(data stored in ACNUC17686 zone)

EMBL: FM252032

ID   FM252032; SV 1; circular; genomic DNA; STD; PRO; 2146229 BP.
XX
AC   FM252032;
XX
PR   Project:PRJEA32237;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Streptococcus suis BM407 complet genome, strain BM407
XX
KW   complete genome.
XX
OS   Streptococcus suis BM407
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2146229
RA   Holden M.T.G.;
RT   ;
RL   Submitted (20-OCT-2008) to the INSDC.
RL   Holden M.T.G., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.pone.0006072.
RX   PUBMED; 19603075.
RA   Holden M.T.G., Hauser H., Sanders M., Ngo T.H., Cherevach I., Cronin A.,
RA   Goodhead I., Mungall K., Quail M.A., Price C., Rabbinowitsch E., Sharp S.,
RA   Croucher N.J., Chieu T.B., Mai N.T.H., Diep T.S., Chinh N.T., Kehoe M.,
RA   Leigh J.A., Ward P.N., Dowson C.G., Whatmore A.M., Chanter N., Iversen P.,
RA   Gottschalk M., Slater J.D., Smith H.E., Spratt B.G., Xu J., Ye C.,
RA   Bentley S.D., Barrell B.G., Schultsz C., Maskell D.J., Parkhill J.;
RT   "Rapid evolution of virulence and drug resistance in the emerging zoonotic
RT   pathogen Streptococcus suis";
RL   PLoS One 4(7):e6072-e6072(2009).
XX
DR   MD5; ca54f5a8a8a210379f6cf0c93f8239fd.
DR   BioSample; SAMEA2272697.
DR   EnsemblGenomes-Gn; EBG00000991851.
DR   EnsemblGenomes-Gn; EBG00000991853.
DR   EnsemblGenomes-Gn; EBG00000991855.
DR   EnsemblGenomes-Gn; EBG00000991857.
DR   EnsemblGenomes-Gn; EBG00000991859.
DR   EnsemblGenomes-Gn; EBG00000991861.
DR   EnsemblGenomes-Gn; EBG00000991863.
DR   EnsemblGenomes-Gn; EBG00000991865.
DR   EnsemblGenomes-Gn; EBG00000991867.
DR   EnsemblGenomes-Gn; EBG00000991870.
DR   EnsemblGenomes-Gn; EBG00000991872.
DR   EnsemblGenomes-Gn; EBG00000991874.
DR   EnsemblGenomes-Gn; EBG00000991876.
DR   EnsemblGenomes-Gn; EBG00000991878.
DR   EnsemblGenomes-Gn; EBG00000991879.
DR   EnsemblGenomes-Gn; EBG00000991881.
DR   EnsemblGenomes-Gn; EBG00000991883.
DR   EnsemblGenomes-Gn; EBG00000991885.
DR   EnsemblGenomes-Gn; EBG00000991887.
DR   EnsemblGenomes-Gn; EBG00000991890.
DR   EnsemblGenomes-Gn; EBG00000991892.
DR   EnsemblGenomes-Gn; EBG00000991894.
DR   EnsemblGenomes-Gn; EBG00000991896.
DR   EnsemblGenomes-Gn; EBG00000991898.
DR   EnsemblGenomes-Gn; EBG00000991900.
DR   EnsemblGenomes-Gn; EBG00000991903.
DR   EnsemblGenomes-Gn; EBG00000991905.
DR   EnsemblGenomes-Gn; EBG00000991907.
DR   EnsemblGenomes-Gn; EBG00000991909.
DR   EnsemblGenomes-Gn; EBG00000991911.
DR   EnsemblGenomes-Gn; EBG00000991913.
DR   EnsemblGenomes-Gn; EBG00000991915.
DR   EnsemblGenomes-Gn; EBG00000991917.
DR   EnsemblGenomes-Gn; EBG00000991920.
DR   EnsemblGenomes-Gn; EBG00000991922.
DR   EnsemblGenomes-Gn; EBG00000991924.
DR   EnsemblGenomes-Gn; EBG00000991926.
DR   EnsemblGenomes-Gn; EBG00000991929.
DR   EnsemblGenomes-Gn; EBG00000991931.
DR   EnsemblGenomes-Gn; EBG00000991933.
DR   EnsemblGenomes-Gn; EBG00000991935.
DR   EnsemblGenomes-Gn; EBG00000991937.
DR   EnsemblGenomes-Gn; EBG00000991939.
DR   EnsemblGenomes-Gn; EBG00000991941.
DR   EnsemblGenomes-Gn; EBG00000991943.
DR   EnsemblGenomes-Gn; EBG00000991945.
DR   EnsemblGenomes-Gn; EBG00000991947.
DR   EnsemblGenomes-Gn; EBG00000991949.
DR   EnsemblGenomes-Gn; EBG00000991951.
DR   EnsemblGenomes-Gn; EBG00000991953.
DR   EnsemblGenomes-Gn; EBG00000991955.
DR   EnsemblGenomes-Gn; EBG00000991956.
DR   EnsemblGenomes-Gn; EBG00000991957.
DR   EnsemblGenomes-Gn; EBG00000991958.
DR   EnsemblGenomes-Gn; EBG00000991959.
DR   EnsemblGenomes-Gn; EBG00000991960.
DR   EnsemblGenomes-Gn; EBG00000991962.
DR   EnsemblGenomes-Gn; EBG00000991964.
DR   EnsemblGenomes-Gn; EBG00000991966.
DR   EnsemblGenomes-Gn; EBG00000991968.
DR   EnsemblGenomes-Gn; EBG00000991970.
DR   EnsemblGenomes-Gn; EBG00000991972.
DR   EnsemblGenomes-Gn; EBG00000991974.
DR   EnsemblGenomes-Gn; EBG00000991975.
DR   EnsemblGenomes-Gn; EBG00000991976.
DR   EnsemblGenomes-Gn; EBG00000991977.
DR   EnsemblGenomes-Gn; EBG00000991978.
DR   EnsemblGenomes-Gn; EBG00000991979.
DR   EnsemblGenomes-Gn; EBG00000991980.
DR   EnsemblGenomes-Gn; EBG00000991981.
DR   EnsemblGenomes-Gn; EBG00000991982.
DR   EnsemblGenomes-Gn; EBG00000991983.
DR   EnsemblGenomes-Gn; EBG00000991984.
DR   EnsemblGenomes-Gn; EBG00000991985.
DR   EnsemblGenomes-Gn; EBG00000991986.
DR   EnsemblGenomes-Gn; EBG00000991987.
DR   EnsemblGenomes-Gn; EBG00000991988.
DR   EnsemblGenomes-Gn; EBG00000991989.
DR   EnsemblGenomes-Gn; EBG00000991990.
DR   EnsemblGenomes-Gn; EBG00000991991.
DR   EnsemblGenomes-Gn; EBG00000991992.
DR   EnsemblGenomes-Gn; EBG00000991993.
DR   EnsemblGenomes-Gn; EBG00000991994.
DR   EnsemblGenomes-Gn; SSUBM407_0064.
DR   EnsemblGenomes-Gn; SSUBM407_0083.
DR   EnsemblGenomes-Gn; SSUBM407_0106.
DR   EnsemblGenomes-Gn; SSUBM407_0117.
DR   EnsemblGenomes-Gn; SSUBM407_0118.
DR   EnsemblGenomes-Gn; SSUBM407_0122.
DR   EnsemblGenomes-Gn; SSUBM407_0129.
DR   EnsemblGenomes-Gn; SSUBM407_0166.
DR   EnsemblGenomes-Gn; SSUBM407_0183.
DR   EnsemblGenomes-Gn; SSUBM407_0200.
DR   EnsemblGenomes-Gn; SSUBM407_0201.
DR   EnsemblGenomes-Gn; SSUBM407_0245.
DR   EnsemblGenomes-Gn; SSUBM407_0246.
DR   EnsemblGenomes-Gn; SSUBM407_0247.
DR   EnsemblGenomes-Gn; SSUBM407_0254.
DR   EnsemblGenomes-Gn; SSUBM407_0306.
DR   EnsemblGenomes-Gn; SSUBM407_0310.
DR   EnsemblGenomes-Gn; SSUBM407_0329.
DR   EnsemblGenomes-Gn; SSUBM407_0330.
DR   EnsemblGenomes-Gn; SSUBM407_0354.
DR   EnsemblGenomes-Gn; SSUBM407_0402.
DR   EnsemblGenomes-Gn; SSUBM407_0413.
DR   EnsemblGenomes-Gn; SSUBM407_0416.
DR   EnsemblGenomes-Gn; SSUBM407_0439.
DR   EnsemblGenomes-Gn; SSUBM407_0441.
DR   EnsemblGenomes-Gn; SSUBM407_0455.
DR   EnsemblGenomes-Gn; SSUBM407_0540.
DR   EnsemblGenomes-Gn; SSUBM407_0614.
DR   EnsemblGenomes-Gn; SSUBM407_0636.
DR   EnsemblGenomes-Gn; SSUBM407_0637.
DR   EnsemblGenomes-Gn; SSUBM407_0663.
DR   EnsemblGenomes-Gn; SSUBM407_0736.
DR   EnsemblGenomes-Gn; SSUBM407_0775.
DR   EnsemblGenomes-Gn; SSUBM407_0794.
DR   EnsemblGenomes-Gn; SSUBM407_0818.
DR   EnsemblGenomes-Gn; SSUBM407_0822.
DR   EnsemblGenomes-Gn; SSUBM407_0823.
DR   EnsemblGenomes-Gn; SSUBM407_0841.
DR   EnsemblGenomes-Gn; SSUBM407_0853.
DR   EnsemblGenomes-Gn; SSUBM407_0876.
DR   EnsemblGenomes-Gn; SSUBM407_0883.
DR   EnsemblGenomes-Gn; SSUBM407_0899.
DR   EnsemblGenomes-Gn; SSUBM407_0907.
DR   EnsemblGenomes-Gn; SSUBM407_0951.
DR   EnsemblGenomes-Gn; SSUBM407_0951a.
DR   EnsemblGenomes-Gn; SSUBM407_0954a.
DR   EnsemblGenomes-Gn; SSUBM407_0960a.
DR   EnsemblGenomes-Gn; SSUBM407_0960b.
DR   EnsemblGenomes-Gn; SSUBM407_0960c.
DR   EnsemblGenomes-Gn; SSUBM407_0961a.
DR   EnsemblGenomes-Gn; SSUBM407_0978.
DR   EnsemblGenomes-Gn; SSUBM407_0986.
DR   EnsemblGenomes-Gn; SSUBM407_0990.
DR   EnsemblGenomes-Gn; SSUBM407_1024.
DR   EnsemblGenomes-Gn; SSUBM407_1025.
DR   EnsemblGenomes-Gn; SSUBM407_1073.
DR   EnsemblGenomes-Gn; SSUBM407_1077.
DR   EnsemblGenomes-Gn; SSUBM407_1078.
DR   EnsemblGenomes-Gn; SSUBM407_1104.
DR   EnsemblGenomes-Gn; SSUBM407_1120.
DR   EnsemblGenomes-Gn; SSUBM407_1121.
DR   EnsemblGenomes-Gn; SSUBM407_1126.
DR   EnsemblGenomes-Gn; SSUBM407_1152.
DR   EnsemblGenomes-Gn; SSUBM407_1169.
DR   EnsemblGenomes-Gn; SSUBM407_1172.
DR   EnsemblGenomes-Gn; SSUBM407_1178.
DR   EnsemblGenomes-Gn; SSUBM407_1187.
DR   EnsemblGenomes-Gn; SSUBM407_1189.
DR   EnsemblGenomes-Gn; SSUBM407_1194.
DR   EnsemblGenomes-Gn; SSUBM407_1212.
DR   EnsemblGenomes-Gn; SSUBM407_1237.
DR   EnsemblGenomes-Gn; SSUBM407_1259.
DR   EnsemblGenomes-Gn; SSUBM407_1265.
DR   EnsemblGenomes-Gn; SSUBM407_1266.
DR   EnsemblGenomes-Gn; SSUBM407_1267.
DR   EnsemblGenomes-Gn; SSUBM407_1268.
DR   EnsemblGenomes-Gn; SSUBM407_1269.
DR   EnsemblGenomes-Gn; SSUBM407_1270.
DR   EnsemblGenomes-Gn; SSUBM407_1271.
DR   EnsemblGenomes-Gn; SSUBM407_1273.
DR   EnsemblGenomes-Gn; SSUBM407_1276.
DR   EnsemblGenomes-Gn; SSUBM407_1283.
DR   EnsemblGenomes-Gn; SSUBM407_1308.
DR   EnsemblGenomes-Gn; SSUBM407_1309.
DR   EnsemblGenomes-Gn; SSUBM407_1310.
DR   EnsemblGenomes-Gn; SSUBM407_1328.
DR   EnsemblGenomes-Gn; SSUBM407_1329.
DR   EnsemblGenomes-Gn; SSUBM407_1341.
DR   EnsemblGenomes-Gn; SSUBM407_1348.
DR   EnsemblGenomes-Gn; SSUBM407_1378.
DR   EnsemblGenomes-Gn; SSUBM407_1465.
DR   EnsemblGenomes-Gn; SSUBM407_1502.
DR   EnsemblGenomes-Gn; SSUBM407_1522.
DR   EnsemblGenomes-Gn; SSUBM407_1526.
DR   EnsemblGenomes-Gn; SSUBM407_1549.
DR   EnsemblGenomes-Gn; SSUBM407_1609.
DR   EnsemblGenomes-Gn; SSUBM407_1667.
DR   EnsemblGenomes-Gn; SSUBM407_1731.
DR   EnsemblGenomes-Gn; SSUBM407_1739.
DR   EnsemblGenomes-Gn; SSUBM407_1761.
DR   EnsemblGenomes-Gn; SSUBM407_1764.
DR   EnsemblGenomes-Gn; SSUBM407_1794.
DR   EnsemblGenomes-Gn; SSUBM407_1804.
DR   EnsemblGenomes-Gn; SSUBM407_1809.
DR   EnsemblGenomes-Gn; SSUBM407_1943.
DR   EnsemblGenomes-Gn; SSUBM407_1944.
DR   EnsemblGenomes-Gn; SSUBM407_1952.
DR   EnsemblGenomes-Gn; SSUBM407_1954.
DR   EnsemblGenomes-Gn; SSUBM407_r0001.
DR   EnsemblGenomes-Gn; SSUBM407_r0002.
DR   EnsemblGenomes-Gn; SSUBM407_r0003.
DR   EnsemblGenomes-Gn; SSUBM407_r0004.
DR   EnsemblGenomes-Gn; SSUBM407_r0005.
DR   EnsemblGenomes-Gn; SSUBM407_r0006.
DR   EnsemblGenomes-Gn; SSUBM407_r0007.
DR   EnsemblGenomes-Gn; SSUBM407_r0008.
DR   EnsemblGenomes-Gn; SSUBM407_r0009.
DR   EnsemblGenomes-Gn; SSUBM407_r0010.
DR   EnsemblGenomes-Gn; SSUBM407_r0011.
DR   EnsemblGenomes-Gn; SSUBM407_r0012.
DR   EnsemblGenomes-Gn; SSUBM407_t0001.
DR   EnsemblGenomes-Gn; SSUBM407_t0002.
DR   EnsemblGenomes-Gn; SSUBM407_t0003.
DR   EnsemblGenomes-Gn; SSUBM407_t0004.
DR   EnsemblGenomes-Gn; SSUBM407_t0005.
DR   EnsemblGenomes-Gn; SSUBM407_t0006.
DR   EnsemblGenomes-Gn; SSUBM407_t0007.
DR   EnsemblGenomes-Gn; SSUBM407_t0008.
DR   EnsemblGenomes-Gn; SSUBM407_t0009.
DR   EnsemblGenomes-Gn; SSUBM407_t0010.
DR   EnsemblGenomes-Gn; SSUBM407_t0011.
DR   EnsemblGenomes-Gn; SSUBM407_t0012.
DR   EnsemblGenomes-Gn; SSUBM407_t0013.
DR   EnsemblGenomes-Gn; SSUBM407_t0014.
DR   EnsemblGenomes-Gn; SSUBM407_t0015.
DR   EnsemblGenomes-Gn; SSUBM407_t0016.
DR   EnsemblGenomes-Gn; SSUBM407_t0017.
DR   EnsemblGenomes-Gn; SSUBM407_t0018.
DR   EnsemblGenomes-Gn; SSUBM407_t0019.
DR   EnsemblGenomes-Gn; SSUBM407_t0020.
DR   EnsemblGenomes-Gn; SSUBM407_t0021.
DR   EnsemblGenomes-Gn; SSUBM407_t0022.
DR   EnsemblGenomes-Gn; SSUBM407_t0023.
DR   EnsemblGenomes-Gn; SSUBM407_t0024.
DR   EnsemblGenomes-Gn; SSUBM407_t0025.
DR   EnsemblGenomes-Gn; SSUBM407_t0026.
DR   EnsemblGenomes-Gn; SSUBM407_t0027.
DR   EnsemblGenomes-Gn; SSUBM407_t0028.
DR   EnsemblGenomes-Gn; SSUBM407_t0029.
DR   EnsemblGenomes-Gn; SSUBM407_t0030.
DR   EnsemblGenomes-Gn; SSUBM407_t0031.
DR   EnsemblGenomes-Gn; SSUBM407_t0032.
DR   EnsemblGenomes-Gn; SSUBM407_t0033.
DR   EnsemblGenomes-Gn; SSUBM407_t0034.
DR   EnsemblGenomes-Gn; SSUBM407_t0035.
DR   EnsemblGenomes-Gn; SSUBM407_t0036.
DR   EnsemblGenomes-Gn; SSUBM407_t0037.
DR   EnsemblGenomes-Gn; SSUBM407_t0038.
DR   EnsemblGenomes-Gn; SSUBM407_t0039.
DR   EnsemblGenomes-Gn; SSUBM407_t0040.
DR   EnsemblGenomes-Gn; SSUBM407_t0041.
DR   EnsemblGenomes-Gn; SSUBM407_t0042.
DR   EnsemblGenomes-Gn; SSUBM407_t0043.
DR   EnsemblGenomes-Gn; SSUBM407_t0044.
DR   EnsemblGenomes-Gn; SSUBM407_t0045.
DR   EnsemblGenomes-Gn; SSUBM407_t0046.
DR   EnsemblGenomes-Gn; SSUBM407_t0047.
DR   EnsemblGenomes-Gn; SSUBM407_t0048.
DR   EnsemblGenomes-Gn; SSUBM407_t0049.
DR   EnsemblGenomes-Gn; SSUBM407_t0050.
DR   EnsemblGenomes-Gn; SSUBM407_t0051.
DR   EnsemblGenomes-Gn; SSUBM407_t0052.
DR   EnsemblGenomes-Gn; SSUBM407_t0053.
DR   EnsemblGenomes-Gn; SSUBM407_t0054.
DR   EnsemblGenomes-Gn; SSUBM407_t0055.
DR   EnsemblGenomes-Gn; SSUBM407_t0056.
DR   EnsemblGenomes-Tr; EBT00001518013.
DR   EnsemblGenomes-Tr; EBT00001518014.
DR   EnsemblGenomes-Tr; EBT00001518015.
DR   EnsemblGenomes-Tr; EBT00001518016.
DR   EnsemblGenomes-Tr; EBT00001518017.
DR   EnsemblGenomes-Tr; EBT00001518018.
DR   EnsemblGenomes-Tr; EBT00001518019.
DR   EnsemblGenomes-Tr; EBT00001518020.
DR   EnsemblGenomes-Tr; EBT00001518021.
DR   EnsemblGenomes-Tr; EBT00001518022.
DR   EnsemblGenomes-Tr; EBT00001518023.
DR   EnsemblGenomes-Tr; EBT00001518024.
DR   EnsemblGenomes-Tr; EBT00001518025.
DR   EnsemblGenomes-Tr; EBT00001518026.
DR   EnsemblGenomes-Tr; EBT00001518027.
DR   EnsemblGenomes-Tr; EBT00001518028.
DR   EnsemblGenomes-Tr; EBT00001518029.
DR   EnsemblGenomes-Tr; EBT00001518030.
DR   EnsemblGenomes-Tr; EBT00001518031.
DR   EnsemblGenomes-Tr; EBT00001518032.
DR   EnsemblGenomes-Tr; EBT00001518033.
DR   EnsemblGenomes-Tr; EBT00001518034.
DR   EnsemblGenomes-Tr; EBT00001518035.
DR   EnsemblGenomes-Tr; EBT00001518036.
DR   EnsemblGenomes-Tr; EBT00001518037.
DR   EnsemblGenomes-Tr; EBT00001518038.
DR   EnsemblGenomes-Tr; EBT00001518039.
DR   EnsemblGenomes-Tr; EBT00001518040.
DR   EnsemblGenomes-Tr; EBT00001518041.
DR   EnsemblGenomes-Tr; EBT00001518042.
DR   EnsemblGenomes-Tr; EBT00001518043.
DR   EnsemblGenomes-Tr; EBT00001518044.
DR   EnsemblGenomes-Tr; EBT00001518045.
DR   EnsemblGenomes-Tr; EBT00001518046.
DR   EnsemblGenomes-Tr; EBT00001518047.
