LLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHFFG
FT                   VTTDMLADAAATVTTVFGTEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYN
FT                   YRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPI
FT                   LAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGAQAGTQVFGQDPLWLAWIT
FT                   DLINLKDAGDMAQYNDLLANITPARFKVGQMIGSSGILMGLTYAMYRNVDEDKKHKYKG
FT                   MFISSALAVFLTGVTEPIEFMFMFAAMPLYVVYAFVQGAAFAMADIVNLRMHSFGNIEF
FT                   LTRTPMAIKAGIGMDVINFIWVTALFAVGMYFIANFMIKKFNLATAGRNGNYDTETTDV
FT                   VSNSNVDTADANSQVVQIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGA
FT                   MGLIIKDSGVQAVYGPKADVLKSDIQDLLESGVAIPRTEIVATEEVAPETQFKGVTETV
FT                   YSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILS
FT                   DKGVEVLVHVGLDTVALNGAPFSTKVTDGQRVEAGDLLLVADLEAIRSAGRETTIVVAF
FT                   TNTAEIKSVSLENLGQVSQDSQVATVEL"
FT   sig_peptide     380606..380713
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="Signal peptide predicted for SSUSC84_0343 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.944) with cleavage
FT                   site probability 0.452 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    380645..381739
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="HMMPfam hit to PF02378, PTS_EIIC, score 1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    join(380651..380719,380762..380830,380849..380917,
FT                   380945..381013,381032..381100,381143..381211,
FT                   381617..381670,381683..381751,381848..381916)
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUSC84_0343 by TMHMM2.0 at aa 16-38, 53-75, 82-104,
FT                   114-136, 143-165, 180-202, 338-355, 360-382 and 415-437"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    382022..382126
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="HMMPfam hit to PF00367, PTS_EIIB, score 5.2e-16"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    382058..382111
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="ScanRegExp hit to PS01035, PTS_EIIB_TYPE_1_CYS,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01035"
FT   misc_feature    382316..382714
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="HMMPfam hit to PF00358, PTS_EIIA_1, score 5.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    382517..382555
FT                   /locus_tag="SSUSC84_0343"
FT                   /note="ScanRegExp hit to PS00371, PTS_EIIA_TYPE_1_HIS,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00371"
FT   CDS_pept        complement(382845..383471)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0344"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0358"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51122"
FT                   /protein_id="CAZ51122.1"
FT                   /translation="MIRHKLFTSLQEEEHWINSIQSEGYQLVKVTPWTATYHFEKCSRT
FT                   PHPVRLDFHEHIAKGEYSNYLSLFEDCGWQPIQGSRRCGIHYFQQTIETSSTEIFSDTE
FT                   SKKAFYSRYQNYAYSYFGLFLTLFFIHYQVGLQNGYTLWNPKSWYLTPGLWERTGTSFW
FT                   FGFLFETPFALFRSGIIPLFFLAWSIYFLHIAEKGKKEAKKLEKY"
FT   misc_feature    complement(join(382890..382958,383067..383126))
FT                   /locus_tag="SSUSC84_0344"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0344 by TMHMM2.0 at aa 116-135 and 172-194"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(383482..383793)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0345"
FT                   /product="PadR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0359"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51123"
FT                   /protein_id="CAZ51123.1"
FT                   /translation="MKRNKHLPLTETTYYILLALLEPAHGYHIMQKVEDMSDGDVKIAA
FT                   GTMYGAIENLLKLKWICSVPSSDKRRKVYQVTATGQEIIKLETQRIQKLHHIAKELGF"
FT   misc_feature    complement(383548..383778)
FT                   /locus_tag="SSUSC84_0345"
FT                   /note="HMMPfam hit to PF03551, PadR, score 3e-08"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        383954..384670
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0360"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51124"
FT                   /protein_id="CAZ51124.1"
FT                   /translation="MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETNS
FT                   ALKFVIDRAKQAQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRSAFGKNGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDDVEA
FT                   EDGTITIYTAPTDLHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKLYDAL
FT                   EDDEDVQKIYTNVDGF"
FT   misc_feature    383960..384661
FT                   /locus_tag="SSUSC84_0346"
FT                   /note="HMMPfam hit to PF01709, DUF28, score 7.8e-130"
FT                   /inference="protein motif:HMMPfam:PF01709"
FT   CDS_pept        385034..385882
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0361"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51125"
FT                   /protein_id="CAZ51125.1"
FT                   /translation="MSNNLLVLQSDFGLVDGAVSAMIGVALQESRDLVVHHLTHDITPY
FT                   NIFEGSYRLFQTVEYWPEGTTFVSVVDPGVGSKRKSVVALTEQNHYIVTPDNGTLSFIK
FT                   KYVGIKAVREISEVANRRANTEHSYTFHGRDVYAYTGAKLASGHISFEEVGPELSVDKI
FT                   VEIPTVPTEVGSDYVKGAIDILDVRFGSLWTSITREEFYTLQPQFEDRFEVTIYNNDML
FT                   VYQNQVTYGKSFADVRIGQPLIYINSLYRVGVAINQGSFAKAYNVGVGQNWHIEIKRIS
FT                   N"
FT   misc_feature    385046..385867
FT                   /locus_tag="SSUSC84_0347"
FT                   /note="HMMPfam hit to PF01887, DUF62, score 5.8e-76"
FT                   /inference="protein motif:HMMPfam:PF01887"
FT   CDS_pept        385903..386448
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0348"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0362"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51126"
FT                   /protein_id="CAZ51126.1"
FT                   /translation="MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQS
FT                   LLAVVFGPVVGFLVGFIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFE
FT                   GKDILFFNLVQIAANVLAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTL
FT                   LLVVYAKSQTKTGSLSKD"
FT   misc_feature    385909..386445
FT                   /locus_tag="SSUSC84_0348"
FT                   /note="HMMPfam hit to PF07155, DUF1393, score 4.2e-120"
FT                   /inference="protein motif:HMMPfam:PF07155"
FT   misc_feature    join(385930..385998,386035..386094,386122..386175,
FT                   386224..386292,386335..386403)
FT                   /locus_tag="SSUSC84_0348"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0348 by TMHMM2.0 at aa 10-32, 45-64, 74-91, 108-130
FT                   and 145-167"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        386556..387476
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0349"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0363"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51127"
FT                   /protein_id="CAZ51127.1"
FT                   /translation="MVWTEEKLGPIIHSILNPDEEVLSLYQSKTTKSIYGCILWNNYYY
FT                   KVFRVSNHPSQSTYKQPTFYDFHGEFYMKGAIRTYLYHTNSWYELSKQGYYLLLFFQKL
FT                   WDEKQEVEASWQNGRMQIRLVVEEEGWQVHYRFPDNQAREVERLLGSGMLVAIRSSRNF
FT                   IKIRTSRFVAPYIALIKQRQLYRKKPSKAMLQWEKYQSQLIEIQRTYRLVEESAPQTFF
FT                   GHWLNKVQLYLCSAIASYWEEVIKGVEWQEAREIKEQRKAEKPHNPIEDKWKENIARRH
FT                   KRKMDQLIGHDTLEKLRQLKTELDD"
FT   CDS_pept        387689..388672
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0364"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51128"
FT                   /protein_id="CAZ51128.1"
FT                   /translation="MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADEG
FT                   INGTVSGDYETTQKYMDYVHANPLFSDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVR
FT                   GELWDGKMYVFDERIAVDVNHVNPVVVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   HKYVRGCSAECRAHERNRYISENGLTRQEWAERLEAIGETLTPANA"
FT   misc_feature    388049..388342
FT                   /locus_tag="SSUSC84_0350"
FT                   /note="HMMPfam hit to PF00581, Rhodanese, score 6.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00581"
FT   repeat_region   complement(388812..388910)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        join(388897..388926,388930..389241)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0351"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0365"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   10, and lacks a translational start codon. Similar to
FT                   Staphylococcus aureus (strain Mu50/ATCC 700699)
FT                   hypothetical protein UniProt:Q99R63 (EMBL:BA000017) (125
FT                   aa) fasta scores: E()=3.4e-06, 34.513% id in 113 aa"
FT   CDS_pept        389359..391032
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0352"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0366"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51130"
FT                   /protein_id="CAZ51130.1"
FT                   /translation="MKKIIEFKDFTFKYQAQQEPTLKDIQLTIYQGEKVLIIGPSGSGK
FT                   STIGQCLNGIIPNIYKGEHSGSLLLDGQEAFNLSVYDKSLLVSTVLQDTDGQFIGLSVA
FT                   EDLAFALENDMESQVVMKQKVGDWAERLSLTDLLAHRPQDLSGGQKQRVSLGGVLIDES
FT                   PILLFDEPLANLDPKSGQDTIDLIDRLHKQEGTTTIIIEHRLEDVLYRQVDRVVLINDG
FT                   RILFNGGPDDLLRTSLLQENGIREPLYLSTLRALGYPIAQAERLSSVWEIDIEALNIAS
FT                   LPTLHFENGEKEALLEVKHLYFSYPNKQVLTDIQLTIHKGERLAIVGKNGAGKSTLAKV
FT                   LCGFIQGEGEILWKGQSIKEDSVKERAERIGYVLQNPNQMISQTMIFDEVALGLRMRGV
FT                   TEEEIEHRVHHILKVCGLYPFRNWPISALSYGQKKRVTIASILVLNPEIILLDEPTAGQ
FT                   DQRHYREMMEFLDQLNAQGHTIVMITHDMQLMLDYSDRAVVVVDGQIIEDASPAEILSD
FT                   DTVIERANLKETSIFHLAERVGVNPLELTTFYMQEERRGR"
FT   misc_feature    389452..390024
FT                   /locus_tag="SSUSC84_0352"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 2.4e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    389791..389835
FT                   /locus_tag="SSUSC84_0352"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    390319..390867
FT                   /locus_tag="SSUSC84_0352"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 3.5e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    390640..390684
FT                   /locus_tag="SSUSC84_0352"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    390889..390963
FT                   /locus_tag="SSUSC84_0352"
FT                   /note="ScanRegExp hit to PS00963, RIBOSOMAL_S2_2, score NA"
FT                   /inference="protein motif:Prosite:PS00963"
FT   CDS_pept        391029..391862
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0353"
FT                   /product="putative transport protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0367"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51131"
FT                   /protein_id="CAZ51131.1"
FT                   /translation="MSQQKLIGYHPGTGLIHSLSAVSKLLFFLIVSILAMITYDTRLIL
FT                   FIAVFSLALFKMSGIRYKEISLVLILTIIFAAMNALMVHLFAPRYGVELYGADTPLLSG
FT                   LGVYSLTSQQAFYLVNLLLKYFCTVPLAIIFLMTTHPSQFASSLNQIGVSYKVAYAVSL
FT                   TMRYIPDIQEEFYTIRMSQEARGLELSKKGKLMDRIKGNLSLVIPLIFSSLERIDTIST
FT                   AMELRRFGKNKKRTWYTQQPLQRIDYAVLLFILALVVVTIYLFFVNQGRFYNPWR"
FT   misc_feature    391062..391742
FT                   /locus_tag="SSUSC84_0353"
FT                   /note="HMMPfam hit to PF02361, CbiQ, score 2.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   misc_feature    join(391071..391139,391221..391289,391371..391439,
FT                   391770..391829)
FT                   /locus_tag="SSUSC84_0353"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0353 by TMHMM2.0 at aa 15-37, 65-87, 115-137 and
FT                   248-267"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        392022..392225
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0354"
FT                   /product="cold shock protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0368"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51132"
FT                   /protein_id="CAZ51132.1"
FT                   /translation="MVQGTVKWFNAEKGFGFIAQENGPDVFAHFSEIQSNGFKSLEDGQ
FT                   KVTFEVEQGQRGLQATNITKIG"
FT   misc_feature    392022..392219
FT                   /locus_tag="SSUSC84_0354"
FT                   /note="HMMPfam hit to PF00313, CSD, score 1.5e-40"
FT                   /inference="protein motif:HMMPfam:PF00313"
FT   misc_feature    392064..392120
FT                   /locus_tag="SSUSC84_0354"
FT                   /note="ScanRegExp hit to PS00352, COLD_SHOCK, score NA"
FT                   /inference="protein motif:Prosite:PS00352"
FT   CDS_pept        complement(392267..392980)
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SSUSC84_0355"
FT                   /product="methyltransferase GidB"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0369"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51133"
FT                   /protein_id="CAZ51133.1"
FT                   /translation="MKPEVFYKTLADQGIQLTDQQKHQFHRYFQLLVEWNEKINLTAIT
FT                   EESEVYLKHFYDSIAPLLQGHIQNEPLRLLDIGAGAGFPSLPMKIIFPQLDVTIIDSLN
FT                   KRINFLHLLAEELELEGVHFYHGRAEDFAQDKNFRAQFDLVTARAVARMQILSELTIPY
FT                   LKLHGKLIALKASSAEDELTQAKNALNLLFAKVIENHDYTLPNGDPRTLTIVEKKKETP
FT                   NKFPRKAGMPNKRPL"
FT   misc_feature    complement(392345..392920)
FT                   /gene="gidB"
FT                   /locus_tag="SSUSC84_0355"
FT                   /note="HMMPfam hit to PF02527, GidB, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF02527"
FT   CDS_pept        complement(393039..395225)
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUSC84_0356"
FT                   /product="putative penicillin-binding protein 1A"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0370"
FT                   /note="Possible alternative translational start site after
FT                   codons 1 and 4"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51134"
FT                   /protein_id="CAZ51134.1"
FT                   /translation="MVNLLKTTTIKKALLITANILLAGAIIACLAGAALVVYYIQSAPE
FT                   LTEESLTATVSSKIYDKNGNLIADLGAEKRSSAKTEEIPTDLVNAIVAIEDQRFFNHRG
FT                   VDVIRIAGSLINNLSGGRLQGGSTLDQQFIKLTYFSTSVEDQNLKRKIQEAWLATQLER
FT                   RNTKQEILTYYINKVYMSNGNYGMKTAALAFYGKELKDLTLPQLALLAGMPQAPNQYDP
FT                   YTNPEDAKARRDLVLAEMLEEKYIDNTQYEQAVLTPVTDGLQPLSNAAAYPAYMDNYLK
FT                   QVVEEVEAKTGYNLLTTGMDVYTNVDPAAQQQLWNIYNTDMYVSYPDDLLQVASTVVDV
FT                   SNGKVVAQLGGRKQETNVSFGTNQAVETNRDFGSTMKPITDYAPAFENGIYTSTADLIL
FT                   DGPYNYPGTPTPVNNWDKQYYGNISVKTAIQYSRNVTAVKALEATGLENALKFLNSVGI
FT                   NYPDIHYSNAISSNTSDTSSKYGASSEKMAAAYAAFANGGTYYAPQYVNKIVFSDGTVT
FT                   EYAPKGTKVMSAETAYMMTDMMKAVMSYGYGLNASVSGVPMAGKTGTSNYTDSETDTIL
FT                   ASIPEANYSYMVVPDENFVGYSSQYAMAVWTGYTNRMTPILDNSMRIATDVYHNMMLFM
FT                   HSDYTATDWEMPSGLVRYGSNYYLRGSRSLSNAYNTYTSSSTSSSSSTETSETTEATTT
FT                   SSETSSGTATETATSSTETATTGNNPATGQTDGQ"
FT   misc_feature    complement(393534..394229)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUSC84_0356"
FT                   /note="HMMPfam hit to PF00905, Transpeptidase, score
FT                   8.5e-28"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(394548..395057)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUSC84_0356"
FT                   /note="HMMPfam hit to PF00912, Transgly, score 1.2e-80"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    complement(395121..395189)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUSC84_0356"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0356 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(395127..395225)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUSC84_0356"
FT                   /note="Signal peptide predicted for SSUSC84_0356 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.978 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(395194..395811)
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SSUSC84_0357"
FT                   /product="putative recombination protein U homologue"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0371"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51135"
FT                   /protein_id="CAZ51135.1"
FT                   /translation="MVNYPHKVSKKINRTSPISSQRVNFANRGMSFEAAINDSNQYYLA
FT                   HDIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVFKRHYIDFEAKETRQ
FT                   KASMPMKNFHAHQIEHMKQVVKQGGICFVLLHFSTLKETYLLPATHLIEFYQVDMGSKS
FT                   MPLTFIRQYGFEIQMGRFPSIPYLEIVEKNLLGGESFENYNN"
FT   misc_feature    complement(395233..395733)
FT                   /gene="recU"
FT                   /locus_tag="SSUSC84_0357"
FT                   /note="HMMPfam hit to PF03838, RecU, score 7.4e-112"
FT                   /inference="protein motif:HMMPfam:PF03838"
FT   CDS_pept        395877..396416
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0372"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51136"
FT                   /protein_id="CAZ51136.1"
FT                   /translation="MDTKSLLVTGYRHTDLGIFSEKDPRLHIIKSAIRRNFIRFLEEGV
FT                   SWFILTGQLGFEYWSLEVLEDLRAEGYQLSIATIFPFENHGEQWNEANQAKLARFKQVD
FT                   FVKYAYPRYENPGQFRDYNQFLLDNTTGCYLFYDSENETNLKYLYHMVLKKEGYNRKTL
FT                   TFEELNEEAENFSNSE"
FT   misc_feature    395877..396398
FT                   /locus_tag="SSUSC84_0358"
FT                   /note="HMMPfam hit to PF06908, DUF1273, score 6.3e-99"
FT                   /inference="protein motif:HMMPfam:PF06908"
FT   CDS_pept        396487..396822
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0359"
FT                   /product="DivIVA protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0373"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51137"
FT                   /protein_id="CAZ51137.1"
FT                   /translation="MASIKFTTKDIFEQDFKIGFRGYDQDEVNDFLDDIMKDYDAYEAI
FT                   IKELKGEIARLKAQAANSPKTTLPTEESNDVLRTERPSSATNFDILRRLNRLEKEVFGK
FT                   QIVQDQE"
FT   misc_feature    396487..396819
FT                   /locus_tag="SSUSC84_0359"
FT                   /note="HMMPfam hit to PF05103, DivIVA, score 2.2e-16"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        396961..397328
FT                   /locus_tag="SSUSC84_m0002"
FT                   /note="RNase P class B (RF00011) as predicted by Rfam,
FT                   score 350.89"
FT   CDS_pept        397379..398545
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0360"
FT                   /product="putative RNA methylase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0374"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51138"
FT                   /protein_id="CAZ51138.1"
FT                   /translation="MKKQFELIATAAAGLEAVVGREIRNLGYECQVENGRVRFQGDVKS
FT                   IIETNIWLRSADRIKIIVGQFPAKTFEELFQGVFNLDWENYLPLGCKFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHFSRPEGVPLQEMGAEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRVEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAAMLAKNIAPG
FT                   LKRSFAFEEWPWVEDQLVVALRKEAQASIKTDLVLDITGSDIDARMIEIAKKNAFAAGV
FT                   EQDIVFKQMRVQDLRTDKINGVIISNPPYGERLLDDEAIVTLYREMGETFEPLKTWSKF
FT                   ILTSDELFETRFGQQADKKRKLYNGTLKVDLYQFFGQRVKRQVQEVQG"
FT   misc_feature    397877..398497
FT                   /locus_tag="SSUSC84_0360"
FT                   /note="HMMPfam hit to PF01170, UPF0020, score 3.1e-65"
FT                   /inference="protein motif:HMMPfam:PF01170"
FT   misc_feature    398288..398308
FT                   /locus_tag="SSUSC84_0360"
FT                   /note="ScanRegExp hit to PS00092, N6_MTASE, score NA"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        398555..400009
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0361"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0375"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51139"
FT                   /protein_id="CAZ51139.1"
FT                   /translation="MGEKNSHHLPLDEEKVLDFEVAKDLTIEEAVKKHKEIEAGVTEDD
FT                   GLLDRYIKQHRAEIESQKFETKINHLPLVEVADEEKNQGHESAEEVEANESSLTEVSEE
FT                   IAPIVEELSVTPMETLEETVIASTVAMEGLSSVADDSSLELEEDETEDLDHSEGADRDQ
FT                   KKKFYFWSAVGLSMIGVMATALVWMNSVNKSNTATSSSSTSTSQTSSTASSSTDANVTA
FT                   FEQLYNSFFTDSSLTKLKNSEFGKLAELKVLLEKLDKNSDSYTKAKEQYDHLEKAIAAI
FT                   QAINGQFDKEVVVNGEIDTTATVKSGESLSATTTGISAVDSLLASVVNFGRSQQEVASA
FT                   TVASEAAVTRNQGADETVSTGVPATTEVASTTVSGSTTDFGIAVPAGVVLQRDRSRVPY
FT                   NQAMIDDVNNEAWNFNPGILENIVTISQQRGYITGNQYILEKVNIINGNGYYNMFKPDG
FT                   TYLFSINCKTGYFVGNGAGHSDALDY"
FT   misc_feature    399053..399121
FT                   /locus_tag="SSUSC84_0361"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0361 by TMHMM2.0 at aa 167-189"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(400392..400874)
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SSUSC84_0362"
FT                   /product="S-ribosylhomocysteinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0376"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51140"
FT                   /protein_id="CAZ51140.1"
FT                   /translation="MKKEVTVESFELDHTIVKAPYIRLISEEVGPKGDIITNFDIRLIQ
FT                   PNENAMDTAGLHTIEHLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDSEKIAQVIK
FT                   SSLEEIAEGITWEDVPGTTIESCGNYKDHSLHSAKEWAKLILSQGISTDAFERKPI"
FT   misc_feature    complement(400425..400862)
FT                   /gene="luxS"
FT                   /locus_tag="SSUSC84_0362"
FT                   /note="HMMPfam hit to PF02664, LuxS, score 1.6e-50"
FT                   /inference="protein motif:HMMPfam:PF02664"
FT   CDS_pept        401004..402617
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0363"
FT                   /product="putative phosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0377"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51141"
FT                   /protein_id="CAZ51141.1"
FT                   /translation="MNIITVVVTLVSALIGLVLGYFAISLKMKSAKETAELTLLNAEQE
FT                   ASNVRGRAEEQAEVILKTAERDRQTLKKELLLEAKEEARKYREEIAEEFKSERQELKQI
FT                   ESRLTERATSLDRKDDNLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKALELER
FT                   VAALSQEEAKEIILTDTRDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRISGEY
FT                   VAEQTITSVHLPDDAMKGRIIGREGRNIRTFESLTGIDVIIDDTPEVVVLSGFDPIRRE
FT                   IARMTMETLLQDGRIHPARIEELVEKHRVEMDNRIREYGEAAAYEVGAPNLHPDLIKIM
FT                   GRLHFRTSYGQNVLRHSIEVAKLAGVLAAELGENVNLARRAGFLHDVGKAIDREVDGSH
FT                   VEIGTELAKKYKENPIVINAIASHHGDVEATSTIAVIVAAADALSAARPGSRRESMEAY
FT                   IKRLQDLEEIANSFEGIKQSYAIQAGREIRIIVHPNKVTDDQITILAHDVREKIENNLD
FT                   YPGNIKITVIRETRATDVAK"
FT   misc_feature    401007..401075
FT                   /locus_tag="SSUSC84_0363"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0363 by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    401685..401864
FT                   /locus_tag="SSUSC84_0363"
FT                   /note="HMMPfam hit to PF00013, KH_1, score 1.1e-08"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   misc_feature    402060..402341
FT                   /locus_tag="SSUSC84_0363"
FT                   /note="HMMPfam hit to PF01966, HD, score 1.4e-25"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        402772..403398
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SSUSC84_0364"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0378"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51142"
FT                   /protein_id="CAZ51142.1"
FT                   /translation="MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQR
FT                   PGEVDGVDYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIE
FT                   VQGALQVKKKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREY
FT                   DYAVVNDEVPLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER"
FT   misc_feature    402889..402942
FT                   /gene="gmk"
FT                   /locus_tag="SSUSC84_0364"
FT                   /note="ScanRegExp hit to PS00856, GUANYLATE_KINASE_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00856"
FT   misc_feature    402892..403206
FT                   /gene="gmk"
FT                   /locus_tag="SSUSC84_0364"
FT                   /note="HMMPfam hit to PF00625, Guanylate_kin, score
FT                   1.2e-47"
FT                   /inference="protein motif:HMMPfam:PF00625"
FT   CDS_pept        403425..403736
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="SSUSC84_0365"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0379"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51143"
FT                   /protein_id="CAZ51143.1"
FT                   /translation="MLKPSIDTLLDKVPSKYSLVILEAKRAHELEAGAKPTQEFTSVKS
FT                   TLRALEEIESGNVVIHPDPEAKREAVRRRAEEAKRLAEEEERKIKAQIAKEKEEGEKI"
FT   misc_feature    403458..403616
FT                   /gene="rpoZ"
FT                   /locus_tag="SSUSC84_0365"
FT                   /note="HMMPfam hit to PF01192, RNA_pol_Rpb6, score 2.7e-16"
FT                   /inference="protein motif:HMMPfam:PF01192"
FT   CDS_pept        403929..406319
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SSUSC84_0366"
FT                   /product="putative primosomal protein N'"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0380"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51144"
FT                   /protein_id="CAZ51144.1"
FT                   /translation="MLAQIIVDVPLMQTDQAYSYRVPAELEEGLKVGVRVHVPFGKGNR
FT                   LIQGIVVDLIDEDDENSLQDLKELAEVLDYSPVLNQEQFWLADQMRKSVFSYKITLLKS
FT                   MLPSLLNSTYDKLIRPGIGLEMAEQISLFGDKEQIRFSDLDVTEQGKIMRLAQSGKILV
FT                   DYVAKDKKQIKTEKWYRVCLEKLREADISNRAKKRQQLREFLLEQSEDQLLSNLKSDYS
FT                   ADTLRYFQEKGYIEVWEEEVSRTQGVFDKVEKTQALDLNPEQAIAVREIVASIGQESQT
FT                   FLLQGVTGSGKTEVYLQVIDRVLKMGKTAIMLVPEISLTPQMTNRFISRFGQQVAILHS
FT                   GLSDGEKYDEWRKIEAGNAQVVVGARSAIFAPLTNLGVIIIDEEHEATYKQDSNPRYHA
FT                   RDVAKLRADYNRATLVLGSATPSLETRARASRGVYGRLTLNQRANPLARIPEVEVVDFR
FT                   DYIGQQEASNFTPVLIEKIREKLARKEQVVLMLNRRGYSSFVMCRDCGSVDQCPNCDIS
FT                   LTLHMDTKTMNCHYCGFQKGIPQTCPNCQSRSIRYYGTGTQKAYDELQELLPEARILRM
FT                   DVDTTKKKGAHEDLLERFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFR
FT                   SSERTFQLLTQVAGRAGRADKEGEVLIQTYNPNHYAIAFAKEQDYEGFYRYEMDIRKNL
FT                   GYPPYYFTVGLTFSHKSEEFVVKKAYETVAFLRQHLTDAIQILGPTPKPIARTHNLYHY
FT                   QIILKYRHEDRLEEVLNQILDWTQERENQDLRLIIDNEPQNMM"
FT   misc_feature    404697..405197
FT                   /gene="priA"
FT                   /locus_tag="SSUSC84_0366"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    404703..404741
FT                   /gene="priA"
FT                   /locus_tag="SSUSC84_0366"
FT                   /note="ScanRegExp hit to PS00018, EF_HAND_1, score NA"
FT                   /inference="protein motif:Prosite:PS00018"
FT   misc_feature    405690..405893
FT                   /gene="priA"
FT                   /locus_tag="SSUSC84_0366"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 7.2e-10"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        406451..407389
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SSUSC84_0367"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0381"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51145"
FT                   /protein_id="CAZ51145.1"
FT                   /translation="MTKLIFMGTPAFSATVLRGLLADGNYNILAVVTQPDRAVGRKKVI
FT                   QMTPVKEVALEYNLPVYQPEKLSGSQEMDELMNLGADGIVTAAFGQFLPTKLLNSVDFA
FT                   VNVHASLLPKYRGGAPIHYALINGDERAGVTIMEMVKEMDAGDMISSDSIAIEESDNVG
FT                   TLFEKLAVVGRDLLLQTLPAYIAGDLKPVAQNPEQVTFSPNIQPEEEVLDWNKTARQLF
FT                   NQIRGMYPWPVAHTYWQGERFKIQEAVEAEGEGSVGRVIARSKKELIIATGQGALSLKT
FT                   VQPAGKPKMTIADFLNGAGRDIAVGDQFGDQ"
FT   misc_feature    406454..406993
FT                   /gene="fmt"
FT                   /locus_tag="SSUSC84_0367"
FT                   /note="HMMPfam hit to PF00551, Formyl_trans_N, score
FT                   7.1e-38"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   misc_feature    406847..406918
FT                   /gene="fmt"
FT                   /locus_tag="SSUSC84_0367"
FT                   /note="ScanRegExp hit to PS00373, GART, score NA"
FT                   /inference="protein motif:Prosite:PS00373"
FT   misc_feature    407066..407350
FT                   /gene="fmt"
FT                   /locus_tag="SSUSC84_0367"
FT                   /note="HMMPfam hit to PF02911, Formyl_trans_C, score
FT                   2.7e-34"
FT                   /inference="protein motif:HMMPfam:PF02911"
FT   CDS_pept        407376..408689
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0368"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0382"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51146"
FT                   /protein_id="CAZ51146.1"
FT                   /translation="MVINKHETARSLALSVLEQVFDQGAYSNIALNKALESSRLSAQDK
FT                   GLATELVYGTVSRKITLEWYLAHFIEDREKLDTWVYYLLMLSLYQLVYLDKLPTHAVVN
FT                   EAVNIAKRKPGTDKFVNAILRKLSQDSLPKPADIKRKNKRLSVQYSVPVWLVQTLIAEY
FT                   GDERAEKIFQSLHDRNKASVRVTDGQQVERLAEELGAQHSQLSPVGLVKPHGHFAGTDY
FT                   FKEGLITIQDETSQLVAPTLDIQGDEIILDACAAPGGKTCHMASYLTDGKVYALDLYDH
FT                   KLNLIEENARRLGLADKIETKGLDASRVHEEFGPDTFDKILVDAPCSGIGLIRRKPDIR
FT                   YNKASMDFDSLKTIQLQILDSVCQSLKIGGIITYSTCTIIAKENQEVIQEFLQNHPNFE
FT                   QVTLEHPQTDIMVDGCLLITPEQYKTDGFFIGQLRRKS"
FT   misc_feature    407394..407768
FT                   /locus_tag="SSUSC84_0368"
FT                   /note="HMMPfam hit to PF01029, NusB, score 4.1e-35"
FT                   /inference="protein motif:HMMPfam:PF01029"
FT   misc_feature    408042..408677
FT                   /locus_tag="SSUSC84_0368"
FT                   /note="HMMPfam hit to PF01189, Nol1_Nop2_Fmu, score
FT                   2.3e-49"
FT                   /inference="protein motif:HMMPfam:PF01189"
FT   misc_feature    408327..408362
FT                   /locus_tag="SSUSC84_0368"
FT                   /note="ScanRegExp hit to PS01153, NOL1_NOP2_SUN, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01153"
FT   CDS_pept        408727..409464
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0369"
FT                   /product="putative protein phosphatase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0383"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51147"
FT                   /protein_id="CAZ51147.1"
FT                   /translation="MEIALLTDVGQKRSNNQDYINRYKNRAGIDLVVLADGMGGHRAGH
FT                   IASEMAATDLGAAWVDTQLVTLNDVREWMVAIIDAENQKIHELGQTEEYKGMGTTLEAV
FT                   VVIDNQMIYAHVGDSRVGLIRDGEYTRLTNDHSLVGALVRAGQLTEEEAQRHPQKNIVT
FT                   QSIGQAEPIEPDIALKTLEVGDYVLINSDGLTNMIPTEDIRDIVLSDVSIESKVETLVR
FT                   FANNAGGLDNITVGLLHITEEAR"
FT   misc_feature    408730..409425
FT                   /locus_tag="SSUSC84_0369"
FT                   /note="HMMPfam hit to PF00481, PP2C, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00481"
FT   CDS_pept        409464..411458
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0370"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0384"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51148"
FT                   /protein_id="CAZ51148.1"
FT                   /translation="MIQIGKIFAGRYRIVRQIGRGGMADVYLARDLILDGEEVAVKVLR
FT                   TNYQTDQIAIQRFQREARAMAELDHPNIVRISDIGEEDGQQYLAMEYVNGLDLKRYIKE
FT                   NAPLSNDVAVRIMGQILLAMRMAHTRGIVHRDLKPQNVLLTSNGVAKVTDFGIAVAFAE
FT                   TSLTQTNSMLGSVHYLSPEQARGSKATIQSDIYAMGIILFEMLTGRIPYDGDSAVTIAL
FT                   QHFQKPLPSVREENANVPQALENVVLKATAKKLNERYKSVAEMYADLASALSMDRQNEP
FT                   RVELEGNKVDTKTLPKLSQANVETKVPHTNSSAQVSATDKGSGKKEVAKSGNKPVSKPR
FT                   PGIRTRYKVLIGAILLTVIAAGLMFFNTPRTVTVPDVSGQTVEKATEMIEVAGLEVGNI
FT                   TEEATATVDEGLVIRTSPAAKTTRRQGSKIDIVVATAALASIPDVVDKESDTARQELEA
FT                   LGFQVTIKEEYSEKVAQGLVIKTDPGANSSAEKGAKITLYVSKGVAPQVVPNVVGKSQE
FT                   NATQILQTAGFSIGTITQEYSSSVTAGQVISTDPVANTELAKGSIINLVISKGKELIMP
FT                   DLTSGNYTYSQARSQLQALGVNAESIEKQEDRSYYSTTSDIVIGQYPAAGATIDGTVTL
FT                   YVSVASTRTSSDSSAGSSTSTSTSTGSGQ"
FT   misc_feature    409497..410120
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="HMMPfam hit to PF00069, Pkinase, score 2e-62"
FT                   /inference="protein motif:HMMPfam:PF00069"
FT   misc_feature    409515..409589
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="ScanRegExp hit to PS00107, PROTEIN_KINASE_ATP, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    409857..409895
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="ScanRegExp hit to PS00108, PROTEIN_KINASE_ST, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    410577..410768
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 1.7e-12"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    410778..410966
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 1.7e-15"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    410979..411170
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 6.8e-14"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    411180..411380
FT                   /locus_tag="SSUSC84_0370"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 8.2e-09"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   repeat_region   411482..411595
FT                   /note="Region similar to ISSs2"
FT   repeat_region   complement(411594..411697)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        411879..412574
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0371"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0386"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51149"
FT                   /protein_id="CAZ51149.1"
FT                   /translation="MRKVQFFLLIESMIFTMAAFDVVANEASRTLLLFSALLLVIWYFL
FT                   GRKVNSVLLVSSLSLLFLVFVLNPFFIIGIMLLVVYMLINFFSRYEKRNQYTHIVFSDY
FT                   SLQVQKEKNRWFGNHDHSQDRFGFEDINIVRLFGNDVVDLDKTVLVGRDNIVVIRKTFG
FT                   RTKIIVPIDVEVALSATSIYGRVSFLGESYWDLRNESIAVNSPDYQESHKRVKVVTNNI
FT                   LGDVEVVRV"
FT   misc_feature    join(411897..411950,411963..412016,412050..412118)
FT                   /locus_tag="SSUSC84_0371"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0371 by TMHMM2.0 at aa 7-24, 29-46 and 58-80"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        412571..413587
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0372"
FT                   /product="sensor histidine kinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0387"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51150"
FT                   /protein_id="CAZ51150.1"
FT                   /translation="MRKRTYLLLAWFACLIVFVVIASTLPLLNYSLLDVTLWISTEQLV
FT                   FTLILLVIVLTLFLAVMVQTVSLASTQVMRTKLQAILKNKSIRTDTESDQLLLQLSDKV
FT                   RNLTRQVQLVDNQDLVKKEEIVEGERKRIARDLHDTVSQELFATSMILSGLSSNLSTLP
FT                   QETLQEQLMLVKDMIESAQRDLRILLLHLRPSELESKTLVEGFELILREVSDKSNIIVH
FT                   FQHEVEELPKLIEEHLFRIAQEIISNTLRHAKAKHLDVYLLQKETELQLKMTDDGIGFQ
FT                   QGADDELSYGLQNIRERVEDMAGTIKIRTAPNKGVAIDIRIPLLKGKEDEYDSSDAG"
FT   sig_peptide     412571..412636
FT                   /locus_tag="SSUSC84_0372"
FT                   /note="Signal peptide predicted for SSUSC84_0372 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.997) with cleavage
FT                   site probability 0.983 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(412589..412657,412700..412768)
FT                   /locus_tag="SSUSC84_0372"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0372 by TMHMM2.0 at aa 7-29 and 44-66"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    412955..413161
FT                   /locus_tag="SSUSC84_0372"
FT                   /note="HMMPfam hit to PF07730, HisKA_3, score 1.2e-20"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   misc_feature    413267..413545
FT                   /locus_tag="SSUSC84_0372"
FT                   /note="HMMPfam hit to PF02518, HATPase_c, score 1.3e-15"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        413559..414200
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0373"
FT                   /product="response regulator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0388"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51151"
FT                   /protein_id="CAZ51151.1"
FT                   /translation="MNTIRVMLVDDHEMVRLGLKSYLNLQPDVEVVAEASDGEEGLAKA
FT                   LEVKPDVVVMDLVMPKMTGVEATLALLKEWPQAQIVILTSYLDNEKIYPVLEAGARGYM
FT                   LKTSSADEILAAIRKVALGEYAIETEVEKKVEHHKRHPDLHDDLTAREREILTLLAKGY
FT                   DNQRIADESFISLKTVKTHVSNILSKLAVSDRTQAVVYAFQHGLVAQEDQ"
FT   misc_feature    413568..413912
FT                   /locus_tag="SSUSC84_0373"
FT                   /note="HMMPfam hit to PF00072, Response_reg, score 7.8e-34"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    413991..414164
FT                   /locus_tag="SSUSC84_0373"
FT                   /note="HMMPfam hit to PF00196, GerE, score 5.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   CDS_pept        414250..415650
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0374"
FT                   /product="cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0389"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51152"
FT                   /protein_id="CAZ51152.1"
FT                   /translation="MDAKLRYKAKKIKIVFFDIDDTLRVKNTGYIPESIQQVFKSLKEK
FT                   GILTGIASGRTPYGLVPEIKALKPDFFAMINGSYVEDAKGQVVYHQPMPQNLVESVLNW
FT                   AKEIGIEYGMLSSQKGTLSARTDRISQVIDLIYEGLETKPTFYKENDIYQLLTFEKDGH
FT                   EVELPEELQAELRSVRWDAISSDIVLKGSSKATGVAKVVEKLGLKPENVLVFGDGLNDI
FT                   ELFDYAGISIAMGHSHPELQKHADYITKKVEEDGIFDALEKLGMVEKEKYFPQLDLENV
FT                   TGPVAHIKTNHGKLTVKLFPEIAPKTVANFVALSKDGYYDGIIFHRIIKDFMIQGGDPT
FT                   GTGMGGESIYGTAFEDEFSMEAFNLRGALSMANAGPNTNGSQFFIVQNQNFPYNAKELE
FT                   RGGWPKEVAEAYVKNGGTPYLDQRHTVFGHLVDEESFVVLDAIAAVATDSADCPHEDVV
FT                   IETIEIED"
FT   misc_feature    414292..415032
FT                   /locus_tag="SSUSC84_0374"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 5.5e-71"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    414892..414960
FT                   /locus_tag="SSUSC84_0374"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score NA"
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    415102..415641
FT                   /locus_tag="SSUSC84_0374"
FT                   /note="HMMPfam hit to PF00160, Pro_isomerase, score
FT                   1.8e-52"
FT                   /inference="protein motif:HMMPfam:PF00160"
FT   CDS_pept        415652..416023
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0375"
FT                   /product="putative S1 RNA binding domain protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0390"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51153"
FT                   /protein_id="CAZ51153.1"
FT                   /translation="MKIGDKLKGTVTGIQPYGAFVQLENGTTGLIHISEIKTGFVDNIY
FT                   DHLKLGQEVLVQVVDFDEYTEKASLSIRTLEEEQQKIPCHHRFTNERNKIGFSPLAKQL
FT                   PKWIEEAKGYLKEHKEKKV"
FT   misc_feature    415655..415870
FT                   /locus_tag="SSUSC84_0375"
FT                   /note="HMMPfam hit to PF00575, S1, score 1.5e-19"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS_pept        complement(416049..416975)
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="SSUSC84_0376"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0391"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51154"
FT                   /protein_id="CAZ51154.1"
FT                   /translation="MAIYQNITQLVGKTPVIKLNNIVPEGAAEVYVKLEAFNPGSSVKD
FT                   RIALAMIEDAEKAGTIKPGDTIVEPTSGNTGIGLAWVGAAKGYNVIIVMPETMSVERRK
FT                   IIQAYGAELVLTPGSEGMKGAIAKAKEIAEEKNGWVPFQFANPSNPKVHEDTTGQEILE
FT                   DFGTTGLDAFVSGVGTGGTVSGVSHVLKTANPDIAIYAVEADESAVLSGEAPGPHKIQG
FT                   ISAGFIPDTLDTSAYDGIIRVKSDDALATGRAIGGKEGFLVGISSGAAIHAAIEVAKEL
FT                   GTGKKVLAILPDNGERYLSTALYEFND"
FT   misc_feature    complement(416094..416957)
FT                   /gene="cysM"
FT                   /locus_tag="SSUSC84_0376"
FT                   /note="HMMPfam hit to PF00291, PALP, score 6.5e-115"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    complement(416823..416879)
FT                   /gene="cysM"
FT                   /locus_tag="SSUSC84_0376"
FT                   /note="ScanRegExp hit to PS00901, CYS_SYNTHASE, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00901"
FT   CDS_pept        complement(417065..417703)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0392"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51155"
FT                   /protein_id="CAZ51155.1"
FT                   /translation="MVMKEFKTIREDGIVEEEIKKSRFICFMKRVTSEEEARDFINKIK
FT                   KEHYKATHNCSAFVLGENMEIKRSSDDGEPSGTAGVPMLTVLENHELTNVATVVTRYFG
FT                   GIKLGAGGLIRAYAGAVANAVKEIGVVEVKEQEGISLSMSYAQYQEFANWRAEQGLEEF
FT                   DTQFTTEVSTMIFVDKEFLEQTLASLTDFYHGKVSTEKANSRIVEVPVY"
FT   misc_feature    complement(417326..417649)
FT                   /locus_tag="SSUSC84_0377"
FT                   /note="HMMPfam hit to PF01205, UPF0029, score 2.8e-60"
FT                   /inference="protein motif:HMMPfam:PF01205"
FT   misc_feature    complement(417377..417466)
FT                   /locus_tag="SSUSC84_0377"
FT                   /note="ScanRegExp hit to PS00910, UPF0029, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00910"
FT   CDS_pept        417754..419046
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="SSUSC84_0378"
FT                   /product="putative late competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0393"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51156"
FT                   /protein_id="CAZ51156.1"
FT                   /translation="MKELENYYGRLFTKYQLTAKEREIAEKVPSITKKNNCFRCGTTFE
FT                   EENKLPNDAYYCRACLLLGRVRSDEKLYHFPQKDFPITKCLKWKGQLTDWQQRISDGLV
FT                   ANVENNRATLVHAVTGAGKTEMIYHTVASVIDKGGAVCLASPRIDVCIELYKRLQNDFS
FT                   VPISLLHGESEPYFRTPLVVATTHQLLKFYQAFDLVLIDEVDAFPYADNPMLYRAADNA
FT                   VKEAGVQVFLTATSTDELDKKVRTGKLSRLSLPRRFHGNPLVVPQKVWFSKFDDTLKKN
FT                   RLVPKLKKAIEEQRKSCFPLLIFVPEISKGQEFTKIMKKTFPEETIGFVSSQTENRLEI
FT                   VEGFRKREITVLISTTILERGVTFPCVDVFVVQANHYLYTVSSLVQIAGRVGRSMERPT
FT                   GLLQFYHEGSTGAIEKAVAEIKQMNKEAGYV"
FT   misc_feature    418018..418467
FT                   /gene="comFA"
FT                   /locus_tag="SSUSC84_0378"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 1.9e-05"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    418708..418938
FT                   /gene="comFA"
FT                   /locus_tag="SSUSC84_0378"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 8.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        419039..419704
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="SSUSC84_0379"
FT                   /product="putative late competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0394"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51157"
FT                   /protein_id="CAZ51157.1"
FT                   /translation="MSNCLLCGQAMKNKTRFSDLIFFSKEKSGICEECFSTFEEIAEQH
FT                   CPHCYKNGESESCKDCQYWQNQGKPVVHTALYQYNQAMAHYFSRYKFQGDYVLRNIFAK
FT                   KLRIALSQFPDYTIVPIPISQKRLSERGFNQVEGLLDATNIPYQSLLGKYESQKQSSKN
FT                   RAERLEAKQMFYLLDEKEVPEKILLFDDIYTTGATIQLAVELFMKIGRKEIKTFSLTR"
FT   CDS_pept        419781..420323
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0380"
FT                   /product="sigma 54 modulation protein / S30EA ribosomal
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0395"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51158"
FT                   /protein_id="CAZ51158.1"
FT                   /translation="MIKFSIRGENLEVTEALRTYVEEKVAKIEKYFNEEQELNAKVNLK
FT                   VYRDKRAKVEVTIPVGAVTLRAEDISQEMYGSIDLVVDKIERQIRRNKTKIERKHRQKV
FT                   ATGQVFTDELVEQTGEEVKVVRTKQVDLKPMDMEEAVLQLELLGHDFFIYTDANDGTTN
FT                   VLYRREDGDLGLLEVRQ"
FT   misc_feature    419787..420077
FT                   /locus_tag="SSUSC84_0380"
FT                   /note="HMMPfam hit to PF02482, Ribosomal_S30AE, score
FT                   1.8e-30"
FT                   /inference="protein motif:HMMPfam:PF02482"
FT   rRNA            420661..422204
FT                   /locus_tag="SSUSC84_r0010"
FT                   /note="16S rRNA"
FT   tRNA            422256..422328
FT                   /locus_tag="SSUSC84_t0035"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:422289..422291,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            422608..425512
FT                   /locus_tag="SSUSC84_r0011"
FT                   /note="23S rRNA"
FT   rRNA            425590..425718
FT                   /locus_tag="SSUSC84_r0012"
FT                   /note="5S rRNA"
FT   tRNA            425719..425791
FT                   /locus_tag="SSUSC84_t0036"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:425752..425754,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            425794..425866
FT                   /locus_tag="SSUSC84_t0037"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:425827..425829,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            425912..425984
FT                   /locus_tag="SSUSC84_t0038"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:425945..425947,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.85"
FT   tRNA            425988..426069
FT                   /locus_tag="SSUSC84_t0039"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:426022..426024,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 45.48"
FT   tRNA            426084..426156
FT                   /locus_tag="SSUSC84_t0040"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:426117..426119,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            426169..426240
FT                   /locus_tag="SSUSC84_t0041"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:426201..426203,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            426248..426331
FT                   /locus_tag="SSUSC84_t0042"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:426282..426284,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 51.48"
FT   tRNA            426350..426423
FT                   /locus_tag="SSUSC84_t0043"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:426384..426386,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 72.48"
FT   tRNA            426471..426544
FT                   /locus_tag="SSUSC84_t0044"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:426505..426507,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   CDS_pept        complement(427102..428454)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0381"
FT                   /product="putative RNA methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0396"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51159"
FT                   /protein_id="CAZ51159.1"
FT                   /translation="MNLQVNQRIPLKIKRMGINGEGIGFYQKTLVFVPGVLKGEEIFCQ
FT                   ITSVKRNFVEAKLLKINKESKFRVKPACDIYRACGGCQIMHLRYDKQLDFKQDLLQQAL
FT                   KKFKPAGYENYTIYPTIGMDKPSHYRAKLQFQTRSFKDQVKAGLYAENSHRLIGITNCY
FT                   VQDAETQEIINGIAKLLTKHRIPIYNERKQHGIRTVMVRKARKTGQVQVIFITSCQVNL
FT                   IKLIDELTSQFPSIITIALNWNRQKTSDIYGEKTEILWGEQAIDEAVLDYEFSLSPRAF
FT                   YQLNPQQTEILYGEAVKALDISGDEDLIDAYCGVGTIGFAFAKKVKSVRGMDIIPEAIE
FT                   DAKANAKRMGLSNTHYEAGKAEEIIPKWYQEGYRADALVVDPPRTGLDEKLLKTILNYK
FT                   PAKMVYVSCNVSTLARDLVELSKAYKVEYIQSVDMFPHTARTEAVVKLSKK"
FT   misc_feature    complement(427105..428193)
FT                   /locus_tag="SSUSC84_0381"
FT                   /note="HMMPfam hit to PF05958, tRNA_U5-meth_tr, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF05958"
FT   misc_feature    complement(427129..427161)
FT                   /locus_tag="SSUSC84_0381"
FT                   /note="ScanRegExp hit to PS01231, TRMA_2, score NA"
FT                   /inference="protein motif:Prosite:PS01231"
FT   misc_feature    complement(427219..427314)
FT                   /locus_tag="SSUSC84_0381"
FT                   /note="ScanRegExp hit to PS01230, TRMA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01230"
FT   misc_feature    complement(428275..428451)
FT                   /locus_tag="SSUSC84_0381"
FT                   /note="HMMPfam hit to PF01938, TRAM, score 2.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01938"
FT   CDS_pept        428492..429268
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0382"
FT                   /product="RecX family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0397"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51160"
FT                   /protein_id="CAZ51160.1"
FT                   /translation="MRITKIEKKKRLYLLEVDGQDSLYITEDTIVRFMLSKGKEITEQE
FT                   FRELRDFAQFSYGKNLALYYLSFKQRTKKEVSNYLKKYEIEENNIVKIVTVLEEEKWLD
FT                   DGNYVDSYVRQNALNGDKGPAMIRQKLMQKGIPKTLIDKRLAEEDFSELAGKIGEKLVG
FT                   RYQRKLPLRALQDKVVQGLMGKGFSYEAAKQSLGQLELVADEENEDDLIAKELDKQYRK
FT                   YSRKYEGYELKQRLIQALARKGYDFDRIQAVLRDYL"
FT   misc_feature    428729..429109
FT                   /locus_tag="SSUSC84_0382"
FT                   /note="HMMPfam hit to PF02631, RecX, score 9.5e-09"
FT                   /inference="protein motif:HMMPfam:PF02631"
FT   CDS_pept        429344..429877
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0398"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51161"
FT                   /protein_id="CAZ51161.1"
FT                   /translation="MKLPKEGDFITIQSYKHDGEIHRTWRDTMVLKTTENAIIGVNNHT
FT                   LVTENDGRRWVTREPAIVYFHKKYWFNIIAMIRENGVSYYCNLASPYVLDNEALKYIDY
FT                   DLDVKVFADGEKRLLDVDEYERHRKAMKYSDDIDFILKENVKILVDWINNQRGPFSPAY
FT                   VNIWYKRYLELRSR"
FT   misc_feature    429452..429745
FT                   /locus_tag="SSUSC84_0383"
FT                   /note="HMMPfam hit to PF04167, DUF402, score 6.8e-41"
FT                   /inference="protein motif:HMMPfam:PF04167"
FT   CDS_pept        429935..430252
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0399"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51162"
FT                   /protein_id="CAZ51162.1"
FT                   /translation="MAFEQTNGRYASFGVVTSLPGEVIDSFWYVIDHYLKGVIPLKSVI
FT                   RFSIKNRRGKITLVFSQEGYKNVLAVDLSSRFDPFYPSTILVMDKQGKETITLPDEVTL
FT                   L"
FT   CDS_pept        430352..431083
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0385"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0400"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51163"
FT                   /protein_id="CAZ51163.1"
FT                   /translation="MVSQTVEKPLYLQLVDELEVAIRERMAPNDKLFSERELTQVYGVS
FT                   RITVRLALQELEKRGLVYKKHGKGTYVSEISDTAVDLSQAYSFTEQMKKIGKVPRTSIL
FT                   SFELVKASDYIAQHLQLSQGEEVFEVERLRLADEIPMMLERTYVPASVFPGLAAQRMKS
FT                   TPLYEIFSEDYHQVIRLAEEEFYASIALDNEAKILGIPSNSPVLHLVRKTYNDKNRIIE
FT                   FTFSIARADQFRYKITHQRGY"
FT   misc_feature    430379..430567
FT                   /locus_tag="SSUSC84_0385"
FT                   /note="HMMPfam hit to PF00392, GntR, score 7.5e-18"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    430448..430513
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1087.000, SD 2.89 at aa 33-54, sequence
FT                   FSERELTQVYGVSRITVRLALQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    430631..431053
FT                   /locus_tag="SSUSC84_0385"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 3.6e-51"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   repeat_region   complement(431088..431179)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(431223..431933)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0386"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0401"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51164"
FT                   /protein_id="CAZ51164.1"
FT                   /translation="MKVPKYQLIQNDLRQQIVSGKFENGDKFYTESELTKLFNVSSITV
FT                   IRAVNELVKDGYLVRQQGKGTFVSRSRKGRLVEFSDIEIFPMDKDKVTVLSCEKGNKPD
FT                   ILEKLNLDKNEFYYKIVRVRAAEDTPYIFHNSYIPQRYIQNPDAPLEHYQSIYQRFKLD
FT                   YNIHMSEEPFVETNEIVSPCPKEVATHLKLKATEPAVLQNKTTTNSTSGEVMEYTETYK
FT                   HWKYYKFEITANHR"
FT   misc_feature    complement(431250..431654)
FT                   /locus_tag="SSUSC84_0386"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 6.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   misc_feature    complement(431730..431921)
FT                   /locus_tag="SSUSC84_0386"
FT                   /note="HMMPfam hit to PF00392, GntR, score 2.2e-14"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(431778..431825)
FT                   /locus_tag="SSUSC84_0386"
FT                   /note="ScanRegExp hit to PS00012, PHOSPHOPANTETHEINE, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    complement(431784..431849)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1054.000, SD 2.78 at aa 29-50, sequence
FT                   YTESELTKLFNVSSITVIRAVN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        432140..433912
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0387"
FT                   /product="putative beta-galactosidase precursor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0402"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51165"
FT                   /protein_id="CAZ51165.1"
FT                   /translation="MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKALG
FT                   FNTVETYVPWNMHEPRKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWGGL
FT                   PAWLMKEELRVRSSDSVYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSYGEE
FT                   KAYLRAVAGLMRKHGLTAPLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENFANMT
FT                   AFFNEHQKNWPLMCMEFWDGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYMFHGGT
FT                   NFGFMNGCSARGQIDLPQVTSYDYDAILDEAGNPTKKFYILQQRLKEVYPELEYAEPLV
FT                   KEAKAFSDVSLHDKVSLFATLENVSDCVKGFYPKNMEELDQSTGYILYRTELERDKTEA
FT                   ERFRVVDARDRIQIYADGKFVATQYQTEIGDDVELDFKDDKLTLDILVENMGRVNYGHK
FT                   LTAPTQSKGIGRGAMADLHFIGHWETYPLHLESVEDLDFSKGWEEGQAAFYRYQFELDE
FT                   LADTYLDMTGFGKGVVFVNNVNIGRFWEKGPILYLYIPKGYLKKGANEIVVFETEGKYR
FT                   EKIHFSQRPVIKDL"
FT   misc_feature    432164..433126
FT                   /locus_tag="SSUSC84_0387"
FT                   /note="HMMPfam hit to PF01301, Glyco_hydro_35, score
FT                   1.5e-177"
FT                   /inference="protein motif:HMMPfam:PF01301"
FT   CDS_pept        433966..434451
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0388"
FT                   /product="sugar phosphotransferase system (PTS), sorbose
FT                   subfamily, IIB component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0403"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51166"
FT                   /protein_id="CAZ51166.1"
FT                   /translation="MAIIATRIDGRLIHGQVANLWTTKLNIGRIMVIDDAVAQNDIEKQ
FT                   GLKLACPPGVKLSILPIEKAANNIKEGKYDSQRLLIVARRPENFLRLVEYGVELAELNV
FT                   GNMSQTPETRSVTRSINVVDKDIADFDALAAKGVKLFAQMVPGDSPKDFMPLLDKVR"
FT   misc_feature    433969..434421
FT                   /locus_tag="SSUSC84_0388"
FT                   /note="HMMPfam hit to PF03830, PTSIIB_sorb, score 2.9e-74"
FT                   /inference="protein motif:HMMPfam:PF03830"
FT   CDS_pept        434493..435392
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0389"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   sorbose-specific family, IIC component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0404"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51167"
FT                   /protein_id="CAZ51167.1"
FT                   /translation="MQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGNME
FT                   VGLLIGASLQLVVLGVGTFGGASRIDATSGAVLATAFSISQGLDPEIAISTIGVPVAGL
FT                   LVYTDILGRFTTTFFAHRVDAAIERFDYAGIERNYLLGAIPWALSRALPVFLALAFGGG
FT                   LVETLVTTIELPEYKWIAAGLTLAARMLPGLGFAILLHYLPLKRNLHYLAVGFALTAML
FT                   TVLYGNVSALGGAVAGIVGTLPEDAGVSFVNNFKGLSMIGIAIVGAFLSVIHFKNSQKV
FT                   TVVAPSNSESGEIEDDEI"
FT   misc_feature    434493..435212
FT                   /locus_tag="SSUSC84_0389"
FT                   /note="HMMPfam hit to PF03609, EII-Sor, score 1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF03609"
FT   misc_feature    join(434550..434609,434628..434696,434766..434834,
FT                   434931..434999,435027..435095,435132..435200,
FT                   435243..435311)
FT                   /locus_tag="SSUSC84_0389"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUSC84_0389 by TMHMM2.0 at aa 20-39, 46-68, 92-114,
FT                   147-169, 179-201, 214-236 and 251-273"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        435379..436197
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0390"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   mannose/fructose/sorbose family, IID component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0405"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51168"
FT                   /protein_id="CAZ51168.1"
FT                   /translation="MTKSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKLHTQFFNTSPFFHTIITGIDLALEESDGVASKDAVNGVKTGL
FT                   MGPFAPIGDSIFGSLVPAIMGTVAATMGKEGSPVGIFLWVAVAIAYDIFRWKQLEVAYK
FT                   EGTKLITTMRDRLTALVDAASVMGVFMMGALIATMINFEVTWAPAIGEKVIDIQDILNT
FT                   IFPRLVPAIFTGFVFWLLGRRGMTSTKAILIIIVLALGFSAIGHFLFGMV"
FT   misc_feature    435394..436179
FT                   /locus_tag="SSUSC84_0390"
FT                   /note="HMMPfam hit to PF03613, EIID-AGA, score 5.1e-119"
FT                   /inference="protein motif:HMMPfam:PF03613"
FT   misc_feature    join(435907..435975,436033..436101,436120..436188)
FT                   /locus_tag="SSUSC84_0390"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0390 by TMHMM2.0 at aa 177-199, 219-241 and
FT                   248-270"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        436197..436598
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0391"
FT                   /product="sugar phosphotransferase system (PTS), fructose
FT                   family, IIA component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0406"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51169"
FT                   /protein_id="CAZ51169.1"
FT                   /translation="MVRSLVLVSHGIFCEELKKSTEMIMGPQEDIYTVALLPEEGPEDF
FT                   QKKFEETIAGLEDFVVFADLLGGTPANVVSRKLIEGGQFDLYAGMNMPMVIGFLNGVLL
FT                   GEAVDYVEFGTSNLVHVNSLLTSDEDDDE"
FT   misc_feature    436203..436532
FT                   /locus_tag="SSUSC84_0391"
FT                   /note="HMMPfam hit to PF03610, EIIA-man, score 1.2e-25"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   CDS_pept        436814..437815
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0392"
FT                   /product="putative aldose 1-epimerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0407"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51170"
FT                   /protein_id="CAZ51170.1"
FT                   /translation="MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGG
FT                   LRNVSLAAKSDDDYRKTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGV
FT                   DTANEQYWDVELDHERNQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSD
FT                   KDTIFNPTNHIYFNLTGDFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFR
FT                   DFAPFAQGFDSQYPQNVLVKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYT
FT                   YNFPVEALACYHGVFSLECQALPNACNVDGFGSILLEQGEEFLSKTTYRFTW"
FT   misc_feature    436847..437803
FT                   /locus_tag="SSUSC84_0392"
FT                   /note="HMMPfam hit to PF01263, Aldose_epim, score 2.2e-82"
FT                   /inference="protein motif:HMMPfam:PF01263"
FT   misc_feature    437318..437347
FT                   /locus_tag="SSUSC84_0392"
FT                   /note="ScanRegExp hit to PS00545, ALDOSE_1_EPIMERASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00545"
FT   CDS_pept        437925..438179
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0408"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51171"
FT                   /protein_id="CAZ51171.1"
FT                   /translation="MTKEQEFLKEFEAWVNTQVMVNEMAVEESRRVLEEDKDERAADAY
FT                   IRYESKLDAYRFIQGKFANYHAGKGFHDLPDELFGQRHY"
FT   misc_feature    437925..438176
FT                   /locus_tag="SSUSC84_0393"
FT                   /note="HMMPfam hit to PF08930, DUF1912, score 8.6e-61"
FT                   /inference="protein motif:HMMPfam:PF08930"
FT   CDS_pept        438194..438580
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0409"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51172"
FT                   /protein_id="CAZ51172.1"
FT                   /translation="MAKKKVNRKKQLKKQLADLKRAGRVGLERAAEVVETVAHKAEAVV
FT                   ERTVEQVKEVVAEVTSSATSLEDFLALPELEGIAAARLETFYEAGIQSVADFANHTEKE
FT                   LLALKGIGPATIKQLKEKGIELKA"
FT   CDS_pept        438822..439211
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0395"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0410"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51173"
FT                   /protein_id="CAZ51173.1"
FT                   /translation="MLHHVEIYVSDLETSRAFYDFLLTKLGYSLYQEWDKGLSYKKAEQ
FT                   YLVFVQTPEDFLEVGYHRCRTGLNHLAFHAGTPDEIDQWRKEFLTRRVKLLYDDRYPHA
FT                   GGPDHYALYLEDPDGIKIELVGEGV"
FT   misc_feature    438822..439193
FT                   /locus_tag="SSUSC84_0395"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase, score 0.00029"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        439208..439783
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0411"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51174"
FT                   /protein_id="CAZ51174.1"
FT                   /translation="MNLIIIGAQASGKMTVGQEVAKLTGMTLFHNHDSIDFSLRFIPEF
FT                   SEDMFDLNTRITFAVYDVFARSGRPLIGTALINFKNLIEVQFLTTVQTIFHHHGQEILF
FT                   VELETALEERLRRNRTENRLTHKPLKRHIEVSEAEILSTADTCRYTSLGIPEGIQHYLK
FT                   INNTHLSANDVAQLIIQKMEELEQEQTK"
FT   CDS_pept        439898..442549
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SSUSC84_0397"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0412"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51175"
FT                   /protein_id="CAZ51175.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQTWLDQDVFKPSGDAEAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGVT
FT                   RYDLGREKFLDKVWEWKDEYAATIREQWGKLGLSLDYQRDRFTLDEGLSKAVRKVFVEL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKPIPIVADEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVAKLQELGALVEIENRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTADKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNESGEMYVGEEAPAGDGWVQDEDVLDTWFSSALWPFSTM
FT                   GWPDENAADFQRYFPTSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNALIHGLIRDEE
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDAARENVAKVAAGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVMTRSVLLYTLDQILRLLHPIMPFVT
FT                   EEIFAQYAEGSIVVAAYPVVNPAFENAEAHKGVESLKDLIRSVRNSRAEVNVAPSKPIT
FT                   ILIKTADSELETFFKANENYIRRFTNPEQLEISSSIAAPELAMSAVITGAEIFLPLADL
FT                   LNVEEELARLDKELVKWQKELDMVGKKLSNERFIANAKPEVVEKEKEKQADYQAKYDAT
FT                   VARIEEMKKLVK"
FT   misc_feature    439946..441577
FT                   /gene="valS"
FT                   /locus_tag="SSUSC84_0397"
FT                   /note="HMMPfam hit to PF00133, tRNA-synt_1, score 0"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    440033..440068
FT                   /gene="valS"
FT                   /locus_tag="SSUSC84_0397"
FT                   /note="ScanRegExp hit to PS00178, AA_TRNA_LIGASE_I, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    441725..442168
FT                   /gene="valS"
FT                   /locus_tag="SSUSC84_0397"
FT                   /note="HMMPfam hit to PF08264, Anticodon_1, score 3e-63"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   CDS_pept        442627..445410
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0398"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0413"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51176"
FT                   /protein_id="CAZ51176.1"
FT                   /translation="MMIILICLSLFIISRTMNGFRLFLDSTIIIGFICLFFYYCCFDLI
FT                   FISLTNLVLILILLVYSFSDILFGIRIIGLSIPFIRSIVLKYIDCKGFLQNKIRNHLVE
FT                   IREIILVTFLFLIFGVQVQLQLPYINFTNYSLIEILGFDIAIFSLYGIYVAFLQFLTEN
FT                   DKVYYLGVSKIRFMLDNSVWSQLTRAKLFHIILLVSVLIPLFSKSNIEFNYQLQNIEYL
FT                   WQTCYIISIVVYIFLLKLSISIVYGVFRLNLENVSKTVKKEDVKEKDSRHKEKIFNRFG
FT                   ITDKINISVQRSFKDEFWKIYKNQNQYRDDYIKVRLQERITLVEKADRDELIFTIFGRE
FT                   NWENYNLSESIFVFIENIDSDEGKQFFRFYKNFCIHKWNFLRDYQTDISPRTWVKLVEQ
FT                   DILIFDKLVKSDSTFNIFKIEFSDNAISRNLNLEKNKKIKEFLFELLLDKEGVNLDDVL
FT                   ISIKKEIQRFSQNKSDQFYRYTYDFLKFRLVTILDKYENDDVNINLPEYKSLSDAFQNG
FT                   QRNDYENSMLYSKICFNYLDRGRIEDFSHTKVEADDSKEREKQKLKAQKIQGLILSMNE
FT                   EYRMAFMLYQLFYTDRTQWDENLAFYDNNIQSIMKHGKQYHGYLFDQVKNIILSETDID
FT                   HRITESFLDKIWETKNETIMDFSWFDQFGDQHQMSNFKILYVQWILSGATTSYLKSRIN
FT                   FERGFPIKVRNSLVGKIKGKENRKMSVKDLKWRIRRKEERIGHLCRDYLLLTDQLTTIF
FT                   TKVPSDKHNLQISVEYLLHSGKVNLSDVIDNISVTSLLRLEWLLRWNYYHYHRESNYTS
FT                   RTFFDEMTSNDRYYWSAGRGILEFFIAKIVDNFYRDLYQDKEFMAGFKYHLESQLNSLN
FT                   KTVEEYVELIAERVSGIDNLSILQKGQIISKLNYILFGQDNNIKIRQKENIAINKF"
FT   misc_feature    join(442684..442752,442756..442815,442825..442881,
FT                   442930..442998,443041..443109,443305..443373)
FT                   /locus_tag="SSUSC84_0398"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0398 by TMHMM2.0 at aa 20-42, 44-63, 67-85,
FT                   102-124, 139-161 and 227-249"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        445482..445556
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0399"
FT                   /product="putative valine-tRNA ligase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0414"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pyogenes (serotype M3) putative
FT                   valine-tRNA ligase ValS UniProt:Q8K6M9 (EMBL:AE014161) (882
FT                   aa) fasta scores: E()=3.6e-05, 91.667% id in 24 aa"
FT   CDS_pept        445637..446443
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0400"
FT                   /product="Fic protein family"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0415"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51178"
FT                   /protein_id="CAZ51178.1"
FT                   /translation="MQPTYNIDNPNLSYEAKQELWETGFGLQKVDGLTPSVYMEELAER
FT                   QARGEYTYEQVYEEITKYHQSTDASTQEADIVSLRIVEMLSQNGFSLRPTTLLHIHKEL
FT                   FHDIFDSSIPVVEYRTVNITKNELVLKGDTVIYSDFPLIAATLDYDFQQERDFSYARLD
FT                   KKAIVAHIQSFISGVWQIHPFREGNTRTITVFLIKYLRSLGFEIDNEPFQKHAKYFRDA
FT                   LVLDNAKLVNKRSDFLTAFFENLLLNGQNDLSSERMYEELGLDEYQ"
FT   misc_feature    445925..446311
FT                   /locus_tag="SSUSC84_0400"
FT                   /note="HMMPfam hit to PF02661, Fic, score 3.3e-11"
FT                   /inference="protein motif:HMMPfam:PF02661"
FT   misc_feature    446243..446272
FT                   /locus_tag="SSUSC84_0400"
FT                   /note="ScanRegExp hit to PS00659, GLYCOSYL_HYDROL_F5, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00659"
FT   CDS_pept        446538..449246
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0401"
FT                   /product="DEAD/DEAH box family helicase"
FT                   /product="helicase, putative"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0416"
FT                   /note="C-terminal region is similar to Streptococcus
FT                   pneumoniae putative helicase UniProt:Q97S40 (EMBL:AE007367)
FT                   (548 aa) fasta scores: E()=1.3e-110, 55.657% id in 548 aa.