DR   EnsemblGenomes-Tr; EBT00001518048.
DR   EnsemblGenomes-Tr; EBT00001518049.
DR   EnsemblGenomes-Tr; EBT00001518050.
DR   EnsemblGenomes-Tr; EBT00001518051.
DR   EnsemblGenomes-Tr; EBT00001518052.
DR   EnsemblGenomes-Tr; EBT00001518053.
DR   EnsemblGenomes-Tr; EBT00001518054.
DR   EnsemblGenomes-Tr; EBT00001518055.
DR   EnsemblGenomes-Tr; EBT00001518056.
DR   EnsemblGenomes-Tr; EBT00001518057.
DR   EnsemblGenomes-Tr; EBT00001518058.
DR   EnsemblGenomes-Tr; EBT00001518059.
DR   EnsemblGenomes-Tr; EBT00001518060.
DR   EnsemblGenomes-Tr; EBT00001518061.
DR   EnsemblGenomes-Tr; EBT00001518062.
DR   EnsemblGenomes-Tr; EBT00001518063.
DR   EnsemblGenomes-Tr; EBT00001518064.
DR   EnsemblGenomes-Tr; EBT00001518065.
DR   EnsemblGenomes-Tr; EBT00001518066.
DR   EnsemblGenomes-Tr; EBT00001518067.
DR   EnsemblGenomes-Tr; EBT00001518068.
DR   EnsemblGenomes-Tr; EBT00001518069.
DR   EnsemblGenomes-Tr; EBT00001518070.
DR   EnsemblGenomes-Tr; EBT00001518071.
DR   EnsemblGenomes-Tr; EBT00001518072.
DR   EnsemblGenomes-Tr; EBT00001518073.
DR   EnsemblGenomes-Tr; EBT00001518074.
DR   EnsemblGenomes-Tr; EBT00001518075.
DR   EnsemblGenomes-Tr; EBT00001518076.
DR   EnsemblGenomes-Tr; EBT00001518077.
DR   EnsemblGenomes-Tr; EBT00001518078.
DR   EnsemblGenomes-Tr; EBT00001518079.
DR   EnsemblGenomes-Tr; EBT00001518080.
DR   EnsemblGenomes-Tr; EBT00001518081.
DR   EnsemblGenomes-Tr; EBT00001518082.
DR   EnsemblGenomes-Tr; EBT00001518083.
DR   EnsemblGenomes-Tr; EBT00001518084.
DR   EnsemblGenomes-Tr; EBT00001518085.
DR   EnsemblGenomes-Tr; EBT00001518086.
DR   EnsemblGenomes-Tr; EBT00001518087.
DR   EnsemblGenomes-Tr; EBT00001518088.
DR   EnsemblGenomes-Tr; EBT00001518089.
DR   EnsemblGenomes-Tr; EBT00001518090.
DR   EnsemblGenomes-Tr; EBT00001518091.
DR   EnsemblGenomes-Tr; EBT00001518092.
DR   EnsemblGenomes-Tr; EBT00001518093.
DR   EnsemblGenomes-Tr; EBT00001518094.
DR   EnsemblGenomes-Tr; EBT00001518095.
DR   EnsemblGenomes-Tr; SSUBM407_0064.
DR   EnsemblGenomes-Tr; SSUBM407_0083.
DR   EnsemblGenomes-Tr; SSUBM407_0106.
DR   EnsemblGenomes-Tr; SSUBM407_0117.
DR   EnsemblGenomes-Tr; SSUBM407_0118.
DR   EnsemblGenomes-Tr; SSUBM407_0122.
DR   EnsemblGenomes-Tr; SSUBM407_0129.
DR   EnsemblGenomes-Tr; SSUBM407_0166.
DR   EnsemblGenomes-Tr; SSUBM407_0183.
DR   EnsemblGenomes-Tr; SSUBM407_0200.
DR   EnsemblGenomes-Tr; SSUBM407_0201.
DR   EnsemblGenomes-Tr; SSUBM407_0245.
DR   EnsemblGenomes-Tr; SSUBM407_0246.
DR   EnsemblGenomes-Tr; SSUBM407_0247.
DR   EnsemblGenomes-Tr; SSUBM407_0254.
DR   EnsemblGenomes-Tr; SSUBM407_0306.
DR   EnsemblGenomes-Tr; SSUBM407_0310.
DR   EnsemblGenomes-Tr; SSUBM407_0329.
DR   EnsemblGenomes-Tr; SSUBM407_0330.
DR   EnsemblGenomes-Tr; SSUBM407_0354.
DR   EnsemblGenomes-Tr; SSUBM407_0402.
DR   EnsemblGenomes-Tr; SSUBM407_0413.
DR   EnsemblGenomes-Tr; SSUBM407_0416.
DR   EnsemblGenomes-Tr; SSUBM407_0439.
DR   EnsemblGenomes-Tr; SSUBM407_0441.
DR   EnsemblGenomes-Tr; SSUBM407_0455.
DR   EnsemblGenomes-Tr; SSUBM407_0540.
DR   EnsemblGenomes-Tr; SSUBM407_0614.
DR   EnsemblGenomes-Tr; SSUBM407_0636.
DR   EnsemblGenomes-Tr; SSUBM407_0637.
DR   EnsemblGenomes-Tr; SSUBM407_0663.
DR   EnsemblGenomes-Tr; SSUBM407_0736.
DR   EnsemblGenomes-Tr; SSUBM407_0775.
DR   EnsemblGenomes-Tr; SSUBM407_0794.
DR   EnsemblGenomes-Tr; SSUBM407_0818.
DR   EnsemblGenomes-Tr; SSUBM407_0822.
DR   EnsemblGenomes-Tr; SSUBM407_0823.
DR   EnsemblGenomes-Tr; SSUBM407_0841.
DR   EnsemblGenomes-Tr; SSUBM407_0853.
DR   EnsemblGenomes-Tr; SSUBM407_0876.
DR   EnsemblGenomes-Tr; SSUBM407_0883.
DR   EnsemblGenomes-Tr; SSUBM407_0899.
DR   EnsemblGenomes-Tr; SSUBM407_0907.
DR   EnsemblGenomes-Tr; SSUBM407_0951.
DR   EnsemblGenomes-Tr; SSUBM407_0951a.
DR   EnsemblGenomes-Tr; SSUBM407_0954a.
DR   EnsemblGenomes-Tr; SSUBM407_0960a.
DR   EnsemblGenomes-Tr; SSUBM407_0960b.
DR   EnsemblGenomes-Tr; SSUBM407_0960c.
DR   EnsemblGenomes-Tr; SSUBM407_0961a.
DR   EnsemblGenomes-Tr; SSUBM407_0978.
DR   EnsemblGenomes-Tr; SSUBM407_0986.
DR   EnsemblGenomes-Tr; SSUBM407_0990.
DR   EnsemblGenomes-Tr; SSUBM407_1024.
DR   EnsemblGenomes-Tr; SSUBM407_1025.
DR   EnsemblGenomes-Tr; SSUBM407_1073.
DR   EnsemblGenomes-Tr; SSUBM407_1077.
DR   EnsemblGenomes-Tr; SSUBM407_1078.
DR   EnsemblGenomes-Tr; SSUBM407_1104.
DR   EnsemblGenomes-Tr; SSUBM407_1120.
DR   EnsemblGenomes-Tr; SSUBM407_1121.
DR   EnsemblGenomes-Tr; SSUBM407_1126.
DR   EnsemblGenomes-Tr; SSUBM407_1152.
DR   EnsemblGenomes-Tr; SSUBM407_1169.
DR   EnsemblGenomes-Tr; SSUBM407_1172.
DR   EnsemblGenomes-Tr; SSUBM407_1178.
DR   EnsemblGenomes-Tr; SSUBM407_1187.
DR   EnsemblGenomes-Tr; SSUBM407_1189.
DR   EnsemblGenomes-Tr; SSUBM407_1194.
DR   EnsemblGenomes-Tr; SSUBM407_1212.
DR   EnsemblGenomes-Tr; SSUBM407_1237.
DR   EnsemblGenomes-Tr; SSUBM407_1259.
DR   EnsemblGenomes-Tr; SSUBM407_1265.
DR   EnsemblGenomes-Tr; SSUBM407_1266.
DR   EnsemblGenomes-Tr; SSUBM407_1267.
DR   EnsemblGenomes-Tr; SSUBM407_1268.
DR   EnsemblGenomes-Tr; SSUBM407_1269.
DR   EnsemblGenomes-Tr; SSUBM407_1270.
DR   EnsemblGenomes-Tr; SSUBM407_1271.
DR   EnsemblGenomes-Tr; SSUBM407_1273.
DR   EnsemblGenomes-Tr; SSUBM407_1276.
DR   EnsemblGenomes-Tr; SSUBM407_1283.
DR   EnsemblGenomes-Tr; SSUBM407_1308.
DR   EnsemblGenomes-Tr; SSUBM407_1309.
DR   EnsemblGenomes-Tr; SSUBM407_1310.
DR   EnsemblGenomes-Tr; SSUBM407_1328.
DR   EnsemblGenomes-Tr; SSUBM407_1329.
DR   EnsemblGenomes-Tr; SSUBM407_1341.
DR   EnsemblGenomes-Tr; SSUBM407_1348.
DR   EnsemblGenomes-Tr; SSUBM407_1378.
DR   EnsemblGenomes-Tr; SSUBM407_1465.
DR   EnsemblGenomes-Tr; SSUBM407_1502.
DR   EnsemblGenomes-Tr; SSUBM407_1522.
DR   EnsemblGenomes-Tr; SSUBM407_1526.
DR   EnsemblGenomes-Tr; SSUBM407_1549.
DR   EnsemblGenomes-Tr; SSUBM407_1609.
DR   EnsemblGenomes-Tr; SSUBM407_1667.
DR   EnsemblGenomes-Tr; SSUBM407_1731.
DR   EnsemblGenomes-Tr; SSUBM407_1739.
DR   EnsemblGenomes-Tr; SSUBM407_1761.
DR   EnsemblGenomes-Tr; SSUBM407_1764.
DR   EnsemblGenomes-Tr; SSUBM407_1794.
DR   EnsemblGenomes-Tr; SSUBM407_1804.
DR   EnsemblGenomes-Tr; SSUBM407_1809.
DR   EnsemblGenomes-Tr; SSUBM407_1943.
DR   EnsemblGenomes-Tr; SSUBM407_1944.
DR   EnsemblGenomes-Tr; SSUBM407_1952.
DR   EnsemblGenomes-Tr; SSUBM407_1954.
DR   EnsemblGenomes-Tr; SSUBM407_r0001-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0002-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0003-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0004-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0005-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0006-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0007-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0008-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0009-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0010-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0011-1.
DR   EnsemblGenomes-Tr; SSUBM407_r0012-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0001-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0002-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0003-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0004-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0005-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0006-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0007-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0008-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0009-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0010-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0011-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0012-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0013-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0014-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0015-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0016-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0017-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0018-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0019-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0020-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0021-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0022-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0023-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0024-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0025-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0026-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0027-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0028-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0029-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0030-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0031-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0032-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0033-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0034-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0035-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0036-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0037-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0038-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0039-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0040-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0041-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0042-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0043-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0044-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0045-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0046-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0047-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0048-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0049-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0050-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0051-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0052-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0053-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0054-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0055-1.
DR   EnsemblGenomes-Tr; SSUBM407_t0056-1.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC2935014; 20585133.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3194845; 21784909.
DR   EuropePMC; PMC3227697; 22026465.
DR   EuropePMC; PMC3486358; 23105076.
DR   EuropePMC; PMC3623174; 23416996.
DR   EuropePMC; PMC3837959; 24078615.
DR   EuropePMC; PMC4735348; 26870017.
DR   EuropePMC; PMC5073339; 27767072.
DR   EuropePMC; PMC5524971; 28740169.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FM252032.
DR   SILVA-SSU; FM252032.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2146229
FT                   /organism="Streptococcus suis BM407"
FT                   /strain="BM407"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam:Ho Chi Minh City"
FT                   /isolation_source="human case of meningitis"
FT                   /collection_date="2004"
FT                   /db_xref="taxon:568814"
FT   CDS_pept        38..1372
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUBM407_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0001"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54833"
FT                   /db_xref="GOA:A0A0H3MSE8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSE8"
FT                   /protein_id="CAZ54833.1"
FT                   /translation="MAKVNFKPSIYDFYVADAKLLGINQQVANIFLNRPFKKDFWEKNF
FT                   EELMIAASFESYGEPLTIQYQFTEDEQEIRNTTNTRSSIVHQVQTLEPATPQETFKPVH
FT                   SDIKSQYTFANFVQGDNNHWAKAAALAVSDNLGELYNPLFIFGGPGLGKTHILNAIGNK
FT                   VLADNPQARIKYVSSETFINEFLEHLRLNDMESFKKTYRNLDLLLIDDIQSLRNKATTQ
FT                   EEFFHTFNALHEKNKQIVLTSDRNPDHLDNLEERLVTRFKWGLTSEITPPDFETRIAIL
FT                   RNKCENLPYNFTNETLSYLAGQFDSNVRDLEGALKDIHLIATMRQLSEISVEVAAEAIR
FT                   SRKQTNPQNMVIPIEKIQTEVGNFYGVSLKELKGSKRVQHIVHARQVAMFLAREMTDNS
FT                   LPKIGKEFGNRDHTTVMHAYNKIKTLLLDDENLEIEITSIKNKLR"
FT   misc_feature    356..1012
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUBM407_0001"
FT                   /note="HMMPfam hit to PF00308, Bac_DnaA, score 6e-111"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    1094..1303
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUBM407_0001"
FT                   /note="HMMPfam hit to PF08299, Bac_DnaA_C, score 3.9e-33"
FT                   /inference="protein motif:HMMPfam:PF08299"
FT   misc_feature    1244..1303
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SSUBM407_0001"
FT                   /note="ScanRegExp hit to PS01008, DNAA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01008"
FT   CDS_pept        1526..2662
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SSUBM407_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0002"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54834"
FT                   /db_xref="GOA:A0A0H3MWU9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWU9"
FT                   /protein_id="CAZ54834.1"
FT                   /translation="MIQFSINKNIFLQALSITKRAISTKNAIPILSTVKITVTSEGITL
FT                   TGSNGQISIEHFISIQDENAGLLISSPGSILLEAGFFINVVSSMPDLVLDFNEIEQKQI
FT                   VLTSGKSEITLKGKEAEQYPRLQEVPTSKPLVLETKVLKQTINETAFAASTQESRPILT
FT                   GVHFVLTENKNLKTVATDSHRMSQRKLVLDTSGDDFNVVIPSRSLREFTAVFTDDIETV
FT                   EVFFSNNQILFRSEHISFYTRLLEGTYPDTDRLIPTEFKTTAIFDTANLRHSMERARLL
FT                   SNATQNGTVKLEIANNVVSAHVNSPEVGRVNEELDTVEVSGEDLVISFNPTYLIEALKA
FT                   TTSEQVKISFISSVRPFTLIPNNEGEDFIQLVTPVRTN"
FT   misc_feature    1529..1906
FT                   /gene="dnaN"
FT                   /locus_tag="SSUBM407_0002"
FT                   /note="HMMPfam hit to PF00712, DNA_pol3_beta, score
FT                   1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    1931..2278
FT                   /gene="dnaN"
FT                   /locus_tag="SSUBM407_0002"
FT                   /note="HMMPfam hit to PF02767, DNA_pol3_beta_2, score
FT                   5e-39"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    2282..2653
FT                   /gene="dnaN"
FT                   /locus_tag="SSUBM407_0002"
FT                   /note="HMMPfam hit to PF02768, DNA_pol3_beta_3, score
FT                   3.8e-33"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   CDS_pept        2754..3635
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0003"
FT                   /product="diacylglycerol kinase protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0003"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54835"
FT                   /db_xref="GOA:A0A0H3MSP5"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSP5"
FT                   /protein_id="CAZ54835.1"
FT                   /translation="MTLYILANPNAGSHTAEHIIFKIKESYPQLAVNIFMTVGPEDEKS
FT                   QIEAILKEFVSSEDQLMILGGDGTLSKALRFWPASLPFAYYPTGSGNDFAKAMNITSLY
FT                   RSVDAILERKTSRIYVLNSSYGTVVNSMDFGFAAQVINGSTNSILKKILNKVKLGKLTY
FT                   LFFGIKTLFSKQAINLELTLDEKSYQLDNLFFISVANSLYFGGGIMIWPTASAKKKEVD
FT                   IVYFKNGNFYQRLQSLLALLTKRHESSHTIQHLTGVDVVLKSKEKLLLQIDGETCTANE
FT                   VTLTYQERSMYL"
FT   misc_feature    2757..3125
FT                   /locus_tag="SSUBM407_0003"
FT                   /note="HMMPfam hit to PF00781, DAGK_cat, score 1.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00781"
FT   CDS_pept        3645..3848
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0004"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54836"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1C8"
FT                   /protein_id="CAZ54836.1"
FT                   /translation="MYQLGTFVEMKKPHACVIKSTGKKANKWEVIRLGADIKIRCTNCD
FT                   HVVMMSRHDFERKMKQVLPSEA"
FT   misc_feature    3645..3836
FT                   /locus_tag="SSUBM407_0004"
FT                   /note="HMMPfam hit to PF06107, DUF951, score 4e-44"
FT                   /inference="protein motif:HMMPfam:PF06107"
FT   CDS_pept        3952..4311
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0005"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0005"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54837"
FT                   /db_xref="GOA:A0A0H3MSS4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSS4"
FT                   /protein_id="CAZ54837.1"
FT                   /translation="MKQLAQQIRVLRTAKNLSQDELAEKLYISRQAVSEWENGEATPDI
FT                   DKLVQLAEIFGVSLDYLVLGKEPEKEIVVEQRGKMNGWEFLNEESKRPLTRGDVVLLIF
FT                   LAVMLLGGLFIKHYF"
FT   misc_feature    3973..4137
FT                   /locus_tag="SSUBM407_0005"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 2.2e-20"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    4000..4065
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2317.000, SD 7.08 at aa 17-38, sequence
FT                   LSQDELAEKLYISRQAVSKWEN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    4246..4305
FT                   /locus_tag="SSUBM407_0005"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0005 by TMHMM2.0 at aa 99-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        4397..5512
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0006"
FT                   /product="putative GTP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0006"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54838"
FT                   /db_xref="GOA:A0A0H3MSF4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSF4"
FT                   /protein_id="CAZ54838.1"
FT                   /translation="MSLTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELIIPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKDS
FT                   VAEFAVLEKIKPVLEDGKSARTVEFTDEEQKIVKQLFLLTTKPVLYVANVDEDKVADPE
FT                   AISYVQQIRDFAATENAEVVVISARAEEEISELDDEDKGEFLEALGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGMKAPQCAGIIHSDFEKGFIRAVTMSYDDLMTYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   misc_feature    4403..4861
FT                   /locus_tag="SSUBM407_0006"
FT                   /note="HMMPfam hit to PF01926, MMR_HSR1, score 4.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    5255..5506
FT                   /locus_tag="SSUBM407_0006"
FT                   /note="HMMPfam hit to PF06071, DUF933, score 6.4e-62"
FT                   /inference="protein motif:HMMPfam:PF06071"
FT   CDS_pept        5670..6239
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SSUBM407_0007"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0007"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54839"
FT                   /db_xref="GOA:A0A0H3MWV5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWV5"
FT                   /protein_id="CAZ54839.1"
FT                   /translation="MTRLIIGLGNPGDRYFETKHNVGFMLLDKIAKRENVTFNHDKIFQ
FT                   ADIATTFIDGEKIYLVKPTTFMNESGKAVHALMTYYGLDATDILVAYDDLDMAVGKIRF
FT                   RQKGSAGGHNGIKSIVKHIGTQEFDRIKIGIGRPKGKMSVVNHVLSGFDIEDRIEIDLA
FT                   LDKLDKAVNVYLEEDDFDTVMRKFNG"
FT   misc_feature    5679..6233
FT                   /gene="pth"
FT                   /locus_tag="SSUBM407_0007"
FT                   /note="HMMPfam hit to PF01195, Pept_tRNA_hydro, score
FT                   4.1e-79"
FT                   /inference="protein motif:HMMPfam:PF01195"
FT   misc_feature    5712..5753
FT                   /gene="pth"
FT                   /locus_tag="SSUBM407_0007"
FT                   /note="ScanRegExp hit to PS01195, PEPT_TRNA_HYDROL_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01195"
FT   misc_feature    5994..6026
FT                   /gene="pth"
FT                   /locus_tag="SSUBM407_0007"
FT                   /note="ScanRegExp hit to PS01196, PEPT_TRNA_HYDROL_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS_pept        6239..9733
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SSUBM407_0008"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0008"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54840"
FT                   /db_xref="GOA:A0A0H3MSQ1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSQ1"
FT                   /protein_id="CAZ54840.1"
FT                   /translation="MNILDLLHKNKQINQWQSGLNQSTRQLLLGLSGTSKSLIMATAYD
FT                   CLAEKIMIVTATQNDAEKLVADLTAIIGSENVYNFFTDDSPIAEFVFASKERTQSRIDS
FT                   LNFLTDSTSSGILVASIVACRVLLPSPETYKGSKIQLEVGQEIEVDKLVKNLVNIGYKK
FT                   VSRVLTQGEFSQRGDILDIFDMQSETPYRIEFFGDEIDGIRIFDVDSQKSLENLDEISI
FT                   SPASDIILSSEDYSRASQYIQTAIEQSTLEEQQSYLREVLADMQTEYRHPDLRKFLSCI
FT                   YEQSWTLLDYLPKSSPLFLDDFHKIADKQAQFEKEIADLLTDDLQKGKTVSSLKYFAST
FT                   YAELRKYKPATFFSSFQKGLGNVKFDALYQFTQHPMQEFFHQIPLLKDELTRYAKSNNT
FT                   VVIQASSDVSLQTLQKNLQEYDIHLPVHAADKLVEGQQQVTIGQLASGFHLMDEKLVFI
FT                   TEKEIFNKKMKRKTRRTNISNAERIKDYSELAVGDYVVHHVHGIGQYLGIETIEISGIH
FT                   RDYLTVQYQNSDRISIPVEQIDLLSKYLASDGKAPKVNKLNDGRFQRTKQKVQKQVEDI
FT                   ADDLIKLYAERSQLKGFAFSPDDENQVEFDNYFTHVETDDQLRSIDEIKKDMEKDSPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDGKQVAILVPTTVLAQQHYANFQERFAEFPVNVDV
FT                   MSRFKTKAEQEKTLEKLKKGQVDILIGTHRLLSKDVVFADLGLLVIDEEQRFGVKHKER
FT                   LKELKKKIDVLTLTATPIPRTLQMSMLGIRDLSVIETPPTNRYPVQTYVMETNPSVIRD
FT                   AMLREIDRGGQVYYLYNKVDTIEQKVSELKELVPEATIGYVHGQMSEIQLENTLYAFVE
FT                   GEYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSSRIAYAYLMYRP
FT                   DKSLTEVAEKRLEAIKGFTELGSGFKIAMQDLSIRGAGNILGAAQSGFIDSVGYEMYSQ
FT                   LLEQAILEKQGKATQRQKSNSEVNLQIDAYLPSDYIGDQRQKIEIYKRIKNIDSRVNYQ
FT                   ELQEELIDRFGEYPDVVAYLLEIGLLKSFLDQVFCHTVLRRQHQVTVTFEPMAGQIFLT
FT                   QDYFEALSVTNLKAQITENKGKLAVVFNIQQKKEYEILEELISFAEKLKEIKARKAE"
FT   misc_feature    7700..7993
FT                   /gene="trcF"
FT                   /locus_tag="SSUBM407_0008"
FT                   /note="HMMPfam hit to PF02559, CarD_TRCF, score 2.4e-52"
FT                   /inference="protein motif:HMMPfam:PF02559"
FT   misc_feature    8078..8572
FT                   /gene="trcF"
FT                   /locus_tag="SSUBM407_0008"
FT                   /note="HMMPfam hit to PF00270, DEAD, score 5.2e-41"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    8762..8995
FT                   /gene="trcF"
FT                   /locus_tag="SSUBM407_0008"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 2.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    9275..9601
FT                   /gene="trcF"