FT                   Full length CDS is similar to Bacteroides fragilis probable
FT                   helicase UniProt:Q64S40 (EMBL:AP006841) (970 aa) fasta
FT                   scores: E()=4.9e-64, 36.773% id in 911 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51179"
FT                   /protein_id="CAZ51179.1"
FT                   /translation="MSYYYEKLTGKVAKHLARFPYYATDKILNLMQFQDNNQQFLISDK
FT                   HLYDYFEEQKHQLSTDEKLSILFNLFKGRIDVYAKSYIDENGKINYFPSYNYGWKKRPV
FT                   EKRTCQPLTKQVLLAHLRGEISIGIFPMSLSDTCSFLAIDFDKNNWREEVSILRDTAEQ
FT                   HGFEGHIEISRSGNGAHLWFFFEEEIACQQARNVGKRLLELAMQESKDIRFSSFDRMFP
FT                   NQDILPKGGFGNLIALPLQGEAFKKGRTVFVDKHFQPFSEQWTYLQQVQKIGQKKILDF
FT                   LGQEFSDTVDDTVLDCSLSNVIRVEKRAISSKTNYLLRKLASFPNPEFYLKQATRQPTY
FT                   QTPERIYLFEETNEALHLPRGILAKLQEIFETVTIRDNRNSLSPIQISFKGRLRFEQEL
FT                   ALADLLASENGLLCAETGFGKTVLGAALIAQRKCRTIILVHNRQLLEQWLERLGEFLEI
FT                   EEEEAVRYTPSGRVKVIGHIGQYGASKKWRSKLVDVVMIQSLFQLDVISDFLSDYDMMI
FT                   VDECHHVTALQFEKVVAQFASQYLYGLTATPECKNGHQPIVFQRIGPILHTAQSGQYDF
FT                   KKRLLLHLTSFGKLDLEQSNSTNFASLNDWLAKDLHRNTLIVQDIFKLYQEKRNILVLV
FT                   NRREHIELLEKLLIEKEMPNIFCLSGASKRRDTKELLKRISELDENSPFVLISTGKFIG
FT                   EGFDMPKLDTLILAAPLSWKNNLIQYAGRLHRPYQGKTEVRIVDYLDIHVPYLERMYQK
FT                   RQIAYRKMAYQVGEKEQTQVLFSGRDYEEKFREDLRNTRSTVYLQLHSFTSSRIQELLG
FT                   LLRGKQVVIHVSKNHKLSEWLMGLNSDNVKVKLVPERIGTTAVILDSNLVWYGNLSPFT
FT                   YQSDDQASLLRLESQSIATELLEKFENSNIK"
FT   misc_feature    446958..447302
FT                   /locus_tag="SSUSC84_0401"
FT                   /note="HMMPfam hit to PF01896, DNA_primase_S, score
FT                   8.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01896"
FT   misc_feature    447705..448187
FT                   /locus_tag="SSUSC84_0401"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 7e-30"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   CDS_pept        449362..450084
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0417"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51180"
FT                   /protein_id="CAZ51180.1"
FT                   /translation="MEKEVFTPDQSQSIVDAILKGYKSYLDERIEKRRTMHVSAGYVWT
FT                   KANHIDGALATANLNFIDKFELKHASQSWEFLEFNSENQLLGRVCFVLKGLTRLRQVFP
FT                   TAVKSGKGYLFDYAQINTSYLENLSRHTDESTLFPVQMELFDDNLFELLNRSEQSINNF
FT                   FFITYQADELHHLTNIQVIMPDSRTGKLIEIQNLSTFISTSNVDFNDEKYQELQGLSEI
FT                   DDVADFEIIPRLASEKEA"
FT   CDS_pept        450097..451251
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0403"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0418"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51181"
FT                   /protein_id="CAZ51181.1"
FT                   /translation="MFNGSRLEELRLLNGLTRADLARELEVTEQAIWQFETGVTLPKMK
FT                   NKIAMARFFQVEVDYFDAVDKNGSFSLSRIAFRNADLEAKKNIHIQMVYLEKMNQMIDY
FT                   LENFVSIPNQIIYQLVDSIEQKLQQHESLEFIADHVREVLAVSIDNANLLYSLEKSGIY
FT                   ISERLINGNADAYSAWSRNGRPFIVLGLGKSAVRHNFDLAHELGHLLLHNQVDFEELSK
FT                   EELEEKEKEANQFASYFLLPRKQFLMDFVNIVGKRVSNPDQYILLKKRFGVSIQALEYR
FT                   AYKLGLLTPQQNSYFYRQISKKGYKAVEPLDLEIPLKKPSKIRSILDVILSNNLLTLSD
FT                   IERNQRVSKNFISQLFSFDVKFFDKYLLQLDTFDNVIPLFSRKQ"
FT   misc_feature    450115..450279
FT                   /locus_tag="SSUSC84_0403"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 3e-10"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    450142..450207
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1677.000, SD 4.90 at aa 16-37, sequence
FT                   LTRADLARELEVTEQAIWQFET"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    450565..450945
FT                   /locus_tag="SSUSC84_0403"
FT                   /note="HMMPfam hit to PF06114, DUF955, score 1.1e-23"
FT                   /inference="protein motif:HMMPfam:PF06114"
FT   misc_feature    451102..451167
FT                   /note="Predicted helix-turn-helix motif with score 995.000,
FT                   SD 2.58 at aa 336-357, sequence LTLSDIERNQRVSKNFISQLFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        451266..452324
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0419"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51182"
FT                   /protein_id="CAZ51182.1"
FT                   /translation="MNKINSYKIHLPSLLPFGFLFANNCYTYREVFMEGQFEAVVEVDE
FT                   AGQLSSYVWDCEMEEVYTAHLVTAPSGAFVGQVRESYQSILDRVEEACCIALPFTKDQS
FT                   NRIAQLIKEQWGDLPDYPFAKLPTYGAFRHPNNNKWYALVSQIPRDKLDGSGSQEEVEI
FT                   VNLKVAGREIAELLSRSGIFPAYHMSKKTWVSVLLDDTVEDQTVFALLEKSRYLVGPKS
FT                   YKATQGPDYWVIPANPKVYDIDTEFAENKVVYWPQKSTIQVGDIVAIYVTAPVQAIRYV
FT                   CRVLGENLENHGESDIPTEKKLMQVELLAQFSDDVLPRARMMDLGVKAVRGPRRLTKEL
FT                   IDVLTSEVINIY"
FT   misc_feature    451596..451922
FT                   /locus_tag="SSUSC84_0404"
FT                   /note="HMMPfam hit to PF04237, DUF419, score 1.5e-32"
FT                   /inference="protein motif:HMMPfam:PF04237"
FT   CDS_pept        452408..453400
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="SSUSC84_0405"
FT                   /product="aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0420"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51183"
FT                   /protein_id="CAZ51183.1"
FT                   /translation="MKKSFIHQQEEISFVKNTFTQYLKDKLEIVEVQGPILSRVGDGMQ
FT                   DNLSGVENAVTVNVKLIPDATYEVVHSLAKWKRHTLARFGFHEGEGLFVHMKALRPDED
FT                   SLDPIHSVYVDQWDWEKVIPDGRRNLAYLKETVEQIYKAIRLTELAVEARYDIESVLPK
FT                   KITFIHTEDLVKNFPDLTPKERENVVAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWT
FT                   SPSEAGYKGLNGDILVWNEALGSAFELSSMGIRVDEEALKRQVAITGDEDRLEFDWHRA
FT                   LLNGLFPLSIGGGIGQSRLAMFLLRKKHIGEVQSSVWPQEVRDNFENIL"
FT   misc_feature    452414..453145
FT                   /gene="asnA"
FT                   /locus_tag="SSUSC84_0405"
FT                   /note="HMMPfam hit to PF03590, AsnA, score 3.4e-181"
FT                   /inference="protein motif:HMMPfam:PF03590"
FT   misc_feature    453248..453295
FT                   /gene="asnA"
FT                   /locus_tag="SSUSC84_0405"
FT                   /note="ScanRegExp hit to PS00879, ODR_DC_2_2, score NA"
FT                   /inference="protein motif:Prosite:PS00879"
FT   CDS_pept        453533..455380
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0406"
FT                   /product="BipA family GTPase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0421"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51184"
FT                   /protein_id="CAZ51184.1"
FT                   /translation="MTKLREDIRNVAIIAHVDHGKTTLVDELLKQSQTLDERTQLDERA
FT                   MDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQNLTPIVVVNKIDKPSARPEEVVDEVLELFIELGADDDQLEF
FT                   PVVYASAINGTSSLSDNPADQEETMAPIFDTIIEHIPAPVDNSDEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERKEIQEAKAGDLIAV
FT                   SGMEDIFVGETVTPTDAVEALPVLRIDEPTLQMTFLVNNSPFAGREGKWVTSRKIEERL
FT                   LAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIIKEIDG
FT                   VKMEPFERVQIDTPEEYQGSVIQSLSERKGDMLDMVATGNGQTRLVFLVPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPVVQGEIGGRHRGALVSIDQGKATTYSIMRIEERGTIFV
FT                   NPGTEVYEGMIIGENSRENDLTVNITTAKQMTNVRSATKDQTSVIKTPRILTLEESLEF
FT                   LNDDEYMEVTPESIRLRKQILNKAERDKAAKKKKLATEE"
FT   misc_feature    453548..454141
FT                   /locus_tag="SSUSC84_0406"
FT                   /note="HMMPfam hit to PF00009, GTP_EFTU, score 2.9e-67"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    453671..453718
FT                   /locus_tag="SSUSC84_0406"
FT                   /note="ScanRegExp hit to PS00301, EFACTOR_GTP, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    454202..454414
FT                   /locus_tag="SSUSC84_0406"
FT                   /note="HMMPfam hit to PF03144, GTP_EFTU_D2, score 6.8e-17"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    454730..454987
FT                   /locus_tag="SSUSC84_0406"
FT                   /note="HMMPfam hit to PF00679, EFG_C, score 1.2e-27"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   CDS_pept        455398..455646
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0407"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0422"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51185"
FT                   /protein_id="CAZ51185.1"
FT                   /translation="MFYLILAIMLVLFYIFIAPSNIKGTMNLIAAVFLLVALAIALVLG
FT                   FLRIMQFPKEIWVGLLMILIGFWAMRDIYQLNDDTKF"
FT   misc_feature    join(455401..455451,455479..455547,455566..455619)
FT                   /locus_tag="SSUSC84_0407"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0407 by TMHMM2.0 at aa 2-18, 28-50 and 57-74"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        456353..456613
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0408"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0423"
FT                   /note="Possible gene remnant. Weakly similar to the
FT                   N-terminal region of Clostridium tetani DNA replication
FT                   protein DnaC UniProt:Q899P7 (EMBL:AE015936) (329 aa) fasta
FT                   scores: E()=7.2, 36.111% id in 72 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51186"
FT                   /protein_id="CAZ51186.1"
FT                   /translation="MDVKNLRKLKRIELYEIMLAQSEEIDCLRNQLEKIKTELADRRIM
FT                   ISQSGSIAEASMKLTNIFEEAQKAADLYLYNVKNKIGDVHE"
FT   CDS_pept        456606..457196
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0409"
FT                   /product="putative signal peptidase I 2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0424"
FT                   /note="Similar to SSU0450, 52.308% identity (52.308%
FT                   ungapped) in 195 aa overlap (4-198:8-202)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51187"
FT                   /protein_id="CAZ51187.1"
FT                   /translation="MNSSNLKGKELPKTSELKELYQHERYRHTFWRTVKSTVFMLVVVA
FT                   AFAILIAVLFLPILRIYGDSMKGTLNSGDIVVSVKSNDFESSDVVAFYYNNNILVKRVI
FT                   AEAGDWVDMDKQGNVYVNNQRLDEPYLANRDYGHTDIEFPYQVPENRIFVMGDNRKESI
FT                   DSRNNAIGTVSNEQIVGKLVFKIWPLSELGWIE"
FT   sig_peptide     456606..456794
FT                   /locus_tag="SSUSC84_0409"
FT                   /note="Signal peptide predicted for SSUSC84_0409 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.630) with cleavage
FT                   site probability 0.630 between residues 63 and 64"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    456714..456782
FT                   /locus_tag="SSUSC84_0409"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0409 by TMHMM2.0 at aa 37-59"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    456783..456977
FT                   /locus_tag="SSUSC84_0409"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score
FT                   2.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    457059..457100
FT                   /locus_tag="SSUSC84_0409"
FT                   /note="ScanRegExp hit to PS00761, SPASE_I_3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00761"
FT   CDS_pept        join(457228..457374,457378..462204)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0410"
FT                   /product="accessory pilus subunit (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0425"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   49. Internal region is similar to the N-terminal region of
FT                   Listeria monocytogenes internalin A precursorinla InlA
FT                   UniProt:P25146 (EMBL:LMO012346) (800 aa) blastp scores:
FT                   E()=4e-09"
FT                   /db_xref="PSEUDO:CAZ51188.1"
FT   sig_peptide     457228..457371
FT                   /locus_tag="SSUSC84_0410"
FT                   /note="Signal peptide predicted for SSUSC84_0410 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.657) with cleavage
FT                   site probability 0.539 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(457285..457353,462130..462189)
FT                   /locus_tag="SSUSC84_0410"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0410 by TMHMM2.0 at aa 20-42 and 1634-1653"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        462311..463753
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0411"
FT                   /product="major pilus subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0427"
FT                   /note="Similar to protein mediating epithelial cell
FT                   invasion by virulent serotype III group B Streptococcus
FT                   agalactiae, Spb1 UniProt:Q84A41 (EMBL:AF485279) (502 aa)
FT                   fasta scores: E()=1.9e-05, 32.961% id in 537 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51189"
FT                   /protein_id="CAZ51189.1"
FT                   /translation="MKKLQQFFTSLVAVLTVFAFGSTALAQTVDSGKSGAGTITVSNAS
FT                   QGQTYTAYKLFDATVTTDGSGISYKLPAGKIATNFGGDTWFEVDSKGNITAKEGATVSS
FT                   EAFAAWAKNFGTEVTSATANDNSLVFTHLTFGYYFVTSSLGAVLTVDSTTPNATVIDKN
FT                   TTNPTIPDSNNGGGKKILSNGATTSETTAKIGDTINFQIKFNATNYVTKDRQTKQIVSY
FT                   TIEDSPTALAIDQNSVNVKVDGVDITAKISKTFDATGKMNLVITWADAAASNKTIYNSP
FT                   AEVIITYSAVVTKDAKEGEATNSATIGYNTIDNPTTPPTPVDPDKPTETTKVTTHRFTL
FT                   KKTNNVGETLTGAEFKLYDAANNGTEIKVVKESDGVYRVAQADEQGVVIEAGEVVIKGL
FT                   KHSTTYYLEEMKAPNGYNILTERQSIEVKENNTAQANIVNKKGGVLPSTGAIGTTLFYL
FT                   VGSILLLVALVYTISKRRMNNI"
FT   sig_peptide     462311..462388
FT                   /locus_tag="SSUSC84_0411"
FT                   /note="Signal peptide predicted for SSUSC84_0411 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.986 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(462329..462397,463658..463726)
FT                   /locus_tag="SSUSC84_0411"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0411 by TMHMM2.0 at aa 7-29 and 450-472"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    463358..463624
FT                   /locus_tag="SSUSC84_0411"
FT                   /note="HMMPfam hit to PF05738, Cna_B, score 7.4e-11"
FT                   /inference="protein motif:HMMPfam:PF05738"
FT   misc_feature    463619..463735
FT                   /locus_tag="SSUSC84_0411"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        463867..464736
FT                   /transl_table=11
FT                   /gene="srtC1"
FT                   /locus_tag="SSUSC84_0412"
FT                   /product="sortase SrtC1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0428"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51190"
FT                   /protein_id="CAZ51190.1"
FT                   /translation="MIKWLKKKGPSFIMPLIFILGIGLLAYPSVSDYWNSFHQSEAIMS
FT                   YSDTVSDMTADQYKEIIDSARQYNQEKPLNWNVTASDIEAYNQELNFNKDGIMGYIEIP
FT                   KIDVKLSIFHGTDETVLETSIGHLEGTSLPVGGLGTHSVLSGHRGLPSARLFSDLDKLR
FT                   EGDIFTIHVLNETLTYKVDQIRVVEPSDLSALTMEPQKDLLTLVTCTPYGINTHRLLVR
FT                   GYRIENVNGSALVTSDAIQIKAIFIAPFIATPILFVILIYIFITTSKTFRSRNRNQVLD
FT                   DFLVPKKF"
FT   sig_peptide     463867..463944
FT                   /gene="srtC1"
FT                   /locus_tag="SSUSC84_0412"
FT                   /note="Signal peptide predicted for SSUSC84_0412 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.820) with cleavage
FT                   site probability 0.737 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(463900..463968,464596..464664)
FT                   /gene="srtC1"
FT                   /locus_tag="SSUSC84_0412"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0412 by TMHMM2.0 at aa 12-34 and 244-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    464167..464544
FT                   /gene="srtC1"
FT                   /locus_tag="SSUSC84_0412"
FT                   /note="HMMPfam hit to PF04203, Sortase, score 8.2e-62"
FT                   /inference="protein motif:HMMPfam:PF04203"
FT   CDS_pept        complement(464847..465182)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0413"
FT                   /product="transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0429"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus mutans transposase UniProt:Q93UN9
FT                   (EMBL:AF068251) (297 aa) fasta scores: E()=2e-19, 55.000%
FT                   id in 100 aa"
FT                   /db_xref="PSEUDO:CAZ51191.1"
FT   CDS_pept        465308..466657
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SSUSC84_0414"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0430"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51192"
FT                   /protein_id="CAZ51192.1"
FT                   /translation="MKMIDIVKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFEE
FT                   NPTAQSLLEDGIRVICGSHPLELLDEDFALMVKNPGIRYDNPMVEKAIGKGIPVWTEVE
FT                   LAYLVSDVPIVGITGSNGKTTTTTMIAEVLNAGKKPAKLCGNIGYPASSVAQTATAEDT
FT                   LVMELSSFQLMGTESFHPHIAVVTNLIASHIDYHGTFEDYVAAKWMIQRQMTAEDFVVI
FT                   NFNQKEAKELAGQTKATVVPFSTQEVVDGAYLADGKLYFKGEYIMDADQIGVPGSHNVE
FT                   NALATIVVAKLLGVDQQAIQESLSAFGGVKHRLQFVGEINGVSFYNDSKSTNILATQKA
FT                   LSGFDNSKVILIAGGLDRGNEFDELVPDLVGLKKMVILGQSAPRVQRAADKAEVETIEA
FT                   LDIADATRKAFAIAEKGDIVLLSPANASWDMYANFEVRGDVFLQTFEELK"
FT   misc_feature    465650..466177
FT                   /gene="murD"
FT                   /locus_tag="SSUSC84_0414"
FT                   /note="HMMPfam hit to PF08245, Mur_ligase_M, score 8.5e-62"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    466235..466462
FT                   /gene="murD"
FT                   /locus_tag="SSUSC84_0414"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 1.3e-19"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        466660..467724
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SSUSC84_0415"
FT                   /product="putative
FT                   UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)pyr
FT                   ophosphoryl-undecaprenol N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0431"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51193"
FT                   /protein_id="CAZ51193.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLIPRFLEEGWEVHYIGDGNGIEHEQ
FT                   VVKSGLDVHFHSIATGKLRRYFSFQNMLDVFKVGFGVLQSLTIIAKIRPQALFSKGGFV
FT                   SVPPVIAANLLRVPVFIHESDLTMGLANKIAYKFATTMYSTFEQPASLTKVKHVGAVTK
FT                   VGQTNDKVTPIQLPEILSHFDKSLPTLLFVGGSGGAKVFNDLISQNSAALTERFNIINL
FT                   TGDSSLNKLDKNLYRVDYVTELYQPLMDLADVVITRGGSNTLFELIAMQQLHLIVPLGR
FT                   QASRGDQIENALYAEKKGYSKQIDESQLTFASLLVEVDELLKHKEFYVQNMANSNEIQS
FT                   VDSFYNLLREDMGR"
FT   misc_feature    466669..467091
FT                   /gene="murG"
FT                   /locus_tag="SSUSC84_0415"
FT                   /note="HMMPfam hit to PF03033, Glyco_transf_28, score
FT                   1.2e-39"
FT                   /inference="protein motif:HMMPfam:PF03033"
FT   misc_feature    467224..467694
FT                   /gene="murG"
FT                   /locus_tag="SSUSC84_0415"
FT                   /note="HMMPfam hit to PF04101, Glyco_tran_28_C, score
FT                   3.5e-27"
FT                   /inference="protein motif:HMMPfam:PF04101"
FT   CDS_pept        467730..468812
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0416"
FT                   /product="putative cell division protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0432"
FT                   /note="CDS is truncated at the C-terminus in comparison to
FT                   some orthologues, for example, similar to Streptococcus
FT                   pneumoniae cell division protein DivIB UniProt:Q9ZHA8
FT                   (EMBL:AF068902) (399 aa) fasta scores: E()=1.7e-28, 35.457%
FT                   id in 361 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51194"
FT                   /protein_id="CAZ51194.1"
FT                   /translation="MTEKDSNVEESVLEVEQASQVELDSEQISPAEKESVLAEEKEFST
FT                   DVDIPEMTAPDDEKSAFFEQWKARHQAYLAHKDEADIQAVDEGQTEQEIPEAKKSKRVL
FT                   FQGIERKTESLKSKKETGEKVQTLKVDIPSKVVWKAIPVLVTSLLLAALALYFISPTSK
FT                   KKQIEVVGNERLTAEQVENYSLISPDDYNVTIALHADAYAKNIKKNSSSVETATIKFQF
FT                   PATFTIHIKEYAIIGYIQQQSQWYPVLSSGEIGGEPISQDSLPEDYTTINLSDKELIKE
FT                   LAIELGKIDAGIRSAIQTINLTPSKVTADLLTFNMRDGNTVLVPLSEISQKVSYYTKIA
FT                   AEVTVPTTIDMEVGIYRYAS"
FT   misc_feature    468135..468203
FT                   /locus_tag="SSUSC84_0416"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0416 by TMHMM2.0 at aa 136-158"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    468213..468428
FT                   /locus_tag="SSUSC84_0416"
FT                   /note="HMMPfam hit to PF08478, POTRA_1, score 7.4e-15"
FT                   /inference="protein motif:HMMPfam:PF08478"
FT   misc_feature    468435..468806
FT                   /locus_tag="SSUSC84_0416"
FT                   /note="HMMPfam hit to PF03799, FtsQ, score 7.8e-12"
FT                   /inference="protein motif:HMMPfam:PF03799"
FT   CDS_pept        468965..470344
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SSUSC84_0417"
FT                   /product="putative cell division protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0433"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51195"
FT                   /protein_id="CAZ51195.1"
FT                   /translation="MARNGFFTGLDIGTSSVKVLVAEYIDNEMNVIGVSNVKSAGVKDG
FT                   IIVNIEVAAGAIKKAIEQAEEKSGIRIEKVNVGLPANLLQIEPTQGMIPVTTDSQEITD
FT                   LDVENVVKSALTKSMTPEREVISFIPEEFTVDGFQGIKDPRGMMGIRLEMRGMLYTGPR
FT                   TILHNLRKTVERAGVQVENIVISPLALTRSVLNEGEREFGATVIDLGGGQTTVAVMRGQ
FT                   ELQYTNIYQEGGDYITNDISKVLTTSKSIAENLKYNYGIAYPQDASDKEKFTVEVIGEN
FT                   APVEVTERYLSEVIAARLRQIFDRVKQDLERTRALDLPGGIVLVGGGAILPGIIELAQE
FT                   VFGVNTKLFVPNQIGIRNPAFASVISFVEYVGELEDVENIAQHAVNGETTLRHKPVEIP
FT                   VARPRISQPIQREIVNELNTVDQVEEQVAPTYHDEEEEVRPAAKGNITDRIRGLFGSMF
FT                   E"
FT   misc_feature    468983..469546
FT                   /gene="ftsA"
FT                   /locus_tag="SSUSC84_0417"
FT                   /note="HMMPfam hit to PF02491, FtsA, score 5.9e-64"
FT                   /inference="protein motif:HMMPfam:PF02491"
FT   misc_feature    469574..470065
FT                   /gene="ftsA"
FT                   /locus_tag="SSUSC84_0417"
FT                   /note="HMMPfam hit to PF02491, FtsA, score 2e-50"
FT                   /inference="protein motif:HMMPfam:PF02491"
FT   CDS_pept        470370..471599
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUSC84_0418"
FT                   /product="cell division protein FtsZ"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0434"
FT                   /note="CDS lacks internal amino acids around residue 360 in
FT                   comparison to some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51196"
FT                   /protein_id="CAZ51196.1"
FT                   /translation="MAFSFEAAASHGAVIKVIGVGGGGGNAINRMIEEGVAGVEFIAAN
FT                   TDVQALSSSKAETVIQLGPKLTRGLGAGGQPEVGRKAAEESEEALTNVLTGADMVFITA
FT                   GMGGGSGTGAAPVIARIAKNLGALTVAVVTRPFGFEGNKRGNFAIEGIEGLREQVDTLL
FT                   IISNNNLLEIVDKKTPLLEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTVMENK
FT                   GNALMGIGIGTGEDRVIEAARKAIYSPLLETTIDGAEDVIVNVTGGYDMTLTEAEDASE
FT                   IVNQAAGQGVNIWLGTSIDETMKDEIRVTVVATGVRQDTADKPARHRTEAVSPRPSHRF
FT                   DHSVASAPTRGAAQQTEAPKASAFGEWDLRRENLIRPTDTEPTSTVSVEKFTMDQDEDE
FT                   LDTPPFFRNR"
FT   misc_feature    470406..470987
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUSC84_0418"
FT                   /note="HMMPfam hit to PF00091, Tubulin, score 1.2e-95"
FT                   /inference="protein motif:HMMPfam:PF00091"
FT   misc_feature    470502..470606
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUSC84_0418"
FT                   /note="ScanRegExp hit to PS01134, FTSZ_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01134"
FT   misc_feature    470991..471356
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUSC84_0418"
FT                   /note="HMMPfam hit to PF03953, Tubulin_C, score 3.3e-25"
FT                   /inference="protein motif:HMMPfam:PF03953"
FT   CDS_pept        471606..472277
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0435"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51197"
FT                   /protein_id="CAZ51197.1"
FT                   /translation="MNFQKNKDAIFSAVAKAAEKAGRPSESVKVIAVTKYVDSSIANQL
FT                   VNTGITHIGENRVDQFLEKYNALADKQLTWHLIGTLQRRKVKDIIPFVDYFHALDSVKL
FT                   AQEIDKRATKIVKCFLQVNVSGEESKHGFAVSEIDAALAEISLLENIELVGLMTMAPID
FT                   ATDDELDEIFSKMQEIQEELATRNLPRMPFTELSMGMSGDFERAIAHGATYVRIGSAFF
FT                   E"
FT   misc_feature    471621..472274
FT                   /locus_tag="SSUSC84_0419"
FT                   /note="HMMPfam hit to PF01168, Ala_racemase_N, score
FT                   1.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01168"
FT   CDS_pept        472294..472857
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0436"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51198"
FT                   /protein_id="CAZ51198.1"
FT                   /translation="MALKDTFKNLFNYFEVDEVNEVEEQADAYSMPNDRPKMRVANTTV
FT                   APVREQQPKVETRREARSESQLQRLHERQQELMTNNNEKEIVKTTIDIKFPKRYEDAPE
FT                   MVNLLLDNASILIDFQYMSEQQARRCLDYLDGARSVLSGNLKKVSNTMWLLTPVNVTVN
FT                   IEELRNAGTTTGVADSNFEFDIKR"
FT   misc_feature    472549..472788
FT                   /locus_tag="SSUSC84_0420"
FT                   /note="HMMPfam hit to PF04472, DUF552, score 8.6e-28"
FT                   /inference="protein motif:HMMPfam:PF04472"
FT   CDS_pept        472862..473125
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0421"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0437"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51199"
FT                   /protein_id="CAZ51199.1"
FT                   /translation="MQILIFLLLKIVEIYSYLLLAYALLSWFPSLYTSSIGRLIQWLVA
FT                   PILKPFRRLNLQFMGLDWTVMAAMIALNMGTRFLVQLLLLLA"
FT   misc_feature    472862..473107
FT                   /locus_tag="SSUSC84_0421"
FT                   /note="HMMPfam hit to PF02325, YGGT, score 7.9e-20"
FT                   /inference="protein motif:HMMPfam:PF02325"
FT   misc_feature    join(472874..472942,473051..473119)
FT                   /locus_tag="SSUSC84_0421"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0421 by TMHMM2.0 at aa 5-27 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        473128..473919
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0422"
FT                   /product="putative RNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0438"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51200"
FT                   /protein_id="CAZ51200.1"
FT                   /translation="MKNDKNLLQHFSREEREFVEKIMDMCQQVEDTYSYRLTHFLHPRQ
FT                   DEIVCKIANYYQLQTFSSRDLVSTEHSRVIIAPTYYELDIKDFELTALHLSYARKFHTL
FT                   SHSQVLGTFLNQLGIKREYLGDILIDDERLIVFIDQKFGQIALQSITKVARVPVKGKEE
FT                   EWTTVRLPIGQEWRSKDVLVSSMRLDKLISVAFNLSRATANKLIEAGHVKLDYVLTEQT
FT                   SKLVEIGQLISVRRYGRVRLNEFLGFSKQGKIKLKLDIVKT"
FT   misc_feature    473683..473823
FT                   /locus_tag="SSUSC84_0422"
FT                   /note="HMMPfam hit to PF01479, S4, score 9.8e-08"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        473928..474617
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0423"
FT                   /product="putative cell-division protein DivIVA"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0439"
FT                   /note="In comparison to orthologues, CDS lacks similarity
FT                   in the C-terminal region, for example, similar to
FT                   Streptococcus pneumoniae cell division protein DivIVA
FT                   UniProt:Q9ZHB4 (EMBL:AF068901) (262 aa) fasta scores:
FT                   E()=6.8e-42, 66.038% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51201"
FT                   /protein_id="CAZ51201.1"
FT                   /translation="MALTALELKDKTFATKFRGYDADEVDDFLDIVTRDYEDLIRKNHD
FT                   QELELKNLRERLAYFDEMKESLSKSVLLAQDTAEKVKVAAEDQAANIIKQADYDAATLL
FT                   HEAKDKANEILRNATDNAKKVVIETEELKNQTRIFHQRLKSTVESQLSLVNSSEWEEIL
FT                   RPTASYIQTSDEAFRDVLHKALDEELPVEEESLDYTRQLTPEEIAELTRQAAAFESGES
FT                   VVLSIEE"
FT   misc_feature    473928..474614
FT                   /locus_tag="SSUSC84_0423"
FT                   /note="HMMPfam hit to PF05103, DivIVA, score 7.1e-66"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        474632..474852
FT                   /locus_tag="SSUSC84_m0003"
FT                   /note="T-box leader (RF00230) as predicted by Rfam, score
FT                   60.74"
FT   CDS_pept        474847..475290
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0424"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0440"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51202"
FT                   /protein_id="CAZ51202.1"
FT                   /translation="MIRLELVNKDNFEVVLQVQLASEDQRRVASVEYSLAQAWLYKDSG
FT                   MILPYAVVSGRKVVGFAMLSIEPKDNSYYLWRLLIDKDFQNRGCGKEAIQQIIGKAKAD
FT                   PLCHKISINYVIGNHKMRYILEKIGFQSVGLEGQEMKMELIIK"
FT   misc_feature    474994..475239
FT                   /locus_tag="SSUSC84_0424"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   4.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        475301..478090
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SSUSC84_0425"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0441"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51203"
FT                   /protein_id="CAZ51203.1"
FT                   /translation="MKLKETLNLGKTAFPMRAGLPTREPEWQKAWDEANLYARRQELNE
FT                   GKPAFHLHDGPPYANGNIHVGHALNKISKDIIVRSKSMSGFRAPFVPGWDTHGLPIEQV
FT                   LAKQGVKRKEMDLVEYLEMCRDYAFSQVDKQRDDFKRLGVSADWENPYITLTKDYEAAQ
FT                   IRVFGAMADKGYIYRGAKPVYWSWSSESALAEAEIEYHDIDSTSLYYANKVKDGKGLLD
FT                   TDSYIVVWTTTPFTVTASRGLTMGADIDYVLVQPAGSDRKYVLAEALVDSLAAKFGWES
FT                   FEVISKHKGAEFEYIVTEHPWDREVDELVILGDHVTTDSGTGIVHTAPGFGEDDYNVGV
FT                   KYDLEVAVTVNERGLMNEAAGPDFEGQFYDKVVPTVKEKLGDLLLASEVINHSYPFDWR
FT                   TKKPIIWRAVPQWFASVSKFRQEILDQIEATTFNPSWGKTRLYNMIRDRGDWVISRQRA
FT                   WGVPLPIFYAEDGTAIMTKEVTDHVAALFEEHGSIIWWKSDAKDLLPAGFTHPGSPNGE
FT                   FTKETDIMDVWFDSGSSWNGVMNARENLAYPADLYLEGSDQYRGWFNSSLITSVAVNGH
FT                   APYKAILSQGFVLDGNGMKMSKSLGNTILPSDVEKQFGAEILRLWVTSVDTSNDVRVSM
FT                   DILGQVSETYRKIRNTLRFLIANTSDFNPASDAVAYEELRSVDQYLLVKFNKLVVQIRE
FT                   AYDNYDFMGIYKSVVNFVTLDLSAFYLDFAKDVVYIDGAKSLSRRQMQTVFYDILVKIT
FT                   KLLTPILPHTAEEIWSYLEHEAEEFVQLAEMPEVETFANEAQLLADWENFMVFRTQAQK
FT                   ALEEARNAKVIGKSLEAHLTAYVSAETKSFLESLNADLAQLLIVSNLTVTTETAPSTAL
FT                   VVDEVAFAVERAAGEVCDRCRRIDTSVAERSYGATICDHCASVVEENFAEAVAQGFEA"
FT   misc_feature    475376..477202
FT                   /gene="ileS"
FT                   /locus_tag="SSUSC84_0425"
FT                   /note="HMMPfam hit to PF00133, tRNA-synt_1, score 5.5e-273"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    475469..475504
FT                   /gene="ileS"
FT                   /locus_tag="SSUSC84_0425"
FT                   /note="ScanRegExp hit to PS00178, AA_TRNA_LIGASE_I, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    477332..477802
FT                   /gene="ileS"
FT                   /locus_tag="SSUSC84_0425"
FT                   /note="HMMPfam hit to PF08264, Anticodon_1, score 1.8e-52"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   misc_feature    477953..478042
FT                   /gene="ileS"
FT                   /locus_tag="SSUSC84_0425"
FT                   /note="HMMPfam hit to PF06827, zf-FPG_IleRS, score 8.4e-09"
FT                   /inference="protein motif:HMMPfam:PF06827"
FT   repeat_region   complement(478141..478247)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(478469..478777)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0442"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51204"
FT                   /protein_id="CAZ51204.1"
FT                   /translation="MKIINTTNSHPNLVQSQLANTDAFLVETYSAGNTDVIFTQAPRHY
FT                   ELLISNKYRAVQQNEIEQIRDFFLHRKIDERTINKAAIQTIHTDRLIEMSIPIIAEV"
FT   misc_feature    complement(478484..478777)
FT                   /locus_tag="SSUSC84_0426"
FT                   /note="HMMPfam hit to PF08860, DUF1827, score 6.3e-58"
FT                   /inference="protein motif:HMMPfam:PF08860"
FT   CDS_pept        complement(478832..479299)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0427"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0443"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51205"
FT                   /protein_id="CAZ51205.1"
FT                   /translation="MPMEKIAVFGEKKAGVSYQSRFGVYAVIPDEKKEQIILVQAPNGA
FT                   WFLPGGEIEKGENHLIALERELMEELGFTAEIGKYFGQADEYFYSSHRDTHFYNPAYIY
FT                   EVTSYHQIGQPLEDFNHIAWFPVNEAIDKLKRGSHKWGIEQWKLQENSFNN"
FT   misc_feature    complement(478853..479242)
FT                   /locus_tag="SSUSC84_0427"
FT                   /note="HMMPfam hit to PF00293, NUDIX, score 1.7e-19"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    complement(479084..479149)
FT                   /locus_tag="SSUSC84_0427"
FT                   /note="ScanRegExp hit to PS00893, NUDIX, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        complement(479479..481707)
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="SSUSC84_0428"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0444"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51206"
FT                   /protein_id="CAZ51206.1"
FT                   /translation="MLCKNCNINDATIHLYTNLNGKQQQVDLCHNCYQIMKTDPHNAIL
FT                   RGLGDLTNPNNMDPFSEFFNHLGGYPGNTPAGKNREQTPPTQAGGHNGRGGQTPPPQQP
FT                   QQPNGLLEEFGINVTEIARRGDIDPVIGRDQEITRVIEILNRRTKNNPVLIGEPGVGKT
FT                   AVVEGLAQKIVDGDVPQKLRDKEVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRNRREI
FT                   ILFIDEIHEIVGAGSAGDGNMDAGNILKPALARGEMQLVGATTLNEYRIIEKDAALERR
FT                   MQPVKVEEPSVEETITILKGIQNKYQDYHHVKYSDAAIEAAAVLSNRYIQDRFLPDKAI
FT                   DLLDEAGSKMNLTLNFIDPKEIDQRLIDSENRKAQATRDEDYEKAAYFRDQIAKYKEMQ
FT                   KATISEEDIPLITEKEIEAIVEQKTNIPVGDLKEKEQSQLVSLASDLKAHVIGQDEAVD
FT                   KIAKAIRRNRVGLGAPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIRFDMSEY
FT                   MEKHAVAKLVGAPPGYVGYEEAGQLTEKVRRNPYSLILLDEVEKAHPDVMHMFLQVLDD
FT                   GRLTDGQGRTVSFKDTIIIMTSNAGTGKVEASVGFGAAMEGRTQSVLGQLSNFFTPEFM
FT                   NRFDGIIEFQPLSKENLLEIVSLMLDDVNKRLSHNGISLHVTDKVKEKLVDLGYNPKMG
FT                   ARPLRRTIQDQIEDAITDFYLEHPAEKDLRAVMSSKGTIQIKAQTKTK"
FT   misc_feature    complement(479785..480282)
FT                   /gene="clpE"
FT                   /locus_tag="SSUSC84_0428"
FT                   /note="HMMPfam hit to PF07724, AAA_2, score 6.3e-98"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    complement(480121..480177)
FT                   /gene="clpE"
FT                   /locus_tag="SSUSC84_0428"
FT                   /note="ScanRegExp hit to PS00871, CLPAB_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00871"
FT   misc_feature    complement(480514..480621)
FT                   /gene="clpE"
FT                   /locus_tag="SSUSC84_0428"
FT                   /note="HMMPfam hit to PF02151, UVR, score 0.0014"
FT                   /inference="protein motif:HMMPfam:PF02151"
FT   misc_feature    complement(480940..480978)
FT                   /gene="clpE"
FT                   /locus_tag="SSUSC84_0428"
FT                   /note="ScanRegExp hit to PS00870, CLPAB_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00870"
FT   misc_feature    complement(480973..481257)
FT                   /gene="clpE"
FT                   /locus_tag="SSUSC84_0428"
FT                   /note="HMMPfam hit to PF00004, AAA, score 2.8e-12"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   CDS_pept        481931..482161
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0445"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51207"
FT                   /protein_id="CAZ51207.1"
FT                   /translation="MESHLVRIINRLEAMANDGGTLKRNFERDGIVVAEVAYSYDEENG
FT                   SVFTLRDVAARETYAFDSIDLIAMEIYELLY"
FT   misc_feature    481952..482155
FT                   /locus_tag="SSUSC84_0429"
FT                   /note="HMMPfam hit to PF08796, DUF1797, score 1.7e-33"
FT                   /inference="protein motif:HMMPfam:PF08796"
FT   CDS_pept        482287..482976
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0430"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0446"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51208"
FT                   /protein_id="CAZ51208.1"
FT                   /translation="MNFSFLPEYWAYFNYGAIVTLIIAFFSVFFGSILGVLLAFAQRSK
FT                   YKVLAWTANIYVWIFRGTPMIVQIMIAFAMTHFVAPTFQLGILTVDLTRLIPGIIVISM
FT                   NSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKQAMRYVIMPQAIKNILPALGNEFVTI
FT                   VKDSSLLSTIGVMELWNGAQTVQSTSYIPLTPLVFAASYYLIMTTVLTVIIQSFEKKLN
FT                   KGGQFHV"
FT   misc_feature    482323..482955
FT                   /locus_tag="SSUSC84_0430"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 8.2e-32"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(482329..482397,482455..482523,482857..482925)
FT                   /locus_tag="SSUSC84_0430"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0430 by TMHMM2.0 at aa 15-37, 57-79 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        482969..483703
FT                   /transl_table=11
FT                   /gene="glnQ3"
FT                   /locus_tag="SSUSC84_0431"
FT                   /product="putative glutamine transporter, ATP-binding
FT                   protein 3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0447"
FT                   /note="Similar to SSU0884, 65.984% identity (65.984%
FT                   ungapped) in 244 aa overlap (1-244:1-244); SSU1676, 58.436%
FT                   identity (58.678% ungapped) in 243 aa overlap
FT                   (3-244:4-246); SSU1192, 55.556% identity (56.017% ungapped)
FT                   in 243 aa overlap (4-244:2-244); and SSU1851, 54.545%
FT                   identity (55.230% ungapped) in 242 aa overlap
FT                   (5-243:1-242)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51209"
FT                   /protein_id="CAZ51209.1"
FT                   /translation="MSNAIISIKDLHKYFGKNEVLKGIDLDIQQGQVVVIIGPSGSGKS
FT                   TFLRTMNLLEVPTKGTVTFEGVDITDKSNDIFKMREKMGMVFQQFNLFPNMTVLDNITL
FT                   SPIKTKGIAKDEAEKKAKELLEKVGLPDKANAYPQSLSGGQQQRIAIARGLAMDPDVLL
FT                   FDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMDGGVIVEDG
FT                   TPEEVFEHTKEERTKDFLSKVL"
FT   misc_feature    483059..483616
FT                   /gene="glnQ3"
FT                   /locus_tag="SSUSC84_0431"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.5e-68"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    483389..483433
FT                   /gene="glnQ3"
FT                   /locus_tag="SSUSC84_0431"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        483833..484681
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SSUSC84_0432"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase]"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0448"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51210"
FT                   /protein_id="CAZ51210.1"
FT                   /translation="MTVIDGKALGVKLQAALAEKTARLKEEKGLVPGLVVILVGENPAS
FT                   QVYVRNKERSALAAGFKSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHIS
FT                   EEKVLLAIDPDKDVDGFHPTNMGKFWSGHPVMIPSTPAGIMEMFKEYQIELEGKSALVI
FT                   GRSNIVGKPMAQLLLDADATVTIAHSRTKNLPDLARQADILVVAIGRGHFVTKEFVKLG
FT                   AVVIDVGMNRDENGKLIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRSA
FT                   K"
FT   misc_feature    483836..484189
FT                   /gene="folD"
FT                   /locus_tag="SSUSC84_0432"
FT                   /note="HMMPfam hit to PF00763, THF_DHG_CYH, score 2.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00763"
FT   misc_feature    484052..484129
FT                   /gene="folD"
FT                   /locus_tag="SSUSC84_0432"
FT                   /note="ScanRegExp hit to PS00766, THF_DHG_CYH_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00766"
FT   misc_feature    484196..484675
FT                   /gene="folD"
FT                   /locus_tag="SSUSC84_0432"
FT                   /note="HMMPfam hit to PF02882, THF_DHG_CYH_C, score
FT                   2.2e-106"
FT                   /inference="protein motif:HMMPfam:PF02882"
FT   misc_feature    484604..484630
FT                   /gene="folD"
FT                   /locus_tag="SSUSC84_0432"
FT                   /note="ScanRegExp hit to PS00767, THF_DHG_CYH_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00767"
FT   CDS_pept        486130..486423
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0433"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0449"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51211"
FT                   /protein_id="CAZ51211.1"
FT                   /translation="MQKTLEKLKRSELFELLVEQAKEIESYQAKLVDLEKRIEYREAVL
FT                   GEIGSIAEASLAVTRIFEEAQLAANIYLEQVQKVTHKQSDNCEIGRTDEDGD"
FT   CDS_pept        486473..487015
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0434"
FT                   /product="putative signal peptidase I 3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0450"
FT                   /note="Similar to SSU0424, 52.308% identity (52.308%
FT                   ungapped) in 195 aa overlap (8-202:4-198)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51212"
FT                   /protein_id="CAZ51212.1"
FT                   /translation="MSEELDKIRYKERYLETLKNTIFTLVTVVALAVLIAMLWLPVLHI
FT                   YVSSMSPTLKAGDMVATVKTNTLSTGDMVAFYYNNKVLVKRVVATSGQWVNIDEQGNVY
FT                   ANGKTLDEPYVKDKAYGQTDIKLPYQVPEGQYFVMGDHRSVSIDSRNTAIGSIGEEQLV
FT                   GKLTFRIWPFHKMGVIK"
FT   misc_feature    486533..486601
FT                   /locus_tag="SSUSC84_0434"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0434 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    486602..486796
FT                   /locus_tag="SSUSC84_0434"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score
FT                   2.9e-10"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    486878..486919
FT                   /locus_tag="SSUSC84_0434"
FT                   /note="ScanRegExp hit to PS00761, SPASE_I_3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00761"
FT   CDS_pept        487034..487420
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0435"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0451"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51213"
FT                   /protein_id="CAZ51213.1"
FT                   /translation="MKILWERLFKFVQQYFREKKTAKITMVLSIIMAFGISYLLILPAI
FT                   TLETDSQESVLQSVYNQPTTVEQPVQEEQAESQLAQVQSAGSLFAEHENITVQVNYEEH
FT                   TFEQPVRLQVLPSEDSTKYIGLVR"
FT   sig_peptide     487034..487180
FT                   /locus_tag="SSUSC84_0435"
FT                   /note="Signal peptide predicted for SSUSC84_0435 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.671) with cleavage
FT                   site probability 0.466 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    487103..487171
FT                   /locus_tag="SSUSC84_0435"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0435 by TMHMM2.0 at aa 24-46"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(487421..487792)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0436"
FT                   /product="putative tranposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0452"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Lactobacillus helveticus ISl2 mobile genetic
FT                   element protein UniProt:Q48559 (EMBL:LHISL2) (268 aa) fasta
FT                   scores: E()=1.2e-13, 44.167% id in 120 aa"
FT   misc_feature    complement(487427..487792)
FT                   /locus_tag="SSUSC84_0436"
FT                   /note="HMMPfam hit to PF01609, Transposase_11, score
FT                   0.0035"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   CDS_pept        487778..488605
FT                   /transl_table=11
FT                   /gene="srtC2"
FT                   /locus_tag="SSUSC84_0437"
FT                   /product="sortase SrtC2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0453"
FT                   /note="Previously sequenced as Streptococcus suis
FT                   sortase-like protein SrtE UniProt:Q8VUN6 (EMBL:AB066355)
FT                   (275 aa) fasta scores: E()=8.4e-98, 100.000% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51215"
FT                   /protein_id="CAZ51215.1"
FT                   /translation="MASQIRHDLSLLVFFLITGLLLLLYPTVSDYWNSHYQSEAVATYS
FT                   EKLLDISKEEKQKILENVSAYNNTLEKGTIPNLNIDSVALKKYDSILNITDTGIMGYVE
FT                   IPKLQTTLPIYHGTDDAVLQVAVGHLAGTSLPIGGQGSHAAISGHRGLPSAKLFSDLDQ
FT                   LVIGDTFMIQVLDNTLTYEIDKIITVTPDDVSPLMIDPNEDFVTLVTCTPYGVNSHRLL
FT                   VRGHRIENQLLARQVVSEGSIVKPILVSPFIALCLLGLLWSLFFIKKEVNLFM"
FT   misc_feature    join(487802..487861,488516..488575)
FT                   /gene="srtC2"
FT                   /locus_tag="SSUSC84_0437"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0437 by TMHMM2.0 at aa 9-28 and 247-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    488084..488461
FT                   /gene="srtC2"
FT                   /locus_tag="SSUSC84_0437"
FT                   /note="HMMPfam hit to PF04203, Sortase, score 3.6e-58"
FT                   /inference="protein motif:HMMPfam:PF04203"
FT   CDS_pept        488735..488899
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0438"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0454"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Enterococcus faecalis (Streptococcus faecalis)
FT                   hypothetical protein UniProt:Q835N7 (EMBL:AE016951) (153
FT                   aa) fasta scores: E()=4.6e-11, 66.667% id in 57 aa"
FT   CDS_pept        488988..489398
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0439"
FT                   /product="MerR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0455"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51217"
FT                   /protein_id="CAZ51217.1"
FT                   /translation="MNIKEVSDVTGLSADTIRYYERVGLIPKIARKSSGVRDFVENDVA
FT                   VLEFVRCFRSAGMSIERLIEYMGLVQAGDSTVEARIDLLKEEREVLQSRLSKIQQALER
FT                   LDYKIENYQTILRGAENQLFTDGSGSCKKDRE"
FT   misc_feature    488988..489053
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1649.000, SD 4.80 at aa 3-24, sequence
FT                   MNIKEVSDVTGLSADTIRYYER"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    488991..489104
FT                   /locus_tag="SSUSC84_0439"
FT                   /note="HMMPfam hit to PF00376, MerR, score 3.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   CDS_pept        complement(489424..489735)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0440"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0456"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51218"
FT                   /protein_id="CAZ51218.1"
FT                   /translation="MPLRHYQSHEYQYEEYIPKEKKANFQTYQAKNANKERLKELLFFV
FT                   NIAFFSLITVIASYVYLSVGIPVFIAIILASATGFLGLRLVQIGLKKKFKPKQVIRKN"
FT   misc_feature    complement(join(489478..489546,489556..489615))
FT                   /locus_tag="SSUSC84_0440"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0440 by TMHMM2.0 at aa 41-60 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        489896..490825
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0441"
FT                   /product="putative peptidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0457"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51219"
FT                   /protein_id="CAZ51219.1"
FT                   /translation="MEKIIITATAESIEQVKELLVAGVDRIYVGEADHALRIPTNFTYD
FT                   ELREIAELVHSAGKELTVAANALMHQDMMDNIKPFMELMREIKVDYLVVGDTGIFYINK
FT                   RDGYNFKLIYDTSVFVTSSRQINFWKDHGAVEAVLAREIPSEELFDIAKNLEMPAEILV
FT                   YGASVIHHSKRTLLQNYYNFTKADETDLSRGRGLFLAEPSDPDSHYSIFEDKHGTHIFI
FT                   NNDIDMMTKLSELDEHGYHNWKLDGIYCPGQNFVEIVKLFVQARDLIEKGDFTYDQAFL
FT                   LDEQVRKLHPAERGLDTGFYEFDRNKVK"
FT   misc_feature    490115..490816
FT                   /locus_tag="SSUSC84_0441"
FT                   /note="HMMPfam hit to PF01136, Peptidase_U32, score
FT                   9.7e-74"
FT                   /inference="protein motif:HMMPfam:PF01136"
FT   CDS_pept        491120..492409
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0442"
FT                   /product="putative peptidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0458"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51220"
FT                   /protein_id="CAZ51220.1"
FT                   /translation="MMSKTLKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRA
FT                   GNFTMDEMREGIEYAHARGAKVYVAANMVTHEGNEEGAGAWFRELRDMGLDAVIVSDPA
FT                   LIVICATEAPGLEIHLSTQASSTNYETFEFWKELGLTRVVLAREVTMEEVAEIRKRTDV
FT                   EIEAFVHGAMCISYSGRCVLSNHMSKRDANRGGCSQSCRWKYNLYDLPFGEERRSIKGE
FT                   IPEEFSMSAVDMCMIDHIPDMIENGVDSLKIEGRMKSVHYVSTVTNCYKAAVDAYLESP
FT                   ERFEAIKQDLIDEMWKVAQRELATGFYYSPPSENEQLFGARRKIPEYKFIAEVVAFDKE
FT                   TMTATIRQRNVINEGDQVEFYGPGFRHFETTIQDLHDSNGEKIDRANKPMELLTIKLDR
FT                   EIYPGDMIRACKSGLINLYQEDGQSLTIRA"
FT   misc_feature    491357..492061
FT                   /locus_tag="SSUSC84_0442"
FT                   /note="HMMPfam hit to PF01136, Peptidase_U32, score
FT                   6.8e-128"
FT                   /inference="protein motif:HMMPfam:PF01136"
FT   misc_feature    491615..491671
FT                   /locus_tag="SSUSC84_0442"
FT                   /note="ScanRegExp hit to PS01276, PEPTIDASE_U32, score NA"
FT                   /inference="protein motif:Prosite:PS01276"
FT   CDS_pept        492535..492651
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0443"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0459"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51221"
FT                   /protein_id="CAZ51221.1"
FT                   /translation="MLRKCYLQPPKVPQTFGASTKSKLKDYKKAEISASERR"
FT   CDS_pept        complement(492825..493148)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0460"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51222"
FT                   /protein_id="CAZ51222.1"
FT                   /translation="MKRFLEVIFEQFTIFLEHGKAPKSIEPDSKEEIKNNLELALYKKA
FT                   AVHVIYGDRSFTGDIVKYDTDRQRIIMKNFKRQVTSIIKIEDIKKVTLVPDSIKTSQQQ
FT                   TKG"
FT   CDS_pept        493240..493455
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0461"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51223"
FT                   /protein_id="CAZ51223.1"
FT                   /translation="MAEFTFEIEEKLLVLSENDKGWTKELNRVSFNGAPAKYDIRTWSP
FT                   DHTKMGKGITLSNEEFQVLLDAFANK"
FT   CDS_pept        complement(493467..494006)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0446"
FT                   /product="BioY family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0462"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51224"
FT                   /protein_id="CAZ51224.1"
FT                   /translation="MKTTSIKSLVYIAIGTALISTLSQISLSIGPVPFTLQTLAIGLVA
FT                   CLYKPKEAITSVSLYLVLGAIGLPVFAGFSGGFAALTGPTSGFLWGFLLYTIITSALTK
FT                   SDSSPVTIFLACLLGTSICFLLGCCVFKLVSGASWTDTIGWTVLPFILPDLAKITLVMI
FT                   CHRLLQPVIKKEAYFA"
FT   misc_feature    complement(493491..493934)
FT                   /locus_tag="SSUSC84_0446"
FT                   /note="HMMPfam hit to PF02632, BioY, score 4.1e-27"
FT                   /inference="protein motif:HMMPfam:PF02632"
FT   misc_feature    complement(join(493614..493682,493710..493778,
FT                   493782..493850,493920..493988))
FT                   /locus_tag="SSUSC84_0446"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0446 by TMHMM2.0 at aa 7-29, 53-75, 77-99 and
FT                   109-131"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(493887..494006)
FT                   /locus_tag="SSUSC84_0446"
FT                   /note="Signal peptide predicted for SSUSC84_0446 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.905) with cleavage
FT                   site probability 0.434 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        494211..494948
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0447"
FT                   /product="putative cyclase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0463"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51225"
FT                   /protein_id="CAZ51225.1"
FT                   /translation="MTELLDIYRTLKSKTWVDLTHQINEKSPHFPALPALEKKALFTHK
FT                   DGFFVEQFTVVGQYGTHIDPPIHFVEGARYLDEIDLKDLLLPLYVIDKSAAVIENNDYE
FT                   ITKQDILDFEAEYGPIAPKSFVAFRSDLSKRWPSQDAIRNLDEDGVQRTPGWSHEALEY
FT                   LIEERQVKAVGHETLDTDSGVSAAKHGGSLSEEYYLLSKDIYQLEVLANLDQVPPTGAL
FT                   ISIAFPHWEKASGSPVRAIAILP"
FT   misc_feature    494256..494900
FT                   /locus_tag="SSUSC84_0447"
FT                   /note="HMMPfam hit to PF04199, Cyclase, score 1.3e-52"
FT                   /inference="protein motif:HMMPfam:PF04199"
FT   CDS_pept        complement(494998..496347)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SSUSC84_0448"
FT                   /product="glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0464"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51226"
FT                   /protein_id="CAZ51226.1"
FT                   /translation="MKVFDIIAIGGGSGGIATMNRAAMYGAKAAVIEGSYLGGTCVNLG
FT                   CVPKKIMWYGSQVAEAIQHYGPEYGFTSQEVTFDFATLRKNREAYIERSRASYGNTFNN
FT                   NEVEVIQGFARFVDNQTVEVNGELIRAKHIVITTGAKPVVPAIPGSELGIVSDDVFAWE
FT                   ELPSSVAVIGAGYIAVEMAGLLHGLGVQTDLFVRGNRPLRSFDTYIVDALMEEMQRTNL
FT                   PLHTGKTPVSLEKTDDGQIQINFADGSNHIAQKVLWAIGRKPNIDKLNLKATSVQLTSS
FT                   GHISVNEYQETAVPGIYALGDVTGEKELTPVAIKAGRLLAERLFNNKPTAKMDYTTIPT
FT                   VVFSHPAIGTVGLTEDEAITQYGQDNVKVYTSAFTSMYTALENNRQMAKFKLVTVGENE
FT                   KVVGLHGIGYGVDEMIQGFSVAIKMGATKEEFDAVVAIHPTGSEEFVTMR"
FT   misc_feature    complement(495001..495336)
FT                   /gene="gor"
FT                   /locus_tag="SSUSC84_0448"
FT                   /note="HMMPfam hit to PF02852, Pyr_redox_dim, score
FT                   1.5e-47"
FT                   /inference="protein motif:HMMPfam:PF02852"
FT   misc_feature    complement(495427..496335)
FT                   /gene="gor"
FT                   /locus_tag="SSUSC84_0448"
FT                   /note="HMMPfam hit to PF07992, Pyr_redox_2, score 1.6e-59"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    complement(495565..495846)
FT                   /gene="gor"
FT                   /locus_tag="SSUSC84_0448"
FT                   /note="HMMPfam hit to PF00070, Pyr_redox, score 1.8e-27"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   misc_feature    complement(496204..496236)
FT                   /gene="gor"
FT                   /locus_tag="SSUSC84_0448"
FT                   /note="ScanRegExp hit to PS00076, PYRIDINE_REDOX_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00076"
FT   CDS_pept        496561..497718
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0449"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0465"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51227"
FT                   /protein_id="CAZ51227.1"
FT                   /translation="MLKTKKAKIALFGGLGVVAVALVGGALIFSNMLTSPSSSEDVAMS
FT                   MTYTVAKEGSIASSTLLTGTITAADEQYVYYDPSKGDLSEVLVAPGAKVEVGTPLIRYD
FT                   ATELQSALDTAVRGRDKIGRQIADLRTNGQTVQTTGDAETDAAATATAQRSVDMQLADL
FT                   NDSYADAQAAVDKAYTALTEATVTSTVAGTVVEVNKAVSKNSTSSQTVVHIVNQGSLQV
FT                   TGSLTEYDLANIAVDQEVKLTSKVYPDKTWTGKITYISNYPSSNQAGAATTGTSGSGAK
FT                   YPFKAALTSELGELKQGFSVNIEVVNTSKNILIPVSAVVPEEDKNYVWTLVDGKAKKVE
FT                   VTLGNADALNQEVTAGIAAGDKVITIPTPNLEDGKEVEANEEPAY"
FT   sig_peptide     496561..496677
FT                   /locus_tag="SSUSC84_0449"
FT                   /note="Signal peptide predicted for SSUSC84_0449 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.797 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    496579..496647
FT                   /locus_tag="SSUSC84_0449"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0449 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        497699..498394
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0450"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0466"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51228"
FT                   /protein_id="CAZ51228.1"
FT                   /translation="MKNQLIRLTSINKSYKNGDQELRVLKNIDLEVEEGEFLAIMGPSG
FT                   SGKSTLMNIIGLLDRFSSGNYWLEGEEVSQLSEKKLAQVRNDQIGFVFQQFFLLSKLNA
FT                   LQNVELPLIYAGVPSSKRKELAKQYLEKVELAERMTHLPSELSGGQKQRVAIARALVNT
FT                   PAIILADEPTGALDTKTGEQIMQLLTELNNEGKTIIMVTHEPEIAAYAKRKIVLRDGVI
FT                   TEDSRREGV"
FT   misc_feature    497801..498358
FT                   /locus_tag="SSUSC84_0450"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 4.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    498134..498178
FT                   /locus_tag="SSUSC84_0450"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        498395..499642
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0451"
FT                   /product="putative permease"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0467"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51229"
FT                   /protein_id="CAZ51229.1"
FT                   /translation="MENWKFALKSIMAHKMRSLLTMLGIIIGVAAVVIIVAMGTGVAKS
FT                   IEKSLAGDQNNVQVYFTAFSSSGTAFGPFGTASTEEPILEEEPDLTDSTLKGLLEIDGV
FT                   SNYYSSISNIAEVRSGNKKAENVTITGVSQNFFAVKEYEILAGRQFTANDYSRFSRMIM
FT                   LDTALAEKLFGSIENSLNQTISVNSNAYLVIGVYKDPKAGTAIYGMNSGGNAVMTNTQL
FT                   AAETGMKENSQIFVHVEDVTRATEVGKAAADYLTKATGLKEARYEIYDMSAMLEEFKSQ
FT                   MSGVTLFIGAVAGISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRGNILIQFLIEA
FT                   MVLTTLGGAIGLAIAQTIVFLLNVSKALGERIAAEISIPVVLGSLAFSAVVGIVFGVLP
FT                   ANKASKLDPIEALRYE"
FT   sig_peptide     498395..498529
FT                   /locus_tag="SSUSC84_0451"
FT                   /note="Signal peptide predicted for SSUSC84_0451 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.625 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(498452..498520,499256..499324,499382..499477,
FT                   499520..499588)
FT                   /locus_tag="SSUSC84_0451"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0451 by TMHMM2.0 at aa 20-42, 288-310, 330-361 and
FT                   376-398"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    499085..499618
FT                   /locus_tag="SSUSC84_0451"
FT                   /note="HMMPfam hit to PF02687, FtsX, score 3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   CDS_pept        499768..500832
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0452"
FT                   /product="luciferase-like monooxygenase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0468"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51230"
FT                   /protein_id="CAZ51230.1"
FT                   /translation="MVELGISTFGETTPLEKTGETYSHDERIRQLVKEIELADAVGLDV
FT                   YGIGEHHREDFAVSAPEIVLAAGAVNTKHIKLTSAVSILSSMDPVRLYQQYTTIDALSN
FT                   GRAEIMAGRGSFTESFPLFGYDLHDYEELFDEKLDMLLEIGKETNLKWDGHFTQSVDNK
FT                   PVYPRPVQEDFPIWVATGGNVESTIKIAKKGLPIVYAVIGAGAHRFKPLVDAYRKVARN
FT                   SGHDPKKTKVAAHSWGWIADDHDKAVEEYYHPTKVITDNIAKDRPHWSEMTKAQYLYSL
FT                   TDEGATIVGDPKRVAEKIIKTIETLDLDRFFLHLPIGSMPHEDVLRAIELYGKEVVPIV
FT                   RDYFAKKEENQSQD"
FT   misc_feature    499771..500787
FT                   /locus_tag="SSUSC84_0452"
FT                   /note="HMMPfam hit to PF00296, Bac_luciferase, score
FT                   2.4e-22"
FT                   /inference="protein motif:HMMPfam:PF00296"
FT   CDS_pept        complement(501032..501268)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0453"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0469"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51231"
FT                   /protein_id="CAZ51231.1"
FT                   /translation="MEIPRVFLHSKIPTTWSGFSGDYEKYLGLGVGKNSNNHREFVNKF
FT                   IFPVVELKQSIPRLFHSHPRTAPKVWGTFGGRR"
FT   CDS_pept        complement(501420..502910)
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SSUSC84_0454"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0470"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51232"
FT                   /protein_id="CAZ51232.1"
FT                   /translation="MSTEHFEELNDQQIVRREKMTALAEQGIDPFGKRFERSANSAELK
FT                   AQYEDKSKEDLEELGQTAIIAGRIMTKRGKGKAGFAHIQDREGQIQIYVRKDDVSEENY
FT                   EIFKKADLGDFIGVEGDVFKTNVGELSIHARKLTHLSKALRPLPEKFHGLTDIETRYRK
FT                   RYLDLITNRESFDRFVTRSKIISEIRRYLDGLGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADY
FT                   QDIMDLTEGIIQHTAKAVVGDGPVTYQGTEIAIHEPFKRIHMVDAIKEQTGVDFWQEMS
FT                   FEEAKALAAEHKVPVEKHHTEVGQIINSFFEEYVEATLIQPTFVYGHPVAVSPLAKKND
FT                   EDPRFTDRFELFIMTKEYGNAFTELNDPIDQLERFEAQAKAKELGDDEATGVDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   misc_feature    complement(501423..502445)
FT                   /gene="lysS"
FT                   /locus_tag="SSUSC84_0454"
FT                   /note="HMMPfam hit to PF00152, tRNA-synt_2, score 7.1e-119"
FT                   /inference="protein motif:HMMPfam:PF00152"
FT   misc_feature    complement(502491..502724)
FT                   /gene="lysS"
FT                   /locus_tag="SSUSC84_0454"
FT                   /note="HMMPfam hit to PF01336, tRNA_anti, score 8.1e-20"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   CDS_pept        complement(503013..503639)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0455"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0471"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51233"
FT                   /protein_id="CAZ51233.1"
FT                   /translation="MKIYFVRHGKTEWNLEGRFQGYSGDSALLPESYQDLEKLGKYLAE
FT                   IPFDAIYSSDLQRAHSTAVEIAKANHHCQTVLTTQQLREWNFGTLEGSKMAIFRAIYPK
FT                   QAWALKHNLALFNNDLFEAESVRQVTQRMVDFVQSLKGQDMETVLIVSHGAFLTASIHR
FT                   LLGFPPAQLRHRGGLDNASVTILETSDFENFTELAWNDTSYKAKQ"
FT   misc_feature    complement(503160..503636)
FT                   /locus_tag="SSUSC84_0455"
FT                   /note="HMMPfam hit to PF00300, PGAM, score 3.5e-43"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   CDS_pept        complement(503642..504124)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0472"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51234"
FT                   /protein_id="CAZ51234.1"
FT                   /translation="MAKKVKIKKTLVDQILDKAKINHDSLVLNAFEGQLPPGIEEHEIY
FT                   KTLALTGDKTGPIIGIIPITEHLSEKKLAKISGNKKVSMIPQKDLEKTTGYIHGANNPV
FT                   GIRQKHNFPIYIDQSALELGHLIVSAGEIGRSIRIDSQVLADFVKADFADLIEGRD"
FT   misc_feature    complement(503660..504073)
FT                   /locus_tag="SSUSC84_0456"
FT                   /note="HMMPfam hit to PF04073, YbaK, score 7e-54"
FT                   /inference="protein motif:HMMPfam:PF04073"
FT   CDS_pept        complement(504124..504966)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0457"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0473"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51235"
FT                   /protein_id="CAZ51235.1"
FT                   /translation="MASWISRIIKGMIIALGFILPGVSGGVLAAILGIYERLIGFLANI
FT                   RKDFKENFLYFVPVGIGGILGIALFSFPVEFLLQHFQVPVLWAFAGAIVGTIPSLLKES
FT                   TQKSKRDSIDLAWLIGTFIISGLLLYNLSDLVGTLPATFASFVLAGALIALGVLVPGLS
FT                   PSNLLLILGIYTPMLNGFKSLDLFGTFLPIAIGGVLAMVAFSKAMDHALKVYHSRVYHF
FT                   IIGIVSSSTLLILIPQASNKESISYAGANFVTWIAAIVLFILGAWLGLWMSKLEEKYK"
FT   misc_feature    complement(join(504154..504213,504256..504315,
FT                   504352..504411,504484..504552,504571..504624,
FT                   504667..504720,504739..504807,504865..504933))
FT                   /locus_tag="SSUSC84_0457"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0457 by TMHMM2.0 at aa 12-34, 54-76, 83-100,
FT                   115-132, 139-161, 186-205, 218-237 and 252-271"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(504157..504957)
FT                   /locus_tag="SSUSC84_0457"
FT                   /note="HMMPfam hit to PF04018, DUF368, score 3.9e-107"
FT                   /inference="protein motif:HMMPfam:PF04018"
FT   sig_peptide     complement(504880..504966)
FT                   /locus_tag="SSUSC84_0457"
FT                   /note="Signal peptide predicted for SSUSC84_0457 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.921) with cleavage
FT                   site probability 0.873 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(505069..505617)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0458"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0474"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51236"
FT                   /protein_id="CAZ51236.1"
FT                   /translation="MPTSKLPILAEVAIFSAIALVFDKIPLFTMPQGGSVSLVMLPILL
FT                   LALRHGLGVGVLTGGIVGTIQLFYGGYFLNVFQVFLDYAFSYAGIGLAGLVAPTLSKQN
FT                   NLKNATLIITLASFLGGSIRLLATFLSGIIFYADYAPDGMPVWFYSFTYNISYILPSTA
FT                   IASILLILLYRARPGFYNL"
FT   misc_feature    complement(join(505099..505167,505210..505278,
FT                   505315..505383,505396..505464,505477..505545))
FT                   /locus_tag="SSUSC84_0458"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0458 by TMHMM2.0 at aa 25-47, 52-74, 79-101,
FT                   114-136 and 151-173"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_RNA        complement(505676..505771)
FT                   /locus_tag="SSUSC84_m0004"
FT                   /note="TPP riboswitch (THI element) (RF00059) as predicted
FT                   by Rfam, score 76.06"
FT   CDS_pept        complement(505795..506649)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0459"
FT                   /product="glycosyl hydrolases family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0475"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51237"
FT                   /protein_id="CAZ51237.1"
FT                   /translation="MRKKLNPMIVVGFFLSFFALIFITGVTGNTVNKTEVANEPAVTQS
FT                   NTSTSSKTTNSSSSYYIANALEMKPIIDVSAWQRPSEIDYDTLSKNISGAIVRIQSGSH
FT                   TKNENTATDKNGLDKSFDTHIKEFQARNIPVAVYAYVTGNSIENMREEARSFYKAANKY
FT                   KPTFYWLDVEEYTMDDMNAGVEAFRKELETLGAKNIGIYVGTYFMEDHSINVDKFDAIW
FT                   IPTYGDDSGYYNAAPNTDLNYDLHQYTSRGYVNGFEHHLDLNIITTLKDPNEVYQKLFT
FT                   TPE"
FT   misc_feature    complement(505879..506436)
FT                   /locus_tag="SSUSC84_0459"
FT                   /note="HMMPfam hit to PF01183, Glyco_hydro_25, score
FT                   7.6e-07"
FT                   /inference="protein motif:HMMPfam:PF01183"
FT   sig_peptide     complement(506566..506649)
FT                   /locus_tag="SSUSC84_0459"
FT                   /note="Signal peptide predicted for SSUSC84_0459 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.842 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(506569..506637)
FT                   /locus_tag="SSUSC84_0459"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0459 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        506762..507181
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0460"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0476"
FT                   /note="Possible gene remnant. Similar to the C-terminal
FT                   regions of many protein, for example, Streptococcus mutans
FT                   hypothetical protein SMU.709. UniProt:Q8DV12
FT                   (EMBL:AE014914) (174 aa) fasta scores: E()=5.2e-09, 38.281%
FT                   id in 128 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51238"
FT                   /protein_id="CAZ51238.1"
FT                   /translation="MHDKSEKVRRVSQLVVLSYFSLLESWILMILVMVGSGLLFGFGTV
FT                   VLWQVLSFAFIQFIWWLAIGPFIKKENIPLWLQSLLAGILVFLYGLTISFLSATQFGTS
FT                   PIVFWLNGLVFDSLHATSTVLFYPIIDYIFRRFYK"
FT   misc_feature    join(506798..506866,506894..506962,506981..507049,
FT                   507077..507145)
FT                   /locus_tag="SSUSC84_0460"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0460 by TMHMM2.0 at aa 13-35, 45-67, 74-96 and
FT                   106-128"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        507178..507543
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0461"
FT                   /product="putative lipoprotein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0477"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51239"
FT                   /protein_id="CAZ51239.1"
FT                   /translation="MKKISIMLMVVFSLFLAACTNTTEKQNNSAIEVTLQITTKDKENR
FT                   QEVTAEEGDSVMDVLKEHHDIVEDNGLITEIDGVSQDTSTNTYWMYKVNGQMADKGAKD
FT                   LTVANGDEIEFYLETFE"
FT   sig_peptide     507178..507231
FT                   /locus_tag="SSUSC84_0461"
FT                   /note="Signal peptide predicted for SSUSC84_0461 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.795) with cleavage
FT                   site probability 0.477 between residues 18 and 19"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        507680..508894
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SSUSC84_0462"
FT                   /product="putative cell division protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0478"
FT                   /note="CDS is truncated at the C-terminus in comparison to
FT                   orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51240"
FT                   /protein_id="CAZ51240.1"
FT                   /translation="MKIDKRQLLNYSILIPYLILSVIGLVMVYSTTSATQIINGGNPFR
FT                   TVINQAGFWIVSLVAIYTIYRMKLSFLRKKAVIYSVILVEVFLLAISRLFPPINGAHGW
FT                   IPLPIAGTLQPAEYLKLIIIWYLAHEFAKQQADIRTYDYVSLIKGSWIPKEFTDWRVVS
FT                   LLLLGLVATLPDLGNATIIVLIMVVMISVSGIAYRWFSTAVLGIVAASTVILGTIRILG
FT                   VETVEKIPLFGYIARRFAAYFDPFGNATNSGLQLTHSYYAMSNGGWLGRGLGNSIEKKG
FT                   YLPEAHTDFAFSIVIEELGFVGASLILALLFFLIIRIIIVGVRARSPFNAMMALGMAGM
FT                   LLIQTFVNIGGISGIIPATGVTFPFLSQGGSSLLIISIGIGFVLNIDASEKRRLIEEEI
FT                   ERTLI"
FT   misc_feature    join(507704..507772,507815..507874,507908..507967,
FT                   508187..508255,508274..508342,508574..508642,
FT                   508679..508747,508760..508828)
FT                   /gene="ftsW"
FT                   /locus_tag="SSUSC84_0462"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0462 by TMHMM2.0 at aa 9-31, 46-65, 77-96, 170-192,
FT                   199-221, 299-321, 334-356 and 361-383"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    507707..508855
FT                   /gene="ftsW"
FT                   /locus_tag="SSUSC84_0462"
FT                   /note="HMMPfam hit to PF01098, FTSW_RODA_SPOVE, score
FT                   7.3e-83"
FT                   /inference="protein motif:HMMPfam:PF01098"
FT   CDS_pept        508915..511611
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="SSUSC84_0463"
FT                   /product="putative phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0479"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51241"
FT                   /protein_id="CAZ51241.1"
FT                   /translation="MAIQKLENYNNKEAIREEVTILTSILEEVAAQMMPAETFAKIVEL
FT                   SQLSRQDDYQALIAIISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQD
FT                   YLGKISTTIDMVSKQENAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRD
FT                   VKLGLLNKNKWEDELRCYIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVTKLQR
FT                   EYKRLAAEKGIVLNNPRPITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDEQL
FT                   YKLYRNFSLSTSIVNVSTAVKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVH
FT                   NKPSDVRYSNVAEFKADLLAIKQSLVENKSMALLKGDFTELLEAVEAFGFYLASIDMRQ
FT                   DSSIHEASVAELLASARIVEDYSSLSEEAKCHVLLKQLETDPRILSATHMPKSEQLEKE
FT                   LAIFAAARELKDKLGEEIIKQHIISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLF
FT                   ETIEDLDNAPDTMRQYLQLDLAKRWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQ
FT                   NELTQIGQDYGVNITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNK
FT                   YGNKDAAYYNLEMLVSATLDRMVTQMITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNP
FT                   HFYDYFFAASPIREVSSLNIGSRPAARKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVG
FT                   SSFKRFIDKHPDNLSKLQKMYESWPFFRSLLSNVDMVLSKSNMNIAFEYAKMCESEEVR
FT                   NIFHVILDEWQLTKEIILSIEQNDELLAELPFLKASLDYRMPYFNVLNYIQIELIHRLR
FT                   RGELSKEQENLIHITINGVATGLRNSG"
FT   misc_feature    508915..511608
FT                   /gene="ppc"
FT                   /locus_tag="SSUSC84_0463"
FT                   /note="HMMPfam hit to PF00311, PEPcase, score 1.6e-92"
FT                   /inference="protein motif:HMMPfam:PF00311"
FT   misc_feature    509314..509349
FT                   /gene="ppc"
FT                   /locus_tag="SSUSC84_0463"
FT                   /note="ScanRegExp hit to PS00781, PEPCASE_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00781"
FT   misc_feature    510568..510606
FT                   /gene="ppc"
FT                   /locus_tag="SSUSC84_0463"
FT                   /note="ScanRegExp hit to PS00393, PEPCASE_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00393"
FT   CDS_pept        511726..512229
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0464"
FT                   /product="RNA polymerase sigma factor protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0480"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51242"
FT                   /protein_id="CAZ51242.1"
FT                   /translation="MSIKLDQYEKEVIGIAEEISYYLQKSGANYADSQDIAQDILVKIL
FT                   EAELVLPFEKLRAWLYRSAVRAYIDKYRRDKRYHEILQKEFFTPENFLVYDQEDYEELY
FT                   QAVADLPEKYQQVIDLYYFQDMSIKEIAHILGAGQSWVKISLHRGRKQLRKILEERGYD
FT                   YEDF"
FT   misc_feature    511789..511959
FT                   /locus_tag="SSUSC84_0464"
FT                   /note="HMMPfam hit to PF04542, Sigma70_r2, score 0.00024"
FT                   /inference="protein motif:HMMPfam:PF04542"
FT   misc_feature    512023..512184
FT                   /locus_tag="SSUSC84_0464"