FT                   /locus_tag="SSUBM407_0008"
FT                   /note="HMMPfam hit to PF03461, TRCF, score 5.3e-36"
FT                   /inference="protein motif:HMMPfam:PF03461"
FT   CDS_pept        9783..10055
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0009"
FT                   /product="S4 domain containing protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0009"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54841"
FT                   /db_xref="GOA:A0A0H3N1D3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1D3"
FT                   /protein_id="CAZ54841.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIQFGNKLLTVKVLEMKDSTKKEDALKMYEIISEKRIEKDEEI"
FT   misc_feature    9783..9923
FT                   /locus_tag="SSUBM407_0009"
FT                   /note="HMMPfam hit to PF01479, S4, score 8.9e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        10042..10410
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0010"
FT                   /product="putative septum formation initiator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0010"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54842"
FT                   /db_xref="GOA:A0A0H3MSS9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSS9"
FT                   /protein_id="CAZ54842.1"
FT                   /translation="MKKSKILQLNNAFIQSERKKTQHQLAERQQKNRFMGAILILVIFL
FT                   FMLPAYNLVGTYTNIQQQEKKLAELEKNYEELTKEQKQEAEMVAKLKNEEYAAKYVRAK
FT                   YQYSKEGEFVYNIPGLPK"
FT   misc_feature    10153..10221
FT                   /locus_tag="SSUBM407_0010"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0010 by TMHMM2.0 at aa 38-60"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    10165..10401
FT                   /locus_tag="SSUBM407_0010"
FT                   /note="HMMPfam hit to PF04977, DivIC, score 3.6e-16"
FT                   /inference="protein motif:HMMPfam:PF04977"
FT   CDS_pept        10407..10520
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0011"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54843"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSF9"
FT                   /protein_id="CAZ54843.1"
FT                   /translation="MTESIFKIVEQFLQHSDEKLEELNQKNRELKLEENES"
FT   CDS_pept        10533..11813
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0012"
FT                   /product="putative exported protein"
FT                   /EC_number="3.5.2.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0012"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54844"
FT                   /db_xref="GOA:A0A0H3MWW4"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWW4"
FT                   /protein_id="CAZ54844.1"
FT                   /translation="MQKKLLVWLLPVLFGWQVVDSTEIPFELTAQEEYELTHTIYDQYF
FT                   QTIPQNPNVFQTENLYSDEELTIAGGQLQPNQHFSITDVLVNSKKELVFQIDDKGYILA
FT                   SRHLLFDDVIVTETTVEQTYWTKKGFTLLTSPIANEATEIKNDLQPYQAVMVSKIVTTS
FT                   LGDFAYVTDKGWIAVNNLSKTDNRVEAVQELLTNKYSKDTIGIYVKQLSTGQTAGVNQE
FT                   KLFYSASIAKLPILYYVQEQLNAGYIDLTTKVKYTAESISFPGAYVAGGSGSLSKTPDN
FT                   KDYSVEELINKTAKESDNVASNLLSYYVANKFDSNFYQVITAKTGSEWSMVTRETSAEI
FT                   AGKMMEALYIQNGYVLESLLSTQFDNQRISKDISVPVAHKIGDADDVKHDVAIVYAGSP
FT                   FVLSIFTDKSNYDEITQIANDIYRILK"
FT   CDS_pept        11814..13082
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0013"
FT                   /product="PP-loop family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0013"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54845"
FT                   /db_xref="GOA:A0A0H3MSQ7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSQ7"
FT                   /protein_id="CAZ54845.1"
FT                   /translation="MKDRFLKVTLDGHFFDKHKKVLVAVSGGLDSMNLFHLLYECKQVL
FT                   GIELGIAHINHGQREESVIEEKYLRQLAEESNVPFYLSYFEGVFSEEAARKWRYGFFAT
FT                   IMEKEGYTALVTAHHADDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKK
FT                   ADFEKLFHFEDCSNADFKYFRNRVRNDYLPKLKQENPKIELTLNNLAVDTNNLFQALRD
FT                   LTQDLSVTDVMSFQQQTPAVQSYLLEEYLEKFPDLQLSRPQFNEVLHILRSKANYYHLL
FT                   KNDYMLEKDYHRFQIYKIGPETDSQPEKIMIESEGIFSYGSYIFSLNHPLEEADSILYF
FT                   PTENPIVVRRRQAGDTILINGVNKKLRRWFIDNKISQKVRQNALIIEQNGEIYGITNLV
FT                   SSDLSKSVKNDIIKATLYIKMKE"
FT   misc_feature    11871..12383
FT                   /locus_tag="SSUBM407_0013"
FT                   /note="HMMPfam hit to PF01171, ATP_bind_3, score 1.4e-78"
FT                   /inference="protein motif:HMMPfam:PF01171"
FT   CDS_pept        13090..13632
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SSUBM407_0014"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0014"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54846"
FT                   /db_xref="GOA:A0A0H3N1D8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1D8"
FT                   /protein_id="CAZ54846.1"
FT                   /translation="MLDKDIKKILVSEEEIVAKCKELGQILATDYADKNPILVGILKGS
FT                   IPFMAELMKHIDAHVETDYMVVSSYHGGTESCGTVKIIKDLDNSVAGRHIIFVEDIIDT
FT                   GRTLKELKELFALRQAASIKIATLLDKPEGRVVEIEPDYTCFTIPNEFVVGFGLDYDEN
FT                   YRNLPYVGVLKEEVYTK"
FT   misc_feature    13102..13536
FT                   /gene="hpt"
FT                   /locus_tag="SSUBM407_0014"
FT                   /note="HMMPfam hit to PF00156, Pribosyltran, score 1.7e-31"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS_pept        13654..15627
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /product="putative cell division protease FtsH"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0015"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54847"
FT                   /db_xref="GOA:A0A0H3MST3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MST3"
FT                   /protein_id="CAZ54847.1"
FT                   /translation="MNNQPNKGFIKNPFLIILVIATIVTAFQFFNAGQQVATQEISYSQ
FT                   VVTELKNNNVSEITYQPNSSVIEITGKYKTEQEAKDELASSIKLFQVSSKVKYKNFKSL
FT                   ILPSETNLSELQALANENGVKVAIKPESSNGLWLNIIFNLLPLVIAGVFFMMMMNQGGG
FT                   GARGAMNFGRNKAKALEQSNIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIP
FT                   AGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAA
FT                   PAIIFIDEIDAVGRQRGVGMGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVL
FT                   DPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAADVDLKLVAQQTPGFVGADLE
FT                   NVLNEAALVAARRNKTVIDASDIDEAEDRVIAGPSKKDRQVSAKEREIVAYHEAGHTIV
FT                   GLVLSNAREVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIF
FT                   NTQTTGASNDFEQATQMARAMVAEYGMSDKMGPMQYEGSHAMFGGQTTQKHISEQTAYE
FT                   LDNEVRDLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSVQIKSLYETGKMPENIE
FT                   RDDEDVHPLSYEEVKEKINTKE"
FT   sig_peptide     13654..13767
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /note="Signal peptide predicted for SSUBM407_0015 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.974) with
FT                   cleavage site probability 0.589 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(13696..13752,14056..14124)
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0015 by TMHMM2.0 at aa 15-33 and 135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    13768..14247
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /note="HMMPfam hit to PF06480, FtsH_ext, score 1.4e-30"
FT                   /inference="protein motif:HMMPfam:PF06480"
FT   misc_feature    14323..14886
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /note="HMMPfam hit to PF00004, AAA, score 4.9e-98"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    14635..14691
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /note="ScanRegExp hit to PS00674, AAA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    14905..15525
FT                   /gene="ftsH"
FT                   /locus_tag="SSUBM407_0015"
FT                   /note="HMMPfam hit to PF01434, Peptidase_M41, score
FT                   2.2e-104"
FT                   /inference="protein motif:HMMPfam:PF01434"
FT   CDS_pept        15965..16435
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="SSUBM407_0016"
FT                   /product="putative competence-specific global transcription
FT                   modulator"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0016"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSG8"
FT                   /protein_id="CAZ54848.1"
FT                   /translation="MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEA
FT                   QPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKRKFDRMPHEDIYELSHAIQSPGLIN
FT                   DELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR"
FT   rRNA            16975..18518
FT                   /locus_tag="SSUBM407_r0001"
FT                   /note="16S rRNA"
FT   tRNA            18570..18642
FT                   /locus_tag="SSUBM407_t0001"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:18603..18605,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            18923..21826
FT                   /locus_tag="SSUBM407_r0002"
FT                   /note="23S rRNA"
FT   rRNA            21904..22032
FT                   /locus_tag="SSUBM407_r0003"
FT                   /note="5S rRNA"
FT   tRNA            22033..22105
FT                   /locus_tag="SSUBM407_t0002"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:22066..22068,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            22108..22180
FT                   /locus_tag="SSUBM407_t0003"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:22141..22143,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            22226..22298
FT                   /locus_tag="SSUBM407_t0004"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:22259..22261,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.85"
FT   tRNA            22302..22383
FT                   /locus_tag="SSUBM407_t0005"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:22336..22338,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 45.48"
FT   tRNA            22398..22470
FT                   /locus_tag="SSUBM407_t0006"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:22431..22433,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            22483..22554
FT                   /locus_tag="SSUBM407_t0007"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:22515..22517,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            22562..22645
FT                   /locus_tag="SSUBM407_t0008"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:22596..22598,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 51.48"
FT   tRNA            22664..22737
FT                   /locus_tag="SSUBM407_t0009"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:22698..22700,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 72.48"
FT   tRNA            22785..22858
FT                   /locus_tag="SSUBM407_t0010"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:22819..22821,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   tRNA            22871..22944
FT                   /locus_tag="SSUBM407_t0011"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:22905..22907,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 69.60"
FT   tRNA            22961..23034
FT                   /locus_tag="SSUBM407_t0012"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:22995..22997,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 81.31"
FT   tRNA            23041..23130
FT                   /locus_tag="SSUBM407_t0013"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:23077..23079,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            23141..23214
FT                   /locus_tag="SSUBM407_t0014"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:23175..23177,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            23230..23302
FT                   /locus_tag="SSUBM407_t0015"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:23263..23265,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            23334..23407
FT                   /locus_tag="SSUBM407_t0016"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:23368..23370,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.63"
FT   tRNA            23420..23507
FT                   /locus_tag="SSUBM407_t0017"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:23454..23456,aa:Ser)"
FT                   /note="tRNA Ser anticodon GCT, Cove score 31.75"
FT   CDS_pept        23567..24403
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0017"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0018"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54849"
FT                   /db_xref="GOA:A0A0H3MWX2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWX2"
FT                   /protein_id="CAZ54849.1"
FT                   /translation="MNKFSKLVVVVSIFLLLSFSLLFVTFSKGLQVPYLNNIVRVVVTP
FT                   IQSVISVPTRFFSEQKDVLTDLMNAYEENKQLKETIMSLEGMAAENTSLKEENASLRSS
FT                   LGVVSDFPEKQLIPGSVLVRTPSSWSEHISINIGETSGVTYNALVVANGGLVGIVSSLS
FT                   SDSAVVTLFTNSDEFTKLPVKISVDSKEIYGILSGYDADTNSFIINQLNSADEIAVGSN
FT                   VVTSDLAGATPANVQIGKVLSVKSNSNSLNREVYVEPTASFSNIYSVLVVGQTNAQ"
FT   sig_peptide     23567..23653
FT                   /locus_tag="SSUBM407_0017"
FT                   /note="Signal peptide predicted for SSUBM407_0017 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.685 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    23585..23644
FT                   /locus_tag="SSUBM407_0017"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0017 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    23921..24394
FT                   /locus_tag="SSUBM407_0017"
FT                   /note="HMMPfam hit to PF04085, MreC, score 2.2e-31"
FT                   /inference="protein motif:HMMPfam:PF04085"
FT   CDS_pept        24393..24908
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0018"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0019"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54850"
FT                   /db_xref="GOA:A0A0H3MSR1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSR1"
FT                   /protein_id="CAZ54850.1"
FT                   /translation="MRNKMIEIFMFPILFFILLLDGQISTLVTNWSVGLFTISSHLVLM
FT                   LAIFYANYVSLGFSLFIFTLLGLVYDISYLNLIGIATTTLPLVLYCIYFFFQGAVSKRG
FT                   INILILLVAIFQFEFISYSFARIFHITNLSVFIFVFNKLLPSLLFNLVLFFVLQPLFER
FT                   LFGITNKT"
FT   misc_feature    join(24405..24473,24531..24599,24612..24680,24708..24776,
FT                   24795..24863)
FT                   /locus_tag="SSUBM407_0018"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0018 by TMHMM2.0 at aa 5-27, 47-69, 74-96, 106-128
FT                   and 135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        24993..26249
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0019"
FT                   /product="putative amidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0020"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54851"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1E3"
FT                   /protein_id="CAZ54851.1"
FT                   /translation="MKKKILATIMLSTVVLSNANYVAVISANDVDSQIATKNQQISELT
FT                   AQQAEAQQQVDAIQGQVDAIVSEQAKLTEENTRLEAESQTLAADIERLSADIVSRDGAL
FT                   KEQARSAQVDGSASSYINTILDSKSIIDAVSRVNAMREIISANNRMLEQQKADKEAIVE
FT                   KQKANQEAITTLAANRQKLEDDAQVLQVRQAELEAAKLNLAVQKATAEDEKNSLLVQKA
FT                   AAEEAARQAAARQAEYQAQQAALAQQQVASVSAPVVSTLVETTVTETVAAPTQTVSQST
FT                   PTVSTPTTSTSSGSGSSAAANNARYDASSYPVGECTWGVKSQLSWVGPYWGDAKQWLAS
FT                   ARAEGFSTGSTPQVGAIAVWTGGYYGHVAVVTAVQSSTSIQVVESNYMGRRYIGNHRGG
FT                   YFNPTTTSEGAVYYIYPPY"
FT   sig_peptide     24993..25073
FT                   /locus_tag="SSUBM407_0019"
FT                   /note="Signal peptide predicted for SSUBM407_0019 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.995) with
FT                   cleavage site probability 0.891 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    25878..26237
FT                   /locus_tag="SSUBM407_0019"
FT                   /note="HMMPfam hit to PF05257, CHAP, score 8e-36"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS_pept        26352..27320
FT                   /transl_table=11
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUBM407_0020"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0021"
FT                   /note="Similar to SSU0918, 52.077% identity (52.751%
FT                   ungapped) in 313 aa overlap (5-317:9-317)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54852"
FT                   /db_xref="GOA:A0A0H3MST9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MST9"
FT                   /protein_id="CAZ54852.1"
FT                   /translation="MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQVN
FT                   IEESIRGTHVYILQSTSSPVNDNLMEILIMVDALKRASAESVNVVMPYYGYARQDRKAR
FT                   AREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMV
FT                   GDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEVMNIIGDIKDKTCIL
FT                   IDDMIDTAGTICHAADALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVLDTIEI
FT                   AEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEASRVK"
FT   misc_feature    26739..26786
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUBM407_0020"
FT                   /note="ScanRegExp hit to PS00114, PRPP_SYNTHETASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    26772..27173
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUBM407_0020"
FT                   /note="HMMPfam hit to PF00156, Pribosyltran, score 5.3e-31"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    27009..27047
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SSUBM407_0020"
FT                   /note="ScanRegExp hit to PS00103, PUR_PYR_PR_TRANSFER,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        27407..28585
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0021"
FT                   /product="putative aminotransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0022"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54853"
FT                   /db_xref="GOA:A0A0H3MSH2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSH2"
FT                   /protein_id="CAZ54853.1"
FT                   /translation="MDLLNRFNKNLNRIEVSMIRQFDQSISDVPGILKLTLGEPDFTTP
FT                   DHVKEAAKAAIDADQSYYTGMAGLLELRQAAAEFVAEKYNLHYNPENEILSTIGATEAL
FT                   SASLVAILEAGDTVLLPAPAYPGYEPIVNMVGADIVEIDTTANDFVLTPEMLEEAIIEQ
FT                   GDKLKAVILNYPANPTGVTYSREQIQAFADVLRNYPVFVLSDEVYAELTYTGQPHTSIA
FT                   EFLPEQTILIQGLSKSHAMTGWRIGLIMSQAPIIAQIIKSHQYLVTAASTAMQYGAVEA
FT                   LKNGKDDALPMRAEYVKRRDYIIEKMTDLGFKIIKPDGAFYIFAKIPAGYNQDSFSFLQ
FT                   DFARKKAVAFIPGAAFGQYGEGYVRISYAASMEKIQTAMARLKEYLEENGTN"
FT   misc_feature    27494..28552
FT                   /locus_tag="SSUBM407_0021"
FT                   /note="HMMPfam hit to PF00155, Aminotran_1_2, score
FT                   2.6e-56"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   misc_feature    28106..28147
FT                   /locus_tag="SSUBM407_0021"
FT                   /note="ScanRegExp hit to PS00105, AA_TRANSFER_CLASS_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS_pept        28572..29354
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SSUBM407_0022"
FT                   /product="DNA repair protein RecO"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0023"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54854"
FT                   /db_xref="GOA:A0A0H3MWX5"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWX5"
FT                   /protein_id="CAZ54854.1"
FT                   /translation="MERIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASKSKL
FT                   VASIQPLTYADFIVKINDDGLSYIEDFHQVQPFKNINGDIFKLSYATYILALADAALQD
FT                   KVYDPALFAFLVKTLDLMESGLDYEVLTNIFEIQLLGRFGISLNFHECAFCHRVGLPFA
FT                   YSYKYSGVLCPQHYQQDERRAYLDPNVPYLLDQFQAISFDELETISIKPEMKRKLRFFI
FT                   DQLYEEYVGIHLKSKKFIDDLSSWGQIMKPRTENEETE"
FT   misc_feature    28572..29309
FT                   /gene="recO"
FT                   /locus_tag="SSUBM407_0022"
FT                   /note="HMMPfam hit to PF02565, RecO, score 1.8e-20"
FT                   /inference="protein motif:HMMPfam:PF02565"
FT   CDS_pept        29351..30358
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SSUBM407_0023"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0024"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54855"
FT                   /db_xref="GOA:A0A0H3MSR5"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSR5"
FT                   /protein_id="CAZ54855.1"
FT                   /translation="MKRIAVDAMGGDHAPQAVVEGVNQALAAFPDIEIQLYGDEAKIKQ
FT                   YLTATERVSIVHTTEKINSDDEPVKAIRRKKEASMVLATKAVKDGQADAVLSAGNTGAL
FT                   LAAGVFVVGRIKNIDRPGLMSTLPTMDGKGFDMMDLGANAENIAHHLYQYGILGSFYAE
FT                   HVRGVKQPRVGLLNNGTEDTKGTPVHQEAYKLLAEDKSINFIGNVEARELLNSVADVVV
FT                   TDGFTGNAVLKTIEGTAKSIVGQLTGSIKNGGLRAKLGGLLVKPTLKKALGAMDYKTAG
FT                   GAVLLGLKAPVIKAHGSSDAQSIFYTIKQTRSILEAGIVEKSVAKFSVVEESHD"
FT   misc_feature    29354..30316
FT                   /gene="plsX"
FT                   /locus_tag="SSUBM407_0023"
FT                   /note="HMMPfam hit to PF02504, FA_synthesis, score
FT                   4.9e-135"
FT                   /inference="protein motif:HMMPfam:PF02504"
FT   CDS_pept        30351..30599
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0024"
FT                   /product="putative acyl carrier protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0025"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54856"
FT                   /db_xref="GOA:A0A0H3N1E6"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1E6"
FT                   /protein_id="CAZ54856.1"
FT                   /translation="MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFV
FT                   LNLEDEFHVDVPDAAIEHFEVLSDIVDFIYKEVKKRS"
FT   CDS_pept        30717..31424