FT                   /note="HMMPfam hit to PF08281, Sigma70_r4_2, score 7.3e-15"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   misc_feature    512101..512166
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1396.000, SD 3.94 at aa 126-147, sequence
FT                   MSIKEIAHILGAGQSWVKISLH"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        512216..513181
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0465"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0481"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51243"
FT                   /protein_id="CAZ51243.1"
FT                   /translation="MKTFEEVTKKSKRKNLWKTVGLSSFIGFILLLIGIQTVKIIVGAR
FT                   EGSENWKQIILMEISYPNIKHDGIKIQSTSYVSGKLYCNLYKDLAGVPMAFGQHEIYYD
FT                   LFDRHYDFAQHIPGNTFKYLYDFTTNTKIPVFYNRKKSVWSVQDIANELHYLKDMSGQL
FT                   VEVAISFDKKYSLAEIKQMIPSNLKQNWYWIGTEGKQNTHYYRPEQLLGLDPEDIQLVF
FT                   SDMPGDYMTGMDFMKEFLESGDQKRAQYLDIPVDDLQAFVDKFGDTDFTKQEEIDKLEF
FT                   AGIILTGKAEDFAQLEGKDWIYSSSIGASIPIQPYYQLHH"
FT   sig_peptide     512216..512347
FT                   /locus_tag="SSUSC84_0465"
FT                   /note="Signal peptide predicted for SSUSC84_0465 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.967) with cleavage
FT                   site probability 0.941 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    512273..512341
FT                   /locus_tag="SSUSC84_0465"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0465 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        513537..514733
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSUSC84_0466"
FT                   /product="elongation factor Tu (EF-Tu)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0482"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51244"
FT                   /protein_id="CAZ51244.1"
FT                   /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVN
FT                   QPKDYASIDAAPEERERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDG
FT                   AILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
FT                   YDFPGDDLPVIQGSALKALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVF
FT                   SITGRGTVASGRIDRGTVRVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAGDNVGV
FT                   LLRGVQRDEIERGQVISKPGSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQFYFRTT
FT                   DVTGSIKLPEGTEMVMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA"
FT   misc_feature    513564..514157
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSUSC84_0466"
FT                   /note="HMMPfam hit to PF00009, GTP_EFTU, score 4.9e-101"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    513696..513743
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSUSC84_0466"
FT                   /note="ScanRegExp hit to PS00301, EFACTOR_GTP, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    514218..514430
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSUSC84_0466"
FT                   /note="HMMPfam hit to PF03144, GTP_EFTU_D2, score 1.5e-23"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    514443..514727
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="SSUSC84_0466"
FT                   /note="HMMPfam hit to PF03143, GTP_EFTU_D3, score 2e-60"
FT                   /inference="protein motif:HMMPfam:PF03143"
FT   CDS_pept        514908..515660
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /gene_synonym="tpiA"
FT                   /locus_tag="SSUSC84_0467"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0483"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51245"
FT                   /protein_id="CAZ51245.1"
FT                   /translation="MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPA
FT                   VDLNALLWFAKDSELKVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFH
FT                   ETDEDINKKAHAIFRNGLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASL
FT                   VIAYEPIWAIGTGKSATKDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAE
FT                   YMACPDVDGALVGGASLEAESFLALLNF"
FT   misc_feature    514920..515651
FT                   /gene="tpi"
FT                   /gene_synonym="tpiA"
FT                   /locus_tag="SSUSC84_0467"
FT                   /note="HMMPfam hit to PF00121, TIM, score 3.3e-132"
FT                   /inference="protein motif:HMMPfam:PF00121"
FT   misc_feature    515403..515435
FT                   /gene="tpi"
FT                   /gene_synonym="tpiA"
FT                   /locus_tag="SSUSC84_0467"
FT                   /note="ScanRegExp hit to PS00171, TIM, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00171"
FT   CDS_pept        complement(515713..516522)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0468"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0484"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51246"
FT                   /protein_id="CAZ51246.1"
FT                   /translation="MSIKLVAIDIDGTLLNSQHQITAEVHSTIQEAKKAGVKIVIATGR
FT                   PISGVQAILEELNLTEAGDYVITFNGGLVQDAATGEDIVKDTLTYEDYLDIESAARKLK
FT                   LPMHASTKEGIYTANRNIGKYTIYESTLVSAPIFYRTPEEMADKEIIKTMMVDEPEILD
FT                   AAIPLLPTILTEKYNVAKSAPFYLEITPKTVNKGQAIIHLAEKLGLTMDQTMAIGDQEN
FT                   DRPMLEVVGNPVVMENGNPELKKIAKYITKSNDESGVAHAFREWVLK"
FT   misc_feature    complement(515734..516507)
FT                   /locus_tag="SSUSC84_0468"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 5.8e-103"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    complement(515806..515874)
FT                   /locus_tag="SSUSC84_0468"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    complement(516475..516510)
FT                   /locus_tag="SSUSC84_0468"
FT                   /note="ScanRegExp hit to PS01228, COF_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01228"
FT   CDS_pept        complement(516512..517825)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0469"
FT                   /product="putative phosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0485"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51247"
FT                   /protein_id="CAZ51247.1"
FT                   /translation="MIEKVFRDPVHNYVHVDHELIYKLINTKEFQRLRRIKQLGTTSYT
FT                   FHGGEHSRFSHCLGAYEIARRITQKFEDKYPQIWDTNESLLTMVAALLHDVGHGAYSHT
FT                   FERLFDTDHEEMTCAIITSPETEINALLKQVSPEFPDKVASVIKHTYPNKQVVQLISSQ
FT                   IDVDRMDYLLRDSYFTGANYGEFDLTRILRVIRPTENGIAFKESGMHAVEDYVLSRYQM
FT                   YMQVYFHPASRSMEVLLQNLLNRAKLLYTGEQEFFARTSPRLLPFFEHRIRLTDYLSLD
FT                   DGVMNTYFQSWIDGPDRILSDLAQRYINRKVLKSITFKAEEEEALDRLRSLVADVGFDP
FT                   EYYTAIHHNFDLPYDIYRPNAEKKRTQIEIYRKDETLVELSSLSPIVHSLSGTIHGDSR
FT                   FYFPKEMLEETGIFAPQIADFNSHIHNDHFIIGESNEH"
FT   misc_feature    complement(517301..517669)
FT                   /locus_tag="SSUSC84_0469"
FT                   /note="HMMPfam hit to PF01966, HD, score 2.1e-08"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        517924..518811
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0470"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0486"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51248"
FT                   /protein_id="CAZ51248.1"
FT                   /translation="MNNQIILLTIQVFIVALILWMLYTILSYAKKHDISLKEKFWTGFG
FT                   IGYVTDLLDTLGIGTFATTTTMFKLTKLVEDDRKIPATMTTAHIIPVLVEALLFITIVE
FT                   VDMVTLIAMAAAAFTGAFVGAKVTQKWDTKKVQRILGILLIIAACFMVYRMITNPGADL
FT                   TNEVKGLTGWKLAVGIAFDFMVGMLMSMGLGNYAPELIFFSLMGISPAVALPVMMLNAA
FT                   MIMTAGAKQFIQSGRVNWPGVPGIVVGGVLGVLTAAFFLSNLDINNLKILVVFIAAYTG
FT                   FTLLRSSFVTRIKK"
FT   misc_feature    join(517936..518004,518041..518109,518209..518277,
FT                   518338..518391,518434..518502,518521..518589,
FT                   518647..518715,518734..518793)
FT                   /locus_tag="SSUSC84_0470"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0470 by TMHMM2.0 at aa 5-27, 40-62, 96-118,
FT                   139-156, 171-193, 200-222, 242-264 and 271-290"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    518209..518379
FT                   /locus_tag="SSUSC84_0470"
FT                   /note="HMMPfam hit to PF01925, DUF81, score 2.2e-08"
FT                   /inference="protein motif:HMMPfam:PF01925"
FT   CDS_pept        518823..519209
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0487"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51249"
FT                   /protein_id="CAZ51249.1"
FT                   /translation="MDIHLRNEIDLDGQIEVVDQQFQVEVKEKDGNLYLIYSNDEAEKV
FT                   VIKCDEEELVMTRFSTPKSIMRFISGKEAIVTIPTPLGIQHFVTDTKRYQLNRSDQSVQ
FT                   LQYELKGLENQQLFASYDLEISWK"
FT   misc_feature    518823..519197
FT                   /locus_tag="SSUSC84_0471"
FT                   /note="HMMPfam hit to PF09148, DUF1934, score 5.6e-08"
FT                   /inference="protein motif:HMMPfam:PF09148"
FT   repeat_region   complement(519211..520747)
FT                   /note="Putative IS element, novel IS"
FT   CDS_pept        complement(519481..520644)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0472"
FT                   /product="putative transposase"
FT                   /note="Identical to SSU1631, 100.000% identity (100.000%
FT                   ungapped) in 387 aa overlap (1-387:1-387), SSU1247,
FT                   100.000% identity (100.000% ungapped) in 387 aa overlap
FT                   (1-387:1-387), and SSU1036, 100.000% identity (100.000%
FT                   ungapped) in 387 aa overlap (1-387:1-387)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51250"
FT                   /protein_id="CAZ51250.1"
FT                   /translation="MKNKHLTLSDRNDIQIGIEQLKPFSAIAAKLGKDPSTISKEVRRN
FT                   RVIKENSSTSNCEACPLLKKTPYVCNACPKKRSNCGYQKQFYYAKRAQLDYEVKLSDSR
FT                   TGVALNKEEFYRMDEIVSAAIQKGQHLNHIIASNEMSASRASIYRYLEKGYLSTKPIDF
FT                   PRVVKFRKRRIRNLQPIPKIAKEGRSYEDFQRFLTEKGISYWLEMDTVTGRIGGKVLLT
FT                   FNLSFCNFIFAQLLDNKTANEVAKHLYAIKNDLHQKEMDFCEIFPVILTDNGGEFARVD
FT                   DIEMDVRGESKLFFCDPNRSDQKGRIEKNHTLIRDILPKRSSFDNLTQEDINLVCSHIN
FT                   SVKRASFNGKSAYELFTFTYGEELATLLGISKIDPENVIQSPRLLDK"
FT   misc_feature    complement(519574..520053)
FT                   /locus_tag="SSUSC84_0472"
FT                   /note="HMMPfam hit to PF00665, rve, score 9.1e-14"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(520516..520581)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1377.000, SD 3.88 at aa 22-43, sequence
FT                   KPFSAIAAKLGKDPSTISKEVR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        520837..521847
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0473"
FT                   /product="putative adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0489"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51251"
FT                   /protein_id="CAZ51251.1"
FT                   /translation="MLIVLNVNELVKTELHCHLDGSLSLGVIRQLAQMAKITIPAEDEA
FT                   LRKLVSVHGKVDSLMAYLKLFDFVRPLLQTATALELAAYDLVRQVASDKVIYIEVRFAP
FT                   ELSTDQDLTILEAVSAVLVGLNRGQEDFGVVAKLLVCGLKQTNTNQTKELFLAIADLAP
FT                   KGLVGFDFAGNEADYPTEELRDIIQFTQSLGYPMTFHAGECGCVTNVIQALELGIRRIG
FT                   HGTALTRNPEAIQAFVNSGATLEMCLTSNLQTGAADSIEYFPYRELVEAGANITINTDN
FT                   RTVSNTTLNREYQLFVEYFGTSKADFYRFNQNAIQASFASEEEKKVLLELLDQQY"
FT   misc_feature    520861..521829
FT                   /locus_tag="SSUSC84_0473"
FT                   /note="HMMPfam hit to PF00962, A_deaminase, score 1.6e-48"
FT                   /inference="protein motif:HMMPfam:PF00962"
FT   CDS_pept        complement(521891..522673)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0474"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0490"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51252"
FT                   /protein_id="CAZ51252.1"
FT                   /translation="MFKKLLKYEFQSVGKWYLGIYIAAVVLSAVLGFWLQALALRTQAG
FT                   NTEPGGGEMVLLGTSFMTFGILIAALFLSTFVLVINRFRKNVYGRQGYLTMTLPVSSHQ
FT                   IILSKLLASIVWYILAGITCLLSIGIILAVILAASEEAIMPEIQTFVQAIDWTILFSQI
FT                   VYYLIEITTGILLIYFSISVGQLFKDHRFLFAILTYIGILIVTGVFSTFFVLSNLGTAY
FT                   STPFSLYPSPVLALVNIILAFAYYFGTHFIMTKKLNLQ"
FT   misc_feature    complement(join(521921..521989,522032..522100,
FT                   522137..522205,522263..522331,522434..522502,
FT                   522560..522628))
FT                   /locus_tag="SSUSC84_0474"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUSC84_0474 by TMHMM2.0 at aa 16-38, 58-80, 115-137,
FT                   157-179, 192-214 and 229-251"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(522690..523397)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0475"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0491"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51253"
FT                   /protein_id="CAZ51253.1"
FT                   /translation="MSNAYTLVELQQVSKSYGGAVALNNVNLKLAAGKIIGLLGPNGSG
FT                   KTTMIKLINGLLQPEYGQVLINGRTPSPETKAIVSYLPDTTYLDEHMKVLEAVTFFEDF
FT                   YADFDKERALHLLQDLGIDLNSRMKHLSKGNKEKVQLILVMSRQAQLYVLDEPIGGVDP
FT                   AARDYILKTIVNNYSPTASVIISTHLISDVEQILDEVIFLHYGSVIRHGNVDDLRIESG
FT                   ESIDELFRQDFKA"
FT   misc_feature    complement(522780..523301)
FT                   /locus_tag="SSUSC84_0475"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.9e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        complement(523390..523764)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0476"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0492"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51254"
FT                   /protein_id="CAZ51254.1"
FT                   /translation="MAWKFDNNIPIYIQISNTIKLQIVTNQLKSGDKLPTVRDLAEIAG
FT                   VNPNTVQRALSDLETEGFVYSVRTTGRFVTDNQELITQTRLHLAQKELENFVNNMLELG
FT                   FRHDELTSQLDDYLKGVTYE"
FT   misc_feature    complement(523543..523734)
FT                   /locus_tag="SSUSC84_0476"
FT                   /note="HMMPfam hit to PF00392, GntR, score 5.3e-13"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(523597..523662)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1665.000, SD 4.86 at aa 37-58, sequence
FT                   PTVRDLAEIAGVNPNTVQRALS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        523918..527028
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SSUSC84_0477"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0493"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51255"
FT                   /protein_id="CAZ51255.1"
FT                   /translation="MLAQLDTKTVYTFMDSMVTIESYVGRAKELGYHALGIMDKNSLYA
FT                   AYSFMESCNKMGLQPIIGCELDWKLQGEEQDITTQLIALTTRGYRNLLKISTAKMTGQD
FT                   DFETIRQYLVDIAVVVPYFSGIEHLELGVNYYIGVTVDTPVQDFKQAPLPIHTVRFFEE
FT                   EQLESLQVLHAIRDNIPLNQVSDVDSRQKLLSADSLTNLFSNRFPQAVDNLRDLVAGIS
FT                   YQLNTDLKLPRFNRDRPAVEELYERSYQGLEEKGLTNSLYKERLEKELSIIHQMEFDDY
FT                   FLIVWDLLRFGRSQGYYMGMGRGSAVGSLVAYALNITGIDPVKHNLLFERFLNAERYSM
FT                   PDIDIDIPDIHRADFIRYVRDRYGSTHAAQIVTYSTFGAKQAIRDVFKRFGTPEYELSN
FT                   ITKKISFRDSLTSAYQRNAAFRQIINSKIEYQKAFAIAQQIEGQPRQTSIHAAGIVMSD
FT                   EELTDTIPLKIGDDMLVTQYDAHAVEANGLLKMDFLGLRNLTFVQKMAEGVRERYQQEI
FT                   DIAKIDLEDKKTLELFAAGRTKGIFQFEQPGAISLLRRVKPGRFEDIVATTSLNRPGAS
FT                   DYSDNFVKRKHGQETVDLLDPTIAPILQPTYGIMLYQEQVMQIAQVYAGFTLGKADLLR
FT                   RAMSKKNAQEMQAMEAEFLQGALKNGHAEENAREIFGMMAKFAGYGFNRSHAYAYSALA
FT                   FQMAYFKSHYTDVFFDVMLNHSSSAYIEDAMQFDFEVARLTINNIPYHDKFDKSKVYLG
FT                   LKTLKGLPKDLALWILDHRPYKSVEDFILRLPDNFKKKDLLIPLIQIGLFDDFDANRKK
FT                   IIENLDNLFVFAEAIGTFFAEESYSWTDVEDYSDSEKFMLEQELLGVGISPHPLVNICR
FT                   ESKRSFTDLADLAVGNRATVLVQIQAIRLIRTKKTGEQMAFLRVTDTKRTLDVTLFPES
FT                   YRQYASILEEGGMGYITGRVQERDGQLQLVLEKLEPVSLEKFWILLENREHDYAVARIL
FT                   DKYRGSIPVVLHYQDSNQTIQAEHHMVMKTPQLEEELSEFVMKTIFR"
FT   misc_feature    523942..524265
FT                   /gene="dnaE"
FT                   /locus_tag="SSUSC84_0477"
FT                   /note="HMMPfam hit to PF02811, PHP, score 2e-14"
FT                   /inference="protein motif:HMMPfam:PF02811"
FT   misc_feature    524488..525900
FT                   /gene="dnaE"
FT                   /locus_tag="SSUSC84_0477"
FT                   /note="HMMPfam hit to PF07733, DNA_pol3_alpha, score
FT                   2.8e-244"
FT                   /inference="protein motif:HMMPfam:PF07733"
FT   misc_feature    526540..526605
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1040.000, SD 2.73 at aa 875-896, sequence
FT                   RSFTDLADLAVGNRATVLVQIQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    526582..526818
FT                   /gene="dnaE"
FT                   /locus_tag="SSUSC84_0477"
FT                   /note="HMMPfam hit to PF01336, tRNA_anti, score 7.5e-10"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   CDS_pept        527113..528123
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /gene_synonym="pfkA"
FT                   /locus_tag="SSUSC84_0478"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0494"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51256"
FT                   /protein_id="CAZ51256.1"
FT                   /translation="MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMV
FT                   AGDIHELSARSVGDIISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDG
FT                   SYHGAMRLTEHGFPAIGVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRT
FT                   FVVEVMGRHAGDIALWAGIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAE
FT                   GVMPAAQFAEELKAAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRG
FT                   GLAVGIRNEQMVENPILGTAEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI"
FT   misc_feature    527116..527946
FT                   /gene="pfk"
FT                   /gene_synonym="pfkA"
FT                   /locus_tag="SSUSC84_0478"
FT                   /note="HMMPfam hit to PF00365, PFK, score 1.4e-182"
FT                   /inference="protein motif:HMMPfam:PF00365"
FT   misc_feature    527842..527898
FT                   /gene="pfk"
FT                   /gene_synonym="pfkA"
FT                   /locus_tag="SSUSC84_0478"
FT                   /note="ScanRegExp hit to PS00433, PHOSPHOFRUCTOKINASE,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00433"
FT   CDS_pept        528190..529695
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="SSUSC84_0479"
FT                   /product="putative pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0495"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51257"
FT                   /protein_id="CAZ51257.1"
FT                   /translation="MNKRVKIVATLGPAVEIRGGKKFGDDGYWGEKLDVESSAQKIAAL
FT                   ITEGANVFRFNFSHGDHQEQGDRMATVRRAEEIAGKKVGFLLDTKGPEIRTELFEDDAK
FT                   EYAYTTGDKLRVATKQGIKSTKEVIALNVAGGLDVFDDVEVGKQILVDDGKLGLTVVEK
FT                   DAVNREFVVLVENDGVIAKQKGVNIPYTKIPFPALAERDNADIRFGLEQGLNFIAISFV
FT                   RTAKDVEVVRNICKETGNDHVQLFAKIENQQGIDNIDEIIEAADGIMIARGDMGIEVPF
FT                   EMVPVYQKMIITKVNAAGKAVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLS
FT                   GESANGKYPVESVRTMATIAKNAQTLLNEYGRLNSDQFNRASKTEVIASAVKDACHSMD
FT                   IKLVVTVTETGYSARSISKYRPDADILAVTFTEKVQKSLMLNWGVIPIVTNRPDSTDDM
FT                   FDLAERIAKEQGLVEAGDDIIIVAGVPVGVAGSTNTMRVRTVK"
FT   misc_feature    528193..529308
FT                   /gene="pyk"
FT                   /locus_tag="SSUSC84_0479"
FT                   /note="HMMPfam hit to PF00224, PK, score 1.5e-208"
FT                   /inference="protein motif:HMMPfam:PF00224"
FT   misc_feature    529339..529686
FT                   /gene="pyk"
FT                   /locus_tag="SSUSC84_0479"
FT                   /note="HMMPfam hit to PF02887, PK_C, score 7.8e-49"
FT                   /inference="protein motif:HMMPfam:PF02887"
FT   CDS_pept        529856..533281
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0480"
FT                   /product="putative membrane anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0496"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51258"
FT                   /protein_id="CAZ51258.1"
FT                   /translation="MNIQERFSLRKSAVGLVSVSLLCAIYTSTVAADTVVTGVNEIIEE
FT                   SQVKDEVSIESEKNESLDGSNIEIVEEIADNIPSPVIAEGEVAVEMKVDRGTENVVSRN
FT                   DTEVTTSEQNQIEVTETKEILNQTSYQTESGEQRQIIWAHGITPPAMEQSGGFVKEKYG
FT                   DYLNYTAPFEAGKGYYDTNKSLNASFIDLNLCFAAVSSNMVHWWLEQNSSYVERYLKEK
FT                   KGTVNVEENYAITDLRRYINSFQNQQNSRVFDMFKTYYGYRTNGFVSDALVDLFINGYK
FT                   PKAQGGVNLEDSQLVPDSRGGFFYDVFKEKKLTNRIFSGSYERFGEDVRTVLESKGLLG
FT                   LTYRTLGYATHIVTVWGAEYDNQGKIKAVYITDSDDQQEQIGLKRMGITRDASGNPRLN
FT                   NHMKNNSAGALLDYVHTIRLGQDLWEEYFNPLAKAKETASQTLADTKKALDLSIQGQSE
FT                   LPESMRLIYLEKLNNLYNQGILSIQKAESSEMLSGALENGLNSLKSLDFPISEVGNALA
FT                   PDLPVGDRSTVSDVDSLSSQETSSTNLEADTENAGIIADGTNQLHFPVEAQTTSSVEAE
FT                   GDNVFEQEADTLPIIIENKDEFGSELSRNMQTSETDSLVVAVEEDVKNDEVAQVEELLE
FT                   SEKVENQSSELLSDTLIVESANDKEEDRVEAVVSEQPDSIPHQNVEISLVEPTNVETET
FT                   VVTPINDAATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVV
FT                   TPVNDVATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTNVETETVVTP
FT                   VNDVATPHGSPTYIDNSVTESVATPLEKDSIQAGETEIAEPTSSESTSVEAELVDNSEI
FT                   HAATSSVTPCGSSAYADGSTTESVATPLEKDSIQTGNTEIAEPTSSKSTNVEAASVDNS
FT                   EIHADASLTAVSSVNLDNPVIEPVAISLIGSKRDTNAEVEVSSLSKREVRKTNTDGLIS
FT                   VQSKVIKKELLESSLAEAGSPLLEATIAQSSNSNSTEIGMSYQNTVLLESNNTERQVSK
FT                   AEIVMEHKETELVETVSSASEPVVLVENISQTSNNTIESGKNMGVQSQAGAKQILGVEQ
FT                   SSKVSTPTSRQIMGVGLLTLVLGSALGLLKKRRK"
FT   sig_peptide     529856..529951
FT                   /locus_tag="SSUSC84_0480"
FT                   /note="Signal peptide predicted for SSUSC84_0480 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.995 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    530069..531127
FT                   /locus_tag="SSUSC84_0480"
FT                   /note="HMMPfam hit to PF09028, Mac-1, score 1.3e-257"
FT                   /inference="protein motif:HMMPfam:PF09028"
FT   misc_feature    533210..533263
FT                   /locus_tag="SSUSC84_0480"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0480 by TMHMM2.0 at aa 1119-1136"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(533606..534715)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0481"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0497"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51259"
FT                   /protein_id="CAZ51259.1"
FT                   /translation="MKKQVIIIGGGIVGSTAAFYLSQEEQVNLTLIDSGVGTATRAAAG
FT                   IIGPWMAQKKNKDWYKLTSDGAVFYRQLVADLEKSGATEIPFKQTGTIGLKSKPELLDK
FT                   IQKIAEERRVDTPTIGEITPLIGSEINQYLPLLKPDYFGIHLEGGGRIDGGRLIDILQE
FT                   QFLKNGGTRIYGQAKLLDNHTVEVDNQVLTADHIILATGAWLPHILEPLGYQVDVRPQK
FT                   GQLFELDTEFDTDNWPVCMPYGEIDILPFENGKIIIGATHEDDMGYDLELDPEKIQAMH
FT                   DKIAEFMPDLANYPVTRTRIGTRAYTSTYSPFYGNIEDMPNVWVASGLGSTGLTNGPII
FT                   GWQIAKEILNQETNFDRTPYSPNRYILKK"
FT   misc_feature    complement(533675..534706)
FT                   /locus_tag="SSUSC84_0481"
FT                   /note="HMMPfam hit to PF01266, DAO, score 9.9e-65"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   CDS_pept        534800..535417
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0482"
FT                   /product="putative esterase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0498"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51260"
FT                   /protein_id="CAZ51260.1"
FT                   /translation="MSDIMYPEVLTVGSGAVKVATVGDSLTYGYGLENREKDAYPCILA
FT                   EKLGHHYQVSNYGLSGRSLQSTADFPYFKEKNAQLSLESEADIVIIMIGSNDSRGPYWN
FT                   RERFIQEYREMAEQYMDLPSQPDVYLVIPPYVPTSRFGLNNQIIEDELQKIIPAIGNEL
FT                   GLPVINLYTVTEGHLEYYSDGLHLTPLGNQVIAEEIYQHLRH"
FT   misc_feature    534854..535396
FT                   /locus_tag="SSUSC84_0482"
FT                   /note="HMMPfam hit to PF00657, Lipase_GDSL, score 3.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00657"
FT   CDS_pept        535460..536002
FT                   /transl_table=11
FT                   /gene="sipC"
FT                   /locus_tag="SSUSC84_0483"
FT                   /product="putative signal peptidase I 1"
FT                   /EC_number="3.4.21.89"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0499"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51261"
FT                   /protein_id="CAZ51261.1"
FT                   /translation="MVKRDLIKQISLLVLLIFGIIGLRFWLLEPVTITPEMANSYLKEN
FT                   DFIMTVRNVRPIHGDFILYNHEGKEYVSRVIALENETVTYMDDVLYRNDIIVTENYLKT
FT                   PHSQESYTDDFTLETLTNGKYNIIPEGHYLVLNDVRTNQQDSRSFGLISSEAIVGRLTF
FT                   RISPLSEFGFIKTGLVQ"
FT   sig_peptide     535460..535573
FT                   /gene="sipC"
FT                   /locus_tag="SSUSC84_0483"
FT                   /note="Signal peptide predicted for SSUSC84_0483 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.749) with cleavage
FT                   site probability 0.587 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    535493..535561
FT                   /gene="sipC"
FT                   /locus_tag="SSUSC84_0483"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0483 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    535568..535744
FT                   /gene="sipC"
FT                   /locus_tag="SSUSC84_0483"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score 0.017"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   CDS_pept        536192..538003
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSUSC84_0484"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing]"
FT                   /EC_number="2.6.1.16"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0500"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51262"
FT                   /protein_id="CAZ51262.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVTGGEQAHLV
FT                   KAVGRIAELSAKVGDKTEGTTGIGHTRWATHGKPTENNAHPHTSQTAGHILVHNGVIEN
FT                   YAEIKEEYLAGHDLKGQTDTEIAVHLIGQFAEEGLSTLEAFKKALKIIQGSYAFALIDA
FT                   ADADTIYVAKNKSPLLIGLGDGYNMVCSDAMAMIRETSEYMEIHDKELVIVKKDSVEVM
FT                   DYDGNAIERGSYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLISAYTNEAGQVTVDA
FT                   DIIKAVQEADRIYILAAGTSYHAGFAAKDFLEKLTDTPVELGISSEWGYSMPLLSKKPL
FT                   FVMISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREATYTMLLHAGPEIAVAST
FT                   KAYTAQIATLAILAKAVGDANGNAYAKEFDLVHELSIVAQSIEASLSEKDVIAEKVEKL
FT                   LSTTRNAFYIGRGSDYYVSMEASLKLKEISYIQCEGFAAGELKHGTISLIEDGVPVLAL
FT                   ISNHPHLASHTRGNIQEVVARGANVLTIVDEAVAKEEDDITVTTVHPFLSAIAMVVPTQ
FT                   LIAYYATLQRGLDVDKPRNLAKSVTVE"
FT   misc_feature    536192..536209
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSUSC84_0484"
FT                   /note="ScanRegExp hit to PS00443, GATASE_TYPE_II, score NA"
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    536195..536770
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSUSC84_0484"
FT                   /note="HMMPfam hit to PF00310, GATase_2, score 1.4e-32"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    537047..537445
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSUSC84_0484"
FT                   /note="HMMPfam hit to PF01380, SIS, score 1.2e-29"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    537563..537958
FT                   /gene="glmS"
FT                   /gene_synonym="gcaA"
FT                   /locus_tag="SSUSC84_0484"
FT                   /note="HMMPfam hit to PF01380, SIS, score 1.1e-15"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS_pept        538155..538796
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0485"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0501"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51263"
FT                   /protein_id="CAZ51263.1"
FT                   /translation="MDYVLEVLPSLLNGAAVSLQVFFLVLILSLPLGAVFAFLMQIKFK
FT                   PLQWLLHFYVLIMRGTPLLLQLIFVYYVLPSVGITFDRMPAVILAFTLNYAAYFSEIFR
FT                   GGIEAIPKGQYEAAKVLKFTPVQTIRYIVLPQVVKIVLPSVFNEVMTLVKDTSLVYALG
FT                   VSDLLLASRTAANRDASLAPMFIAGAIYLLMIGAVTLISKQVEKKFDYYR"
FT   misc_feature    538185..538787
FT                   /locus_tag="SSUSC84_0485"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 1.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(538197..538265,538299..538367,538410..538463,
FT                   538689..538757)
FT                   /locus_tag="SSUSC84_0485"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0485 by TMHMM2.0 at aa 15-37, 49-71, 86-103 and
FT                   179-201"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        538806..539438
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0486"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0502"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51264"
FT                   /protein_id="CAZ51264.1"
FT                   /translation="MLELRNLSKRFEDKQIFSNYDLVIPEGKIVAIVGQSGGGKTTLLR
FT                   MLAGLETIDSGTLMYNGQELPLEELGKRHLLGFVFQDFQLFPHLSVLENLVLSPMKTQN
FT                   MLRSEAEDKALKLLDTLGLANHANAYPFSLSGGQKQRVALARAMMIDPEIIGYDEPTSA
FT                   LDPELRKEVEKLILENRATGITQIVVTHDMQFAENIADEIIKIEPKH"
FT   misc_feature    538884..539432
FT                   /locus_tag="SSUSC84_0486"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 5.5e-59"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    539205..539249
FT                   /locus_tag="SSUSC84_0486"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        539459..540295
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0487"
FT                   /product="putative amino acid ABC transporter,
FT                   extracellular amino acid-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0503"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51265"
FT                   /protein_id="CAZ51265.1"
FT                   /translation="MNIKKMMLGALALVTSLTLAACGSNDSATKSDNWTAYESEKSVTI
FT                   GFDKTFVPMGFEQTDGSYTGFDIDLANAVFEKYGITVKWQPIDWDLKETELNNGNIDLI
FT                   WNGYSITDERKEKVLFTNPYMDNQQVLVTKKSSNISQVSDMKDKILGAQAGSSGYSVFE
FT                   SQPAILKDIVQNNDASQYATFNEALIDLKNDRIDGLLIDRVYANYYLQQEGIIADYNII
FT                   DAGFENEAFAVGARKSDTTLVENINKAFAELYKEGKFQEISQKWFGEDVATDTVKK"
FT   sig_peptide     539459..539545
FT                   /locus_tag="SSUSC84_0487"
FT                   /note="Signal peptide predicted for SSUSC84_0487 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.500 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    539585..540265
FT                   /locus_tag="SSUSC84_0487"
FT                   /note="HMMPfam hit to PF00497, SBP_bac_3, score 4.1e-75"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   CDS_pept        complement(540753..541040)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0488"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0503A"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Geobacillus kaustophilus transposase
FT                   UniProt:Q5KVU7 (EMBL:BA000043) (378 aa) fasta scores:
FT                   E()=4.5e-05, 28.889% id in 90 aa"
FT                   /db_xref="PSEUDO:CAZ51266.1"
FT   CDS_pept        join(541267..541380,541384..541533,541537..541608)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0489"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0505A"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus gordonii transposase UniProt:Q84AQ8
FT                   (EMBL:AY116209) (170 aa) fasta scores: E()=5.1e-05, 35.766%
FT                   id in 137 aa"
FT   CDS_pept        join(541650..541742,541747..541830,541834..541905,
FT                   541909..541914,541918..541950,541954..542082)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0490"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0505B"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae putative transposase
FT                   UniProt:Q9L9Q9 (EMBL:AF165983) (287 aa) fasta scores:
FT                   E()=0.00035, 44.785% id in 163 aa"
FT   CDS_pept        complement(542135..542773)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0491"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /EC_number="3.1.2.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0506"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51269"
FT                   /protein_id="CAZ51269.1"
FT                   /translation="MIIHKSVNPVAFQNTYYLENDTHLIIIDPGSDWTKIQVTIEKIGK
FT                   PISAILLTHTHYDHIMSLDILRETYNFPPVYVAENEASWLYTPEMNLSGLPRHDDMENV
FT                   VCRPAEKIFQYQEDYQFDGFHFKVVPTPGHSIGGVSFIFPEDECVITGDALFRETVGRT
FT                   DLPTSNFDDLITGIREHIFTLPNHYTVHPGHGQNTSVGHEKNFNPFFRM"
FT   misc_feature    complement(542192..542740)
FT                   /locus_tag="SSUSC84_0491"
FT                   /note="HMMPfam hit to PF00753, Lactamase_B, score 1.8e-35"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        542881..545349
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0492"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0507"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51270"
FT                   /protein_id="CAZ51270.1"
FT                   /translation="MNSMKDTRTSNRYAVVDLEATGTGTDAKIIQIGIVLVENGEIIDS
FT                   YATDINPYELLDDHIKNLTGITDQQLSQAPDFGQVASTIYDMIGDAIFVAHNVKFDANL
FT                   LAEALFFEGYELLTPRVDTVELSQLFFPTFEKYSLGNLAEHLELGLDQAHTAISDAMAT
FT                   ARLLIKIQEKIKSLPRSIVEKILDLADNLLFESRLVIDEMVPVLSENLSYDLESIHDLV
FT                   LKKPEEIKSAYRLSEDFSTNIALLGLHERKKQTAFAQVVEKRLVDEEKVHFIQAQAGLG
FT                   KTYGYLLPLLAKSDQPLLVTVPTKLLQEQIMEKEGSKLKEIFRIPIVSLKSPKHFIKLD
FT                   NYWKTLQRQDDNRLVNQFKMQVLVWLCETTTGDLDELKQKQRYQAYFDEIAHDGKLEPE
FT                   SLFWGLDFWQRLNQQALSSRLLITNHAYFLSHLKDQDPHMDKRMVVIDEAQKFLLAAEN
FT                   LATASQDLTSMLQVLQSKKDRATAILDQRLYESCQFELNHFLSRFRQHGQREVQKAELH
FT                   QLGQNLEELGDVDLNDLHQLIDYYDTFWLEEKNLEEKRLAYLRSSKDSLLNATNYLPDT
FT                   KIFCISATLTISKKVSLADLLGFEQVTLDLIPTQTVTNQRLLFPTHLPDILAWTKEEHA
FT                   AYLATTLGEIAELGRPILVLFTSISMLLQVSDLLEDNNIPHLAQHKHGQEMTLKRKFER
FT                   GECQILLGTGVFWEGVDFASQNQLIQVITRLPFDNPKDRFVQKINHHLREEGKNPFYDY
FT                   SLPMMMIKLKQAIGRTNRHDKQDSLVLVLDPRVHTKRYGQQILSFFEKDYLMLSVDAKE
FT                   IEGAIQDFFE"
FT   misc_feature    542917..543381
FT                   /locus_tag="SSUSC84_0492"
FT                   /note="HMMPfam hit to PF00929, Exonuc_X-T, score 6.7e-35"
FT                   /inference="protein motif:HMMPfam:PF00929"
FT   misc_feature    544882..545199
FT                   /locus_tag="SSUSC84_0492"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 0.0044"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        545509..546585
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SSUSC84_0493"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0508"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51271"
FT                   /protein_id="CAZ51271.1"
FT                   /translation="MTEKTIVFKVGTSSLTQENGSLDRIKIARITNQLAQLHQKGYQIV
FT                   LVTSGSIAAGFRRLGFDKRPTKIAEKQASAAVGQGLLIEEYTQNLMKDGIVSAQILLTQ
FT                   DDFADARRYQNASQALQVLLKQRAIPIINENDTIAIEEIKVGDNDTLSAQVASLLKADL
FT                   LVLLTDVDGLYTANPNSDPTAQHLPQIKEITEDLFAMAAGAGSSNGTGGMTTKLQAAQI
FT                   ATKSGVPVFICSSKEDTALLQAVTQANRGTLFLADDHAMNQRKQWMAFYARTDAAVEVD
FT                   AGAVDAMLHQGRSLLATGVKALEGDFEVGQVVEVYSQADHRLIGKGRVKLSSKDLQDQL
FT                   ANGRAEGVLIHRNDWVSL"
FT   misc_feature    545518..546210
FT                   /gene="proB"
FT                   /locus_tag="SSUSC84_0493"
FT                   /note="HMMPfam hit to PF00696, AA_kinase, score 1.3e-64"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   misc_feature    546124..546177
FT                   /gene="proB"
FT                   /locus_tag="SSUSC84_0493"
FT                   /note="ScanRegExp hit to PS00902, GLUTAMATE_5_KINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00902"
FT   misc_feature    546334..546522
FT                   /gene="proB"
FT                   /locus_tag="SSUSC84_0493"
FT                   /note="HMMPfam hit to PF01472, PUA, score 1.7e-17"
FT                   /inference="protein motif:HMMPfam:PF01472"
FT   CDS_pept        546650..547888
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SSUSC84_0494"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0509"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51272"
FT                   /protein_id="CAZ51272.1"
FT                   /translation="MTTTQVLLDSLLANKASINLATTEQKNQALSAMADQLVAQTEAIL
FT                   AGNAIDMEHAQGKISQVMQDRLLLTEERIEAMADGIRALIGLPDPVGLVLEESTRADGL
FT                   NICKKSIPFGLVGMIYESRPNVTSDAAALAIKSGNAVILRGGKEAFHSAKAIVTALKSG
FT                   LEEAGVSPKVIELVQDTSRVSATELMTAKGKIDLLVPRGGAGLIQAVVENATVPVIETG
FT                   TGICHVYVDKDADLDKALRIVVNAKTSRPSVCNAAEVLLVHEEIASQFLPRLEEALSGQ
FT                   VELRADSQAQALLNQARPAGDQDFDTEFLDYIMAVKVVSSVEEAISHIAQHSTGHSEAI
FT                   VTENSQTAEHFTLHVDSAAVYVNASTRFTDGGEFGLGCELGISTQKMHARGPMGLREMT
FT                   TYKYIITGDGHIR"
FT   misc_feature    546656..547861
FT                   /gene="proA"
FT                   /locus_tag="SSUSC84_0494"
FT                   /note="HMMPfam hit to PF00171, Aldedh, score 1.4e-07"