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SSUBM407_0025"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0026"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54857"
FT                   /db_xref="GOA:A0A0H3MSU5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSU5"
FT                   /protein_id="CAZ54857.1"
FT                   /translation="MKTDLLYSGKAKDIYATADSDQIVAVYKDQATAFNGGKKEQIVGK
FT                   GRLNNLISSLIFEKLNEAGVPTHFIKRLSDSEQLNKKVEIIPLEVVLRNVTAGSFSKRF
FT                   GVEEGITLSTPIVEFYYKKDELDDPFINDEHIAFLELASQDQIAYIKEETRRINEFLKD
FT                   LFAQIGLTLVDFKLEFGIDSSGQILLADEFSPDNCRLWDADGNHLDKDVFRRGLGELTE
FT                   VYEVVLAKLQEVK"
FT   misc_feature    30720..31421
FT                   /gene="purC"
FT                   /locus_tag="SSUBM407_0025"
FT                   /note="HMMPfam hit to PF01259, SAICAR_synt, score 5e-118"
FT                   /inference="protein motif:HMMPfam:PF01259"
FT   misc_feature    30969..31013
FT                   /gene="purC"
FT                   /locus_tag="SSUBM407_0025"
FT                   /note="ScanRegExp hit to PS01057, SAICAR_SYNTHETASE_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01057"
FT   misc_feature    31230..31256
FT                   /gene="purC"
FT                   /locus_tag="SSUBM407_0025"
FT                   /note="ScanRegExp hit to PS01058, SAICAR_SYNTHETASE_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01058"
FT   misc_feature    31248..31295
FT                   /gene="purC"
FT                   /locus_tag="SSUBM407_0025"
FT                   /note="ScanRegExp hit to PS00012, PHOSPHOPANTETHEINE, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS_pept        31437..35156
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0026"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase protein"
FT                   /EC_number="6.3.5.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0027"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54858"
FT                   /db_xref="GOA:A0A0H3MSH7"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSH7"
FT                   /protein_id="CAZ54858.1"
FT                   /translation="MAKRIFVEKKAAFQIKAEALRKELTHNLQLTSLSSLRLVQVYDVF
FT                   NLEEDLLEQAIKHIFTEQVTDKVLSDEELGLEGAVYFAIEALPGQFDQRAASSQEALLL
FT                   LGSRQEVRVNTGQLYILNGDVQEEELVAIKNYLLNPVDSRFKDMDAPLVAQEFSVSDTV
FT                   IPSLDFFDSYGVEEFASYKREAGLAMEVEDLLFIQDYFKSIGRVPTETELKVLDTYWSD
FT                   HCRHTTFETELRSIDFSASKFQKQLQATYDKYLAMRTELGRTDKPQTLMDIATIFGRYE
FT                   RANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATCIG
FT                   GAIRDPLSGRSYVYQAMRISGAGDITQPLTATRSGKLPQQIISKTAAHGYSSYGNQIGL
FT                   ATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPVAGDVVILLGGKTGRDGIGGAT
FT                   GSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGAVTRLIKKSNDFGAGGVCVAIGE
FT                   LADGLEIDLDKVPLKYAGLNGTEIAISESQERMSVVVRPEDVDAFIAACRQENIHAVVV
FT                   AKVTEKPNLVMTWNGQTIVDLERSFLDTNGVRVVVDAKVVDSPVNLPETRTTSAQTLRE
FT                   DLKDLLSDLNHASQKGLQTIFDSSVGRSTVNHPLGGRHQLTPTESSVQKLPVQQGVTTT
FT                   ASVMAQGYHPYLADWSPYHGAAYAVIEATARLVATGANWSKARFSYQEYFQRMDKQAER
FT                   FGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPTLVAFGVTTADSCKVLSPE
FT                   FKATGEHIYYLPGQILSEDIDFTLIKSNFKAFEKWQSDYVITAASAVKYGGVLESLALM
FT                   SFGNQVGARVELADFETSLTGQLGGFVFTSQEDIPDAVKIGQTTTDFTLVVNGVNLSGQ
FT                   DLQVAFEGKLEEVYPTEFEQATELQDVPAVTSSAVIKAKETVEVPVVYIPVFPGTNSEY
FT                   DSAKAFEQAGAKVNLVPFVTLDAESIENSVDTMVDNIAKANILFFAGGFSAADEPDGSA
FT                   KFIVTILRNAKVRSAIDQFIEKRGLIIGICNGFQALVKSGLLPYGNFEEAGDTSPTLFY
FT                   NDANQHIAKMVETRIANVNSPWLAGVQVGDIHAIPVSHGEGKFVVTDEEFATLRDNGQI
FT                   FSQYVDFTGQPSMDSKYNPNGSSHAIEGITSRNGQIIGKMGHSERYEDGLFQNIPGKKD
FT                   QGLFVSAVRYFTGK"
FT   misc_feature    32370..32471
FT                   /locus_tag="SSUBM407_0026"
FT                   /note="HMMPfam hit to PF00586, AIRS, score 5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    32745..33206
FT                   /locus_tag="SSUBM407_0026"
FT                   /note="HMMPfam hit to PF02769, AIRS_C, score 5e-35"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   misc_feature    33633..33707
FT                   /locus_tag="SSUBM407_0026"
FT                   /note="ScanRegExp hit to PS01159, WW_DOMAIN_1, score NA"
FT                   /inference="protein motif:Prosite:PS01159"
FT   CDS_pept        35159..36613
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SSUBM407_0027"
FT                   /product="putative amidophosphoribosyltransferase
FT                   precursor"
FT                   /EC_number="2.4.2.14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0028"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54859"
FT                   /db_xref="GOA:A0A0H3MWY1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWY1"
FT                   /protein_id="CAZ54859.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIL
FT                   ANDGGQLCRHRGTGLIAEVFKNPADLEALTGTAAIGHVRYATSGSASINNIQPFLFDFA
FT                   DMQVGLAHNGNLTNAVSLKAELEKNGSIFSSSSDTEILMHLIRRSHNPDFMGKIKEALN
FT                   TVKGGFAYLILLEDKLVAALDPNGFRPLSIGKMKNGAWVVASETCAFEVVGADWVRDVE
FT                   PGEIVVIDDSGIQYDSYTRDTQLAVCSMEYVYFARPDSVIHGVNVHTARKNMGRRLAQE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSSVVKGKRVVMIDDSIVRGTTSRRIVQLLRDAGAKEVHVAIGSPELKYPCFYGID
FT                   IQTRRELISANHTVEEVCEIIGADSLTYLSLEGMIEAIGIETDAPKGGLCVAYFDGEFP
FT                   TPLYDYEEEYLRSLEEKTSFYIENVK"
FT   misc_feature    35159..35206
FT                   /gene="purF"
FT                   /locus_tag="SSUBM407_0027"
FT                   /note="ScanRegExp hit to PS00443, GATASE_TYPE_II, score NA"
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    35192..35779
FT                   /gene="purF"
FT                   /locus_tag="SSUBM407_0027"
FT                   /note="HMMPfam hit to PF00310, GATase_2, score 9.9e-43"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    35924..36361
FT                   /gene="purF"
FT                   /locus_tag="SSUBM407_0027"
FT                   /note="HMMPfam hit to PF00156, Pribosyltran, score 2.7e-07"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    36215..36253
FT                   /gene="purF"
FT                   /locus_tag="SSUBM407_0027"
FT                   /note="ScanRegExp hit to PS00103, PUR_PYR_PR_TRANSFER,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS_pept        36669..37691
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SSUBM407_0028"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0029"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54860"
FT                   /db_xref="GOA:A0A0H3MSR9"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSR9"
FT                   /protein_id="CAZ54860.1"
FT                   /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERLGVMGALGGFGG
FT                   MFDLTKLDVKEPVLVSGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNEPAKLEQVVAGVAEGCVQAGCGLIGGETAEMPGMYGEDDYDLAGFAVGIA
FT                   EKSQIIDGSKVQEGDILLGLASSGIHSNGYSLVRRVFADVSGDALLPELNGRALKDVLL
FT                   EPTRIYVQQVLPLVKAGLVNGIAHITGGGFIENVPRMFADNLAAEIEEDKIPVLPIFTA
FT                   LETYGQIKHEEMFEIFNMGIGMVLAVSPGKVEKVRELVGEEVYEIGRIITKEDKSVVIK
FT                   "
FT   misc_feature    36675..37160
FT                   /gene="purM"
FT                   /locus_tag="SSUBM407_0028"
FT                   /note="HMMPfam hit to PF00586, AIRS, score 2.4e-70"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    37191..37688
FT                   /gene="purM"
FT                   /locus_tag="SSUBM407_0028"
FT                   /note="HMMPfam hit to PF02769, AIRS_C, score 1.8e-46"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   CDS_pept        37688..38239
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SSUBM407_0029"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0030"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54861"
FT                   /db_xref="GOA:A0A0H3N1F0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1F0"
FT                   /protein_id="CAZ54861.1"
FT                   /translation="MKRIAVFASGNGSNFQVIAEQFEVAFVFSDRRNAYVLERAEKLGV
FT                   PTFAFELKEFADKQAYEEAIIQLLDQHQIDLVVLAGYMKIVGPTLLAQYEGRIINIHPA
FT                   YLPEFPGAHGIEDAWNAGVAESGVTVHWVDSGIDTGQIIKQVRVPRLADDILETFEARI
FT                   HEAEYQLYPAVLEELGAVKK"
FT   misc_feature    37691..38212
FT                   /gene="purN"
FT                   /locus_tag="SSUBM407_0029"
FT                   /note="HMMPfam hit to PF00551, Formyl_trans_N, score
FT                   1.4e-60"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   CDS_pept        38249..39796
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SSUBM407_0030"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase; IMP cyclohydrolase]"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0031"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54862"
FT                   /db_xref="GOA:A0A0H3MSV0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSV0"
FT                   /protein_id="CAZ54862.1"
FT                   /translation="MTKRALISVSDKNGIVEFAQELTKLGWEIISTGGTKVALDNAGVA
FT                   TIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDHEIGLIDLVVVNLYP
FT                   FKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYPTVLGEIAEQGQT
FT                   TYPTRQRLAAKVFRHTAAYDALIADYFTKQVGEDKPEKLTITYDLNQPMRYGENPQQNA
FT                   DFYQNALPTDYSIAAAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALKHMNPCGI
FT                   GQAETIEKAWDYAYEADPVSIFGGIVVLNREVDAATAEKMHPIFLEIIIAPSYSAEALA
FT                   ILTNKKKNLRILELAFDAQDASEVEKEFTGVVGGLLVQDQDVVVESPADWQVVTERQPS
FT                   EQEWAAMEFAWKSSKYVKSNGIIITNDKMTLGVGPGQTNRVASVRIAIEQAKDRLEGAV
FT                   LASDAFFPFADNVEEIAAAGIKAIIQPGGSVRDQDSIDMANKYGLTMVFTGVRHFRH"
FT   misc_feature    38288..38635
FT                   /gene="purH"
FT                   /locus_tag="SSUBM407_0030"
FT                   /note="HMMPfam hit to PF02142, MGS, score 4.4e-56"
FT                   /inference="protein motif:HMMPfam:PF02142"
FT   misc_feature    38648..39598
FT                   /gene="purH"
FT                   /locus_tag="SSUBM407_0030"
FT                   /note="HMMPfam hit to PF01808, AICARFT_IMPCHas, score
FT                   4.8e-148"
FT                   /inference="protein motif:HMMPfam:PF01808"
FT   CDS_pept        39922..41184
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SSUBM407_0031"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0032"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54863"
FT                   /db_xref="GOA:A0A0H3MSI4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSI4"
FT                   /protein_id="CAZ54863.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESEQVEQVFVAPGNDGMTLDGIELV
FT                   NIGISEHSAIINFAKENDVAWTFVGPDDALAAGIVDDFEQAGLKAFGPSRLAAELEWSK
FT                   DFAKQIMVKYGIPTAAFGTFSNFEEAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAREMLLDNKFGDSGARVVIEEFLAGEEFSLFALVNGDQFYILPTAQDHKRAFDGDQ
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPILEGMIADGRSYLGVLYAGLILTDQGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNIDDILHKRPTQLTWLDSGVTLGVVVASNGYPL
FT                   DYEKGVELPAKTEGDITTYYAGARFAENSRALLSNGGRVYMLVTTADTVQDAQEKIYSE
FT                   LKNQDTTGLFYRTDIGSKAVK"
FT   misc_feature    39922..40224
FT                   /gene="purD"
FT                   /locus_tag="SSUBM407_0031"
FT                   /note="HMMPfam hit to PF02844, GARS_N, score 8.4e-44"
FT                   /inference="protein motif:HMMPfam:PF02844"
FT   misc_feature    40228..40803
FT                   /gene="purD"
FT                   /locus_tag="SSUBM407_0031"
FT                   /note="HMMPfam hit to PF01071, GARS_A, score 4e-119"
FT                   /inference="protein motif:HMMPfam:PF01071"
FT   misc_feature    40783..40806
FT                   /gene="purD"
FT                   /locus_tag="SSUBM407_0031"
FT                   /note="ScanRegExp hit to PS00184, GARS, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    40900..41178
FT                   /gene="purD"
FT                   /locus_tag="SSUBM407_0031"
FT                   /note="HMMPfam hit to PF02843, GARS_C, score 3.2e-14"
FT                   /inference="protein motif:HMMPfam:PF02843"
FT   CDS_pept        41210..41698
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SSUBM407_0032"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0033"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54864"
FT                   /db_xref="GOA:A0A0H3MWY7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWY7"
FT                   /protein_id="CAZ54864.1"
FT                   /translation="MNIPISIIMGSSSDWKTMKKAADMLDKFGVAYEKKVVSAHRTPDL
FT                   MFRHAEEARGHGFKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALSGVDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDQTIAAQLADFAKEQEKIAEAMTDDLI"
FT   misc_feature    41216..41692
FT                   /gene="purE"
FT                   /locus_tag="SSUBM407_0032"
FT                   /note="HMMPfam hit to PF00731, AIRC, score 1.7e-87"
FT                   /inference="protein motif:HMMPfam:PF00731"
FT   CDS_pept        41685..42764
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SSUBM407_0033"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   ATPase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0034"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54865"
FT                   /db_xref="GOA:A0A0H3MSS3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSS3"
FT                   /protein_id="CAZ54865.1"
FT                   /translation="MTSSKTIGIIGGGQLGQMMAISAIYMGHKVITLDPAADCPASKVS
FT                   EVIVAPYHDVAALKQLAERCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNRIF
FT                   EKDFLAKKAGVQVAPYKVVTSSLDLEGLDLSKNYVLKTATGGYDGHGQKVIREEADLVE
FT                   ASQLANSAECVLEEFVNFDLEISVLVSGNGSDYTVFPVQENIHRNNILYKTIVPARIFD
FT                   ELAEKAKTMALQIADKLHLVGTLCVEMFVAGQEILVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHIRGILGEPLPPIRLLSPAVMINVLGQDMETVQTFLQENPTAHPHFYGKLEAKHNRK
FT                   MGHVTVLGEDAESVEEFEN"
FT   misc_feature    41985..42512
FT                   /gene="purK"
FT                   /locus_tag="SSUBM407_0033"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp, score 1.6e-66"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   CDS_pept        42808..43569
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0034"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0035"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1F4"
FT                   /protein_id="CAZ54866.1"
FT                   /translation="MPLPQKIQEEIKRYCNNHLPNNDWYEKEFDFIHDVSLKNRIIREF
FT                   KSIRYAYKLYEGITAEEEHLIFEIRSQILAYASIYEAVVEYVLETYYSDTQVYDDLVHQ
FT                   NNVMTKIDIPEEKRKKLERELIHLVDNGTKNIEIHTFFYQRKRKASTSIRFDAKCRAAE
FT                   ELNIISKIYQKGNKVVADLPSDIIEIYEYRNAIHLIAEQRKNIDYELELSQRAYRRMKP
FT                   FIEQIKDRLITDNKLIIKNTKDTLTDSSIKN"
FT   CDS_pept        43642..44868
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0035"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0036"
FT                   /note="N-terminal region is similar to Bacillus
FT                   thuringiensis serovar konkukian str. 97-27 hypothetical
FT                   protein. UniProt:Q5LK81 (EMBL:CP000047) (325 aa) fasta
FT                   scores: E()=2.6e-22, 31.858% id in 339 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSV7"
FT                   /protein_id="CAZ54867.1"
FT                   /translation="MLNKEWYFKNFNMVSELDISGEFIYTGISIVNNMDRIAPEMPTEL
FT                   FLALYNISVGVERLQKIILVLWEFDEVDSIEDFSESLKIHNQVELHSRIEKAINKKIFS
FT                   KQECQFLELLKEFYSNARYDRFSAVGNRWEYELISKFFSNNQISYEESVSDSQVILIND
FT                   SIRKLIGRVLSRIVKNYYLLVEEGSNKSGTYSYELRNDSKAQKIFLHMENRRGLSSIKI
FT                   DERIALSEILIYLRNTSDKSSYLKFIEGIYPLDFDKMEISRYLSIILLEDRIPQDLIDE
FT                   IEYIYAEKDIKVGERIENLDLLTKNNMQVTFDYPYLKEVYIILEEVKKQESINDDTISR
FT                   LEESNCYIDDSDTQEIIESIIAVARQYRNNKILKEEFIKEFSSHYKTLEDNYTLSYISN
FT                   LMQLEVRSK"
FT   CDS_pept        44870..46162
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SSUBM407_0036"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0037"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54868"
FT                   /db_xref="GOA:A0A0H3MSJ1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSJ1"
FT                   /protein_id="CAZ54868.1"
FT                   /translation="MIERYSRPEMAAIWSEENKYEAWLEVEILADEAWAELGEIPKEDV
FT                   ALIREKATFDIDRILEIEEETRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTTIIADKAREHKYTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NMERFDVAAKGVEAGKISGAVGNFANIPPFVEEYVCGKLGIRPQEISTQVLPRDLHAEY
FT                   FSALALIATSIERMATEIRGLQKSEQREVEEYFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVVRGHLVTAFENVALWHERDISHSSAERIITPDTTILINYMLNRFGNIVKNLTVFPEN
FT                   MKRNMESTFGLIYSQRVMLSLIEKGMTREEAYDLVQPKTAQSWDNQVDFKPLLEADERV
FT                   TAKLSQEEIDELFNPDYYAKRVDDIFERLGL"
FT   misc_feature    44876..45727
FT                   /gene="purB"
FT                   /locus_tag="SSUBM407_0036"
FT                   /note="HMMPfam hit to PF00206, Lyase_1, score 1.8e-91"
FT                   /inference="protein motif:HMMPfam:PF00206"
FT   misc_feature    45650..45679
FT                   /gene="purB"
FT                   /locus_tag="SSUBM407_0036"
FT                   /note="ScanRegExp hit to PS00163, FUMARATE_LYASES, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS_pept        47099..47827
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0037"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0039"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54869"
FT                   /db_xref="GOA:A0A0H3MWZ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWZ2"
FT                   /protein_id="CAZ54869.1"
FT                   /translation="MNMFRLIFKSVIHRRDVALFYAFAGLPILVPILSKFLVGVKAEYT
FT                   DNFLDFLGAALATQDGIVLPVLLLSLIISAVFRDEIDSGILFLYKDLNRTRLFNAKIIS
FT                   LVVMYASYVLLTVLTSAIAYFGFLNASGKVVSDDWSNVQSTFLSIFATISINVIGILLV
FT                   STVSIKAKSLQAVLAGVFWSLFTTTAPLLIGVRYVVPNGYAKMSLDQPLLAWSLVVAIT
FT                   TFYTVATYLKGRSNFEKLEF"
FT   sig_peptide     47099..47224
FT                   /locus_tag="SSUBM407_0037"
FT                   /note="Signal peptide predicted for SSUBM407_0037 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.879) with
FT                   cleavage site probability 0.877 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(47147..47215,47258..47326,47408..47476,47534..47602,
FT                   47621..47689,47732..47791)
FT                   /locus_tag="SSUBM407_0037"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0037 by TMHMM2.0 at aa 17-39, 54-76, 104-126,
FT                   146-168, 175-197 and 212-231"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        47837..48415
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0038"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0040"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54870"
FT                   /db_xref="GOA:A0A0H3MSS8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSS8"
FT                   /protein_id="CAZ54870.1"
FT                   /translation="MVVRYMRPVALSLALIVLASISYLLATSLVLFSSSQFLQLAYLFS
FT                   IMVGMPIGFILLPSMITKRYQLCQELSEVKFSWKSFVLLAIAIFLVNFWFIQSDEYVNQ
FT                   FIIATCEEFLFRYLIYRILKSEYPTWLAMLVTSLLFGVLLHMNYSLLDNLIIRTPLGLL
FT                   FSVLATRFGLQYAIGGHWIYNLLVSRFPF"
FT   sig_peptide     47837..47935
FT                   /locus_tag="SSUBM407_0038"
FT                   /note="Signal peptide predicted for SSUBM407_0038 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.997) with
FT                   cleavage site probability 0.946 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(47861..47929,47939..48007,48065..48124,48221..48289,
FT                   48314..48382)
FT                   /locus_tag="SSUBM407_0038"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0038 by TMHMM2.0 at aa 9-31, 35-57, 77-96, 129-151
FT                   and 160-182"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    48128..48409
FT                   /locus_tag="SSUBM407_0038"
FT                   /note="HMMPfam hit to PF02517, Abi, score 1.9e-12"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS_pept        48427..48858
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0039"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0041"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54871"
FT                   /db_xref="GOA:A0A0H3N1F9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1F9"
FT                   /protein_id="CAZ54871.1"
FT                   /translation="MMIFILLLSLFYICLTVASSQLLLSLSVPVLLLLTYLLPPIVNSI
FT                   CMGLQKDKSWKAWSAGIFPTMSMIFYAAFAYITSSNGQWEQFAQLHTVSDDVMSVELAG
FT                   ELLVPSQMLFVAVLYYGTAIATYFIQQAGRKKEKGATYA"
FT   misc_feature    join(48430..48498,48508..48576,48595..48663,48745..48813)
FT                   /locus_tag="SSUBM407_0039"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0039 by TMHMM2.0 at aa 2-24, 28-50, 57-79 and
FT                   107-129"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        48851..49723
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0040"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0042"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54872"
FT                   /db_xref="GOA:A0A0H3MSW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW1"
FT                   /protein_id="CAZ54872.1"
FT                   /translation="MLKINHLSKQFAGNEFYSLKDVSLEINKGEIVGLIGKNGAGKSTL
FT                   MKLMAKSLKPSSGTITYKGTDIFSQDNLLADFGIMIDPVFYPEMTVMDNLKFYLDLHGK
FT                   KDLYPNIEKTLKLVELWDARNRKPKGFSFGMKQRTALAIALVAEPDFLILDEPFVGLDP
FT                   IGVQKLIDILKQWSSERQISMLISSHQLGELEALCSRYVYIESGELADAFEGKSHPSVL
FT                   VQLDTTKNLDSVKDLLNDHVVLEGEVLEISTATPTSELNQIFGVLTRQELIVKLEVKEN
FT                   HLKEIFTKG"
FT   misc_feature    48935..49471
FT                   /locus_tag="SSUBM407_0040"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.8e-47"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        49729..50502
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0041"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0043"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54873"
FT                   /db_xref="GOA:A0A0H3MSJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSJ8"
FT                   /protein_id="CAZ54873.1"
FT                   /translation="MKQIFPAVFRTIWKRKETQVYLLFTLFPFIYLVTSFIEGSNFMQI
FT                   HAGEGYKVSLVAFTNMMVSSADSFILPSLTLYFLAISVFRKEVDEHTMFLYRDLGRKQI
FT                   FWSKYLGLLATIVIFYGLFFVTSAFVHYVRVIHLPFGSPAVFEASLAESLSNVFCIVAY
FT                   LLKDILSISLATALCLYLKNITTMITGFLVTITMMILAIVGGPVAMLFPTSYMTLASEG
FT                   LTGAGLAYLGAICVTIIYVLVFTKIAAKKFKNLEF"
FT   misc_feature    join(49786..49854,49912..49980,50038..50106,50203..50271,
FT                   50290..50358,50401..50460)
FT                   /locus_tag="SSUBM407_0041"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0041 by TMHMM2.0 at aa 20-42, 62-84, 104-126,
FT                   159-181, 188-210 and 225-244"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        50505..52217
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0042"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0044"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54874"
FT                   /db_xref="GOA:A0A0H3MWZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MWZ8"
FT                   /protein_id="CAZ54874.1"
FT                   /translation="MNKRLVGVLLKSLNKTMFLFGIVLSALGVGMGLFLPQFIGKLLDQ
FT                   TYLSNLLTRPELLAGFILFFVSVYAVQALSNYFIGRSGSNALKQLQQYIYESLLTTSVK
FT                   DLDQYQSGDLASRLTNDMSVVLNFITVILPNFLMNGLMVMGSIYFLWTISPWLTGLSLF
FT                   LLPLLSMVMIPMNQRLEGYYSAYQEGLGQVSSRISHKFTTIRLMKAFQGEKHEQREMGK
FT                   SFQYLSQTFEKMIGLSAVQHTLVSSLMTGFIILMLLIAGIEVTKGVMTMATLTTFVLYM
FT                   MQLIDPVTDIAASLNELTEFHAVSKRLVELLELNKEEQVDTELVDATSIQLEKVRFSYH
FT                   TDPILNGVSVRIPEGAHVAIVGPSGAGKSTIFALLMKYYQDYKGKIRIGQQCLSDISTK
FT                   EMRRLISFIPQDNTLFHGTIRENLLYGKNESVSEERIAYILKELGLSPLVAELEDGLDT
FT                   RISENGTGLSEGQKQRFSIARALLLEHPIYLLDEATASLDTVTERVISKAIDRLTAGKT
FT                   RLTIAHRLHTVREADAILVLDKNGQVADYGHHQQLVERNHLYQDFLRGLPQAS"
FT   misc_feature    join(50553..50621,50673..50741,50874..50933,50943..51011,
FT                   51231..51299)
FT                   /locus_tag="SSUBM407_0042"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0042 by TMHMM2.0 at aa 17-39, 57-79, 124-143,
FT                   147-169 and 243-265"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    50556..51368
FT                   /locus_tag="SSUBM407_0042"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 6.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    51567..52127
FT                   /locus_tag="SSUBM407_0042"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 7.5e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        52787..53788
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SSUBM407_0043"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0046"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54875"
FT                   /db_xref="GOA:A0A0H3MST2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MST2"
FT                   /protein_id="CAZ54875.1"
FT                   /translation="MTNRILDMEQMQDEEYVERTLRPQKLNEYIGQDKVKDQLKIFIEA
FT                   AKLRDEALDHTLLFGPPGLGKTTMAFVIANELGVNIKQTSGPVIEKAGDLVALLNDLEP
FT                   GDVLFIDEIHRMPMAVEEILYSAMEDFYIDIMIGAGEASRSVHLELPPFTLIGATTRAG
FT                   MLSNPLRARFGITGHMEYYELADLTEIVERTADIFDMEITHEAAIELARRSRGTPRIAN
FT                   RLLKRVRDFAQIMGDGLIDDSITDKALTMLDVDREGLDYVDQKILRTMIEMYGGGPVGL
FT                   NTLSVNIAEERETVEDMYEPYLIQQGFLMRTRTGRVATAKAYEHLGYPYTEK"
FT   misc_feature    52793..52948
FT                   /gene="ruvB"
FT                   /locus_tag="SSUBM407_0043"
FT                   /note="HMMPfam hit to PF05496, RuvB_N, score 5.7e-28"
FT                   /inference="protein motif:HMMPfam:PF05496"
FT   misc_feature    52949..53488
FT                   /gene="ruvB"
FT                   /locus_tag="SSUBM407_0043"
FT                   /note="HMMPfam hit to PF00004, AAA, score 7.1e-28"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    53537..53773
FT                   /gene="ruvB"
FT                   /locus_tag="SSUBM407_0043"
FT                   /note="HMMPfam hit to PF05491, RuvB_C, score 1.5e-53"
FT                   /inference="protein motif:HMMPfam:PF05491"
FT   CDS_pept        53788..54534
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0044"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0047"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54876"
FT                   /db_xref="GOA:A0A0H3N1G4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1G4"
FT                   /protein_id="CAZ54876.1"
FT                   /translation="MAEQMRQAARLFGDWPETIIWTCLEGVMGDIYVDDSQLPQSALAL
FT                   YGRQSFFGFLAGQPHRDLLKICEGKDMILVPQNQNWSDLIEGTYGDGIRSFTRYATKKD
FT                   TEFDLGHLQKLVDDLPESFDMKRIDRNLYEACLVEEWSRDLVGNYIDVEQFLDLGLGYV
FT                   ILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDA
FT                   HTLTSLKLAEKLGYQLDKPYQAYEWR"
FT   misc_feature    54271..54498
FT                   /locus_tag="SSUBM407_0044"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   1.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        54536..55171
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0045"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0048"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54877"
FT                   /db_xref="GOA:A0A0H3MSW5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW5"
FT                   /protein_id="CAZ54877.1"
FT                   /translation="MTPTFIWDLDGTLLDSYEAILAGIQETYQEYVLPFDRAEVRKFIL
FT                   RYSVKDLLVRDADKYGLDSDELNRVRATSLKEKNTQIPLMAGAVEILNWTAEQGIQNFV
FT                   YTHKSDNAFQVLEDLGVRHHFTEILTSDSGFARKPSPEALLFLIEKYGLDKENTYYIGD
FT                   RLLDVETAVNAGIHSINLQIDGVEQNWKIVSLLDIKQILTDKSSHNNL"
FT   misc_feature    54539..55072
FT                   /locus_tag="SSUBM407_0045"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 8.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        55418..56323
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0046"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0049"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54878"
FT                   /db_xref="GOA:A0A0H3MSK4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSK4"
FT                   /protein_id="CAZ54878.1"
FT                   /translation="MNDKEFGQRVRQLRESASMTREQFCDDELELSVRQLTRIEAGASK
FT                   PTFSKIQYIATRLGMGLGLYELMPDYVSLPERYSKLKFDVLRTPTYGNEDLAEKRDAMM
FT                   TEIYDDYYDELPEEEKIAIDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYELNDL
FT                   LIVRLHLEYVRLSSCDSEIFRQFLKIIEHLHEQINIINSNDLFVLRDTLLSCVNILGSK
FT                   KYYEPIPKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDKDRDEAEKHYLDAVLFAK
FT                   LIENRELEQKIEEDWRVDNQ"
FT   repeat_region   56478..57997
FT                   /note="putative IS element, novel IS"
FT   CDS_pept        56728..57891
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0047"
FT                   /product="transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0051"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54879"
FT                   /db_xref="GOA:A0A0H3MX03"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX03"
FT                   /protein_id="CAZ54879.1"
FT                   /translation="MDVLYQSCAGIDVHQANIVVCILHGPLTSTRPKREMATFDTTTKG
FT                   LRACHDFLSQFHVEAVGMESTGVYWRPVWHALCDDFELILAQPAHMKAIPGQKTDKKDA
FT                   HWIAKLTRIGLLPRSFVPDETIQELRELTRQRKHYVESRNRETNRIHKFLQSGGIKLTT
FT                   YIEDIMGLSGRNLLQLLVDGTPITPRIVHQSVYTSLKKKVPQLLEALDGYFSDHHRFML
FT                   KQSLEIYDFYQKQIELLEERITVYLSQYENHVETLDSIPGIDVITASVIISEVGVDMSQ
FT                   FPTSGHLASWAGLCPGNNESAGKKRSTKIRHGNSYLKKCLCQAAFAARNQKGSTLADRF
FT                   YQIQSRRGSQKATIALAHQLLKIAYILLKEQMTYPEFLAQKRLLGTS"
FT   misc_feature    57001..57228
FT                   /locus_tag="SSUBM407_0047"
FT                   /note="HMMPfam hit to PF01548, Transposase_9, score
FT                   1.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01548"
FT   misc_feature    57490..57750
FT                   /locus_tag="SSUBM407_0047"
FT                   /note="HMMPfam hit to PF02371, Transposase_20, score
FT                   5.9e-24"
FT                   /inference="protein motif:HMMPfam:PF02371"
FT   CDS_pept        complement(58143..58241)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0048"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0052"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MST7"
FT                   /protein_id="CAZ54880.1"
FT                   /translation="MVDLFVFYTPNLTITTDANRVRLISNLQQSLL"
FT   repeat_region   complement(58294..59456)
FT                   /note="IS element, novel IS"
FT   repeat_region   58294..58314
FT                   /note="Inverted repeat"
FT   CDS_pept        complement(58429..59367)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0049"
FT                   /product="transposase"
FT                   /product="putative transposase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0053"
FT                   /note="CDS is possibly truncated in comparison to some
FT                   proteins. Similar to the C-terminal region of Lactococcus
FT                   lactis subsp. lactis (Streptococcus lactis) putative
FT                   transposase UniProt:O34116 (EMBL:U91581) (439 aa) fasta
FT                   scores: E()=6e-31, 37.456% id in 283 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54881"
FT                   /db_xref="GOA:A0A0H3N1G9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1G9"
FT                   /protein_id="CAZ54881.1"
FT                   /translation="MLDQIKAHLLDSINDIVSTANQFLLHPKKDFSRKSQLTRNLDERA
FT                   AFIDMLKTSSFKQALVIMDRGYESYNVMVHCQERNWSYIIRIRVGNHSMKSGFNLPDTP
FT                   CFDEAFDLNICRKQTNEMKQLYRDFPNHYRCLPNHTSFDFLPNSSRKRDPLQFYDLHFR
FT                   MVRLEIKPGFFETLVTNTDYSPEKLKDLYAYRWGIETSFRDLKYSIGLTHFHAKKKEGI
FT                   LQEIYARFINFNVCKWLTSHVTIKTSKLKQTYKICFSDAVYACRKFLREELTSFQLETY
FT                   IAKHLSIIRPNRTFQRKIKSQAPVSFTYRIS"
FT   misc_feature    complement(58663..59349)
FT                   /locus_tag="SSUBM407_0049"
FT                   /note="HMMPfam hit to PF01609, Transposase_11, score
FT                   1.7e-05"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   repeat_region   complement(59436..59456)
FT                   /note="Inverted repeat"
FT   CDS_pept        59507..60727
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0050"
FT                   /product="putative folylpolyglutamate synthase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0054"
FT                   /note="Weakly similar to SSU0136, 35.680% identity (37.789%
FT                   ungapped) in 412 aa overlap (5-402:9-411)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54882"
FT                   /db_xref="GOA:A0A0H3MSW9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW9"
FT                   /protein_id="CAZ54882.1"
FT                   /translation="MLENWLNTKQGQVFHYKMEKIEYALELLGNPQFAVPVIHVAGTNG
FT                   KGSTIAFMRKLFQAHGMRVGSFVSPHMVSVHDRICIDSQPISDHDFQHYLQKVYDLEQE
FT                   IATRYEPFRYFEVMVLIMFLYFEAQQPDVALVEVGIGGLLDTTNVVAPALSVITSIGMD
FT                   HQDLLGSTLREIAEQKAGIIKESVPVVLGPLSPETTAICRQIAQDNQAPVYQFGQEFTY
FT                   KAGQFSNPDIDLSELVLGLAGHHQEENAAVALQTFLLYMTNIQKDIQPQLIQQALAQTS
FT                   WPGRLELVVQEPKIYLDGAHNVPAIERLLEFIQVQEEPVTILFSALRRKDFQEMLELLE
FT                   EKLPHTPLVLTSFAYDGALAEENRQGRDYVENYQQFIEDWQSSKQGILIVTGSLYFISE
FT                   VRRIFKK"
FT   misc_feature    59618..60277
FT                   /locus_tag="SSUBM407_0050"
FT                   /note="HMMPfam hit to PF08245, Mur_ligase_M, score 0.00013"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    59909..59956
FT                   /locus_tag="SSUBM407_0050"
FT                   /note="ScanRegExp hit to PS01012, FOLYLPOLYGLU_SYNT_2,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS01012"
FT   misc_feature    60350..60607
FT                   /locus_tag="SSUBM407_0050"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 5.2e-05"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        60752..60865
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0051"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0055"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSL0"
FT                   /protein_id="CAZ54883.1"
FT                   /translation="MTHAEKVAFLKEFQENKRHTFRQLEQFAKISRTPDRK"
FT   CDS_pept        60918..62441
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0052"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0056"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54884"
FT                   /db_xref="GOA:A0A0H3MX09"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX09"
FT                   /protein_id="CAZ54884.1"
FT                   /translation="MTELDVVSDVVTHPEETYRRSRRASRRQQVQLNGEFHERVLKTKY
FT                   WPALVWSLVLSVFSVANPLLMPFATNIQTQNLYAGMAMANGQIPYGDFFGTSGLLFYLL
FT                   AFLGHLGGTFIIFGILQFIALLIAGVYFYKIVAYFSQSEHLAISSSHWFYVFIFALGFG
FT                   GMYAEMFALPFLLTSVWFLVRYFENAVRDEAFILYGIDAALVFLIYPKSLILWLVAGLV
FT                   LFIFNIQHRQVTRGIYQLLATIFGFLLILYAVGYYAFEAQILGTAIQQTFLYNLQLDFH
FT                   HSYLYLALAIVSVFLLLSGFFKSFIQMVFSFKQGRHTYIKVLLLLTFLVQCVFIIGNAN
FT                   FQWSQLILLLPYGFAMSVVYLRDEDVEDYSGYLRRQFFLPLAICLGIIAQPVYLYLVQG
FT                   DLRTDREQVANYIDEQTKDSDKIYVWDNSASIYLSSQRLSAATITTAEPYLNTDDNKNS
FT                   LMYDINKNEAKFVVVNKNLPILDEIKTNLESQYQSVQTTDYFTIYQKNE"
FT   misc_feature    join(61056..61124,61185..61253,61266..61334,61371..61466,
FT                   61524..61592,61626..61694,61767..61835,61872..61940,
FT                   62049..62108)
FT                   /locus_tag="SSUBM407_0052"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUBM407_0052 by TMHMM2.0 at aa 47-69, 90-112, 117-139,
FT                   152-183, 203-225, 237-259, 284-306, 319-341 and 378-397"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        62559..64496
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="SSUBM407_0053"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0057"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54885"
FT                   /db_xref="GOA:A0A0H3MSU2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSU2"
FT                   /protein_id="CAZ54885.1"
FT                   /translation="MSHIIELPEILANQIAAGEVIERPASVVKELVENSIDAGASQIEI
FT                   SVEEAGLKMIQITDNGEGIAPDEVALALRRHATSKIKNQSDLFRIRTLGFRGEALPSIA
FT                   SVSHMIIETATADSAHGLHLEAKGGVIEKEEPVSRPVGTQITVSDLFYNTPARLKYVRS
FT                   QQAELSHIVDVVNRLSLAHPEIAFVLVNEGRELIRTAGTGKLRQAISGIYGIASAKKMV
FT                   EIEAEDLDFQISGYVSLPELTRANRNYISIFINGRYIKNFLLNRAILEGYGSKLMVGRF
FT                   PLAVISIEIDPYLADVNVHPTKQEVRISKEKELMTLIREAISQALKEQDLIPDALENLA
FT                   QSSTRPKVKAEQGTLPLREPKIYYDTIKQDFFLKPDVVAEDVKPLEEDRQEIVESPVEN
FT                   RPTSVQFAERQSVESEDQEHPNLSAKELAKLADKLDREETSTFPELEYFGQMHGTYLFA
FT                   QGKTGLYIIDQHAAQERVKYEYYREKIGQVDNSAQQLLVPYIFEFPQNDALDLVHKMDA
FT                   LRQVGVNLEEYGSNQFILREHPIWMKEEEIESGIYEMCDMLLLTDQVSIKQYRAELVIM
FT                   MSCKRSIKANHALDDYSARDLLRQLSYCQNPYNCPHGRPVLVHFSKSDMEKMFRRIQEN
FT                   HTSLRELGKY"
FT   misc_feature    62613..62798
FT                   /gene="mutL"
FT                   /locus_tag="SSUBM407_0053"
FT                   /note="HMMPfam hit to PF02518, HATPase_c, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   misc_feature    62838..62858
FT                   /gene="mutL"
FT                   /locus_tag="SSUBM407_0053"
FT                   /note="ScanRegExp hit to PS00058, DNA_MISMATCH_REPAIR_1,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00058"
FT   misc_feature    63198..63539
FT                   /gene="mutL"
FT                   /locus_tag="SSUBM407_0053"
FT                   /note="HMMPfam hit to PF01119, DNA_mis_repair, score
FT                   9.7e-47"
FT                   /inference="protein motif:HMMPfam:PF01119"
FT   misc_feature    63897..64325
FT                   /gene="mutL"
FT                   /locus_tag="SSUBM407_0053"
FT                   /note="HMMPfam hit to PF08676, MutL_C, score 9.9e-54"
FT                   /inference="protein motif:HMMPfam:PF08676"
FT   CDS_pept        64535..65125
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SSUBM407_0054"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0058"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54886"
FT                   /db_xref="GOA:A0A0H3N1H3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1H3"
FT                   /protein_id="CAZ54886.1"
FT                   /translation="MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVT
FT                   VYTHQVIREDAHLLYGFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQK
FT                   NITYLTKFPKIGKKTAQQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALG
FT                   YRPAELKKIKKFFEGTNDTAENYIKSALKMLMK"
FT   misc_feature    64535..64717
FT                   /gene="ruvA"
FT                   /locus_tag="SSUBM407_0054"
FT                   /note="HMMPfam hit to PF01330, RuvA_N, score 1.3e-29"
FT                   /inference="protein motif:HMMPfam:PF01330"
FT   misc_feature    64982..65119
FT                   /gene="ruvA"
FT                   /locus_tag="SSUBM407_0054"
FT                   /note="HMMPfam hit to PF07499, RuvA_C, score 4.1e-08"
FT                   /inference="protein motif:HMMPfam:PF07499"
FT   CDS_pept        complement(65282..65689)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0055"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0059"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSX3"
FT                   /protein_id="CAZ54887.1"
FT                   /translation="MSLRRSHNEISCKISVRPSIFSLSFTPFVSGHDMSHKNRHYFCGE
FT                   LVRYLGKSQIAIAVVGAGKNSTGRKRIRLPAPAQLIRPDLMCGTRTNLPINHCAEMLTQ
FT                   TLSNKTKLFNHHTGTLVEHGYDTLKNCQTES"
FT   CDS_pept        65850..66419
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SSUBM407_0056"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0060"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54888"
FT                   /db_xref="GOA:A0A0H3MSL7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSL7"
FT                   /protein_id="CAZ54888.1"
FT                   /translation="MSRCAWVNPNNPLYIAYHDEEWGKPLHDEQSLFELLCLESYQAGL
FT                   SWEIVLNKRQAFRSAFFNYDIQKVAAMTDSELDSLLTNPDIIRHKAKLYATRANAQAFL
FT                   RVQEEFGTFDTYLWEWVNFTSIDNPVKSFRELPTKNDLSERISKDLKKRGFKFVGPVCI
FT                   YSYLQAAGLLNEHEETCEIGKKLRTN"
FT   misc_feature    65865..66404
FT                   /gene="tag"
FT                   /locus_tag="SSUBM407_0056"
FT                   /note="HMMPfam hit to PF03352, Adenine_glyco, score
FT                   5.6e-93"
FT                   /inference="protein motif:HMMPfam:PF03352"
FT   CDS_pept        66456..67637
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="SSUBM407_0057"
FT                   /product="CinA-like protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0061"
FT                   /note="CDS contains internal deletions relative to
FT                   orthologues, residues 240 to 310"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54889"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX13"
FT                   /protein_id="CAZ54889.1"
FT                   /translation="MKAELIAVGTEILTGQIINTNAQFLSEKCAELGIDVYFHTAVGDN
FT                   EGRLLSTLEVASKRSNMVVLCGGLGPTEDDLTKQTLATFLGRNLVFDELAMAKLDRFFA
FT                   SRPGRVRTPNNERQAQIVEGSQALQNPAGLAVGGMIEQDGVTYIVLPGPPSELKAMFSE
FT                   SLLPLLSQSQQQLYSRVLRFFGIGESQLVTVLADVIDKQTDPTLAPYAKVGEVTLRLST
FT                   KATSQEEANLRLNQLEEDILQHDKLADYFYAYGEDNSLVKTVATRLAEKRQTIAIVEQG
FT                   TGGLLQAELSLALADQPYFSGGKVVGQLGIESGWLSEEADCIRQELQADLGLAVSVLIK
FT                   PESTEDNVLAKVYLTLATPSGISQKEIDLGGYSWQYLRQLACLQAWDFVRNTL"
FT   misc_feature    66465..66968
FT                   /gene="cinA"
FT                   /locus_tag="SSUBM407_0057"
FT                   /note="HMMPfam hit to PF00994, MoCF_biosynth, score
FT                   2.6e-51"
FT                   /inference="protein motif:HMMPfam:PF00994"
FT   misc_feature    67224..67634
FT                   /gene="cinA"
FT                   /locus_tag="SSUBM407_0057"
FT                   /note="HMMPfam hit to PF02464, CinA, score 0.00013"
FT                   /inference="protein motif:HMMPfam:PF02464"
FT   CDS_pept        67689..68840
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="SSUBM407_0058"
FT                   /product="RecA recombinase (recombinase A)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0062"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54890"
FT                   /db_xref="GOA:A0A0H3MSU6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSU6"
FT                   /protein_id="CAZ54890.1"
FT                   /translation="MAKKPGKKLEDITKKFGDERKKALDDALKSIEKDFGKGAVMRLGE
FT                   RAEQKVQVMSSGSLSIDIALGAGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKDGGIA
FT                   AFIDAEHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDSVAAL
FT                   VPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTVAIFINQLREKVGVMFGNPET
FT                   TPGGRALKFYASVRMDVRGNTQIKGTGDKKDQNVGKETKVKIVKNKVAPPFKEAVVEIM
FT                   YGEGISRTGELIEIGSNLGIIQKAGAWYSYNGEKIGQGSENAKKFLADNPAIFDEIDRK
FT                   IRVHYGLIEADGVEEVATEEAPVVAEEIQDVILDLDGGIELED"
FT   misc_feature    67752..68729
FT                   /gene="recA"
FT                   /locus_tag="SSUBM407_0058"
FT                   /note="HMMPfam hit to PF00154, RecA, score 1.5e-239"
FT                   /inference="protein motif:HMMPfam:PF00154"
FT   misc_feature    68370..68396
FT                   /gene="recA"
FT                   /locus_tag="SSUBM407_0058"