FT                   /inference="protein motif:HMMPfam:PF00171"
FT   misc_feature    547604..547669
FT                   /gene="proA"
FT                   /locus_tag="SSUSC84_0494"
FT                   /note="ScanRegExp hit to PS01223, PROA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01223"
FT   CDS_pept        547898..548683
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SSUSC84_0495"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0510"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51273"
FT                   /protein_id="CAZ51273.1"
FT                   /translation="MKIGFIGLGNMGAALAQAVSQQPDTQLLLSNHNPAKAQALQEKVG
FT                   GQLFSNGQIAEQAEIIFLGVKPHLIQTVLSGLQDQISQNPSAIWISMAAGVPLDSLAAF
FT                   VSADKVIRIMPNTPVAIGQGMTTYSLVNQNLAPLLEQILEKSGKVQQVPESLIDAATAI
FT                   AGCGPAFVYQMIEALTDAGVQNGLTAQDAKVLAAQTLAGTAQMVLTSDKHPAQLRQEVT
FT                   SPGGSTIAGVVALEKEGFRYAIIKAVAAALKKTRKLGKK"
FT   misc_feature    547901..548626
FT                   /gene="proC"
FT                   /locus_tag="SSUSC84_0495"
FT                   /note="HMMPfam hit to PF03807, F420_oxidored, score
FT                   5.6e-61"
FT                   /inference="protein motif:HMMPfam:PF03807"
FT   misc_feature    548537..548605
FT                   /gene="proC"
FT                   /locus_tag="SSUSC84_0495"
FT                   /note="ScanRegExp hit to PS00521, P5CR, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00521"
FT   CDS_pept        complement(548706..549110)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0496"
FT                   /product="TetR family regulatory proteins"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0511"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51274"
FT                   /protein_id="CAZ51274.1"
FT                   /translation="MAGRKISPQSLKNLYQSNKEANQLTKESIETALLFLLEKKELKQI
FT                   SVSELVRKAGVSRNAFYRNYKSKEEILEDYYERTSSNLKKKWHDLQDKVQKDGVKQSFA
FT                   DFVQEQKRKAEQSKALSNVSQWIKEKTKRD"
FT   misc_feature    complement(548886..548975)
FT                   /locus_tag="SSUSC84_0496"
FT                   /note="HMMPfam hit to PF00440, TetR_N, score 2.2e-07"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(548913..548978)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1173.000, SD 3.18 at aa 45-66, sequence
FT                   ISVSELVRKAGVSRNAFYRNYK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        549238..550089
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0512"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51275"
FT                   /protein_id="CAZ51275.1"
FT                   /translation="MTKWKIVADSGCDYRQLANLAPDTEFISVPLTIQVGEQAFVDDAS
FT                   LDIDHMMEVMEASKSAAGSACPSPQAYQAAFEGAENIIVVTITGGLSGSFNAARVARDM
FT                   YIEEHPNVNIHLIDSLSASGEMDLLVDEINRLISAGLDFPQVVEAITHYREHSKLLFVL
FT                   AKVDNLVKNGRLSKLVGTVVGLLNIRMVGEASAEGKLELLQKARGHKKSVTAAFEEMKK
FT                   AGYDGGRIVMAHRNNAKFFQQFSELVKASFPTAVIDEVATSGLCSFYAEEGGLLMGYEV
FT                   KA"
FT   misc_feature    549445..550077
FT                   /locus_tag="SSUSC84_0497"
FT                   /note="HMMPfam hit to PF02645, DegV, score 9.6e-67"
FT                   /inference="protein motif:HMMPfam:PF02645"
FT   CDS_pept        complement(550188..551447)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0498"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0513"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51276"
FT                   /protein_id="CAZ51276.1"
FT                   /translation="MKKYQVIIQDILTGIEEHRFKRGEKLPSIRQLREQYHCSKDTVQK
FT                   AMLELKYQNKIYAVEKSGYYILEDRDFQDHTVELNPTDFQELPYEDFRICLKESLIGRE
FT                   NYLFNYYHQQEGLAELISSVQSLLMDYHVYTKKDQLVITAGSQQALYILTQMETLAGKT
FT                   EILIENPTYSRMIELIRHQGIPYQTIERNLDGIDLEELESIFQTGKIKFFYTIPRLHNP
FT                   LGSTYDIATKTAIVKLAKQYDVYIIEDDYLADFDSSHSLPLHYLDTDNRVIYIKSFTPT
FT                   LFPALRIGAISLPNQLRDIFIKHKSLIDYDTNLIMQKALSLYIDNGMFARNTQHLHHIY
FT                   HAQWNKIKDCLEKYALNIPYRISKGSVTFQLSKGILSPSIQHMFGKCYYFSGQKADFLQ
FT                   IFFEQDFADKLEQFVRYLNE"
FT   misc_feature    complement(550272..550307)
FT                   /locus_tag="SSUSC84_0498"
FT                   /note="ScanRegExp hit to PS00139, THIOL_PROTEASE_CYS, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00139"
FT   misc_feature    complement(550698..551108)
FT                   /locus_tag="SSUSC84_0498"
FT                   /note="HMMPfam hit to PF00155, Aminotran_1_2, score
FT                   1.3e-05"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    complement(551250..551441)
FT                   /locus_tag="SSUSC84_0498"
FT                   /note="HMMPfam hit to PF00392, GntR, score 1.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   CDS_pept        551570..552304
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0514"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51277"
FT                   /protein_id="CAZ51277.1"
FT                   /translation="MKIIIPNAKEVNTNLENASFYLLSDRSKPVLDAISQFDVKKMAAF
FT                   YKLNEAKAELEADRWYRIRTGQAKTYPAWQLYDGLMYRYMDRRGIDSKEENYLRDHVRV
FT                   ATALYGLIHPFEFISPHRLDFQGSLKIGNQSLKQYWRPYYDQEVGDDELILSLASSEFE
FT                   QVFSPQIQKRLVKILFMEEKAGQLKVHSTISKKGRGRLLSWLAKNNIQELSDIQDFKVD
FT                   GFEYCTSESTANQLTFIRSIKM"
FT   misc_feature    551570..552295
FT                   /locus_tag="SSUSC84_0499"
FT                   /note="HMMPfam hit to PF03883, DUF328, score 1.8e-46"
FT                   /inference="protein motif:HMMPfam:PF03883"
FT   CDS_pept        552409..553854
FT                   /transl_table=11
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSUSC84_0500"
FT                   /product="integral membrane regulatory protein Wzg"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0515"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51278"
FT                   /protein_id="CAZ51278.1"
FT                   /translation="MKKRSGRSKSSKFKLVNFALLGLYSITLCLFLVTMYRYNILDFRY
FT                   LNYIVTLLLVGVAVLAGLLMWRKKARIFTALLLVFSLVITSVGIYGMQEVVKFSTRLNS
FT                   NSTFSEYEMSILVPANSDITDVRQLTSILAPAEYDQDNITALLDDISKMESTQLATSPA
FT                   TSYLTAYQSMLNGESQAMVFNGVFTNILENEDPGFSSKVKKIYSFKVTQTVETATKQVS
FT                   GDSFNIYISGIDAYGPISTVSRSDVNIIMTVNRATHKILLTTTPRDSYVAIADGGQNQY
FT                   DKLTHAGIYGVNASVHTLENLYGIDISNYVRLNFISFLQLIDLVGGIDVYNDQEFTSLH
FT                   GNYHFPVGQVHLNSDQALGFVRERYSLTGGDNDRGKNQEKVIAALIKKMSTPENLKNYQ
FT                   AILSGLEGSIQTDLSLETIMSLVNTQLESGTQFTVESQALTGTGRSDLSSYAMPGSQLY
FT                   MMEINQDSLEQSKAAIQSVLVEK"
FT   misc_feature    join(552445..552513,552541..552606,552625..552684)
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSUSC84_0500"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0500 by TMHMM2.0 at aa 13-35, 45-66 and 73-92"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    552610..552957
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSUSC84_0500"
FT                   /note="HMMPfam hit to PF02916, DNA_PPF, score 8.6e-65"
FT                   /inference="protein motif:HMMPfam:PF02916"
FT   misc_feature    553138..553581
FT                   /gene="wzg"
FT                   /gene_synonym="cps2A"
FT                   /locus_tag="SSUSC84_0500"
FT                   /note="HMMPfam hit to PF03816, LytR_cpsA_psr, score
FT                   2.1e-69"
FT                   /inference="protein motif:HMMPfam:PF03816"
FT   CDS_pept        553872..554561
FT                   /transl_table=11
FT                   /gene="cps2B"
FT                   /locus_tag="SSUSC84_0501"
FT                   /product="putative chain length determinant protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0516"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51279"
FT                   /protein_id="CAZ51279.1"
FT                   /translation="MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFL
FT                   VTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYLAKDYREIILSQDVLTQVATELNLK
FT                   ESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAVQKVVEVTKVSDVTTLEE
FT                   AVPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGIV
FT                   PDSKKLK"
FT   misc_feature    553896..554303
FT                   /gene="cps2B"
FT                   /locus_tag="SSUSC84_0501"
FT                   /note="HMMPfam hit to PF02706, Wzz, score 1.7e-50"
FT                   /inference="protein motif:HMMPfam:PF02706"
FT   misc_feature    join(553944..554012,554403..554471)
FT                   /gene="cps2B"
FT                   /locus_tag="SSUSC84_0501"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUSC84_0501 by TMHMM2.0 at aa 25-47 and 178-200"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    554409..554486
FT                   /gene="cps2B"
FT                   /locus_tag="SSUSC84_0501"
FT                   /note="ScanRegExp hit to PS00217, SUGAR_TRANSPORT_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00217"
FT   CDS_pept        554571..555248
FT                   /transl_table=11
FT                   /gene="wze"
FT                   /gene_synonym="cps2c"
FT                   /locus_tag="SSUSC84_0502"
FT                   /product="tyrosine-protein kinase Wze"
FT                   /EC_number="2.7.10.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0517"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51280"
FT                   /protein_id="CAZ51280.1"
FT                   /translation="MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKS
FT                   NEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMPGFFKPITKITGLTDYLAGTTDLSQ
FT                   GLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVVDAA
FT                   IIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEKTGTPFLGVILNKYDIATEKYSEYGNYG
FT                   KKA"
FT   misc_feature    554682..555239
FT                   /gene="wze"
FT                   /gene_synonym="cps2c"
FT                   /locus_tag="SSUSC84_0502"
FT                   /note="HMMPfam hit to PF01656, CbiA, score 1.4e-12"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   CDS_pept        555287..556018
FT                   /transl_table=11
FT                   /gene="wzh"
FT                   /gene_synonym="cps2d"
FT                   /locus_tag="SSUSC84_0503"
FT                   /product="protein-tyrosine phosphatase Wzh"
FT                   /EC_number="3.1.3.48"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0518"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51281"
FT                   /protein_id="CAZ51281.1"
FT                   /translation="MIDIHSHIIFGVDDGPKTIEESLSLISEAYRQGVRYIVATSHRRK
FT                   GMFETPEKIIMINFLQLKEAVAEVYPEIRLCYGAELYYSKDILSKLEKKKVPTLNGSCY
FT                   ILLEFSTDTPWKEIQEAVNEMTLLGLTPVLAHIERYDALAFQSERVEKLIDKGCYTQVN
FT                   SNHVLKPALIGERAKEFKKRTRYFLEQDLVHCVASDMHNLYSRPPFMREAYQLVKKEYG
FT                   EDRAKALFKKNPLLILKNQVQ"
FT   misc_feature    555290..555898
FT                   /gene="wzh"
FT                   /gene_synonym="cps2d"
FT                   /locus_tag="SSUSC84_0503"
FT                   /note="HMMPfam hit to PF02811, PHP, score 1e-29"
FT                   /inference="protein motif:HMMPfam:PF02811"
FT   CDS_pept        556043..557422
FT                   /transl_table=11
FT                   /gene="cps2E"
FT                   /locus_tag="SSUSC84_0504"
FT                   /product="putative galactosyl transferase"
FT                   /EC_number="2.7.8.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0519"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51282"
FT                   /protein_id="CAZ51282.1"
FT                   /translation="MNIEIGYRQTKLALFDMIAVTISAILTSHIPNADLNRSGIFIIMM
FT                   VHYFAFFISRMPVEFEYRGNLIEFEKTFNYSIIFVIFLMAVSFMLENNFALSRRGAVYF
FT                   TLINFVLVYLFNVIIKQFKDSFLFSTTYQKKTILITTAELWENMQVLFESDILFQKNLV
FT                   ALVILGTEIDKINLPLPLYYSVEEAIEFSTREVVDYVFINLPSEYFDLKQLVSDFELLG
FT                   IDVGVDINSFGFTVLKNKKIQMLGDHSIVTFSTNFYKPSHILMKRLLDILGAVVGLIIC
FT                   GIVSILLIPIIRRDGGPAIFAQKRVGQNGRIFTFYKFRSMFVDAEVRKKELMAQNQMQG
FT                   GMFKMDNDPRITPIGHFIRKTSLDELPQFYNVLIGDMSLVGTRPPTVDEFEKYTPSQKR
FT                   RLSFKPGITGLWQVSGRSDITDFNEVVRLDLTYIDNWTIWSDIKILLKTVKVVLLREGS
FT                   K"
FT   misc_feature    join(556076..556135,556145..556198,556259..556312,
FT                   556340..556399,556853..556921)
FT                   /gene="cps2E"
FT                   /locus_tag="SSUSC84_0504"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUSC84_0504 by TMHMM2.0 at aa 12-31, 35-52, 73-90, 100-119
FT                   and 271-293"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    556838..557419
FT                   /gene="cps2E"
FT                   /locus_tag="SSUSC84_0504"
FT                   /note="HMMPfam hit to PF02397, Bac_transf, score 1e-143"
FT                   /inference="protein motif:HMMPfam:PF02397"
FT   CDS_pept        557457..558626
FT                   /transl_table=11
FT                   /gene="cps2F"
FT                   /gene_synonym="wchF"
FT                   /locus_tag="SSUSC84_0505"
FT                   /product="putative rhamnosyl transferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0520"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51283"
FT                   /protein_id="CAZ51283.1"
FT                   /translation="MRTVYIIGSKGIPAKYGGFETFVEKLTEYQKDKSINYFVACTREN
FT                   SAKSDITGEVFEHNGATCFNIDVPNIGSAKAILYDIMALKKSIEIAKDRNDTSPIFYIL
FT                   ACRIGPFIYLFKKQIESIGGQLFVNPDGHEWLREKWSYPVRQYWKFSESLMLKYADLLI
FT                   CDSKNIEKYIHEDYRKYAPETSYIAYGTDLDKSRLSPTDSVVREWYKEKEISENDYYLV
FT                   VGRFVPENNYEVMIREFMKSYSRKDFVLITNVEHNSFYEKLKKETGFDKDKRIKFVGTV
FT                   YNQELLKYIRENAFAYFHGHEVGGTNPSLLEALSSTKLNLLLDVGFNREVGEEGAKYWN
FT                   KDNLHRVIDSCEQLSQEQINDMDSLSTKQVKERFSWDFIVDEYEKLFKG"
FT   misc_feature    557457..558032
FT                   /gene="cps2F"
FT                   /gene_synonym="wchF"
FT                   /locus_tag="SSUSC84_0505"
FT                   /note="HMMPfam hit to PF09314, DUF1972, score 3.4e-139"
FT                   /inference="protein motif:HMMPfam:PF09314"
FT   misc_feature    558072..558563
FT                   /gene="cps2F"
FT                   /gene_synonym="wchF"
FT                   /locus_tag="SSUSC84_0505"
FT                   /note="HMMPfam hit to PF00534, Glycos_transf_1, score
FT                   0.0048"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   CDS_pept        558630..559787
FT                   /transl_table=11
FT                   /gene="csp2G"
FT                   /locus_tag="SSUSC84_0506"
FT                   /product="putative glycosyl transferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0521"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51284"
FT                   /protein_id="CAZ51284.1"
FT                   /translation="MKKILYLHAGAELYGADKVLLELIKGLDKNEFEAHVILPNDGVLV
FT                   PALREVGAQVEVINYPILRRKYFNPKGIFDYFISYHHYSKQIAQYAIENKVDIIHNNTT
FT                   AVLEGIYLKRKLKLPLLWHVHEIIVKPKFISDSINFLMGRFADKIVTVSQAVANHIKQS
FT                   PHIKDDQISVIYNGVDNKVYYQSDARSVRERFDIDEEALVIGMVGRVNAWKGQGDFLEA
FT                   VAPILEQNPKAIAFIAGSAFEGEEWRVVELEKKISQLKVSSQVRRIDYYANTTELYNMF
FT                   DIFVLPSTNPDPLPTVVLEAMACGKPVVGYRHGGVCEMVKEGVNGFLVTPNSPLNLSKV
FT                   ILQLSENINLRKKIGNNSIERQKEHFSLKSYVKNFSKVYTSLKVY"
FT   misc_feature    559191..559712
FT                   /gene="csp2G"
FT                   /locus_tag="SSUSC84_0506"
FT                   /note="HMMPfam hit to PF00534, Glycos_transf_1, score
FT                   8.2e-34"
FT                   /inference="protein motif:HMMPfam:PF00534"
FT   repeat_region   559876..559970
FT                   /note="csp repeat region"
FT   repeat_region   559876..559938
FT                   /note="63mer direct repeat"
FT   repeat_region   559894..559941
FT                   /note="48mer direct repeat"
FT   repeat_region   559937..559970
FT                   /note="34mer direct repeat"
FT   CDS_pept        560176..561546
FT                   /transl_table=11
FT                   /gene="csp2H"
FT                   /locus_tag="SSUSC84_0507"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0523"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51285"
FT                   /protein_id="CAZ51285.1"
FT                   /translation="MKIISFTMVNNESEIIESFIRYNYNFIDEMVIIDNGCTDNTMQII
FT                   FNLIKEGYKISVYDESLEAYNQYRLDNKYLTKIIAEKNPDLIIPLDADEFLTADSNPRK
FT                   LLEQLDLEKIHYVNWQWFVMTKKDDINESFIPRRMQYCFEKPVWHHSDGKPVTKCIISA
FT                   KYYKKMNLKLSMGHHTVFGNPNVRIEHHNDLKFAHYRAISQEQLIYKTICYTIRDIATM
FT                   ENNIETAQRTNQMALIESGVDMWETAREASYSGYDCNVIHAPIDLSFCKENIVIKYNEL
FT                   SRETVAERVMKTGREMAVRAYNVERKQKEKKFLKPIIFVLDGLKGDEYIHPNPSNHLTI
FT                   LTEMYNVRGLLTDNHQIKFLKVNYRLIITPDFAKFLPHEFIVVPDTLDIEQVKSQYVGT
FT                   GVDLSKIISLKEYRKEIGFIGNLYALLGFVPNMLNRIYLYIQRNGIANTIIKIKSRL"
FT   misc_feature    560941..560961
FT                   /gene="csp2H"
FT                   /locus_tag="SSUSC84_0507"
FT                   /note="ScanRegExp hit to PS00290, IG_MHC, score NA"
FT                   /inference="protein motif:Prosite:PS00290"
FT   misc_feature    561421..561489
FT                   /gene="csp2H"
FT                   /locus_tag="SSUSC84_0507"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0507 by TMHMM2.0 at aa 416-438"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        561614..562813
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /gene_synonym="csp2I"
FT                   /locus_tag="SSUSC84_0508"
FT                   /product="oligosaccharide repeat unit polymerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0524"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51286"
FT                   /protein_id="CAZ51286.1"
FT                   /translation="MRIRINNLFFVAIAFMGIIISNSQVVLAIGKASVIQYLSYLVLIL
FT                   CIVNDLLKNNKHIVVYKLGYLFLIIFLFTIGICQQILPITTKIYLSISMMIISVLATLP
FT                   ISLIKDIDDFRRISNHLLFALFITSILGIMMGATMFTGAVEGIGFSQGFNGGLTHKNFF
FT                   GITILMGFVLTYLAYKYGSYKRTDRFILGLELFLILISNTRSVYLILLLFLFLVNLDKI
FT                   KIEQRQWSTLKYISMLFCAIFLYYFFGFLITHSDSYAHRVNGLINFFEYYRNDWFHLMF
FT                   GAADLAYGDLTLDYAIRVRRVLGWNGTLEMPLLSIMLKNGFIGLVGYGIVLYKLYRNVR
FT                   ILKTDNIKTIGKSVFIIVVLSATVENYIVNLSFVFMPICFCLLNSISTMESTINKQLQT
FT                   "
FT   sig_peptide     561614..561697
FT                   /gene="wzy"
FT                   /gene_synonym="csp2I"
FT                   /locus_tag="SSUSC84_0508"
FT                   /note="Signal peptide predicted for SSUSC84_0508 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.963 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(561632..561700,561710..561769,561788..561856,
FT                   561869..561937,561974..562042,562100..562159,
FT                   562196..562264,562307..562375,562433..562501,
FT                   562544..562612,562673..562741)
FT                   /gene="wzy"
FT                   /gene_synonym="csp2I"
FT                   /locus_tag="SSUSC84_0508"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSUSC84_0508 by TMHMM2.0 at aa 7-29, 33-52, 59-81, 86-108,
FT                   121-143, 163-182, 195-217, 232-254, 274-296, 311-333 and
FT                   354-376"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        562952..563950
FT                   /transl_table=11
FT                   /gene="cps2J"
FT                   /locus_tag="SSUSC84_0509"
FT                   /product="ptative glycosyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0525"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51287"
FT                   /protein_id="CAZ51287.1"
FT                   /translation="MEKVSIIVPIFNTEKYLRECLDSIISQSYTNLEILLIDDGSSDSS
FT                   TDICLEYAEQDGRIKLFRLPNGGVSNARNYGIKNSTANYIMFVDSDDIVDGNIVESLYT
FT                   CLKENDSDLSGGLLATFDGNYQESELQKCQIDLEEIKEVRDLGNENFPNHYMSGIFNSP
FT                   CCKLYKNIYINKGFDTEQWLGEDLLFNLNYLKNIKKVSYVNRNLYFARRGIQSTTNTFK
FT                   KDVFIQLENLEEKTFDLFVKIFGGQYEFSVFKETLQWHIIYYSLLMFKNGDESLPKKLH
FT                   IFKYLYNRHSLDTLSIKRTSSVFKRICKLIVANNLFKIFLNTLIREEKNND"
FT   misc_feature    562964..563482
FT                   /gene="cps2J"
FT                   /locus_tag="SSUSC84_0509"
FT                   /note="HMMPfam hit to PF00535, Glycos_transf_2, score
FT                   1.5e-43"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   CDS_pept        563943..564947
FT                   /transl_table=11
FT                   /gene="csp2K"
FT                   /locus_tag="SSUSC84_0510"
FT                   /product="putative glycosyl transferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0526"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51288"
FT                   /protein_id="CAZ51288.1"
FT                   /translation="MINISIIVPIYNVEQYLSKCINSIVNQTYKHIEILLVNDGSTDNS
FT                   EEICLAYAKKDSRIRYFKKENGGLSDARNYGISRAKGDYLAFIDSDDFIHSEFIQRLHE
FT                   AIERENALVAVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVAWNK
FT                   LYKKELFEDFRFEKGKIHEDEYFTYRLLYELEKVAIVKECLYYYVDRENSIITSSMTDH
FT                   RFHCLLEFQNERMDFYESRGDKELLLECYRSFLAFAVLFLGKYNHWLSKQQKKLLQTLF
FT                   RIVYKQLKQNKRLALLMNAYYLVGCLHLNFSVFLKTGKDKIQERLRRSESSTR"
FT   misc_feature    563955..564464
FT                   /gene="csp2K"
FT                   /locus_tag="SSUSC84_0510"
FT                   /note="HMMPfam hit to PF00535, Glycos_transf_2, score
FT                   4.5e-51"
FT                   /inference="protein motif:HMMPfam:PF00535"
FT   misc_feature    564819..564887
FT                   /gene="csp2K"
FT                   /locus_tag="SSUSC84_0510"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0510 by TMHMM2.0 at aa 293-315"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        564987..565298
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0511"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0527"
FT                   /note="Possible gene remnant, CDS could be fragement of
FT                   larger CDS including downstream CDSs"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51289"
FT                   /protein_id="CAZ51289.1"
FT                   /translation="MNPTNSRIALFDTIKCIMVLCVIFTHLDWSVEQRQWFIFPYFVDM
FT                   AVPIFLLLSAYFRTNKWNTKQETLKLKFSSGIKESINMLCLYAIVMAVNVLLSYSRTI"
FT   misc_feature    join(564999..565067,565095..565163,565224..565283)
FT                   /locus_tag="SSUSC84_0511"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUSC84_0511 by TMHMM2.0 at aa 5-27, 37-59 and 80-99"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        565341..565547
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0512"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0528"
FT                   /note="Possible gene remnant, CDS could be fragement of
FT                   larger CDS including upstream and downstream CDSs"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51290"
FT                   /protein_id="CAZ51290.1"
FT                   /translation="MSCGYFLENRVQGVGSYYVPLLIQVVFLLPILYVLFEKNKWLGLL
FT                   TCFLVNFSVDAIFANMAEHGIYI"
FT   misc_feature    565377..565445
FT                   /locus_tag="SSUSC84_0512"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0512 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        565608..566006
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0513"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0529"
FT                   /note="Possible gene remnant, CDS could be fragement of
FT                   larger CDS including upstream CDSs"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51291"
FT                   /protein_id="CAZ51291.1"
FT                   /translation="MRSKVDTFIATLFGIIGAILIFVNHSIEPFSWFYGWKSTSFLCVP
FT                   FAYAMLFFMIKYGQKIPAILLSKLGVASYHIYLTQMLYFSVVAPFLAVQFKVSSLNLWN
FT                   GLFTFLICLFGGYIFYKVDLFMRVRGKR"
FT   misc_feature    join(565626..565679,565722..565781,565818..565886,
FT                   565914..565967)
FT                   /locus_tag="SSUSC84_0513"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUSC84_0513 by TMHMM2.0 at aa 7-24, 39-58, 71-93 and
FT                   103-120"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        join(566192..566350,566446..566568,566568..566690)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0514"
FT                   /product="N-acylneuraminate cytidylyltransferase
FT                   (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0530"
FT                   /note="Probable gene remnant. CDS is disrupted by a repeat,
FT                   that is also found elsewhere the csp region. Similar to the
FT                   N-terminal region of Streptococcus agalactiae (serotype V)
FT                   N-acylneuraminate cytidylyltransferase (ec 2.7.7.43) (CMP-N
FT                   acetylneuraminic acid synthetase) (CMP-neunac synthetase)
FT                   (cmp-siali acid synthetase) NeuA UniProt:Q9AFG9
FT                   (EMBL:AE014244) (413 aa) fasta scores: E()=7.3e-25, 57.246%
FT                   id in 138 aa. Similar to the N-terminal region of SSU0538,
FT                   87.273% identity (87.273% ungapped) in 55 aa overlap
FT                   (9-63:4-58)"
FT   misc_feature    join(566192..566350,566446..566568,566568..566654)
FT                   /locus_tag="SSUSC84_0514"
FT                   /note="HMMPfam hit to PF02348, CTP_transf_3, score 1.5e-28"
FT                   /inference="protein motif:HMMPfam:PF02348"
FT   repeat_region   566372..566455
FT                   /note="csp repeat region"
FT   repeat_region   566372..566419
FT                   /note="48mer direct repeat"
FT   repeat_region   566372..566416
FT                   /note="45mer direct repeat"
FT   repeat_region   566421..566455
FT                   /note="35mer direct repeat"
FT   CDS_pept        566790..567761
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0515"
FT                   /product="putative lipooligosaccharide sialyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0533"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51293"
FT                   /protein_id="CAZ51293.1"
FT                   /translation="MRRIYICHTMYQILISLLKMDVERDSLMSVDIIGHFPDVREQLQQ
FT                   HVHLIEETERSFDLYSLIARSKTKERLSLLQSYDEVIIFQDHRQVGHFLNKHRIPYSLL
FT                   EDGYNFFKDKRVCDLESIQSSVWKRLFYQWYFKPTYLIGSSLYCQSIEVNDLSLVQFDE
FT                   AYKPFVEVPRKQLFDQASPEKVQALLQIFGARAIVADEESSQKRLLLLTQPLSWDYHVT
FT                   EEELLEIYVAGLAPYREDYTIYIKPHPRDGVDYSFLGKAVVLLPQGIPFELFEMAGSIR
FT                   FDIGMTYSSSALDFLNCFEEKVYLKDTFPLLSKNDILREGIE"
FT   misc_feature    566793..567695
FT                   /locus_tag="SSUSC84_0515"
FT                   /note="HMMPfam hit to PF05855, LST, score 1.7e-28"
FT                   /inference="protein motif:HMMPfam:PF05855"
FT   CDS_pept        567770..569176
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0516"
FT                   /product="putative exopolysaccharide biosynthesis protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0534"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51294"
FT                   /protein_id="CAZ51294.1"
FT                   /translation="MSKKSIVVSGLVYTIGTILVQGLAFITLPIYTRVISQEVYGQFSL
FT                   YNSWVGLVGLFIGLQLGGAFGPGWVHFREKFDDFVSTLMVSSIAFFLPIFGLSFLLSQP
FT                   LSLLFGLPDWVVPLIFLQSFMSVVQGFFTTYLVQRQQSMWTLLLSVLSAVINTALSLFL
FT                   IFSMENDFIARVMANSATTGVFACVSLLFFYKKIGLHFRKDYLRYGLSISIPLIFHGLG
FT                   HNVLNQFDRIMLGKMLTLSDVALYSFGYTLASILQIVFSSLNTVWCPWYFEKKRGADKD
FT                   LLSYVRYYLAIGLFVTFGFLTIYPELAMLLGGSEYRFSMGFIPMIIVGVFFVFLYSFPA
FT                   NIQFYSGNTKFLPIGTFIAGVLNISVNFVLIPTIGIYGAALATTASYLLLLVLHYFVAK
FT                   KKYAYDEVAISTFVKVIALVVVYTGLMTVFVGSIWIRWSLGIAVLVVYAYIFRKELTVA
FT                   LNTFREKRSK"
FT   misc_feature    567785..568594
FT                   /locus_tag="SSUSC84_0516"
FT                   /note="HMMPfam hit to PF01943, Polysacc_synt, score
FT                   4.2e-22"
FT                   /inference="protein motif:HMMPfam:PF01943"
FT   misc_feature    join(567788..567856,567914..567982,568016..568084,
FT                   568112..568180,568199..568267,568280..568348,
FT                   568385..568444,568502..568570,568631..568699,
FT                   568727..568795,568814..568882,568895..568963,
FT                   568988..569056,569066..569122)
FT                   /locus_tag="SSUSC84_0516"
FT                   /note="14 probable transmembrane helices predicted for
FT                   SSUSC84_0516 by TMHMM2.0 at aa 7-29, 49-71, 83-105,
FT                   115-137, 144-166, 171-193, 206-225, 245-267, 288-310,
FT                   320-342, 349-371, 376-398, 407-429 and 433-451"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   569175..569277
FT                   /note="csp repeat region"
FT   repeat_region   569175..569237
FT                   /note="63mer direct repeat"
FT   repeat_region   569193..569237
FT                   /note="45mer direct repeat"
FT   repeat_region   569237..569270
FT                   /note="34mer direct repeat"
FT   repeat_region   569243..569277
FT                   /note="35mer direct repeat"
FT   CDS_pept        569699..570715
FT                   /transl_table=11
FT                   /gene="neuB"
FT                   /locus_tag="SSUSC84_0517"
FT                   /product="putative N-acetylneuraminic acid synthase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0535"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51295"
FT                   /protein_id="CAZ51295.1"
FT                   /translation="MVYIIAEIGCNHNGDVHLARKMVEVAVDCGVDAVKFQTFKADLLI
FT                   SKYAPKAEYQKITTGESDSQLEMTRRLELSFEEYLDLRDYCLEKGVDVFSTPFDEESLD
FT                   FLISTDMPVYKIPSGEITNLPYLEKIGRQAKKVILSTGMAVMDEIHQAVKILQENGTTD
FT                   ISILHCTTEYPTPYPALNLNVLHTLKKEFPNLTIGYSDHSVGSEVPIAAAAMGAELIEK
FT                   HFTLDNEMEGPDHKASATPDILAALVKGVRIVEQSLGKFEKEPEEVEVRNKIVARKSIV
FT                   AKKAIAKGEVFTEENITVKRPGNGISPMEWYKVLGQVSEQDFEEDQNICHSAFENQM"
FT   misc_feature    569762..570487
FT                   /gene="neuB"
FT                   /locus_tag="SSUSC84_0517"
FT                   /note="HMMPfam hit to PF03102, NeuB, score 4.6e-144"
FT                   /inference="protein motif:HMMPfam:PF03102"
FT   misc_feature    570527..570703
FT                   /gene="neuB"
FT                   /locus_tag="SSUSC84_0517"
FT                   /note="HMMPfam hit to PF08666, SAF, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF08666"
FT   CDS_pept        570727..571860
FT                   /transl_table=11
FT                   /gene="neuC"
FT                   /locus_tag="SSUSC84_0518"
FT                   /product="putative UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0536"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51296"
FT                   /protein_id="CAZ51296.1"
FT                   /translation="MKKICFVTGSRAEYGIMRRLLSYLQDDPEMELDLVVTAMHLEEKY
FT                   GMTVKDIEADKRRIVKRIPLHLTDTSKQTIVKSLATLTEQLTVLFEEVQYDLVLILGDR
FT                   YEMLPVANAALLYNIPICHIHGGEKTMGNFDESIRHAITKMSHLHLTSTDEFRNRVIQL
FT                   GENPNHVLNIGAMGVENVLKQDFLTREELAMELGIDFAEDYYVVLFHPVTLEDNTAEEQ
FT                   TQALLDALKEDGSQCLIIGSNSDTHADKIMELMHEFVKQDSDSYIFTSLPTRYYHSLVK
FT                   HSQGLIGNSSSGLIEVPSLQVPTLNIGNRQFGRLSGPSVVHVGTSKEAIVGGLGQLRDV
FT                   IDFTNPFEQPDSALQGYRAIKEFLSVQASTMKEFYDR"
FT   misc_feature    570790..571809
FT                   /gene="neuC"
FT                   /locus_tag="SSUSC84_0518"
FT                   /note="HMMPfam hit to PF02350, Epimerase_2, score 1.7e-95"
FT                   /inference="protein motif:HMMPfam:PF02350"
FT   CDS_pept        571874..572500
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0519"
FT                   /product="putative transferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0537"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51297"
FT                   /protein_id="CAZ51297.1"
FT                   /translation="MKKVAFLGAGTFSDGVLPWLDRSRYELIGYFEDKPISDYRGYPVF
FT                   GPLQDVLTYLDDGKVDAVFVTIGDNVKRKEIFDLLAKDHYDALFNIISEQANIFSPDSI
FT                   KGRGVFIGFSSFVGADSYVYDNCIINTGAIVEHHTTVEAHCNITPGVTINGLCRIGEGT
FT                   YIGSGSTVIQCIEIAPYTTLGAGTVVLKSLTESGTYVGVPARKIK"
FT   misc_feature    572231..572284
FT                   /locus_tag="SSUSC84_0519"
FT                   /note="HMMPfam hit to PF00132, Hexapep, score 13"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    572285..572338
FT                   /locus_tag="SSUSC84_0519"
FT                   /note="HMMPfam hit to PF00132, Hexapep, score 0.7"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    572339..572392
FT                   /locus_tag="SSUSC84_0519"
FT                   /note="HMMPfam hit to PF00132, Hexapep, score 6.4"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   misc_feature    572366..572452
FT                   /locus_tag="SSUSC84_0519"
FT                   /note="ScanRegExp hit to PS00101, HEXAPEP_TRANSFERASES,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    572393..572446
FT                   /locus_tag="SSUSC84_0519"
FT                   /note="HMMPfam hit to PF00132, Hexapep, score 58"
FT                   /inference="protein motif:HMMPfam:PF00132"
FT   CDS_pept        572509..573741
FT                   /transl_table=11
FT                   /gene="neuA"
FT                   /locus_tag="SSUSC84_0520"
FT                   /product="N-acylneuraminate cytidylyltransferase"
FT                   /EC_number="2.7.7.43"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0538"
FT                   /note="N-terminal region is similar to SSU0530, 87.273%
FT                   identity (87.273% ungapped) in 55 aa overlap (4-58:9-63)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51298"
FT                   /protein_id="CAZ51298.1"
FT                   /translation="MEPICLIPARSGSKGLPNKNMLFLDGVPMIFHTIRAAIESGCFKK
FT                   ENIYVSTDSEVYKEICETTGVQVLMRPADLATDFTTSFQLNEHFLQDFSDDQVFVLLQV
FT                   TSPLRSGKHVKEAMELYGKGQADHVVSFTKVDKSPTLFSTLDENGFAKDIAGLGGSYRR
FT                   QDEKTLYYPNGAIYISSKQAYLADKTYFSEKTAAYVMTKEDSIDVDDHFDFTGVIGRIY
FT                   FDYQRREQQNKPFYKRELKRLCEQRVHDSLVIGDSRLLALLLDGFDNISIGGMTASTAL
FT                   ENQGLFLATPIKKVLLSLGVNDLITDYPLHMIEDTIRQLMESLVSKAEQVFVTTIAYTL
FT                   FRDSVSNEEIVQLNDVIVQSASELGISVIDLNEVVEKEAMLDYQYTNDGLHFNQIGQER
FT                   VNQLILTSLTR"
FT   misc_feature    572518..573237
FT                   /gene="neuA"
FT                   /locus_tag="SSUSC84_0520"
FT                   /note="HMMPfam hit to PF02348, CTP_transf_3, score 2.4e-45"
FT                   /inference="protein motif:HMMPfam:PF02348"
FT   misc_feature    573391..573720
FT                   /gene="neuA"
FT                   /locus_tag="SSUSC84_0520"
FT                   /note="HMMPfam hit to PF00657, Lipase_GDSL, score 5.2e-06"
FT                   /inference="protein motif:HMMPfam:PF00657"
FT   repeat_region   573895..574953
FT                   /note="IS element, novel IS"
FT   CDS_pept        join(573938..574417,574416..574811)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0521"
FT                   /product="transposase (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0539"
FT                   /note="CDS contains a frameshift and deletion after codon
FT                   160. Similar to Streptococcus thermophilus IS1198
FT                   transposase UniProt:Q70C57 (EMBL:AR542664) (334 aa) blastp
FT                   scores: E()=8e-82"
FT                   /db_xref="PSEUDO:CAZ51299.1"
FT   misc_feature    join(574352..574416,574417..574763)
FT                   /locus_tag="SSUSC84_0521"
FT                   /note="HMMPfam hit to PF01609, Transposase_11, score
FT                   4.7e-08"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   575014..575913
FT                   /note="IS element, novel IS"
FT   CDS_pept        575061..575411
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0522"
FT                   /product="putative transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0966"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51300"
FT                   /protein_id="CAZ51300.1"
FT                   /translation="MAYSLDFRKKVLAYCEKTGSITEASAIFQVSRNTIYQWLKLKEKT
FT                   GELHHQVKGTKPRKVDRDKLKNYLETHPDAYLTEIASEFDCHPTAIHYPLKAMGYTRKK
FT                   RAVPTMNKTLKK"
FT   misc_feature    575061..575405
FT                   /locus_tag="SSUSC84_0522"
FT                   /note="HMMPfam hit to PF01710, Transposase_14, score
FT                   6.5e-16"
FT                   /inference="protein motif:HMMPfam:PF01710"
FT   misc_feature    575115..575180
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2164.000, SD 6.56 at aa 19-40, sequence
FT                   GSITEASAIFQVSRNTIYQWLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        575429..575908
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0523"
FT                   /product="transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0967"
FT                   /note="Full length CDS is similar to Synechocystis sp.
FT                   (strain PCC 6803) transposase UniProt:Q55696
FT                   (EMBL:AP004311) (164 aa) fasta scores: E()=2.5e-16, 42.000%
FT                   id in 150 aa. C-terminal region is similar to to
FT                   Streptococcus pneumoniae IS630-Spn1, transposase Orf2
FT                   UniProt:Q97CV1 (EMBL:AE007319) (112 aa) fasta scores:
FT                   E()=6.6e-33, 76.786% id in 112 aa, and to Synechocystis sp.