FT                   /note="ScanRegExp hit to PS00321, RECA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00321"
FT   CDS_pept        69076..69474
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0059"
FT                   /product="regulatory protein Spx"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0063"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54891"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1H7"
FT                   /protein_id="CAZ54891.1"
FT                   /translation="MIKIYTVSSCTSCKKAKNWLNAHQLSYNEHNLAKEAITKEEILNI
FT                   LTKTENGIASIVSSKNRYAKSLDFDIEELSVNEVIDLITSNPRILKSPILIDEKRLQVG
FT                   YKEDDIRAFLPRAVRNVENAQARMRAAL"
FT   misc_feature    69088..69420
FT                   /locus_tag="SSUBM407_0059"
FT                   /note="HMMPfam hit to PF03960, ArsC, score 3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF03960"
FT   CDS_pept        69574..69840
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0064"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54892"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSX8"
FT                   /protein_id="CAZ54892.1"
FT                   /translation="MGFTEETVRFRLDDTDKQEISKTLTSVYRSLEEKGYNPINQIIGY
FT                   VLSGDPAYIPRYNDARNQIRKHERDEIIEELVRYYLKGNGIDL"
FT   misc_feature    69583..69819
FT                   /locus_tag="SSUBM407_0060"
FT                   /note="HMMPfam hit to PF06135, DUF965, score 1.9e-50"
FT                   /inference="protein motif:HMMPfam:PF06135"
FT   CDS_pept        69840..70259
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0061"
FT                   /product="putative Holliday junction resolvase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0065"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54893"
FT                   /db_xref="GOA:A0A0H3MSM4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSM4"
FT                   /protein_id="CAZ54893.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERL
FT                   TELVEQYKVDKFVVGLPKNMNNTSGPRVEASQAYGDLLTERYKLPVDYQDERLTTVAAE
FT                   RMLIEQADISRGKRKKVIDKLAAQLILQNYLDRTF"
FT   misc_feature    69840..70250
FT                   /locus_tag="SSUBM407_0061"
FT                   /note="HMMPfam hit to PF03652, UPF0081, score 2.2e-50"
FT                   /inference="protein motif:HMMPfam:PF03652"
FT   CDS_pept        70271..70591
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0066"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54894"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX18"
FT                   /protein_id="CAZ54894.1"
FT                   /translation="MAHHHDHEHDHNHDERELITLVDDQGNETLFEILLTIDGQEEFGK
FT                   NYVLLIPASAEEDENGEVEIQAYSYIENENGTEGDLQPIPEDATAEWDMIEEVFNSFME
FT                   EE"
FT   misc_feature    70316..70585
FT                   /locus_tag="SSUBM407_0062"
FT                   /note="HMMPfam hit to PF06949, DUF1292, score 2.6e-50"
FT                   /inference="protein motif:HMMPfam:PF06949"
FT   CDS_pept        70799..71377
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0067"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54895"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSV1"
FT                   /protein_id="CAZ54895.1"
FT                   /translation="MKDSFTERSKKLSEELERCLLADKNILVILDIMDRLNLSDCWLCA
FT                   GTIRNFIWNQYSFDEETDVDLVFFDENISYEETMEIESNLYQNYPAYQWELKNQVYMHI
FT                   HSPNTKPYQSSRDAIEKFPERCTAIGICRTERNKLEIFAPFGLDDIYAYQVRPTPHFLA
FT                   DPNRMELYRQRILKKQWKKRWLSLTVKEI"
FT   misc_feature    70886..71371
FT                   /locus_tag="SSUBM407_0063"
FT                   /note="HMMPfam hit to PF06042, DUF925, score 2.3e-77"
FT                   /inference="protein motif:HMMPfam:PF06042"
FT   CDS_pept        71450..71716
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0064"
FT                   /product="putative competence-specific global transcription
FT                   modulator (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0068"
FT                   /note="Probable gene remnant. Weakly similar to an internal
FT                   region of Streptococcus pneumoniae transcriptional
FT                   regulator ComX2 UniProt:Q97CV2 (EMBL:AE007319) (159 aa)
FT                   fasta scores: E()=0.0002, 35.802% id in 81 aa. Similar to
FT                   an internal region of SSU0016, 68.421% identity (71.233%
FT                   ungapped) in 76 aa overlap (15-87:55-130)"
FT                   /db_xref="PSEUDO:CAZ54896.1"
FT   CDS_pept        72039..72347
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SSUBM407_0065"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0069"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54897"
FT                   /db_xref="GOA:A0A0H3N1I2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1I2"
FT                   /protein_id="CAZ54897.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTE
FT                   RSFYTIIRATHKYKDSREQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   misc_feature    72051..72338
FT                   /gene="rpsJ"
FT                   /locus_tag="SSUBM407_0065"
FT                   /note="HMMPfam hit to PF00338, Ribosomal_S10, score
FT                   1.4e-60"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    72123..72170
FT                   /gene="rpsJ"
FT                   /locus_tag="SSUBM407_0065"
FT                   /note="ScanRegExp hit to PS00361, RIBOSOMAL_S10, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS_pept        72444..73070
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SSUBM407_0066"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0070"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54898"
FT                   /db_xref="GOA:A0A0H3MSY0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSY0"
FT                   /protein_id="CAZ54898.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YAAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGQEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GNRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   misc_feature    72468..73046
FT                   /gene="rplC"
FT                   /locus_tag="SSUBM407_0066"
FT                   /note="HMMPfam hit to PF00297, Ribosomal_L3, score 3.1e-94"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    72741..72812
FT                   /gene="rplC"
FT                   /locus_tag="SSUBM407_0066"
FT                   /note="ScanRegExp hit to PS00474, RIBOSOMAL_L3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS_pept        73095..73718
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SSUBM407_0067"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0071"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54899"
FT                   /db_xref="GOA:A0A0H3MSM9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSM9"
FT                   /protein_id="CAZ54899.1"
FT                   /translation="MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVNSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNIPGVKVATATTASVLDIANADKLLVTQAAISKIEEVLA"
FT   misc_feature    73140..73709
FT                   /gene="rplD"
FT                   /locus_tag="SSUBM407_0067"
FT                   /note="HMMPfam hit to PF00573, Ribosomal_L4, score 5.7e-76"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS_pept        73718..74017
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SSUBM407_0068"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0072"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54900"
FT                   /db_xref="GOA:A0A0H3MX22"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX22"
FT                   /protein_id="CAZ54900.1"
FT                   /translation="MNLYDVIKKPVITESSMGQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKTKRVGRYVGRTNKVKKAIITLAADSKAIELFATADAE"
FT   misc_feature    73727..74002
FT                   /gene="rplW"
FT                   /locus_tag="SSUBM407_0068"
FT                   /note="HMMPfam hit to PF00276, Ribosomal_L23, score
FT                   2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   misc_feature    73946..73993
FT                   /gene="rplW"
FT                   /locus_tag="SSUBM407_0068"
FT                   /note="ScanRegExp hit to PS00050, RIBOSOMAL_L23, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00050"
FT   CDS_pept        74035..74868
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SSUBM407_0069"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0073"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54901"
FT                   /db_xref="GOA:A0A0H3MSV6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSV6"
FT                   /protein_id="CAZ54901.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDGVEAIVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTVVHNIELKPGRGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQK"
FT   misc_feature    74158..74388
FT                   /gene="rplB"
FT                   /locus_tag="SSUBM407_0069"
FT                   /note="HMMPfam hit to PF00181, Ribosomal_L2, score 2.6e-47"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    74404..74793
FT                   /gene="rplB"
FT                   /locus_tag="SSUBM407_0069"
FT                   /note="HMMPfam hit to PF03947, Ribosomal_L2_C, score
FT                   1.3e-86"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    74686..74721
FT                   /gene="rplB"
FT                   /locus_tag="SSUBM407_0069"
FT                   /note="ScanRegExp hit to PS00467, RIBOSOMAL_L2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS_pept        75119..75400
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SSUBM407_0070"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0074"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54902"
FT                   /db_xref="GOA:A0A0H3N1I6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1I6"
FT                   /protein_id="CAZ54902.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   misc_feature    75125..75367
FT                   /gene="rpsS"
FT                   /locus_tag="SSUBM407_0070"
FT                   /note="HMMPfam hit to PF00203, Ribosomal_S19, score
FT                   3.2e-51"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    75275..75349
FT                   /gene="rpsS"
FT                   /locus_tag="SSUBM407_0070"
FT                   /note="ScanRegExp hit to PS00323, RIBOSOMAL_S19, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS_pept        75418..75762
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SSUBM407_0071"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0075"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54903"
FT                   /db_xref="GOA:A0A0H3MSY5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSY5"
FT                   /protein_id="CAZ54903.1"
FT                   /translation="MAEITSAKATARTVRVSPRKSRLVLDNIRGKSVADAIAILKFTPN
FT                   KAAGIIEGVLNSAIANAENNFGLEKANLVVSEAFANEGPTLKRFRPRAKGSASPINKRT
FT                   AHITVVVAEK"
FT   misc_feature    75442..75756
FT                   /gene="rplV"
FT                   /locus_tag="SSUBM407_0071"
FT                   /note="HMMPfam hit to PF00237, Ribosomal_L22, score
FT                   1.3e-59"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    75676..75750
FT                   /gene="rplV"
FT                   /locus_tag="SSUBM407_0071"
FT                   /note="ScanRegExp hit to PS00464, RIBOSOMAL_L22, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS_pept        75775..76428
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SSUBM407_0072"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0076"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54904"
FT                   /db_xref="GOA:A0A0H3MSN4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSN4"
FT                   /protein_id="CAZ54904.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRNFIKKE
FT                   LADASTSTIEIERAVNKVIVSIHTAKPGMVIGKAGSNVDALRAQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGESIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEALTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   misc_feature    75775..75957
FT                   /gene="rpsC"
FT                   /locus_tag="SSUBM407_0072"
FT                   /note="HMMPfam hit to PF00417, Ribosomal_S3_N, score
FT                   3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    75958..76122
FT                   /gene="rpsC"
FT                   /locus_tag="SSUBM407_0072"
FT                   /note="HMMPfam hit to PF07650, KH_2, score 1.4e-22"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    76126..76377
FT                   /gene="rpsC"
FT                   /locus_tag="SSUBM407_0072"
FT                   /note="HMMPfam hit to PF00189, Ribosomal_S3_C, score 1e-50"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    76258..76362
FT                   /gene="rpsC"
FT                   /locus_tag="SSUBM407_0072"
FT                   /note="ScanRegExp hit to PS00548, RIBOSOMAL_S3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS_pept        76432..76845
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SSUBM407_0073"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0077"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54905"
FT                   /db_xref="GOA:A0A0H3MX29"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX29"
FT                   /protein_id="CAZ54905.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKQVDFGQYGLQATTSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EVAGVSEEIAREAFRLAGHKLPVKVKFVKREAE"
FT   misc_feature    76432..76827
FT                   /gene="rplP"
FT                   /locus_tag="SSUBM407_0073"
FT                   /note="HMMPfam hit to PF00252, Ribosomal_L16, score
FT                   2.6e-80"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    76606..76641
FT                   /gene="rplP"
FT                   /locus_tag="SSUBM407_0073"
FT                   /note="ScanRegExp hit to PS00586, RIBOSOMAL_L16_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    76675..76710
FT                   /gene="rplP"
FT                   /locus_tag="SSUBM407_0073"
FT                   /note="ScanRegExp hit to PS00701, RIBOSOMAL_L16_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS_pept        76855..77061
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SSUBM407_0074"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0078"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54906"
FT                   /db_xref="GOA:A0A0H3MSW0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW0"
FT                   /protein_id="CAZ54906.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFELRFQAAAGQLE
FT                   QTARLNEVKKQIARIKTVQSETK"
FT   misc_feature    76882..77055
FT                   /gene="rpmC"
FT                   /locus_tag="SSUBM407_0074"
FT                   /note="HMMPfam hit to PF00831, Ribosomal_L29, score
FT                   1.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   misc_feature    76990..77034
FT                   /gene="rpmC"
FT                   /locus_tag="SSUBM407_0074"
FT                   /note="ScanRegExp hit to PS00579, RIBOSOMAL_L29, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00579"
FT   CDS_pept        77085..77345
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SSUBM407_0075"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0079"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54907"
FT                   /db_xref="GOA:A0A0H3N1J0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1J0"
FT                   /protein_id="CAZ54907.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   misc_feature    77115..77321
FT                   /gene="rpsQ"
FT                   /locus_tag="SSUBM407_0075"
FT                   /note="HMMPfam hit to PF00366, Ribosomal_S17, score
FT                   6.2e-37"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   misc_feature    77253..77291
FT                   /gene="rpsQ"
FT                   /locus_tag="SSUBM407_0075"
FT                   /note="ScanRegExp hit to PS00056, RIBOSOMAL_S17, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS_pept        77370..77738
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SSUBM407_0076"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0080"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54908"
FT                   /db_xref="GOA:A0A0H3MSZ1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ1"
FT                   /protein_id="CAZ54908.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDIIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRADGSYIKFDENAAVIIREDKNPRGTRIFGPVAR
FT                   ELRDGGFMKIVSLAPEVL"
FT   misc_feature    77370..77735
FT                   /gene="rplN"
FT                   /locus_tag="SSUBM407_0076"
FT                   /note="HMMPfam hit to PF00238, Ribosomal_L14, score 7e-77"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   misc_feature    77547..77627
FT                   /gene="rplN"
FT                   /locus_tag="SSUBM407_0076"
FT                   /note="ScanRegExp hit to PS00049, RIBOSOMAL_L14, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS_pept        77877..78182
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SSUBM407_0077"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0081"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54909"
FT                   /db_xref="GOA:A0A0H3MSN7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSN7"
FT                   /protein_id="CAZ54909.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGVEAVVVTALPKVNKVIVEGVNIVKKHQ
FT                   KSNSENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   misc_feature    77883..77984
FT                   /gene="rplX"
FT                   /locus_tag="SSUBM407_0077"
FT                   /note="HMMPfam hit to PF00467, KOW, score 5.5e-08"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    77892..77945
FT                   /gene="rplX"
FT                   /locus_tag="SSUBM407_0077"
FT                   /note="ScanRegExp hit to PS01108, RIBOSOMAL_L24, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS_pept        78206..78748
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SSUBM407_0078"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0082"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54910"
FT                   /db_xref="GOA:A0A0H3MX32"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX32"
FT                   /protein_id="CAZ54910.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGDAV
FT                   SNAKNLEKAAQELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VTVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGMDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   misc_feature    78278..78448
FT                   /gene="rplE"
FT                   /locus_tag="SSUBM407_0078"
FT                   /note="HMMPfam hit to PF00281, Ribosomal_L5, score 7.5e-30"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    78377..78427
FT                   /gene="rplE"
FT                   /locus_tag="SSUBM407_0078"
FT                   /note="ScanRegExp hit to PS00358, RIBOSOMAL_L5, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    78458..78742
FT                   /gene="rplE"
FT                   /locus_tag="SSUBM407_0078"
FT                   /note="HMMPfam hit to PF00673, Ribosomal_L5_C, score
FT                   2.1e-52"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS_pept        78763..78948
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SSUBM407_0079"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0083"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54911"
FT                   /db_xref="GOA:A0A0H3MSW6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW6"
FT                   /protein_id="CAZ54911.1"
FT                   /translation="MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   DLAYLGQIPGVTKASW"
FT   misc_feature    78775..78942
FT                   /gene="rpsN"
FT                   /locus_tag="SSUBM407_0079"
FT                   /note="HMMPfam hit to PF00253, Ribosomal_S14, score
FT                   3.6e-18"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   misc_feature    78829..78897
FT                   /gene="rpsN"
FT                   /locus_tag="SSUBM407_0079"
FT                   /note="ScanRegExp hit to PS00527, RIBOSOMAL_S14, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00527"
FT   CDS_pept        79079..79249
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0080"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0084"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54912"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1J4"
FT                   /protein_id="CAZ54912.1"
FT                   /translation="MTDKVKIGTLAKNACVLDRVIFFTQAVARVQMLGCNSIILANSNF
FT                   ALPIRHTLTSK"
FT   CDS_pept        79285..79683
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SSUBM407_0081"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0085"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54913"
FT                   /db_xref="GOA:A0A0H3MSZ6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ6"
FT                   /protein_id="CAZ54913.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIATILKNEGF
FT                   VKNVEFIEDDKQGIIRVFLKYGPNGEKVITNLKRVSKPGLRVYSKREDIPKVLNGLGIA
FT                   IISTSEGLLTDKQARQKNVGGEVIAYVW"
FT   misc_feature    79297..79680
FT                   /gene="rpsH"
FT                   /locus_tag="SSUBM407_0081"
FT                   /note="HMMPfam hit to PF00410, Ribosomal_S8, score 5.8e-75"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    79588..79641
FT                   /gene="rpsH"
FT                   /locus_tag="SSUBM407_0081"
FT                   /note="ScanRegExp hit to PS00053, RIBOSOMAL_S8, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00053"
FT   CDS_pept        79827..79967
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0082"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0086"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSP1"
FT                   /protein_id="CAZ54914.1"
FT                   /translation="MFKSDLLIIWYHATKLEQDSLIEHAYNSLKKVKSVSEILTLFVVN
FT                   V"
FT   CDS_pept        80015..80062
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0083"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   (fragment)"
FT                   /note="Possible gene remnant. N-terminus is similar to the
FT                   N-terminal region of Streptococcus pyogenes (serotype M3)
FT                   pure putative phosphoribosylaminoimidazole carboxylase I
FT                   UniProt:Q8K8Y3 (EMBL:AE014136) (203 aa) fasta scores:
FT                   E()=0.041, 81.250% id in 16 aa"
FT   CDS_pept        80149..80685
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SSUBM407_0084"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0088"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54916"
FT                   /db_xref="GOA:A0A0H3MX39"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX39"
FT                   /protein_id="CAZ54916.1"
FT                   /translation="MSRIGNKVITLPAGVELAQNNGVVTVKGPKGELTREFPTAIEIRV
FT                   EGAEVTLHRPNDSKEMKTIHGTSRANLNNMVVGVSEGFKKELEMRGVGYRAQLAGNKLT
FT                   LAVGKSHPDEVVAPEGITFEVPTPTQIVVSGINKEVVGQTAAYIRSLRAPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   misc_feature    80179..80394
FT                   /gene="rplF"
FT                   /locus_tag="SSUBM407_0084"
FT                   /note="HMMPfam hit to PF00347, Ribosomal_L6, score 8.3e-24"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80416..80643
FT                   /gene="rplF"
FT                   /locus_tag="SSUBM407_0084"
FT                   /note="HMMPfam hit to PF00347, Ribosomal_L6, score 1.8e-29"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    80608..80634
FT                   /gene="rplF"
FT                   /locus_tag="SSUBM407_0084"
FT                   /note="ScanRegExp hit to PS00525, RIBOSOMAL_L6_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS_pept        80774..81130
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SSUBM407_0085"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0089"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54917"
FT                   /db_xref="GOA:A0A0H3MSX0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSX0"
FT                   /protein_id="CAZ54917.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKISGTAARPRLNIFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALAESARENGLKF"
FT   misc_feature    80789..81127
FT                   /gene="rplR"
FT                   /locus_tag="SSUBM407_0085"
FT                   /note="HMMPfam hit to PF00861, Ribosomal_L18p, score
FT                   1.3e-54"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS_pept        81149..81643
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SSUBM407_0086"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0090"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54918"
FT                   /db_xref="GOA:A0A0H3N1J8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1J8"
FT                   /protein_id="CAZ54918.1"
FT                   /translation="MAFKDNAVEIEERVVAINRVTKVVKGGRRLRFAALVVVGDRNGRV
FT                   GFGTGKAQEVPEAIRKAVESAKKNMIEVPMVGTTIPHEVRSEFGGARVLLKPASEGSGV
FT                   AAGGATRAVIELAGIADVTSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   misc_feature    81173..81373
FT                   /gene="rpsE"
FT                   /locus_tag="SSUBM407_0086"
FT                   /note="HMMPfam hit to PF00333, Ribosomal_S5, score 1.2e-40"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    81227..81325
FT                   /gene="rpsE"
FT                   /locus_tag="SSUBM407_0086"
FT                   /note="ScanRegExp hit to PS00585, RIBOSOMAL_S5, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    81398..81619
FT                   /gene="rpsE"
FT                   /locus_tag="SSUBM407_0086"
FT                   /note="HMMPfam hit to PF03719, Ribosomal_S5_C, score
FT                   4.3e-34"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS_pept        81658..81840
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SSUBM407_0087"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0091"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54919"
FT                   /db_xref="GOA:A0A0H3MT02"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT02"
FT                   /protein_id="CAZ54919.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNPAILG
FT                   MVNAISHLVTVEEVK"
FT   misc_feature    81661..81819
FT                   /gene="rpmD"
FT                   /locus_tag="SSUBM407_0087"
FT                   /note="HMMPfam hit to PF00327, Ribosomal_L30, score
FT                   5.9e-16"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   misc_feature    81721..81819
FT                   /gene="rpmD"
FT                   /locus_tag="SSUBM407_0087"
FT                   /note="ScanRegExp hit to PS00634, RIBOSOMAL_L30, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00634"
FT   CDS_pept        81976..82416
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SSUBM407_0088"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0092"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54920"
FT                   /db_xref="GOA:A0A0H3MSP7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSP7"
FT                   /protein_id="CAZ54920.1"
FT                   /translation="MKLHELQPATGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRPGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNAFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITSKGGSVEVI"
FT   misc_feature    81976..82281
FT                   /gene="rplO"
FT                   /locus_tag="SSUBM407_0088"
FT                   /note="HMMPfam hit to PF01305, Ribosomal_L15, score
FT                   6.1e-61"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    82303..82398
FT                   /gene="rplO"
FT                   /locus_tag="SSUBM407_0088"
FT                   /note="HMMPfam hit to PF00256, L15, score 3e-11"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    82303..82395
FT                   /gene="rplO"
FT                   /locus_tag="SSUBM407_0088"
FT                   /note="ScanRegExp hit to PS00475, RIBOSOMAL_L15, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS_pept        82430..83740
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SSUBM407_0089"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0093"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54921"
FT                   /db_xref="GOA:A0A0H3MX46"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX46"
FT                   /protein_id="CAZ54921.1"
FT                   /translation="MFFKLLKDALKVKLVRSKILFTIFILFVFRVGTHITVPGVNAKSL
FT                   EALSNLPFLNMLSLVSGNAMRNFSVFALGVSPYITASIIVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFVQSIGITAGFNALSGAKLTNMPLNWQTYLLIGAILTTGSI
FT                   IVTWLGEQISEKGYGNGTSMIIFAGIISSLPGTFHEIYIDRFVNIESSRLGESAIFVAA
FT                   LVVLIFFVVYFTTFVQQAEYKLPIQYTKRAQGAPSSSYLPLKLNPAGVIPVIFAGSITA
FT                   VPTSLIQYFASQNKSAGWLLTVQEYFDYSTAKGMIVYAGLIIAFTFFYTFVQVNPEKTA
FT                   ESLQKSAAYIHGVRPGNGTEQFLSKLLTRLAVIGALFLSFVALLPILAQNLFGLSSSIA
FT                   FLGTSLIIVISTSIEGIKQLEGYLLKRKYVGFLEITE"
FT   sig_peptide     82430..82555
FT                   /gene="secY"
FT                   /locus_tag="SSUBM407_0089"
FT                   /note="Signal peptide predicted for SSUBM407_0089 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.948) with
FT                   cleavage site probability 0.919 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(82487..82555,82625..82693,82775..82843,82871..82936,
FT                   82955..83023,83081..83140,83234..83302,83372..83425,
FT                   83525..83593,83621..83677)
FT                   /gene="secY"
FT                   /locus_tag="SSUBM407_0089"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUBM407_0089 by TMHMM2.0 at aa 20-42, 66-88, 116-138,
FT                   148-169, 176-198, 218-237, 269-291, 315-332, 366-388 and
FT                   398-416"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    82634..83683
FT                   /gene="secY"
FT                   /locus_tag="SSUBM407_0089"
FT                   /note="HMMPfam hit to PF00344, SecY, score 5.8e-152"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    82634..82693
FT                   /gene="secY"
FT                   /locus_tag="SSUBM407_0089"
FT                   /note="ScanRegExp hit to PS00755, SECY_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00755"
FT   CDS_pept        83834..84475
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SSUBM407_0090"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0094"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54922"
FT                   /db_xref="GOA:A0A0H3MSX6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSX6"
FT                   /protein_id="CAZ54922.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEKFNVAHISTGDMFRAAMANQTEM
FT                   GILAKSYIDKGDLVPDEVTNGIVKERLVQDDIKEKGFLLDGYPRTIEQAHALDENLADL
FT                   GIELQGVINIEIDPSKLVERLSGRIIHKETGETFHKVFNPPVGDYKEEDFYQREDDKPE
FT                   SVKRRLEVNIAQGQPIIDHYRAKGLVHDIEGDQDIDLVFQAIDTVLSKLQ"
FT   misc_feature    83846..84397
FT                   /gene="adk"
FT                   /locus_tag="SSUBM407_0090"
FT                   /note="HMMPfam hit to PF00406, ADK, score 1.1e-89"
FT                   /inference="protein motif:HMMPfam:PF00406"
FT   misc_feature    84077..84112
FT                   /gene="adk"
FT                   /locus_tag="SSUBM407_0090"
FT                   /note="ScanRegExp hit to PS00113, ADENYLATE_KINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00113"
FT   misc_feature    84215..84268
FT                   /gene="adk"
FT                   /locus_tag="SSUBM407_0090"
FT                   /note="HMMPfam hit to PF05191, ADK_lid, score 0.0003"
FT                   /inference="protein motif:HMMPfam:PF05191"
FT   CDS_pept        84597..84815
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SSUBM407_0091"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0095"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54923"
FT                   /db_xref="GOA:A0A0H3N1K3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1K3"
FT                   /protein_id="CAZ54923.1"
FT                   /translation="MAKEDVIEIEGKVVDTMPNAMFTVELENGHQVLATVSGKIRKNYI
FT                   RILVGDRVTVELSPYDLTRGRITYRFK"
FT   misc_feature    84609..84806
FT                   /gene="infA"
FT                   /locus_tag="SSUBM407_0091"
FT                   /note="HMMPfam hit to PF01176, eIF-1a, score 1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF01176"
FT   CDS_pept        84840..84956
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SSUBM407_0092"
FT                   /product="50S ribosomal protein L36"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0096"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54924"
FT                   /db_xref="GOA:A0A0H3MT07"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT07"
FT                   /protein_id="CAZ54924.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
FT   misc_feature    84840..84953
FT                   /gene="rpmJ"
FT                   /locus_tag="SSUBM407_0092"
FT                   /note="HMMPfam hit to PF00444, Ribosomal_L36, score
FT                   3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00444"
FT   misc_feature    84870..84950
FT                   /gene="rpmJ"
FT                   /locus_tag="SSUBM407_0092"
FT                   /note="ScanRegExp hit to PS00828, RIBOSOMAL_L36, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00828"
FT   CDS_pept        84976..85341
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SSUBM407_0093"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0097"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54925"
FT                   /db_xref="GOA:A0A0H3MSQ3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSQ3"
FT                   /protein_id="CAZ54925.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   misc_feature    84982..85299
FT                   /gene="rpsM"
FT                   /locus_tag="SSUBM407_0093"
FT                   /note="HMMPfam hit to PF00416, Ribosomal_S13, score
FT                   4.2e-55"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    85234..85275
FT                   /gene="rpsM"
FT                   /locus_tag="SSUBM407_0093"
FT                   /note="ScanRegExp hit to PS00646, RIBOSOMAL_S13_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS_pept        85359..85742
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SSUBM407_0094"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0098"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54926"
FT                   /db_xref="GOA:A0A0H3MX49"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX49"
FT                   /protein_id="CAZ54926.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   misc_feature    85407..85736
FT                   /gene="rpsK"
FT                   /locus_tag="SSUBM407_0094"
FT                   /note="HMMPfam hit to PF00411, Ribosomal_S11, score
FT                   5.4e-72"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   misc_feature    85641..85709
FT                   /gene="rpsK"
FT                   /locus_tag="SSUBM407_0094"
FT                   /note="ScanRegExp hit to PS00054, RIBOSOMAL_S11, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS_pept        85787..86725
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SSUBM407_0095"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0099"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54927"
FT                   /db_xref="GOA:A0A0H3MSY2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSY2"
FT                   /protein_id="CAZ54927.1"
FT                   /translation="MIEFEKPTITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSIKIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKKIELDVVGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIADGATFKAVLTVNSGRGYVPAEDNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTLEINTNGTIIPEDALGLSARILMEHLGLF
FT                   TDLTEVAKSAEVMKEAEVASDDRMLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKTEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKKDK"
FT   misc_feature    85826..86458
FT                   /gene="rpoA"
FT                   /locus_tag="SSUBM407_0095"
FT                   /note="HMMPfam hit to PF01193, RNA_pol_L, score 3.3e-26"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    85946..86293
FT                   /gene="rpoA"
FT                   /locus_tag="SSUBM407_0095"
FT                   /note="HMMPfam hit to PF01000, RNA_pol_A_bac, score
FT                   1.1e-56"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    86492..86695
FT                   /gene="rpoA"
FT                   /locus_tag="SSUBM407_0095"
FT                   /note="HMMPfam hit to PF03118, RNA_pol_A_CTD, score 2e-30"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS_pept        86740..87126
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SSUBM407_0096"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0100"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54928"
FT                   /db_xref="GOA:A0A0H3N1K7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1K7"
FT                   /protein_id="CAZ54928.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSATALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   misc_feature    86785..87123
FT                   /gene="rplQ"
FT                   /locus_tag="SSUBM407_0096"
FT                   /note="HMMPfam hit to PF01196, Ribosomal_L17, score
FT                   3.2e-62"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    86827..86895
FT                   /gene="rplQ"
FT                   /locus_tag="SSUBM407_0096"
FT                   /note="ScanRegExp hit to PS01167, RIBOSOMAL_L17, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01167"
FT   rRNA            87776..89319
FT                   /locus_tag="SSUBM407_r0004"
FT                   /note="16S rRNA"
FT   tRNA            89371..89443
FT                   /locus_tag="SSUBM407_t0018"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:89404..89406,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            89723..92627
FT                   /locus_tag="SSUBM407_r0005"
FT                   /note="23S rRNA"
FT   rRNA            92705..92831
FT                   /locus_tag="SSUBM407_r0006"
FT                   /note="5S rRNA"
FT   tRNA            92834..92906
FT                   /locus_tag="SSUBM407_t0019"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:92867..92869,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            92912..92982
FT                   /locus_tag="SSUBM407_t0020"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:92944..92946,aa:Gly)"
FT                   /note="tRNA Gly anticodon TCC, Cove score 69.41"
FT   tRNA            93013..93086
FT                   /locus_tag="SSUBM407_t0021"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:93047..93049,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 80.63"
FT   tRNA            93093..93164
FT                   /locus_tag="SSUBM407_t0022"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:93126..93128,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   tRNA            93173..93262
FT                   /locus_tag="SSUBM407_t0023"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:93209..93211,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 37.00"
FT   tRNA            93272..93345
FT                   /locus_tag="SSUBM407_t0024"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:93306..93308,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 63.79"
FT   tRNA            93361..93433
FT                   /locus_tag="SSUBM407_t0025"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:93394..93396,aa:Phe)"
FT                   /note="tRNA Phe anticodon GAA, Cove score 64.99"
FT   tRNA            93454..93534
FT                   /locus_tag="SSUBM407_t0026"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:93488..93490,aa:Tyr)"
FT                   /note="tRNA Tyr anticodon GTA, Cove score 55.83"
FT   tRNA            93542..93612
FT                   /locus_tag="SSUBM407_t0027"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:93574..93576,aa:Trp)"
FT                   /note="tRNA Trp anticodon CCA, Cove score 50.14"
FT   tRNA            93620..93692
FT                   /locus_tag="SSUBM407_t0028"
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:93653..93655,aa:His)"
FT                   /note="tRNA His anticodon GTG, Cove score 60.96"
FT   tRNA            93704..93775
FT                   /locus_tag="SSUBM407_t0029"
FT                   /product="transfer RNA-Gln"
FT                   /anticodon="(pos:93736..93738,aa:Gln)"
FT                   /note="tRNA Gln anticodon TTG, Cove score 49.54"
FT   tRNA            93787..93870
FT                   /locus_tag="SSUBM407_t0030"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:93821..93823,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAA, Cove score 62.17"
FT   repeat_region   93818..93906
FT                   /note="Direct repeat region flanking genomic island"
FT   misc_feature    93871..99855
FT                   /note="Putative genomic island"
FT   CDS_pept        complement(93957..95090)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0097"
FT                   /product="putative integrase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0101"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54929"
FT                   /db_xref="GOA:A0A0H3MT13"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT13"
FT                   /protein_id="CAZ54929.1"
FT                   /translation="MTVKKAKNGTWTVDISDGFHPVTKKRIRIIRKGFKTKKEALELEQ
FT                   YIRVVELKEKRFDFLVTTDMLFDILEEEDRQNNRKISYISTQRNNYERHIKPYFINTNL
FT                   NKLSYEHIFEFREYLKIKPKKQNDSSTLSHNTVNKIMILLKKIFDTGVRKSLIDKNPVE
FT                   NIRKLPISKPTINFWNVEEFNEFRKLITSDEISYDLFFTIAFFTGMRLGEIVALTWYDI
FT                   NLITNSIHITKTAYFVNGTNHINSTKTRAGTRRITINHKLARMLADWKEKQKDLLKEFT
FT                   TDTENLQVIQSTPLPMTKNMIDKKFKQILARNDYLKKIRIHDLRHSHASLLINQGEDYL
FT                   VVKERLGHASITTTIDTYSHLYPSKQKTLANKLDDIF"
FT   misc_feature    complement(93987..94544)
FT                   /locus_tag="SSUBM407_0097"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        complement(95080..95286)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0102"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54930"
FT                   /db_xref="InterPro:IPR021512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSQ8"
FT                   /protein_id="CAZ54930.1"
FT                   /translation="MIATVNKNDLVALGFSEGTSKRIIRQGKELLIARGFRVYQNKRVG
FT                   TIPASIATELLGFDVSLGAHHDS"
FT   CDS_pept        complement(95347..96363)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0099"
FT                   /product="replication initiation factor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0103"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54931"
FT                   /db_xref="GOA:A0A0H3MX54"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR040819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX54"
FT                   /protein_id="CAZ54931.1"
FT                   /translation="MNTVRIDYFAVTVKNIPPESVLTDILLIPLEDFTLNNWGINKYQR
FT                   HYACSEIKVYFNEDRPSMGVFIELKGQGCRQYEEFLDGNENNWIALIGRLYQYSVNFTR
FT                   LDIAHDIFDGSLDVQRVYDYCKKGLCISKAKHFEYHEKSVLENGERVGETVAIGSRGNQ
FT                   QWCIYNKRMEQLSKQELVEYPSWIRAELRCWQDKANIIAEQLFLKRPLSSIYFEAINGH
FT                   YRFVKPNATDTNRWRRKKVKWWLDYLKTENQTVLSVERTKPTLRQSEAWTEKQVAKTLA
FT                   KVYTAKYQAYDVQKAEDYIQGLLKEGLSRLTDNDEKDIEQYIREQNSSPLWGQKKTT"
FT   misc_feature    complement(95395..96066)
FT                   /locus_tag="SSUBM407_0099"
FT                   /note="HMMPfam hit to PF02486, Rep_trans, score 4.4e-11"
FT                   /inference="protein motif:HMMPfam:PF02486"
FT   CDS_pept        complement(96368..96787)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0104"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54932"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSY7"