FT                   (strain PCC 6803) transposase. UniProt:Q55696
FT                   (EMBL:AP004311) (164 aa) fasta scores: E()=2.5e-16, 42.000%
FT                   id in 150 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51301"
FT                   /protein_id="CAZ51301.1"
FT                   /translation="MNNLSHLTPVYIDETGFETYFHRKYGRSLKGQLIKGKVSGRRYQR
FT                   ISLVAGLINGALIAPMTYKDTMTSGFFEAWFKTFLLPTLGKPSVIIMDNAKFHRMSKLK
FT                   DLCEEQGHRLLPLPPYSPEYNPIEKIWAHIKKHLRRVLPNCDTFLEALSSCSCFS"
FT   CDS_pept        575945..576130
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0524"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0543"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pneumoniae IS66 family element,
FT                   Orf1 UniProt:Q97PZ4 (EMBL:AE007441) (79 aa) fasta scores:
FT                   E()=8.5e-13, 63.934% id in 61 aa"
FT                   /db_xref="PSEUDO:CAZ51302.1"
FT   CDS_pept        576111..576398
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0525"
FT                   /product="putative transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0544"
FT                   /note="Possible gene remnant. Similar to the N-terminal
FT                   region of several IS element proteins, for example,
FT                   Streptococcus pneumoniae IS66 family element, Orf2
FT                   UniProt:Q97PZ5 (EMBL:AE007441) (116 aa) fasta scores:
FT                   E()=1.9e-33, 84.211% id in 95 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51303"
FT                   /protein_id="CAZ51303.1"
FT                   /translation="MTIRLSDLGQVFLVCGKTDMRQGIDSLAYLVKSQFNLDPFSGQVY
FT                   LFCGGRKDRFKALYWDEQGFWLLYKRFENGKLAWSNNEEEVKALTSEQVD"
FT   misc_feature    576129..576395
FT                   /locus_tag="SSUSC84_0525"
FT                   /note="HMMPfam hit to PF05717, Transposase_34, score
FT                   4.1e-35"
FT                   /inference="protein motif:HMMPfam:PF05717"
FT   CDS_pept        join(576458..576718,576720..577526,577529..577600,
FT                   577600..578007)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0526"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0545"
FT                   /note="CDS contains frameshifts after codons 87, 356 and
FT                   380. Similar to Ruminococcus gnavus hypothetical protein
FT                   UniProt:Q8VRK5 (EMBL:AF439554) (538 aa) fasta scores:
FT                   E()=3.4e-28, 32.645% id in 533 aa"
FT                   /db_xref="PSEUDO:CAZ51304.1"
FT   misc_feature    576855..577439
FT                   /locus_tag="SSUSC84_0526"
FT                   /note="HMMPfam hit to PF03050, Transposase_25, score
FT                   1.7e-11"
FT                   /inference="protein motif:HMMPfam:PF03050"
FT   repeat_region   578075..578165
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        578247..579032
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0527"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0549"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus thermophilus (strain CNRZ 1066)
FT                   IS1239, transposase, IS30 family UniProt:Q5M0H3
FT                   (EMBL:CP000024) (332 aa) fasta scores: E()=4.8e-96, 94.253%
FT                   id in 261 aa"
FT                   /db_xref="PSEUDO:CAZ51305.1"
FT   misc_feature    578586..579023
FT                   /locus_tag="SSUSC84_0527"
FT                   /note="HMMPfam hit to PF00665, rve, score 6.6e-24"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS_pept        579232..579390
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0528"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0550"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pneumoniae IS66 family element,
FT                   Orf1 UniProt:Q97QB1 (EMBL:AE007429) (79 aa) fasta scores:
FT                   E()=3.8e-11, 62.745% id in 51 aa"
FT   CDS_pept        579371..579424
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0529"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0551"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pneumoniae IS66 family element
FT                   UniProt:Q7WVV7 (EMBL:AY336008) (116 aa) fasta scores:
FT                   E()=0.00047, 88.235% id in 17 aa"
FT                   /db_xref="PSEUDO:CAZ51307.1"
FT   CDS_pept        complement(join(579425..579655,579655..579999))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0530"
FT                   /product="putative tyrosine recombinase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0552"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Methanobacterium thermoautotrophicum XerC-like tyrosine
FT                   recombinase UniProt:O26979 (EMBL:AE000865) (311 aa) fasta
FT                   scores: E()=4.6e-18, 47.222% id in 144 aa"
FT   misc_feature    complement(join(579464..579655,579655..579957))
FT                   /locus_tag="SSUSC84_0530"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   5.1e-36"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   repeat_region   580365..580393
FT                   /note="29mer direct repeat"
FT   CDS_pept        join(580499..580651,580655..581050,581049..581396)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="SSUSC84_0531"
FT                   /product="D-alanine--D-alanine ligase (pseudogene)"
FT                   /EC_number="6.3.2.4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0554"
FT                   /note="CDS contains nonsense (amber) and frameshift
FT                   mutations after codons 51 and 182. The frameshift mutation
FT                   occurs at a poly T hexamer. Similar to Aquifex aeolicus
FT                   D-alanine--D-alanine ligase (ec 6.3.2.4) (D-alanylalanine
FT                   synthetase (D-ala-D-ala ligase) Ddl UniProt:O66806
FT                   (EMBL:AE000694) (291 aa) fasta scores: E()=1.8e-05, 21.127%
FT                   id in 284 aa"
FT                   /db_xref="PSEUDO:CAZ51309.1"
FT   CDS_pept        complement(581391..583748)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0532"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0556"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51310"
FT                   /protein_id="CAZ51310.1"
FT                   /translation="MSHWNQFLTEITYSIIQAHTDQKSLSLYIPFEDSLSKSLAFDTIS
FT                   QELLESEIDGNGTVLYSDFGDNNITDEYKLSFAEKFFKPISVSVNNSIQGFGTAGLSLK
FT                   YDSTEIEKKILNNSNNYRLIFLIQHWEWLGSELKLFFIRLLNNISHYEKQYNKSIIIVI
FT                   GGSELKNNDIRFSKNFDVHHFELNDLKDTLGNIIQTSNISDNLEDTLYPLTKGNLEKIY
FT                   NFILLSQNNSKIEKLLDDLLNTIEIDFRKNKIEIDFIYQLSVLPEYFNPYDAEEYFNLK
FT                   TFQIEKAIDILKKLLVLIPVKNRTNFYSLILIMKDKLLLTVEKGQKEIYRRYYHYLCGK
FT                   EPFNYRLKIEILSRLKESQEYLLSLYLLWYEYLLNQNEILESEKKSLYKLEFLTEETKS
FT                   IFFKCIKYKYTNGTNSLYNEILPENSLLSSILLKNDINFQGNTSQDFSFHSLCDTLYEN
FT                   ILAESAKDVIVEPIHYLSCIYMLLPHLIDKLNIDKLNEIDKFQVLNENIVKKFYTTKDI
FT                   EQNAQYLENIYLRKSFLYKDNDRSINDANKALKFFNDVDDEIEQYYTLGSLLGLLLVSS
FT                   NYERANQVKQEIETLSDKHNLPLYWKSKNNFVVLDFLSGMEGDFDYWKSRFESILTEYE
FT                   LNDVSKHLMYTNLCAISLYYSKTKGYRSYKTILEELMDVEDLADLEDTSIDDFYRYYFG
FT                   WFEFCLLLLESKHRQAKNKYNQLKDFSPIIFNSNKKLLIEKHRRYKKIFESNIKTGKEF
FT                   SEFLSQSKFASREWNYFRRGLMLTDIQYTSAL"
FT   repeat_region   complement(583759..583787)
FT                   /note="29mer direct repeat"
FT   CDS_pept        583965..585245
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="SSUSC84_0533"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0557"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51311"
FT                   /protein_id="CAZ51311.1"
FT                   /translation="MKLRRSVEKLKGTIRVPGDKSISHRSIIFGSLAKGVTRFHNILRG
FT                   EDVLSTMQVFRDLGVKIEDNGDIVEVHGVGFDGLQAPKNDLDMGNSGTSIRLISGVLAG
FT                   QDFEATMFGDDSLSKRPMDRVTIPLSQMGVEISGQTERDLPPLTIKGNKNLKPIRYQLP
FT                   VASAQVKSALIFAALQAEGESVIVEKELTRNHTEDMIVQFGGQLEVNGKEIRIQGGQEF
FT                   IAQEITVPGDISSAAFWLVAGLIIPGSKIVLENVGINETRTGILDVIKAMGGKMTLSNI
FT                   DELAKSATITVETSELKATEIAGELIPRLIDELPIITLLATQAHGTTIIRDAEELKVKE
FT                   TDRIQVVADALNSMGATIEPTEDGMIIHGPTALHGAEINTFGDHRIGMMTAIAALLAKD
FT                   GEVVLERAEAINTSYPAFFEHLNSLMD"
FT   misc_feature    583974..585227
FT                   /gene="aroA"
FT                   /locus_tag="SSUSC84_0533"
FT                   /note="HMMPfam hit to PF00275, EPSP_synthase, score
FT                   6.1e-142"
FT                   /inference="protein motif:HMMPfam:PF00275"
FT   misc_feature    584220..584264
FT                   /gene="aroA"
FT                   /locus_tag="SSUSC84_0533"
FT                   /note="ScanRegExp hit to PS00104, EPSP_SYNTHASE_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00104"
FT   misc_feature    584973..585029
FT                   /gene="aroA"
FT                   /locus_tag="SSUSC84_0533"
FT                   /note="ScanRegExp hit to PS00885, EPSP_SYNTHASE_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00885"
FT   CDS_pept        585254..585745
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SSUSC84_0534"
FT                   /product="putative shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0558"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51312"
FT                   /protein_id="CAZ51312.1"
FT                   /translation="MPIVLLGFMGVGKTTTAHLLNLPVYDMDHIIEERIGMPIADYFSL
FT                   EGEASFRQLETEVLKGLLDLPSNCIVSTGGGVIKSEVNRELLLANREDNVLLTASFEVS
FT                   YQRIRKDRQSQRPLFLQCSKEEFEALYRERMALYQGLADTVIDTDKLIPEQVARKILCK
FT                   "
FT   misc_feature    585278..585739
FT                   /gene="aroK"
FT                   /locus_tag="SSUSC84_0534"
FT                   /note="HMMPfam hit to PF01202, SKI, score 1.4e-54"
FT                   /inference="protein motif:HMMPfam:PF01202"
FT   misc_feature    585407..585487
FT                   /gene="aroK"
FT                   /locus_tag="SSUSC84_0534"
FT                   /note="ScanRegExp hit to PS01128, SHIKIMATE_KINASE, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS01128"
FT   CDS_pept        585736..586563
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="SSUSC84_0535"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0559"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51313"
FT                   /protein_id="CAZ51313.1"
FT                   /translation="MQVAYLGPRGSFTHQVAQQVFPTADLQAFETITEVIKAYETGEVT
FT                   YSVIPVENSIEGSVHETIDYLFHQAEIHAVAEIVQPIAQQLLATSADKAVEVIYSHPQA
FT                   IAQGKKYIQEHFPQARIEITVSTAYAARFVAEHPEQPFAAIAPQAAAVEYGLEVIAQDI
FT                   QEISENFTRFWILGDKAPSIALEQVAKKVSLALTLPDNLPGALYKAMSVFSWRGISLTK
FT                   IESRPLKTALGEYFFILDLDNQSEELLTYSQKELTSLDITYKVLGNYLVYMTS"
FT   misc_feature    585742..586278
FT                   /gene="pheA"
FT                   /locus_tag="SSUSC84_0535"
FT                   /note="HMMPfam hit to PF00800, PDT, score 2e-65"
FT                   /inference="protein motif:HMMPfam:PF00800"
FT   misc_feature    586393..586416
FT                   /gene="pheA"
FT                   /locus_tag="SSUSC84_0535"
FT                   /note="ScanRegExp hit to PS00858, PREPHENATE_DEHYDR_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00858"
FT   CDS_pept        586575..587900
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0536"
FT                   /product="cell envelope-related transcriptional attenuator
FT                   domain protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0560"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51314"
FT                   /protein_id="CAZ51314.1"
FT                   /translation="MNKNNNILTHHEQLRLDYLQKNIHYLNDKESRELDYLLYKKELRE
FT                   RHGSPRQSLRSFTPTAYEDDYFEEDYFEEDDEQEELLPRYPERKSRKTRQAKPQRFQSP
FT                   RIGPKAKVPKPKKARKKGGFKRFIGFVLLAIALVIVAMGYSFFKGMNSVSEKPVAEVFN
FT                   GVDTSNGTNILILGTDGRVGESSGETRTDTIMVLNVNNTDNKVKLVSFMRDTLVDIEGY
FT                   EYKLNTAYTLGEQDNQQGAEEVRKALKNSFDIDIKYYAMVDFATFATTIDTLFPEGVTI
FT                   DAQFSTINGEVVSSVEVPNDLQLEENAPAYQTIQVGVQQMDGKTLLNYARYRSDDEGDF
FT                   GRTRRQQEVLSAVMTQAKNPMKLFSGSEAIGKVVAMTPTTVPQSFMWLQGPGLLLDAAN
FT                   GIERVTIPENGDWIDDYDMYGGMALRVDFEKYQQRLAELGLR"
FT   misc_feature    586953..587012
FT                   /locus_tag="SSUSC84_0536"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0536 by TMHMM2.0 at aa 127-146"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    587142..587651
FT                   /locus_tag="SSUSC84_0536"
FT                   /note="HMMPfam hit to PF03816, LytR_cpsA_psr, score
FT                   4.6e-67"
FT                   /inference="protein motif:HMMPfam:PF03816"
FT   CDS_pept        587966..589324
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0537"
FT                   /product="putative RNA methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0561"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51315"
FT                   /protein_id="CAZ51315.1"
FT                   /translation="MLKKNDIVEVEVVDLTHEGQGVAKIDGFVFFVDNALPGEKISMRI
FT                   LKLKKNIGFGKVEQWQSFSQDRNQDLDFTYLRTGIADLGHLTYPAQLAFKKKQVENSLR
FT                   KIAGISEIAVADTLGMDSPLAYRNKAAVPVRRVNGQLETGFFRKNSHDLVPIEDFYIQH
FT                   KEIDALVLATRDLLRKLDLKPYDEKEQTGLVRNIVVRRGHYSGQLMLVLVTTRPKIFRV
FT                   ETLIERLTSQFPNLVSIVQNINDQNTNAIFGQEFRLLHGSETIADTMLGNEFEISAPSF
FT                   YQVNTEMAEKLYQTAIDFAELSADDVVIDAYSGIGTIGLSFAKQVKHVYGVEVVEKAVL
FT                   DSQKNAARNGIDNVTYVCDSAESAMQKWVADGVKPTVIFVDPPRKGLTESFIKASTSVK
FT                   PEKIVYISCNVATMARDIKLYEELGYKLTKVQPADLFPNTHHIEVVGLLEKRN"
FT   misc_feature    587966..588142
FT                   /locus_tag="SSUSC84_0537"
FT                   /note="HMMPfam hit to PF01938, TRAM, score 8.7e-07"
FT                   /inference="protein motif:HMMPfam:PF01938"
FT   misc_feature    588224..589318
FT                   /locus_tag="SSUSC84_0537"
FT                   /note="HMMPfam hit to PF05958, tRNA_U5-meth_tr, score
FT                   2.3e-08"
FT                   /inference="protein motif:HMMPfam:PF05958"
FT   misc_feature    589106..589201
FT                   /locus_tag="SSUSC84_0537"
FT                   /note="ScanRegExp hit to PS01230, TRMA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01230"
FT   CDS_pept        complement(join(589390..589593,589593..589658))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0538"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0562"
FT                   /note="Probable gene remnant. Similar to Streptococcus
FT                   pneumoniae transposase. UniProt:O33754 (EMBL:SPZ86112) (271
FT                   aa) blastp scores: E()=4e-20"
FT                   /db_xref="PSEUDO:CAZ51316.1"
FT   CDS_pept        589884..590996
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="SSUSC84_0539"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0563"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51317"
FT                   /protein_id="CAZ51317.1"
FT                   /translation="MKKYDYLVVGAGLFGAVFAHEAAKKGKKIKVIEKRDHIAGNIYTK
FT                   EVEGIQVHEYGAHIFHTSEKEIWDYVNQFAEFNSYTNTPVANYKGEIYNLPFNMNTFNK
FT                   LWGVVTPAEAGAKIAEQRAVLGGKTPENLEEQAISLVGTDIYEKLIKSYTEKQWEKPCT
FT                   ELPAFIIRRLPVRLTYDNNYFNDTYQGIPIGGYTQIVEKMLEHENIDVETNVDFFANKE
FT                   DYLATYPKIVFTGMIDEFFDYQLGELEYRSLRFETEVLDMENYQGNAVVNYTDSETPYT
FT                   RIIEHKHFEFGTQPKTIITREYSKTWKRGDEPYYPVNNNRNNHLYTAYKKLSEQQENVI
FT                   FGGRLGHYRYYDMHQVIGAALQCVRNEVGE"
FT   misc_feature    589896..590006
FT                   /gene="glf"
FT                   /locus_tag="SSUSC84_0539"
FT                   /note="HMMPfam hit to PF07992, Pyr_redox_2, score 4.4e-06"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    590325..590933
FT                   /gene="glf"
FT                   /locus_tag="SSUSC84_0539"
FT                   /note="HMMPfam hit to PF03275, GLF, score 2.2e-115"
FT                   /inference="protein motif:HMMPfam:PF03275"
FT   CDS_pept        complement(591096..591641)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0540"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0564"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51318"
FT                   /protein_id="CAZ51318.1"
FT                   /translation="MANVLFLVGSLRDGSFNHQMAKKAEAFLTDKAQVSYIDLAKIPLF
FT                   NQDIETPILPEIAELRAQVDAADAIWIFSPVYNYAIPGIVKNALDWLSRSLDLSNPKGP
FT                   SILQDKITTVSAVANSGHDHLFKDFQHLLPFIRTQIAGEFTGSTINPEAWGTGVLELSD
FT                   ETLTKLEQQVADLLAAIQ"
FT   misc_feature    complement(591360..591638)
FT                   /locus_tag="SSUSC84_0540"
FT                   /note="HMMPfam hit to PF03358, FMN_red, score 2.6e-25"
FT                   /inference="protein motif:HMMPfam:PF03358"
FT   CDS_pept        complement(591704..592153)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0541"
FT                   /product="MarR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0565"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51319"
FT                   /protein_id="CAZ51319.1"
FT                   /translation="MRTVEQSLNENKHALHSLVVFRRAANTIAKSELETIKKYGLTVCQ
FT                   FGVMEALYNKGNLRIQDLIDKLLSTSGNMTVVIKNMIRDGYIYKTIDTNDRRASLIALT
FT                   PLGRETIEKILPEHYDHVGEIFSVLSSEEQDQLAEILKKFKNQQT"
FT   misc_feature    complement(591824..592033)
FT                   /locus_tag="SSUSC84_0541"
FT                   /note="HMMPfam hit to PF01047, MarR, score 5.8e-18"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   repeat_region   592400..593299
FT                   /note="IS element"
FT   CDS_pept        592447..592797
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0542"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51320"
FT                   /protein_id="CAZ51320.1"
FT                   /translation="MAYSLDFRKKVLAYCEKTGSITEASAIFQVSRNTIYQWLKLKEKT
FT                   GELHHQVKGTKPRKVDRDKLKNYLETHPDAYLTEIASEFDCHPTAIHYPLKAMGYTRKK
FT                   RAVPTMNKTLKK"
FT   misc_feature    592447..592791
FT                   /locus_tag="SSUSC84_0542"
FT                   /note="HMMPfam hit to PF01710, Transposase_14, score
FT                   6.5e-16"
FT                   /inference="protein motif:HMMPfam:PF01710"
FT   misc_feature    592501..592566
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2164.000, SD 6.56 at aa 19-40, sequence
FT                   GSITEASAIFQVSRNTIYQWLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        592815..593294
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0543"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51321"
FT                   /protein_id="CAZ51321.1"
FT                   /translation="MNNLSHLTPVYIDETGFETYFHRKYGRSLKGQLIKGKVSGRRYQR
FT                   ISLVAGLINGALIAPMTYKDTMTSGFFEAWFKTFLLPTLGKPSVIIMDNAKFHRMSKLK
FT                   DLCEEQGHRLLPLPPYSPEYNPIEKIWAHIKKHLRRVLPNCDTFLEALSSCSCFS"
FT   CDS_pept        593353..593850
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0544"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0568"
FT                   /note="Possible alternative translational start sites after
FT                   codons 8, 11, 19 and 20."
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51322"
FT                   /protein_id="CAZ51322.1"
FT                   /translation="MEKKIFQLLEWMASKTGQLVMGSFILLSVVTFSIFTIWDIAAAPF
FT                   NNARSHAVGVATEYADLQTVNDFSIYNGTETYFCVFGVTSQGEEVAVLIPEASSTVYVY
FT                   SLAQGISQEEAQAIAKKNGASQVERTILGLRDGKPIWEVKSGTAYYLVEFETGNFIKRE
FT                   GL"
FT   misc_feature    593410..593478
FT                   /locus_tag="SSUSC84_0544"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0544 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        593847..595028
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="SSUSC84_0545"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0569"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51323"
FT                   /protein_id="CAZ51323.1"
FT                   /translation="MSKLSKRVLEMEESVTLAAGARAKALKAEGRDILELTLGEPDFVT
FT                   PKNIQEAAIKSIEDGKASFYTVASGLPELKDAVNTYFENFYGYSIERNQVVLATGAKFI
FT                   LYAFFAAVINPGDEVLIPTPYWVSYADQIKMNDGVPVFVTASEEHNFKVTVDQLEAART
FT                   DKTKVFLLNTPSNPTGMIYSREELEAIGNWAVEHDILILADDIYGRLVYNGNTFTPISS
FT                   ISESIRQQTIVVNGVAKAYAMTGWRVGFAVGNPEIIAAMSKIVGQTTSNLTTAAQYAAI
FT                   EAFTGPQDTVETMRQAFEERLNTIYPLLAEVPGFEVIKPEGAFYLFPNVKKAMEMKGYT
FT                   DVTEFTTAILEEVGVAMVTGAGFGAPENIRLSYATDMDTLKEAVARLHTFMKK"
FT   misc_feature    593937..595007
FT                   /gene="aspC"
FT                   /locus_tag="SSUSC84_0545"
FT                   /note="HMMPfam hit to PF00155, Aminotran_1_2, score
FT                   2.1e-89"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    594552..594593
FT                   /gene="aspC"
FT                   /locus_tag="SSUSC84_0545"
FT                   /note="ScanRegExp hit to PS00105, AA_TRANSFER_CLASS_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS_pept        595043..596389
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="SSUSC84_0546"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0570"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51324"
FT                   /protein_id="CAZ51324.1"
FT                   /translation="MSRKLITINQVKDYVGQEVTIGAWVANKSGKGKLAFLQLRDGTAF
FT                   FQAVAFKPNFIEKFGEEAGTEKFDVAKRLSQETSVYVTGIVKEDERSKFGYELDVTDLE
FT                   VIGESQDYPITPKEHGTDFLMDNRHLWLRSRKQVAIQQIRNAIIYATYEFFEKNGFIKF
FT                   DSPILSGNAAEDSTELFETDYFGQLAYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYSFLSHEESLDLQEAYVKALIQGVIDRAPQALETLERDVDALKRY
FT                   IAEPFKRVAYDDAITLLQEHEADKDTDYEHIEHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREDNYDALVAKMDELGMDKSEY
FT                   EFYLDLRKYGSVPHGGFGIGIERMVTFVAGTKHIREAIPFPRMLHRLHP"
FT   misc_feature    595097..595360
FT                   /gene="asnS"
FT                   /locus_tag="SSUSC84_0546"
FT                   /note="HMMPfam hit to PF01336, tRNA_anti, score 4.1e-19"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   misc_feature    595400..596374
FT                   /gene="asnS"
FT                   /locus_tag="SSUSC84_0546"
FT                   /note="HMMPfam hit to PF00152, tRNA-synt_2, score 3e-98"
FT                   /inference="protein motif:HMMPfam:PF00152"
FT   CDS_pept        596661..596888
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0571"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51325"
FT                   /protein_id="CAZ51325.1"
FT                   /translation="MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDY
FT                   EIGIKALKKFQENPVTHSIDDVLAELEDGL"
FT   CDS_pept        596878..597147
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0548"
FT                   /product="putative plasmid addiction system, toxin protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0572"
FT                   /note="Similar to SSU1318, 51.765% identity (51.765%
FT                   ungapped) in 85 aa overlap (3-87:2-86)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51326"
FT                   /protein_id="CAZ51326.1"
FT                   /translation="MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGK
FT                   ALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEIGHRKEIYKK"
FT   misc_feature    596890..597138
FT                   /locus_tag="SSUSC84_0548"
FT                   /note="HMMPfam hit to PF05016, Plasmid_stabil, score
FT                   9.8e-15"
FT                   /inference="protein motif:HMMPfam:PF05016"
FT   CDS_pept        597553..598872
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0549"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0573"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51327"
FT                   /protein_id="CAZ51327.1"
FT                   /translation="MKQESLGKEIIRLALPATVENIFQTLVGFVDTLLIAQLGLVAVTA
FT                   VGLANTILNVYLAVYMALGVGATALIARSIGAGDRESLTFHVRQALVLSVGVGLLLGLL
FT                   SLVFGRQMLVLMGADAESLAGVQVFFYWVGGLTIFQALMTILGTILRASGDTVFPMKMS
FT                   LLTNGFNVVLDYFLIFGIGSWSGLGIVGTALGTVLARLLGTVLLYRKVQQTDLAVDLKQ
FT                   LFHLGSPKEMVVLTLPAATERLVMRLGQVVYFSLIVGLGTIVYASHMIAGNIESFTYMP
FT                   AYGLATAAAVLIGQALGKGDILTVRRVAFLSSAYGVAIMSLLGTILFFGAPSFALLFTK
FT                   DLEAVRQVVTALRIDAFNQPGLAVSLIMAGALQGLGDTKSPLYSTMIGMWGLRVSGVIV
FT                   LGQMFGLGIAGVWLSILIDLLLRAIFLTWRFIVQTRKLAE"
FT   misc_feature    597598..598080
FT                   /locus_tag="SSUSC84_0549"
FT                   /note="HMMPfam hit to PF01554, MatE, score 7.5e-39"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    join(597628..597696,597706..597765,597823..597891,
FT                   597934..598002,598039..598098,598108..598176,
FT                   598297..598365,598378..598446,598480..598548,
FT                   598762..598830)
FT                   /locus_tag="SSUSC84_0549"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUSC84_0549 by TMHMM2.0 at aa 26-48, 52-71, 91-113,
FT                   128-150, 163-182, 186-208, 249-271, 276-298, 310-332 and
FT                   404-426"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    598264..598749
FT                   /locus_tag="SSUSC84_0549"
FT                   /note="HMMPfam hit to PF01554, MatE, score 2e-28"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   CDS_pept        598923..599300
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0550"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0574"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51328"
FT                   /protein_id="CAZ51328.1"
FT                   /translation="MKTIHTDKAPAAIGPYVQGKVVGNFLFASGQVPLSPETGEVVGET
FT                   IQEQTEQVLKNIAAILSEAGTDFDHVVKTTCFLKDMNDFVAFNEVYKTAFSADFPARSA
FT                   VEVARLPRDVKVEIEVIAVID"
FT   misc_feature    598938..599294
FT                   /locus_tag="SSUSC84_0550"
FT                   /note="HMMPfam hit to PF01042, Ribonuc_L-PSP, score
FT                   1.4e-65"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   misc_feature    599220..599276
FT                   /locus_tag="SSUSC84_0550"
FT                   /note="ScanRegExp hit to PS01094, UPF0076, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01094"
FT   CDS_pept        599322..600209
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0551"
FT                   /product="P-loop ATPase protein family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0575"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51329"
FT                   /protein_id="CAZ51329.1"
FT                   /translation="MSDKLHLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPTLLPKFL
FT                   ELIRHSQDNNKIALVVDMRSRSFFSEIREVLDEIEGAEDLDFKVLFLDATDSELVARYK
FT                   ETRRSHPLAADGRVLDGIQLERELLAPLKNMSQNVIDTTELTPRNLRKVISEQFASQDN
FT                   QPSFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYKLELRNLTGLDAPVFDYVMEHQES
FT                   EEFYSHLLGLIEPILPGYQKEGKSVLTIAVGCTGGQHRSVAFAKRLADDLEKNWNVNRS
FT                   HRDKDRRKETVNRS"
FT   misc_feature    599334..600185
FT                   /locus_tag="SSUSC84_0551"
FT                   /note="HMMPfam hit to PF03668, ATP_bind_2, score 4e-130"
FT                   /inference="protein motif:HMMPfam:PF03668"
FT   CDS_pept        600206..601180
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0576"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51330"
FT                   /protein_id="CAZ51330.1"
FT                   /translation="MRKPKITVIGGGTGIPVILKSLRDKDVEITAIVTVADDGGSSGEI
FT                   RQALQVTPPGDLRNVLLAMSDMPKLYEQIFQYRFADSDGPLAGHPLGNLIIAGISEMQG
FT                   STYNAMRLLTRFFHTTGRIYPSSEQALTLHAIFTDGTEVAGESKISKHNGMIDHVYVTN
FT                   SYNDDEPKASRQVVETIMESDMIVLGPGSLFTSILPNLMISDIGKALKETKAEVTYVCN
FT                   IMTQRGETEFFSDADHVAVLNAHLAEQFIDTVLVNIEPVPQEYMNSNQFDEYLVQVKHD
FT                   FAGLQKQANRVISSNFLRLENGGAFHDGDLVVEELLKILQVRP"
FT   misc_feature    600221..601108
FT                   /locus_tag="SSUSC84_0552"
FT                   /note="HMMPfam hit to PF01933, UPF0052, score 1.5e-141"
FT                   /inference="protein motif:HMMPfam:PF01933"
FT   misc_feature    600221..600265
FT                   /locus_tag="SSUSC84_0552"
FT                   /note="ScanRegExp hit to PS01036, HSP70_3, score NA"
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        601177..602094
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0577"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51331"
FT                   /protein_id="CAZ51331.1"
FT                   /translation="MSFTVQVKEELLLQSSQNKSELSAIIKLSGSLGLASSGLTLSIST
FT                   ENAKIARHIYELLLHFYQIKAEIRHHQKPNLKKNRVYAVLIEDGVNEILNDLHLADSFF
FT                   GLETGISPLVLENDSWSQAYLRGAFLAAGSVKDPEKGKYQLEIASVYSDHANDLANLMQ
FT                   KFLLDAKVIERSKGTITYLQRAEDIMDFLLVIGAEETKTEFENVKLLREARNDLNRATN
FT                   AEAANIAKTVNASMKTINNIIKIMDTIGLDQLSGDLQEIAQLRIQHPDYSIQQLADSLT
FT                   VPITKSGVNHRLRKINKIADELTD"
FT   misc_feature    601183..602079
FT                   /locus_tag="SSUSC84_0553"
FT                   /note="HMMPfam hit to PF02650, DUF199, score 4.1e-71"
FT                   /inference="protein motif:HMMPfam:PF02650"
FT   CDS_pept        602380..603075
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0554"
FT                   /product="Crp family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0579"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51332"
FT                   /protein_id="CAZ51332.1"
FT                   /translation="MISNEQYDYLRAHPTFERLTRDSFDQLAKHIRFRKIPKGQIFFYA
FT                   EDPRDYLFVLYKGYARIEQYDETDSFTYLDYIRQGGAFPFGDMFQDKPYHYTAIAITDL
FT                   EYFIVPMVLFETLSKINPSQMAYICQKLSKVLRFQELRLRNAMRSKASDRVVQALALLY
FT                   WDMCQREQFATLPFEIHIQEISRLAATTRETVSHVLKQLKQDGKIAYSHKQLTYLDIDY
FT                   FLENLTETH"
FT   misc_feature    602476..602748
FT                   /locus_tag="SSUSC84_0554"
FT                   /note="HMMPfam hit to PF00027, cNMP_binding, score 3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   misc_feature    602902..603003
FT                   /locus_tag="SSUSC84_0554"
FT                   /note="HMMPfam hit to PF00325, Crp, score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00325"
FT   misc_feature    602914..602979
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1622.000, SD 4.71 at aa 179-200, sequence
FT                   IHIQEISRLAATTRETVSHVLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        603336..604565
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="SSUSC84_0555"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0580"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51333"
FT                   /protein_id="CAZ51333.1"
FT                   /translation="MSNHPIHVFSEIGKLKKVMLHRPGKEIENLMPDYLERLLFDDIPF
FT                   LEDAQKEHDAFAQALRDEGVEVLYLEKLAAESLVTPEIREQFIDEYLEEANIRGRATKK
FT                   AIRKLLMSIEDNQELVEKTMAGVQKAELPEIPSEEKGLTDLVESSYPFAIDPMPNLYFT
FT                   RDPFATIGNAVSLNHMYSETRNRETLYGKYIFTHHPEYGGKVPLVYNREETTRIEGGDE
FT                   LVLSKDVLAVGISQRTDAASIEKLLVNIFERHVGFKKVLAFEFANNRKFMHLDTVFTMV
FT                   DYDKFTIHPEIEGDLRVFSVTYENDTLHIEEEHGDLAELLAANLGLEKVELIRCGGGDM
FT                   VAAGREQWNDGSNTLTIAPGVVVVYKRNTITNAILESKGLRLIKIGGSELVRGRGGPRC
FT                   MSMPFEREDI"
FT   misc_feature    603363..604553
FT                   /gene="arcA"
FT                   /locus_tag="SSUSC84_0555"
FT                   /note="HMMPfam hit to PF02274, Amidinotransf, score 4e-199"
FT                   /inference="protein motif:HMMPfam:PF02274"
FT   CDS_pept        604565..605005
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0556"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0581"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51334"
FT                   /protein_id="CAZ51334.1"
FT                   /translation="MPSIERTTIGSEEWQRAASIYVRYKVFVLERGIAKEDEFDQNDTE
FT                   ERVYANLFIGEEPVSTGRFLPVGPGQARLTRIATLPNFRGKGYGKMIISSLEAYAREAG
FT                   FHQLNIHSELTAKTFYESVGYQATSEVYQEDGEWCQTLTKFI"
FT   misc_feature    604721..604942
FT                   /locus_tag="SSUSC84_0556"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score 1e-10"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        605024..606037
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="SSUSC84_0557"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0582"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51335"
FT                   /protein_id="CAZ51335.1"
FT                   /translation="MTNVFKGRHFLAEKDFTRAELEWLIDFSAHLKDLKKRNIPHRYLE
FT                   GKNIALLFEKTSTRTRAAFTVASIDLGAHPEYLGANDIQLGKKESTEDTAKVLGRMFDG
FT                   IEFRGFSQKMVEELAEFSGVPVWNGLTDAWHPTQMLADYLTVKENFGKLEGLTLVYCGD
FT                   GRNNVANSLLVTGAILGVNVHIFSPKELFPEEEVVALAEGFAKESGARVLITDNADEAV
FT                   KGADVLYTDVWVSMGEEDKFAERVALLKPYQVNMELVKKAENENLIFLHCLPAFHDTNT
FT                   VYGKDVAEKFGVEEMEVTDEVFRSKYARHFDQAENRMHTIKAVMAATLGDPFVPRV"
FT   misc_feature    605045..605470
FT                   /gene="arcB"
FT                   /locus_tag="SSUSC84_0557"
FT                   /note="HMMPfam hit to PF02729, OTCace_N, score 7.8e-68"
FT                   /inference="protein motif:HMMPfam:PF02729"
FT   misc_feature    605180..605203
FT                   /gene="arcB"
FT                   /locus_tag="SSUSC84_0557"
FT                   /note="ScanRegExp hit to PS00097, CARBAMOYLTRANSFERASE,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00097"
FT   misc_feature    605480..606007
FT                   /gene="arcB"
FT                   /locus_tag="SSUSC84_0557"
FT                   /note="HMMPfam hit to PF00185, OTCace, score 7.3e-79"
FT                   /inference="protein motif:HMMPfam:PF00185"
FT   CDS_pept        606155..607102
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SSUSC84_0558"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0583"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51336"
FT                   /protein_id="CAZ51336.1"
FT                   /translation="MANRKIVVALGGNAILSSDPSAKAQKEALVQTAKHLVKLIKNGDD
FT                   LIITHGNGPQVGNLLLQNLAADSEKNPAFPLDSLVAMTEGSIGFWLQNALENELLKEGI
FT                   EKDVASVVTQVIVDKNDPAFENLTKPIGPFYTEEEAKAEAEKTGATFKEDAGRGWRKVV
FT                   ASPKPVGIKEIGTIRTLLNAGEVVVAAGGGGIPVVQEADGTLTGVEAVIDKDFASQCLA
FT                   ELVDADLFIVLTGVDYVFVNYNKPDQEKLETVTVAELEEYIKQNQFAPGSMLPKVEAAI
FT                   AFVNNKPQSKAVITSLENLGALIESDSGTIIVKG"
FT   sig_peptide     606155..606226
FT                   /gene="arcC"
FT                   /locus_tag="SSUSC84_0558"
FT                   /note="Signal peptide predicted for SSUSC84_0558 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.974) with cleavage
FT                   site probability 0.964 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    606164..607042
FT                   /gene="arcC"
FT                   /locus_tag="SSUSC84_0558"
FT                   /note="HMMPfam hit to PF00696, AA_kinase, score 9.2e-96"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   CDS_pept        607445..608947
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0559"
FT                   /product="C4-dicarboxylate anaerobic carrier protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0584"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51337"
FT                   /protein_id="CAZ51337.1"
FT                   /translation="MSEKVKKGFKLPSSYTILMLIIAFMAVMTWVIPAGQYQVDEAGRL
FT                   VAGTYEKVAQNPQGIYDVFMAPVRAMLGHGATEAAINVAFFIIMVGAFLGVVNETGALD
FT                   VGIASIVKRFKGREKMLIYILMPLFALGGSTYGMGEETMAFFPLLVPVMMAVGFDSITG
FT                   VAIILLGSQIGCLASTVNPFATVVASDAAGVSVADGMIWRFVFFVVILAMGVLFVANYA
FT                   EKVKNDPTKSLVYKQREADMQHFNVAATQEVNAELSPAQKRVLWVFVLTFVLMICSFIP
FT                   WEDLGVTIFTQFNDWLIGLPFIGQVIGSSTAALGTWYFPEGAMLFGIAGIVVGLVYGMS
FT                   EERLVKSFMFGAADIFSVALICAIARGIQVIMNDGMITATILHMGEEGLQGLSSQVFII
FT                   LTYLFYLPMSFLIPSSSGLAGASMGIMAPLGEFVNVPASLVITAFQAASGLLNLVAPTS
FT                   GIVMGALALGRVEIGTWYKFVGKLIVGIMIASIAILVIATFF"
FT   misc_feature    607475..608941
FT                   /locus_tag="SSUSC84_0559"
FT                   /note="HMMPfam hit to PF03606, DcuC, score 9.7e-204"
FT                   /inference="protein motif:HMMPfam:PF03606"
FT   misc_feature    join(607481..607549,607667..607735,607805..607858,
FT                   607886..607954,607973..608032,608042..608110,
FT                   608234..608290,608333..608401,608405..608458,
FT                   608486..608554,608615..608683,608780..608848,
FT                   608867..608935)
FT                   /locus_tag="SSUSC84_0559"
FT                   /note="13 probable transmembrane helices predicted for
FT                   SSUSC84_0559 by TMHMM2.0 at aa 13-35, 75-97, 121-138,
FT                   148-170, 177-196, 200-222, 264-282, 297-319, 321-338,
FT                   348-370, 391-413, 446-468 and 475-497"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        609066..610406
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0560"
FT                   /product="peptidase family M20/M25/M40 protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0585"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51338"
FT                   /protein_id="CAZ51338.1"
FT                   /translation="MRTSFIQSSHQEACIQAIQELVAFPSVLQEHQADTPFGQAIQDVL
FT                   EHTLALTEKMGFKTYLDPAGYYGYAEIGQGEELLAILCHLDVVPAGDLSQWQTPPFEAV
FT                   VEGDYIIGRGVQDDKGPSMAALFAVKALLDAGVQFNKRIRFIFGTDEETLWRCMNRYNQ
FT                   LEEVATMGFAPDSSFPLTYAEKGLLQAKLHGPGHPCLSIEAGTAYNVVPAKASYSGHLL
FT                   AGVIAELDQLGFDYEIKDDQVTVLGISRHAKDAAEGVNAIVRLAKALEHFENHPALDFI
FT                   VNAVGEDATGFKLFGDVTDEPSGTLSFNIAGLTISAKKSEIRLDIRIPVTADKEALVST
FT                   LQAKAQSCGLTYEEYDYLASLYVPLDSQLVSTLMSVYQDKTGDLTSEPISSGGATFART
FT                   MPNCVAFGACFPDTEQTEHQENERMPLEDLYKTMDIYAEAVYRLTAE"
FT   misc_feature    609303..610391
FT                   /locus_tag="SSUSC84_0560"
FT                   /note="HMMPfam hit to PF01546, Peptidase_M20, score
FT                   3.5e-27"
FT                   /inference="protein motif:HMMPfam:PF01546"
FT   misc_feature    610335..610400
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1124.000, SD 3.02 at aa 430-451, sequence
FT                   MPLEDLYKTMDIYAEAVYRLTA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        610777..615036
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0561"
FT                   /product="glycosyl hydrolase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0587"
FT                   /note="Internal region is similar to Clostridium
FT                   perfringens endo-beta-galactosidase C UniProt:Q8XNF8
FT                   (EMBL:BA000016) (845 aa) fasta scores: E()=1.6e-168,
FT                   55.637% id in 816 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51339"
FT                   /protein_id="CAZ51339.1"
FT                   /translation="MKKETSKFTKKVILGQLLICTSFLVWAGQTVAAEEVSQGEPVAIN
FT                   NETPPVIEAKPLVEATPSTETEPSTPEEKQEEPQVAGKNVVEGKKPVTNSQHQMVSELS
FT                   TVPSVSIKNPDAATDGSAYGSSDDANSNTKIIAGKETGEPDNGYSKWDHVYVQYDFEKE
FT                   VPVHTVKIHRNTYDNAVSTFKDVKVELSTSADFSPETTEVIFKQADVEETIANKGQPQV
FT                   IQLPAPINARYIRIWGRGHYIQNTNSSWKGYSNGVLFNEIEVLAQVEADAGTNEEPQTE
FT                   LVNLAKLKKPYFYGKAPTNPEAINDGKFDENYTTQESIGDKAYLQYEFRNVYTIEEIKV
FT                   QLAPGEYRNFRIDLDDDYNDGNNYNTIYKNENFTIDKEQIITIKTPKNSKARYVRFRGT
FT                   RVDDTPLRYSEIQIMGRGKSYDESAPEYVPPKSEYDTLVWSDEFNGDKIDESKWQIIDG
FT                   MWNHAAIYNRKAVSIKKDGDKSYLSIRSTNHKDKKTLVEAVGHDRYDDKELPDKVTWSS
FT                   GRLESKDKYSFQFGRMAVRAKVNDSKGIWPAIWMLAQDETGHDEIDVLEYLGQNPWYAW
FT                   TTNHFGILAKNKKSDGSAYKNYEAWSQEFHVYEVEWTPDVIKWYIDGKFVFQTDRGKDR
FT                   DGMHTRPMFPILETQVGDGWVGDVDYKRNMTKQDSEYLVDWVRIYQKADQSKVRFDNLD
FT                   DAKPNDYVIKPQQKLGHLVTVSNGKAAHENKNNFYYGGQPRYETSRLYADGDGENALVY
FT                   KIANPEALHLTTYYKTLEDYSVYNKEAGANEGKSVRKHLINAKDGEIDFTVYSSVDGKS
FT                   WNKENVTVVDNFVEATPAYARTTFDIRNIRKGTKFVKIVFPTVKGISYKLEDGTEKGLQ
FT                   ASDVQLAKVTFVATHPEAEPEKPIVDQEKLALSKVFSLDAGRKYFSVNQIKEIIDLISS
FT                   YGYTDMNLLLGNDGLRFLLDDMNLTVGDKVYDSEAVRKAIINGNKHYYDDPNGTTLSQS
FT                   EMDDILAYAKEKNISIIPTINSPGHMDAIVEAMEELGIKSPKFSYNGKTSARTVDLKND
FT                   QAVAFTKALIDKYASYFAGKSKIFNIGLDEYANDATNASGWHILQTQGDYGKFIQYAND
FT                   LAAIVKKHGLEPMAFNDGIYYNHDTSSGTFDKDIIASFWTGGWGGYDVASSKFLHEKGH
FT                   KILNTNDAWYYVIGREAEGLGWYNLDQGLRGTKSTRFDQVPKSENTKVPIIGSMVAVWA
FT                   DDPSKPYSYDSIKKLLHSFTENNSDYFLAEYRDLREEVGKIPTDLNSYTPESVATLKEV
FT                   LNKIDWKLSRNNQAFVDGYLAEVKAAREALVPVTAKGDSVKAEPLPEGKLPLITAKGKS
FT                   VQAEPRPAFKGYLTSNYGPSVTPLSLVSKPSSEQSNSKQAASQKKELPNTGVVDGLGFS
FT                   LLGMIGLAFASRRRKKE"
FT   sig_peptide     610777..610875
FT                   /locus_tag="SSUSC84_0561"
FT                   /note="Signal peptide predicted for SSUSC84_0561 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.953 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    611122..611562
FT                   /locus_tag="SSUSC84_0561"
FT                   /note="HMMPfam hit to PF00754, F5_F8_type_C, score 0.0029"
FT                   /inference="protein motif:HMMPfam:PF00754"
FT   misc_feature    611635..612009
FT                   /locus_tag="SSUSC84_0561"
FT                   /note="HMMPfam hit to PF00754, F5_F8_type_C, score 4.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00754"
FT   misc_feature    612148..612810
FT                   /locus_tag="SSUSC84_0561"
FT                   /note="HMMPfam hit to PF00722, Glyco_hydro_16, score
FT                   1.7e-33"
FT                   /inference="protein motif:HMMPfam:PF00722"
FT   misc_feature    613495..614469
FT                   /locus_tag="SSUSC84_0561"
FT                   /note="HMMPfam hit to PF00728, Glyco_hydro_20, score
FT                   7.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00728"
FT   misc_feature    614920..615030
FT                   /locus_tag="SSUSC84_0561"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   0.0002"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        complement(615327..615800)
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="SSUSC84_0562"
FT                   /product="arginine repressor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0588"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51340"
FT                   /protein_id="CAZ51340.1"
FT                   /translation="MNKIESRHQLILSLIMEKKIHTQQELQELLEVNGVSVTQSTLSRD
FT                   IKMLNLVKVNEDDSSHYVINPIAPTRWEKRLRLYMEDALVMLKPIQHQVVLKTLPGLAN
FT                   SFGSILDAMEIPQIVATVCGDDVCLIICEDVEGAQACFEHLKQFTPPFFFSKL"
FT   misc_feature    complement(615357..615566)
FT                   /gene="argR"
FT                   /locus_tag="SSUSC84_0562"
FT                   /note="HMMPfam hit to PF02863, Arg_repressor_C, score
FT                   8.9e-27"
FT                   /inference="protein motif:HMMPfam:PF02863"
FT   misc_feature    complement(615591..615800)
FT                   /gene="argR"
FT                   /locus_tag="SSUSC84_0562"
FT                   /note="HMMPfam hit to PF01316, Arg_repressor, score
FT                   1.2e-18"
FT                   /inference="protein motif:HMMPfam:PF01316"
FT   CDS_pept        complement(615849..616877)
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SSUSC84_0563"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0589"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51341"
FT                   /protein_id="CAZ51341.1"
FT                   /translation="MNTADFDFDLPEELIAQVPLEKRDSSKLLILDREKRSMVDSHFDH
FT                   IIDQLNPGDALVMNNTRVLPARLYGYKPETMGHVELLLLKNTQGDQWEVLAKPAKRLKV
FT                   GTTVAFGDGRLTATIVEELEHGGRIVEFSYEGIFLEVLESLGEMPLPPYIHEKLEDRER
FT                   YQTVYAKENGSAAAPTAGLHFTQELLEKIEAKGVKLVYLTLHVGLGTFRPVSVDNVDEH
FT                   EMHSEFYNLSAEAAQTLNQVKDSGGRIVAVGTTSIRTLETIGNKFDGRLQADSGWTNIF
FT                   IKPGYTFRIVDAFSTNFHLPKSTLVMLVSAFAGREFTLDAYKHAVEERYRFFSFGDAMF
FT                   IQ"
FT   misc_feature    complement(616230..616877)
FT                   /gene="queA"
FT                   /locus_tag="SSUSC84_0563"
FT                   /note="HMMPfam hit to PF02547, Queuosine_synth, score
FT                   1.8e-118"
FT                   /inference="protein motif:HMMPfam:PF02547"
FT   CDS_pept        617223..617927
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="SSUSC84_0564"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0591"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51342"
FT                   /protein_id="CAZ51342.1"
FT                   /translation="MKIHVVNNQVEGATVALDILREKLNGGTKVLGLATGSSPLEFYRL
FT                   IRESDLDFSDVTSVNLDEYVGLGEESDQSYIHFMKENLFNTKPFKQSYLPNGLATDVVA
FT                   ETERYNKILAEHPVDFQILGIGRNGHIGFNEPGAPFDGQTHLVELAPSTIEANARFFDN
FT                   PEDVPKQAISMGIANIMAAKTIVLMAYGQEKADAIKATVEGAVTEDVPASVLQNHDNVI
FT                   LILDQAAASKLV"
FT   misc_feature    617265..617918
FT                   /gene="nagB"
FT                   /locus_tag="SSUSC84_0564"
FT                   /note="HMMPfam hit to PF01182, Glucosamine_iso, score
FT                   1.8e-41"
FT                   /inference="protein motif:HMMPfam:PF01182"
FT   misc_feature    617556..617612
FT                   /gene="nagB"
FT                   /locus_tag="SSUSC84_0564"
FT                   /note="ScanRegExp hit to PS01161, GLC_GALNAC_ISOMERASE,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01161"
FT   CDS_pept        618394..618738
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0565"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0592"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51343"
FT                   /protein_id="CAZ51343.1"
FT                   /translation="MKHIVTKRNYKVGACAMALALLMTTAGGAVVNAEQHLESSVGLVQ
FT                   RGDVLLKLKESNQSFNEGEVGNLEPVNPTVPPMASSVQKSWFSSFWGGVKTFWNALCCS
FT                   VGLTGLKVSK"
FT   sig_peptide     618394..618492
FT                   /locus_tag="SSUSC84_0565"
FT                   /note="Signal peptide predicted for SSUSC84_0565 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.797 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    618427..618486
FT                   /locus_tag="SSUSC84_0565"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0565 by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        619137..619451
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0566"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0593"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51344"
FT                   /protein_id="CAZ51344.1"
FT                   /translation="MKQLVTKRSYKIGLSAMALVLLMTTAGGATAHASTGTYSVETRGD
FT                   AKVYRLLETPAGSFTQGGIVLKPVNNSTTKPSETKSWFDSFWSSVKTFWEAICRGVGWC
FT                   "
FT   sig_peptide     619137..619235
FT                   /locus_tag="SSUSC84_0566"
FT                   /note="Signal peptide predicted for SSUSC84_0566 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.995 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    619170..619238
FT                   /locus_tag="SSUSC84_0566"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0566 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        619883..620218
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0567"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0594"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51345"
FT                   /protein_id="CAZ51345.1"
FT                   /translation="MKRIVTKRSYKVGLCAMALALLMSTAGGVTAGAQGHNFTSSDSSA
FT                   MRNTQVLVKGNTSNRSSHDGPVKIAMPRAAGSKKQKTWYESLWSTIKKFFEQLRHGFHL
FT                   ERLFKNG"
FT   sig_peptide     619883..619981
FT                   /locus_tag="SSUSC84_0567"
FT                   /note="Signal peptide predicted for SSUSC84_0567 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.921 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    619916..619984
FT                   /locus_tag="SSUSC84_0567"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0567 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        620328..620672
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0568"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0595"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51346"
FT                   /protein_id="CAZ51346.1"
FT                   /translation="MKQANSKLVALTLITTLAVTSVIATTVHAEEKVTADQTVAGKHKP
FT                   ITGEQLQKAIGDRNPNSIQIQAKFENTNFKNQGITFIGKAEIPSKSSEKSSWFWELWTR
FT                   FTTFVKGIFS"
FT   sig_peptide     620328..620414
FT                   /locus_tag="SSUSC84_0568"
FT                   /note="Signal peptide predicted for SSUSC84_0568 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 1.000 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    620346..620414
FT                   /locus_tag="SSUSC84_0568"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0568 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        621287..622822
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="SSUSC84_0569"
FT                   /product="D-alanine--poly(phosphoribitol) ligase subunit 1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0596"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51347"
FT                   /protein_id="CAZ51347.1"
FT                   /translation="MISSMLERVEHFATENPDYPVYHYLGQLYSYGDLKADSDSLAAHI
FT                   DSLDLPANSPVLVFGGQEYQMLAIFVALTKAGHPYIPVDSHSALDRIEAILEIAEPSLV
FT                   FAVADFPLETSLPVLGLSEVEAIFEKKSTYQLIHPVSEDDTYYIIFTSGTTGKPKGVQI
FT                   SHDNLLSFTNWMIRDKEFALPERPQMLAQPSYSFDLSVMYWAPTLALGGTLFALPKELT
FT                   LDFKTLFAAIQTLPFKIWTSTPSFVDMALLSREFDGEHLPDLTHFYFDGEELTVKTAQK
FT                   LRERFPKAVIVNAYGPTEATVALSAVAITDEMLVNYKRLPIGYTKPDSPTFILDEDGQV
FT                   VPNGQQGEIVVSGPAVSKGYLNNPERTEAAFFQFDGLQAYHTGDLGVMTDEGLLLYGGR
FT                   MDFQIKYNGYRIELEEVAQHLNKSTYIEAAVAVPRYNADHKVQNLLAYVVPKAGIMEQF
FT                   DRELELTKVIKQELKERMMDYMMPSKFIYRDSLPLTANGKIDIKGLIAEVNAQ"
FT   misc_feature    621374..622579
FT                   /gene="dltA"
FT                   /locus_tag="SSUSC84_0569"
FT                   /note="HMMPfam hit to PF00501, AMP-binding, score 2.7e-113"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    621728..621763
FT                   /gene="dltA"
FT                   /locus_tag="SSUSC84_0569"
FT                   /note="ScanRegExp hit to PS00455, AMP_BINDING, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        622819..624060
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="SSUSC84_0570"
FT                   /product="putative activated D-alanine transport protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0597"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51348"
FT                   /protein_id="CAZ51348.1"
FT                   /translation="MMEFFKQLPQLEPYGNPLYFFYLVLALVPIFIGLFFKKRFPLYET
FT                   GVSLAFIVLMFTGTKTMQLLSLLAYIIWQTMLIFFYKHYRQRANQSWVFYLIVCLAVFP
FT                   LTWVKLAPTFSQHGAIFGFLGISYLTFRSVGMVIEMRDGLLTEFSLGSFLRFLLFMPTI
FT                   SSGPIDRYRRFTEDYKQIPERTELLNMLDQTVHYIMMGFLYKFILAYFIGHTLLEPLKA
FT                   VALDQGGWFNLPTIGVMYLYGFELFFDFAGYSMFAIGISNLMGIRCPINFDQPFKSRDL
FT                   KEFWNRWHISLSFWFRDFVFMRLVKTLLKHKVFKNRNTVSNVAYLLNMLLMGLWHGVTW
FT                   YYIAYGLFHALGLIINDAWIRKKKSINLARKKAGQEPLPDNRWTSFAGMFVTFHTVMFS
FT                   FLIFSGFLDKLWFK"
FT   misc_feature    join(622855..622923,622966..623034,623089..623142,
FT                   623155..623223,623398..623466,623524..623592,
FT                   623782..623850,623971..624039)
FT                   /gene="dltB"
FT                   /locus_tag="SSUSC84_0570"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0570 by TMHMM2.0 at aa 13-35, 50-72, 91-108,
FT                   113-135, 194-216, 236-258, 322-344 and 385-407"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    623137..624015
FT                   /gene="dltB"
FT                   /locus_tag="SSUSC84_0570"
FT                   /note="HMMPfam hit to PF03062, MBOAT, score 7.3e-92"
FT                   /inference="protein motif:HMMPfam:PF03062"
FT   CDS_pept        624103..624342
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="SSUSC84_0571"
FT                   /product="D-alanyl carrier protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0598"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51349"
FT                   /protein_id="CAZ51349.1"
FT                   /translation="MDVKETILNIIEELFMEDVSEMMDEDLFDAGVLDSMGTVELIVEL
FT                   ESRFNITVPVSEFGREDWNTANKIISGVVELMHA"
FT   CDS_pept        624335..625600
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="SSUSC84_0572"
FT                   /product="putative D-alanyl-lipoteichoic acid biosynthesis
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0599"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51350"
FT                   /protein_id="CAZ51350.1"
FT                   /translation="MRKQLWQIFGPVICATFLVILTLLFFPSSSRSNFKEEKQDAVALS
FT                   YISFKSKYKKNRALGDKNHRFVPFFGSSEWSRFDSMHPSVLADAYQREYTPYLLGQRGA
FT                   ASLTQYFGMQQIGAHLKNSQAIYVVSPQWFSPKGASSKAFEQYFSSDQATHFLQTSAKD
FT                   DYDRYAAKRFLELKSDCSLTGMFQKVASGKELSKWDREQLNWQAYLLEKQDALFSRFAD
FT                   SGSNLGLVETEAMKLPETFSYDRLSKVANEDGSRSTQSNDFQIDDRFYRNRLQSKIKKL
FT                   KQSQTKISYLQSPEYNDFQLVLNEFAKHQTDVLFVIPPVNERWMNYTGLNKDMYRATVA
FT                   KIKYQLTSQGFNHIADLSEQGGIDYFMQDTIHIGWQGWLELDKYVHPFLTEQQAPVHYQ
FT                   LKKEFLTSEWAAYKGDLNLFLK"
FT   sig_peptide     624335..624430
FT                   /gene="dltD"
FT                   /locus_tag="SSUSC84_0572"
FT                   /note="Signal peptide predicted for SSUSC84_0572 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.996) with cleavage
FT                   site probability 0.963 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    624347..624415
FT                   /gene="dltD"
FT                   /locus_tag="SSUSC84_0572"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0572 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    624440..624628
FT                   /gene="dltD"
FT                   /locus_tag="SSUSC84_0572"
FT                   /note="HMMPfam hit to PF04915, DltD_N, score 2.3e-31"
FT                   /inference="protein motif:HMMPfam:PF04915"
FT   misc_feature    624629..625117
FT                   /gene="dltD"
FT                   /locus_tag="SSUSC84_0572"
FT                   /note="HMMPfam hit to PF04918, DltD_M, score 5.8e-60"
FT                   /inference="protein motif:HMMPfam:PF04918"
FT   misc_feature    625118..625510
FT                   /gene="dltD"
FT                   /locus_tag="SSUSC84_0572"
FT                   /note="HMMPfam hit to PF04914, DltD_C, score 1.1e-74"
FT                   /inference="protein motif:HMMPfam:PF04914"
FT   CDS_pept        complement(625689..626804)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0573"
FT                   /product="putative low temperature requirement A protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0600"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51351"
FT                   /protein_id="CAZ51351.1"
FT                   /translation="MSEITAKRVSNYELFYDLVFVLATSSLTGLLHGNHIGFKEVTTFI
FT                   TTNLIIMTLWMNETIYLNKYGERDFLDIFTIIPSMYLIGNMSLNFSNDFAQTALPFNTF
FT                   LTLSYVIILLQYYLRGRRIGFNEDIKATLQMLATYIVVFAGATLLVIFKLWTNDERMLI
FT                   VYIIPFLISFFFQKRMSHDPINFPHMVERCQLITIITFGEIVIAIIKNYPLLELPLEGI
FT                   LLFFAMATLFIFYISQTYLTIDHHRKADATVLLYAHLVIVLGLNFFTVAMELFPSHHND
FT                   LALPMLIVGNLIFYSGILSTSFYNQQVHQVGRRGLFIYALILLIGNVALLLDGHSNILL
FT                   FVILNLLSHAMVAYHVIRFGKANHSLLGEDM"
FT   misc_feature    complement(join(625734..625793,625806..625859,
FT                   625893..625961,625989..626048,626082..626141,
FT                   626154..626222,626280..626324,626352..626411,
FT                   626445..626513,626541..626597,626616..626684,
FT                   626712..626771))
FT                   /locus_tag="SSUSC84_0573"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SSUSC84_0573 by TMHMM2.0 at aa 12-31, 41-63, 70-88, 98-120,
FT                   132-151, 161-175, 195-217, 222-241, 253-272, 282-304,
FT                   316-333 and 338-357"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(625737..626789)
FT                   /locus_tag="SSUSC84_0573"
FT                   /note="HMMPfam hit to PF06772, LtrA, score 8.7e-51"
FT                   /inference="protein motif:HMMPfam:PF06772"
FT   CDS_pept        complement(626877..627833)
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0601"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51352"
FT                   /protein_id="CAZ51352.1"
FT                   /translation="MGLLQDGKWVDQWYDTKSTGGKFIRSVTQFRNWITPDGQAGPTGE
FT                   GGFKAESGRYHLYISLACPWASRTLIMRKLKGLEDHISLSVVHPLMLENGWTFEDGPGV
FT                   IKDTLFNSDYLYQVYLKADPHYSGRVTVPVLWDKKTNTIVSNESAEIMRMFNSAFNDIT
FT                   GNYDDYYPANLQAEIDAMNDFVYPNINNGVYKAGFSTSQAVYEKEVKNLFAALDKLEEH
FT                   LADKNYLVGNQLTEADIRLFTTLVRFDPVYFGHFKCNIKALVDYPNLWNYTKRIYNHAG
FT                   IAETVDFDHIKQHYYGSHKTINPTGIVPVGPDLDWTL"
FT   misc_feature    complement(626994..627308)
FT                   /locus_tag="SSUSC84_0574"
FT                   /note="HMMPfam hit to PF00043, GST_C, score 1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00043"
FT   CDS_pept        627972..628688
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0575"
FT                   /product="putative ribosomal small subunit pseudouridine
FT                   synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0602"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51353"
FT                   /protein_id="CAZ51353.1"
FT                   /translation="MRLDKCLEKAKVGSRKQVKKLFKAQQIKINGQAAQSLSQIVDPEL
FT                   QTIQVSGKKVALEGSAYYLLHKPAGVVSAVTDQEHQTVIDLISPQDSREGLYPVGRLDR
FT                   DTEGLVLITNNGPLGYRMLHPSHHVDKVYYVEVNGCLAEDASKFFASGVTFLDGTRCQP
FT                   ADLTVLEASLDHSRATIKLAEGKFHQVKKMFLAYGVKVTYLKRISFGGFELGDLERGTY
FT                   RQLTPNEMEHLFTYFD"
FT   misc_feature    627972..628112
FT                   /locus_tag="SSUSC84_0575"
FT                   /note="HMMPfam hit to PF01479, S4, score 2.8e-05"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    628152..628559
FT                   /locus_tag="SSUSC84_0575"
FT                   /note="HMMPfam hit to PF00849, PseudoU_synth_2, score
FT                   2.2e-10"
FT                   /inference="protein motif:HMMPfam:PF00849"
FT   misc_feature    628269..628313
FT                   /locus_tag="SSUSC84_0575"
FT                   /note="ScanRegExp hit to PS01149, PSI_RSU, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01149"
FT   CDS_pept        628702..629181
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0576"
FT                   /product="putative glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0603"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51354"
FT                   /protein_id="CAZ51354.1"
FT                   /translation="MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQ
FT                   ELYDSYKDNGFVVLDFPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASP
FT                   LYRYLKKEKSTLLGGRIEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK"
FT   misc_feature    628708..629031
FT                   /locus_tag="SSUSC84_0576"
FT                   /note="HMMPfam hit to PF00255, GSHPx, score 4.6e-46"
FT                   /inference="protein motif:HMMPfam:PF00255"
FT   misc_feature    628876..628899
FT                   /locus_tag="SSUSC84_0576"
FT                   /note="ScanRegExp hit to PS00763, GLUTATHIONE_PEROXID_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00763"
FT   CDS_pept        complement(629200..630201)
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="SSUSC84_0577"
FT                   /product="ferrichrome transport permease"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0604"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51355"
FT                   /protein_id="CAZ51355.1"
FT                   /translation="MIRHHNYLKIFTFLLILLFIIFLLSLSIGYSNSSFSDFIDIMSGR
FT                   ASSSTLLIIGRIRLPRIIASIIGGASLALAGLLLQTLTRNPLADSGILGINAGAGLVVA
FT                   LFVGLSSKISPVLLSLMPLFAMMGGGLTIFLVYWIARKKLYGIHPARLIITGVGISSML
FT                   SGIMVSIISQLDDFKMEYIVQWLSGRVNGGDWKTIAIYTPLLLLVWMATFSRSRSLNIM
FT                   NLNDQTAMALGLHLQRERRITLILATALASLSVILVGNITFVGLIAGHIVRKWLGNDHR
FT                   VIIPATMIIGSFILLLADTIGRVLLVGTGIPTGIIVSLIGAPYFLWLLKQEG"
FT   misc_feature    complement(629209..630153)
FT                   /gene="fhuG"
FT                   /locus_tag="SSUSC84_0577"
FT                   /note="HMMPfam hit to PF01032, FecCD, score 2.2e-85"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   misc_feature    complement(join(629221..629289,629308..629361,
FT                   629404..629472,629560..629613,629680..629748,
FT                   629782..629850,629878..629946,629965..630033,
FT                   630115..630183))
FT                   /gene="fhuG"
FT                   /locus_tag="SSUSC84_0577"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUSC84_0577 by TMHMM2.0 at aa 7-29, 57-79, 86-108,
FT                   118-140, 152-174, 197-214, 244-266, 281-298 and 305-327"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(630094..630201)
FT                   /gene="fhuG"
FT                   /locus_tag="SSUSC84_0577"
FT                   /note="Signal peptide predicted for SSUSC84_0577 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.480 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(630198..631223)
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SSUSC84_0578"
FT                   /product="ferrichrome transport permease"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0605"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51356"
FT                   /protein_id="CAZ51356.1"
FT                   /translation="MNKLVSSRYPKTKPKNIWLVFFIICLSFIAGVYLSLRFGAISYSH
FT                   QQLIETLKHPLTNSSAQDVIIDLRLPRMVAAILVGAAMAQAGAMMQGITRNPIADPGLL
FT                   GINAGAGLALIVAYALFGGLHYSQILLICLLGSCLAAGLVFGLAYQVQKGYNQLRLILS
FT                   GAMVASLFSAIGQAITIYFDLSTAVIGWQAGGLVQVNWKMLAIIAPLIIIGLILAQLFS
FT                   HQLTILSLNETVAKNLGQRTLLMTLVLLGIVLLLSASAVALVGSLSFIGLIIPHFIRMF
FT                   TGKNYKLLLPLTAFAGASFLIWVDLVCRSINPPVETPISAVISIIGLPCFLWLIRKEKH
FT                   F"
FT   misc_feature    complement(630213..631145)
FT                   /gene="fhuB"
FT                   /locus_tag="SSUSC84_0578"
FT                   /note="HMMPfam hit to PF01032, FecCD, score 5.2e-102"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   misc_feature    complement(join(630219..630272,630291..630359,
FT                   630402..630497,630558..630626,630684..630752,
FT                   630771..630839,630849..630917,630954..631022,
FT                   631107..631175))
FT                   /gene="fhuB"
FT                   /locus_tag="SSUSC84_0578"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUSC84_0578 by TMHMM2.0 at aa 17-39, 68-90, 103-125,
FT                   129-151, 158-180, 200-222, 243-274, 289-311 and 318-335"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(631107..631223)
FT                   /gene="fhuB"
FT                   /locus_tag="SSUSC84_0578"
FT                   /note="Signal peptide predicted for SSUSC84_0578 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.877) with cleavage
FT                   site probability 0.734 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(631237..632166)
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SSUSC84_0579"
FT                   /product="putative ferrichrome-binding protein precursor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0606"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51357"
FT                   /protein_id="CAZ51357.1"
FT                   /translation="MKKFLAIFSLFVGLVFLTACSTSSSSTDVELSSMPKIEGITYHGD
FT                   IPKNPKKVVNFAYSYTGYLLQLGIDVSSYSLDLEKNSPVFGDKLKDVPQLTTADTEAIA
FT                   AQKPDVILVFSGDDNLETLKEIAPVIEITYGKSDYLKMLTDIGQIFGKEKEAQAWLDQW
FT                   DKKVTTAKEELKGLIDTSSTFTVMDFFDKNIFLYGNNFGRGGELIYRALGFAAPAKVQE
FT                   DIINKEGWFGVSQEALPEYVGDYVLVNVNDKTKEAAASLKESDIWKNLPAVKNGHVIEI
FT                   DYNLFYFSDPMSLDLQIDAFVSEIQKLQ"
FT   misc_feature    complement(631315..632019)
FT                   /gene="fhuD"
FT                   /locus_tag="SSUSC84_0579"
FT                   /note="HMMPfam hit to PF01497, Peripla_BP_2, score 4e-45"
FT                   /inference="protein motif:HMMPfam:PF01497"
FT   sig_peptide     complement(632092..632166)
FT                   /gene="fhuD"
FT                   /locus_tag="SSUSC84_0579"
FT                   /note="Signal peptide predicted for SSUSC84_0579 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.659 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(632179..632964)
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SSUSC84_0580"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0607"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51358"
FT                   /protein_id="CAZ51358.1"
FT                   /translation="MSSIQAENIQVSYDNRIIIDELSTSIPKGSITTIIGANGCGKSTL
FT                   LKALTRIIPVQEGAIYLDGQAISQLPTKEVAKKLALLPQVLEATEGISVYELVSYGRFP
FT                   HQNGLGHLTDQDREKINWALEVTRTAPYARLPVDDLSGGQRQRVWIAMALAQDTDTIFL
FT                   DEPTTYLDLNHQLEVLELLKELNQSRQKTIVMVLHDVNLSARFSDYMIAMKEGDIRYHG
FT                   SVSNMMTTEILRDIFSIEPQLMQVAGQDYPILLTYDLKK"
FT   misc_feature    complement(632317..632880)
FT                   /gene="fhuC"
FT                   /locus_tag="SSUSC84_0580"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.1e-50"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(632503..632547)
FT                   /gene="fhuC"
FT                   /locus_tag="SSUSC84_0580"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(633116..634561)
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SSUSC84_0581"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-dia
FT                   minopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0608"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51359"
FT                   /protein_id="CAZ51359.1"
FT                   /translation="MITIERVLEILKADANFRHIKQNDQTDSTWTDVQFDALSYDSRTV
FT                   SPMTLFFAKGLAFKKEFLEKAIEAGLAFYVSEINYEVGIPAIIVHDIKQAMSLIAMEFH
FT                   GHPQKQLKLLAFTGTKGKTTAAYFAFNILKQSKKPAMLSTMNTTLDGKTFFKSTLTTPE
FT                   SLDLFAMMAEAVKNGMTHLIMEVSSQAYLVKRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMDNSRAVIVNAGMDHFEVVKEQVSSKDHDFYGPTSENQISQSAGFDFTA
FT                   TGKLAGHYDIQLIGGFNQENAIAAGLACLRLGASLEDIHTGIAQTNVPGRMEVLTQQNG
FT                   AKVFVDYAHNGDSVKKLIDVVLEHQTGKVFLILGAPGNKGESRRKDFGLLLNDYPQIEV
FT                   ILTADDPNREDPAAIAEQIRAHMTRTSNFILDREEAIRTAMSQTSSPKDAVIIAGKGAD
FT                   AYQIVNGEKAAYDGDLEVAKQYL"
FT   misc_feature    complement(633317..633580)
FT                   /gene="murE"
FT                   /locus_tag="SSUSC84_0581"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 3.2e-21"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   misc_feature    complement(633635..634222)
FT                   /gene="murE"
FT                   /locus_tag="SSUSC84_0581"
FT                   /note="HMMPfam hit to PF08245, Mur_ligase_M, score 3.5e-32"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    complement(634250..634462)
FT                   /gene="murE"
FT                   /locus_tag="SSUSC84_0581"
FT                   /note="HMMPfam hit to PF01225, Mur_ligase, score 0.0039"
FT                   /inference="protein motif:HMMPfam:PF01225"
FT   CDS_pept        634708..635457
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0582"
FT                   /product="putative acyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0609"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51360"
FT                   /protein_id="CAZ51360.1"
FT                   /translation="MFYSYLRTLLTFLLWAINGNIHYHDREKILPQEENYILIAPHKTF
FT                   WDPVFLGYAAAPKQFIFMAKKELFKDRGFGWWISKCGAFPIDRDNPGMAAIKYPVNMLK
FT                   KSDRSLVMFPSGSRHSSELKGGVAVIAKSAKVKLMPATYVGPMTIKGLLAGERIDVAFG
FT                   NPIDVSDIKRMDDAGTAEVTSRIEAEFKRLDDHAASFQTKKKPNILTYIYRIPVLLLVA
FT                   LILGLTYAFSYIASFFWQPSTQLDKNK"
FT   misc_feature    634765..635139
FT                   /locus_tag="SSUSC84_0582"
FT                   /note="HMMPfam hit to PF01553, Acyltransferase, score
FT                   4.3e-25"
FT                   /inference="protein motif:HMMPfam:PF01553"
FT   misc_feature    635356..635424
FT                   /locus_tag="SSUSC84_0582"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0582 by TMHMM2.0 at aa 217-239"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        635520..636182
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="SSUSC84_0583"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0610"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51361"
FT                   /protein_id="CAZ51361.1"
FT                   /translation="MDTIKTYIEMLKEYKWQIALPAVAGLLMATFLIFSQPAKSDQTGL
FT                   TDFPQTEQASSSQEQTEETSTEESEELSQLTVDVKGAVEKPGLYTLEAGARVNDAVEAA
FT                   GGLTSQADPKSINLAQKLSDEAVVYVASKDENISVVASTTASSAMSPEEKSTSLVNLNT
FT                   ATEADLQTISGIGAKRAADIIAYREANGGFKSVNDLNNVSGIGDKTMESIRPYVTVE"
FT   sig_peptide     635520..635639
FT                   /gene="comEA"
FT                   /locus_tag="SSUSC84_0583"
FT                   /note="Signal peptide predicted for SSUSC84_0583 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.926) with cleavage
FT                   site probability 0.876 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    635565..635633
FT                   /gene="comEA"
FT                   /locus_tag="SSUSC84_0583"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0583 by TMHMM2.0 at aa 16-38"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    635988..636077
FT                   /gene="comEA"
FT                   /locus_tag="SSUSC84_0583"
FT                   /note="HMMPfam hit to PF00633, HHH, score 5.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS_pept        636166..638403
FT                   /transl_table=11
FT                   /gene="comEC"
FT                   /locus_tag="SSUSC84_0584"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0611"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51362"
FT                   /protein_id="CAZ51362.1"
FT                   /translation="MSRLSKLPCQPVHLAVLAVAAYFAVHSFSLLTMCLLSLVLAVFGV
FT                   RQGKTVFLKTLPLLTLCGLFFGCQKVQWERAAQSAPEQVTTVQVIPDTIDINGDSLSFR
FT                   GRADGQNYQVFYKLTSQEEQTYFQNLADLVQLEVEAEVSLPAGQRNFKGFDYQAYLKTQ
FT                   GIYRTVKLTAIKKIVPVQSWNVFDWLSTWRRQALVYVKTNFPAPMSHYMTGLLFGELDS
FT                   DFDQMSDLYSSLGIIHLFALSGMQVGFFIDKFRWILLRLGLTKETVDKLQIPFSLVYAG
FT                   LTGFSVSVVRSLVQKILGNLGLRKLDNFAVTVFICLLILPRFLLTAGGVLTFTYAFLLT
FT                   VFDFEDLGQVKKAAVESLSISLGILPVLMTYFYAFQPLSILLTFVFSFVFDVLLLPGLS
FT                   VIFLLSPVVKMTWVNGFFVFMEKIIVWVADLGLRPWILGKPSELVLLLLLVSLFLLYDF
FT                   HRRKKWLLGLSLVLALLFFITKHPLENEVTVLDIGQGDSIFLRDMRGRTVLIDVGGRVD
FT                   FAAKEAWQERSRQANAERTLIPYLHSRGVDRIDSLVLTHTDTDHVGDVLEVAKQVQIGR
FT                   IVVSPGSLTVPDFVATLKKINVPVHVVKVGDRLPIFDSYLEVLYPDGTGDGGNNDSIVL
FT                   YGRLLETNFLFTGDLEQGELDLIETYPNLPVDVLKAGHHGSKGSSYPEFLDHIGAKIAL
FT                   VSAGENNRYKHPHQETLERFDSRNIQVYRTDQQGAIRFRGWKEWKIETVRR"
FT   misc_feature    join(636232..636300,636853..636918,636976..637035,
FT                   637096..637164,637222..637290,637309..637377,
FT                   637468..637536,637555..637614)
FT                   /gene="comEC"
FT                   /locus_tag="SSUSC84_0584"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUSC84_0584 by TMHMM2.0 at aa 23-45, 230-251, 271-290,
FT                   311-333, 353-375, 382-404, 435-457 and 464-483"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    636808..637548
FT                   /gene="comEC"
FT                   /locus_tag="SSUSC84_0584"
FT                   /note="HMMPfam hit to PF03772, Competence, score 4.6e-43"
FT                   /inference="protein motif:HMMPfam:PF03772"
FT   misc_feature    637645..638262
FT                   /gene="comEC"
FT                   /locus_tag="SSUSC84_0584"
FT                   /note="HMMPfam hit to PF00753, Lactamase_B, score 1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        638420..638548
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0585"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0612"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Streptococcus criceti putative transposase
FT                   UniProt:Q93RH3 (EMBL:AB042239) (287 aa) fasta scores:
FT                   E()=1.4e-08, 66.667% id in 42 aa"
FT   misc_feature    638423..638491
FT                   /locus_tag="SSUSC84_0585"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0585 by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        638728..639384
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0613"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51364"
FT                   /protein_id="CAZ51364.1"
FT                   /translation="MSVKDFMTRKVVYISPDTTVAHAADIMREQDLHRLPVIENDKLVG
FT                   LVTEGTIAEASPSKATSLSIYEMNYLLNKTKVKDVMIKNVITVSGYASLEDAAYLMYKN
FT                   KVGILPVVDNGQLYGVITDRDIFAAFLHVSGYGEEGVRARFLVENKAGELEKIIRLVAD
FT                   KDYNIVSTVQLATKSGKVVIEVQIDGKVDVEEVRTLFEGAGIQVDSLVPTVAKNI"
FT   misc_feature    638740..639120
FT                   /locus_tag="SSUSC84_0586"
FT                   /note="HMMPfam hit to PF00571, CBS, score 2.1e-40"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    639148..639330
FT                   /locus_tag="SSUSC84_0586"
FT                   /note="HMMPfam hit to PF01842, ACT, score 0.0071"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        639478..640305
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0587"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0614"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51365"
FT                   /protein_id="CAZ51365.1"
FT                   /translation="MGHKYKKYKKYGKNNSGLVALLVLLAIGFVMSFWYILLPTGLLIG
FT                   YFYKREAIQRFLNRDSIKRLQVLALSIRSGYEKHQELLVEKGEDKVVLQLRNRLLGQLF
FT                   ELDQLYQKFGKYLNGYESKEVVDTLQLKYHLKLPEAKTEKNTDTQVSTGGNAVMDEQGM
FT                   IADLAPEILETYCNIQRDNLVILEKLEKATDKREELTAIHEANMNRFNDILQGYLKIKK
FT                   SPKDYFNAEERLVQAKSAMEMFDKDLDDTIKQFNEADMKDFEVSLRMMKREEE"
FT   sig_peptide     639478..639573
FT                   /locus_tag="SSUSC84_0587"
FT                   /note="Signal peptide predicted for SSUSC84_0587 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.817) with cleavage
FT                   site probability 0.759 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    639523..639591
FT                   /locus_tag="SSUSC84_0587"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUSC84_0587 by TMHMM2.0 at aa 16-38"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        640311..641582
FT                   /transl_table=11
FT                   /locus_tag="SSUSC84_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0615"
FT                   /db_xref="EnsemblGenomes-Gn:SSUSC84_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ51366"
FT                   /protein_id="CAZ51366.1"
FT                   /translation="MSGFNFDIDQIANNSLSTKDKTTELIQATPTGDNSKVSFLAQLTP
FT                   EQQTGIRAKAPQLVDNFLANQNVLLDFGKEAVEEVNATVNHILSEQKKIEIPQVDELLA
FT                   NTNRELNGFVAKYKDISTTAELEKKPGFFQHLFKQTKNDLQEFYFDSQTIEKKMDSMAA
FT                   SVVKQEEVLARNIVSAELLIENNTKSIENLVGVIAFIEATGQEAAQRAKAEQERLAGLQ
FT                   PTTVDYQVASEKLARVTEVANILEQQHSEYMSRLYVAWTTTPQMRNLVKVSSDMKQRLG
FT                   MLRRNTIPTMKLSIAQLGILQQSIKSSQTADAIVNANNAALQMLADTSKEAIPMMERTA
FT                   QNPTLSVASVTKLAESLVAQNNGIIAAIDEGRQKRRELEAAIVRSAETINDSVKLRDQK
FT                   IIAALLEQGKEAQSEAEQPLETNQ"
FT   misc_feature