FT                   /protein_id="CAZ54932.1"
FT                   /translation="MTYNMTDTTLKIGQLDLDMTQFEVPKKIVILSAKVNNRYNEVNGE
FT                   KIKTEEVTKITCTALDADKVKVLTEMGISTDDLKAINLEIVGNVDKVATLAQNESLLNV
FT                   PIELVKPKVRLAWNMARSNWAGVKLVCEDIKILGA"
FT   CDS_pept        complement(97089..98411)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0101"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0106"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54933"
FT                   /db_xref="GOA:A0A0H3N1L1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1L1"
FT                   /protein_id="CAZ54933.1"
FT                   /translation="MRLNPYIITSKRLFLSRVGMDLFLGMLLINTWVSPYSIPIKSVLS
FT                   LIFIGIICSIEKFFKSVFISKIQNILYVRESLFDMLIGLNLYEESDNVVTNSATLNFEI
FT                   LPNDIVMVEVPLFGNKFLKLLKNLEEYLVPTLGLPLLSKYEFPDHVIYKLGKIEEIEQY
FT                   IFNSQTLTRDFFEDIPTPIVKLSNTQQFSLKQNTNLGVYGRTGTGKTIALQWYLFNALA
FT                   KGCGIDTYLAIVDGKGADLYALGALLQEELGKQISVGSSPTSLAKLSRQFVKIMDERFE
FT                   VIKQNSSLNADAYDLGMTPNFLFIDELASIRDSCGSSKQGKELWNEILQNLGLIARKGR
FT                   QAGCHLCLSTQDPNAENIPVELRNQISAVLYLGNIGDDRLKMAFSMCELENVPTISDRK
FT                   GEALFYADGLNSVEPVLTIVPFVDVKTKQDFLQVVRNILPN"
FT   misc_feature    complement(97122..97157)
FT                   /locus_tag="SSUBM407_0101"
FT                   /note="ScanRegExp hit to PS00327, BACTERIAL_OPSIN_RET,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00327"
FT   misc_feature    complement(97347..97937)
FT                   /locus_tag="SSUBM407_0101"
FT                   /note="HMMPfam hit to PF01580, FtsK_SpoIIIE, score 3.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01580"
FT   misc_feature    complement(98307..98375)
FT                   /locus_tag="SSUBM407_0101"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0101 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98380..98637)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0102"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0107"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54934"
FT                   /db_xref="GOA:A0A0H3MT17"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT17"
FT                   /protein_id="CAZ54934.1"
FT                   /translation="MKIYKFMFNITYPALVISLYIIFQMKGTMSPWFDTLFVAGGFLVI
FT                   PLLLLLLGYLSENDHGGTDNEANQAESCSTSEVESLYNNL"
FT   misc_feature    complement(join(98473..98541,98569..98625))
FT                   /locus_tag="SSUBM407_0102"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0102 by TMHMM2.0 at aa 5-23 and 33-55"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98692..99012)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0103"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0108"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSR2"
FT                   /protein_id="CAZ54935.1"
FT                   /translation="MKTFKDIFLSEGMEMPNINGIKRVQSFNSDKSVNFTLDDESRDFL
FT                   KENLPIEGVIYEPTLKKLAENIIILNRQKHRISDEFRISLMNKEIYQGYRETSFYTSII
FT                   EA"
FT   CDS_pept        complement(99191..99712)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0104"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0109"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54936"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX58"
FT                   /protein_id="CAZ54936.1"
FT                   /translation="MCISNTTKLIIGVKMRSHLGVRLSYEAKYWLESIQAVIQEKLDAK
FT                   INEQDIENLEHATKSYLKEVDNELGATSVTLILKASASSVLEEAFEKTKSLSLKDWHKL
FT                   DNEMKHSISSIPKDKDVGTLSVRFFLENSIITSLESYQKEFMTSEMVRQVRLSYVLKLV
FT                   IFAYYKEIMQ"
FT   repeat_region   99856..99944
FT                   /note="Direct repeat flanking genomic island, partial tRNA"
FT   CDS_pept        100040..100822
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0110"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54937"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ0"
FT                   /protein_id="CAZ54937.1"
FT                   /translation="MKTLYHYTTVETLLLILNYKTLRFKSLLYVDDPLEPSTSDFGNLG
FT                   GFKYVSCWTDTPNSIPQWTMYSDNMTGVCIGISFDKETDVFLTEKFSLSESSEPIDMVN
FT                   ALHPLKSGLLVTNNKYVPSLEQIRYTDDVSLITPRVVSSDDKSTTINLASNGIYKTTDW
FT                   SFQNEQRFSFQIFPLPIDLVLELMNANKGDLTEIINSFISVKPKEYFDLDLNPTIFSNM
FT                   TITFGKRCSAEDKLKVSKFLEDNKFHIPLFDSTVNIKP"
FT   CDS_pept        complement(join(100819..101157,101188..101334,
FT                   101338..101460))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0106"
FT                   /product="putative integrase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0111"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus mutans tyrosine recombinase XerC
FT                   UniProt:O69155 (EMBL:AE014942) (356 aa) fasta scores:
FT                   E()=0.00011, 27.717% id in 184 aa"
FT                   /db_xref="PSEUDO:CAZ54938.1"
FT   misc_feature    complement(join(100849..101157,101188..101334,
FT                   101338..101415))
FT                   /locus_tag="SSUBM407_0106"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   5.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS_pept        101543..101986
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0107"
FT                   /product="MarR-family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0112"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54939"
FT                   /db_xref="GOA:A0A0H3N1L3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1L3"
FT                   /protein_id="CAZ54939.1"
FT                   /translation="MNRIALEIEKYLHEIVLSSENQLEILVGSCQSTVKLTNTQEHILM
FT                   LIEKAAYTNTEIAKELNVSQAAITKATKSLVAQGLLVAVRDDKDARIVRFSLTEAAKPI
FT                   AAEHAHHHAHTLEAYEELLENYSLEEQESIARFLSELVEKIRK"
FT   misc_feature    101648..101854
FT                   /locus_tag="SSUBM407_0107"
FT                   /note="HMMPfam hit to PF01047, MarR, score 1.5e-13"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    101696..101761
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1850.000, SD 5.49 at aa 54-75, sequence
FT                   YTNTEIAKELNVSQAAITKATK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        101987..102691
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0108"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0113"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54940"
FT                   /db_xref="GOA:A0A0H3MT23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT23"
FT                   /protein_id="CAZ54940.1"
FT                   /translation="MRYITVEDLSFYYDKEPVLEHIHYYLDSGEFVTLTGENGAAKTTL
FT                   IKATLGILKPKQGKVSIAEKSIKGKKLRMAYLPQQIASFNAGFPSTVYEFVKSGRYPRQ
FT                   GWFRRLTAHDEEHVRISLESVGMWEHRDKRLGALSGGQKQRAVIARMFASDPDIFILDE
FT                   PTTGMDAGTKDAFYQLMHHSAKKHGKSVLMITHDPDELNKYADRNIHLVRDQQSPWRCF
FT                   NVHEADEEVAHV"
FT   misc_feature    102071..102631
FT                   /locus_tag="SSUBM407_0108"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 3.7e-45"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    102398..102442
FT                   /locus_tag="SSUBM407_0108"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        102684..103496
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0109"
FT                   /product="ABC transporter permease protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0114"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54941"
FT                   /db_xref="GOA:A0A0H3MSR7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSR7"
FT                   /protein_id="CAZ54941.1"
FT                   /translation="MFDLSVFHYDFMQRAFLAIIAMSLFSPILGVFLILRRQSLMSDTL
FT                   SHVSLAGVAFGLVLGISPTLSTVLVVIVAAVFLEYLRTIYKNFMEIGTAILMSTGLAIS
FT                   LIVMNKSGGKSGLSLEQYLFGSIVTISQEQVIALFTIAVIVIVLTLLFLRPMYILTFDE
FT                   DTAFVDGLPVRAMSIAFNVVTGVAIALMIPAAGALLVSTIMVLPASIALRLGKSFKAVI
FT                   FTGMGIGFFGMVMGLLTSYYAETPASASITLIFISIFLLVNVVQKFKK"
FT   misc_feature    102705..103481
FT                   /locus_tag="SSUBM407_0109"
FT                   /note="HMMPfam hit to PF00950, ABC-3, score 2.3e-102"
FT                   /inference="protein motif:HMMPfam:PF00950"
FT   misc_feature    join(102726..102788,102849..102917,102945..103004,
FT                   103089..103157,103215..103283,103344..103412,
FT                   103425..103478)
FT                   /locus_tag="SSUBM407_0109"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUBM407_0109 by TMHMM2.0 at aa 15-35, 56-78, 88-107,
FT                   136-158, 178-200, 221-243 and 248-265"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        103506..105017
FT                   /transl_table=11
FT                   /gene="adcA"
FT                   /locus_tag="SSUBM407_0110"
FT                   /product="zinc-binding protein AdcA precursor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0115"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54942"
FT                   /db_xref="GOA:A0A0H3MX63"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX63"
FT                   /protein_id="CAZ54942.1"
FT                   /translation="MKKVGLLFLSVSALLLGACGNSTASEDGKLNIVTTFYPVYEFTKQ
FT                   VAGDEANVDLLVKAGTEVHGYEPSAKDIARIQEADAFVYENENMETWVHDVEKSLDTTK
FT                   VNVISATEGMLLLPGGEEEHEGHDHSEEGHSHAYDPHVWLSPERAITLVENIRDSLVAK
FT                   YPEKKDAFETNAAAYIEKLDALDAKYSETLSAAKQKYFVTQHTAFAYLALDYGLKQVSI
FT                   TGVAADEDPTPSRLAELTEYINKYGIKYIYFEENASKSVAETLAKETGVQLDVLNPLES
FT                   LTDEDMKNGKDYISVMEDNLIALEKTTSQEGSEILPEEGAETAQTVYNGYFEDSAVKDR
FT                   TLSDYAGEWQSVYPYLLDGTLDQVWDYKAKIKGGMTAEEYKTYYDTGYKTDVDQINITD
FT                   NTMEFVVGDKKEKFTYKYVGYKILTYKKGNRGVRFLFEATDANAGNYKYVQFSDHNIAP
FT                   VKTGHFHIYFGGESQEKLLEELENWPTYYPVGLTGLEIGQEMLAH"
FT   sig_peptide     103506..103577
FT                   /gene="adcA"
FT                   /locus_tag="SSUBM407_0110"
FT                   /note="Signal peptide predicted for SSUBM407_0110 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.459 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    103527..104432
FT                   /gene="adcA"
FT                   /locus_tag="SSUBM407_0110"
FT                   /note="HMMPfam hit to PF01297, SBP_bac_9, score 9.6e-101"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   misc_feature    104469..105014
FT                   /gene="adcA"
FT                   /locus_tag="SSUBM407_0110"
FT                   /note="HMMPfam hit to PF09223, YodA, score 2e-136"
FT                   /inference="protein motif:HMMPfam:PF09223"
FT   CDS_pept        105102..105590
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="SSUBM407_0111"
FT                   /product="putative negative regulator of copper transport
FT                   operon"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0116"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54943"
FT                   /db_xref="GOA:A0A0H3MSZ4"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ4"
FT                   /protein_id="CAZ54943.1"
FT                   /translation="MLGGECVEQTISAAEWQVMRVLWAHPGATSQEIIQALQEGFDWQA
FT                   TTIKTLLGRLRKKNYLRMAKETSKYHYYPLISEEEHLQGQVELLLAAICSTKQGQLVEK
FT                   LLDTGTFSKKSLENLASKISQLQRTAPEQIACRCLAGQCTCGHHHTLRKSTSDVVDLT"
FT   misc_feature    105132..105476
FT                   /gene="copY"
FT                   /locus_tag="SSUBM407_0111"
FT                   /note="HMMPfam hit to PF03965, Pencillinase_R, score 5e-36"
FT                   /inference="protein motif:HMMPfam:PF03965"
FT   CDS_pept        105607..105774
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0112"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0117"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1L7"
FT                   /protein_id="CAZ54944.1"
FT                   /translation="MELYSLLPENAKVVGFYLLLEKRRRSLYFQPSKVPRTFEASLNLI
FT                   FIEYKKGERT"
FT   CDS_pept        105771..105980
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="SSUBM407_0113"
FT                   /product="putative copper chaperone CopZ"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0118"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54945"
FT                   /db_xref="GOA:A0A0H3MT28"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT28"
FT                   /protein_id="CAZ54945.1"
FT                   /translation="MKQTLKLKNLSCQNCVKHVTNHLLDLDGVEEVKIQLEEQLAEVAT
FT                   SVAYDLERYQEVLEDTIYEVEELV"
FT   misc_feature    105780..105971
FT                   /gene="copZ"
FT                   /locus_tag="SSUBM407_0113"
FT                   /note="HMMPfam hit to PF00403, HMA, score 4.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    105789..105878
FT                   /gene="copZ"
FT                   /locus_tag="SSUBM407_0113"
FT                   /note="ScanRegExp hit to PS01047, HMA_1, score NA"
FT                   /inference="protein motif:Prosite:PS01047"
FT   CDS_pept        complement(106008..106385)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0114"
FT                   /product="putative histidine triad (HIT) protein"
FT                   /EC_number="3.6.1.17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0119"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54946"
FT                   /db_xref="GOA:A0A0H3MSS1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSS1"
FT                   /protein_id="CAZ54946.1"
FT                   /translation="MTCIFCHQIEEIDILYQTEYFKVVWDIDPIQTGHLLIISKDHYDT
FT                   LSQVPPTIRYELSDLEVFLTEKLCQTLAIDGVTTACNDRLFNAGTHFHVHLIPRFRSDG
FT                   FWDQISLAQAQLDLTHFLKAL"
FT   misc_feature    complement(106080..106361)
FT                   /locus_tag="SSUBM407_0114"
FT                   /note="HMMPfam hit to PF01230, HIT, score 5e-06"
FT                   /inference="protein motif:HMMPfam:PF01230"
FT   CDS_pept        complement(106443..107699)
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SSUBM407_0115"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0120"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54947"
FT                   /db_xref="GOA:A0A0H3MX69"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX69"
FT                   /protein_id="CAZ54947.1"
FT                   /translation="MNIFEELKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKDTVDGWVTKIQGQ
FT                   LSRFLDFENGDNKAEMVNNYDWFSDISFIDFLRDVGKYYTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRRKADKSGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   KQFDAARHERLAQKILAKEVVTLVHGEEAYNQALNITEQLFAGNIKNLSAKELKQGLSN
FT                   VPNYAVQAEDNLNIVELLVTSGIVNSKRQAREDVQNGAIYVNGERVQDLDYTLSDSDKI
FT                   DGELTVIRRGKKKYSVLTY"
FT   misc_feature    complement(106503..106646)
FT                   /gene="tyrS"
FT                   /locus_tag="SSUBM407_0115"
FT                   /note="HMMPfam hit to PF01479, S4, score 4.9e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    complement(106731..107624)
FT                   /gene="tyrS"
FT                   /locus_tag="SSUBM407_0115"
FT                   /note="HMMPfam hit to PF00579, tRNA-synt_1b, score
FT                   2.6e-110"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   misc_feature    complement(107553..107585)
FT                   /gene="tyrS"
FT                   /locus_tag="SSUBM407_0115"
FT                   /note="ScanRegExp hit to PS00178, AA_TRNA_LIGASE_I, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS_pept        107853..110276
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUBM407_0116"
FT                   /product="putative penicillin-binding protein 1B"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0121"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   orthologues, for example Streptococcus pneumoniae Pbp1B
FT                   penicillin-binding protein 1B UniProt:Q75YI4
FT                   (EMBL:AB119810) (820 aa) fasta scores: E()=2.5e-164,
FT                   57.755% id in 793 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54948"
FT                   /db_xref="GOA:A0A0H3MSZ8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ8"
FT                   /protein_id="CAZ54948.1"
FT                   /translation="MATKSDKQDFKKKISALGLGDVVGVFLRTLKLLFNSVAVLVFLFG
FT                   LFGAGIGIGFVVSLFDDVKIPKTEELVAKVSEVSRISTVTYSDGSLVSEVNSDLLRVPI
FT                   TSEEVSNYLKQAVIATEDETFETHNGVVPKAVLRAALGSVGLGSSSGGSTLTQQLIKQQ
FT                   LVGDAPTFTRKANEIVSALALERNMTKEEILTIYLNVSPFGRNNQGRNIAGVEAAAQGI
FT                   FGKPAKDLTVPQAAFIAGLPQSPIVYSPYASDGTRKSDEDMVYGIERYQDVLFNMYRAS
FT                   FLTKEEYETYKAYDIKQDFIAPAPVMADTKDYLYYKVMEEAQEVMFDYLVKRDKVSKND
FT                   LKNDETKASYEELAKQELSQGGYTIKSTVDQKIYAAMQSVVANYGSVLDDGNEYVETGS
FT                   VLIDNATGAILGFVGGRDYATNQNNHAFDTLRSPASTIKPLLAYGIAIDQGLIGSASIL
FT                   SDYPTNFSSGQPIMYGSGRGTGMMNLQTAIDRSVNIPAFWTYKMMRNAGVDAKAYMDKM
FT                   NYHIPMYDIESVPLGGGVEISVLTNTNAYQTLANGGVYNKHYIVESITASDGTVVYQHE
FT                   ATPVQVYSKATASIMNQLLRQVVNSGYTTTFKSRLSGLNPQAASSDFVGKTGTSNEVND
FT                   VWLMLSTPRVTLGTWAGNDDNSEMYVWTGYHNNSQYVAHMVDALYNVNADMFAGKFELD
FT                   SSVIASSVVASTGQRAGTTQVNGRQVTVGGAMTTSYWAKNGAPVTSYNFMVGGTDSDRA
FT                   QAWNTIIGSQTATSSSSTQRSSSTRSSTSSSANNTNQSSETQTATSEQANNDSP"
FT   misc_feature    107961..108029
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUBM407_0116"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0116 by TMHMM2.0 at aa 37-59"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    108096..108614
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUBM407_0116"
FT                   /note="HMMPfam hit to PF00912, Transgly, score 2.8e-79"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    109041..109739
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUBM407_0116"
FT                   /note="HMMPfam hit to PF00905, Transpeptidase, score
FT                   1.8e-24"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    109284..109334
FT                   /gene="pbp1B"
FT                   /locus_tag="SSUBM407_0116"
FT                   /note="ScanRegExp hit to PS00237, G_PROTEIN_RECEP_F1_1,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00237"
FT   CDS_pept        complement(110542..110649)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0117"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0121A"
FT                   /note="Possible gene remnant. Similar to an internal region
FT                   of Streptococcus pyogenes (serotype M3) pure putative
FT                   phosphoribosylaminoimidazole carboxylase I UniProt:Q8K8Y3
FT                   (EMBL:AE014136) (203 aa) fasta scores: E()=0.041, 81.250%
FT                   id in 16 aa"
FT   CDS_pept        complement(110735..110854)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0118"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0121B"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus pyogenes (serotype M6) hypothetical
FT                   protein UniProt:Q5XCE9 (EMBL:CP000003) (95 aa) fasta
FT                   scores: E()=9.1e-06, 71.875% id in 32 aa"
FT   CDS_pept        110911..114483
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0122"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54951"
FT                   /db_xref="GOA:A0A0H3N1M1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1M1"
FT                   /protein_id="CAZ54951.1"
FT                   /translation="MAGHEVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDYGL
FT                   KEVFEDVLPVSNFTDTMELEFVGYELKEPKYTLEEARAHDANYSAPIYVTFRLVNKETG
FT                   EIKTQEVFFGEFPIMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVRNTIE
FT                   KDIHKNPADSRTDEALKEIYERLRPGEPKTAESSRSLLTARFFDPRRYDLAPVGRYKIN
FT                   KKLNLRTRLLNQTLAEHVINGETGEIVLEAGTVLSRDVLEKVEAQFDELNLVEYIPNDN
FT                   AVLLEPVLLQKFKIVAPKDPERVVTVIGNANPAENVRTVTPADILAEMSYFLNLAEGLG
FT                   RVDDIDHLGNRRIRAVGELLANQVRIGLTRMERNLRERMSVQDNEVLTPQQIINIRPVT
FT                   AAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGRM
FT                   CPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKIDRATGTVTNEIVWLTADEEDAYI
FT                   VAQSTSPLDENNRFVDKIVMGRHQGNNQEFPADSADFMDVSPKQVVAVATACIPFLEND
FT                   DSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAIIAQHDGKVVYADADKVE
FT                   VRREDGSLDVYHISKFRRSNSGTAYNQRTLVKLGDIVEKGDFIADGPSMENGEMALGQN
FT                   PIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTKLGPEEITREIPNVG
FT                   EDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTS
FT                   LRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVV
FT                   SRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFDG
FT                   ASSEDLWSTVKEAGMDSDAKTILYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARSV
FT                   GPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYEA
FT                   ITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDNNEVELRDLDEGEDDDIIHVDDL
FT                   EKARAKAAADAAAAFAAEEAEGKE"
FT   misc_feature    110992..112314
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="HMMPfam hit to PF04563, RNA_pol_Rpb2_1, score 1e-49"
FT                   /inference="protein motif:HMMPfam:PF04563"
FT   misc_feature    111328..111888
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="HMMPfam hit to PF04561, RNA_pol_Rpb2_2, score
FT                   2.1e-15"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    112015..112149
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="HMMPfam hit to PF04561, RNA_pol_Rpb2_2, score
FT                   1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    112324..112533
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="HMMPfam hit to PF04565, RNA_pol_Rpb2_3, score
FT                   4.7e-40"
FT                   /inference="protein motif:HMMPfam:PF04565"
FT   misc_feature    112936..114102
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="HMMPfam hit to PF00562, RNA_pol_Rpb2_6, score
FT                   9e-215"
FT                   /inference="protein motif:HMMPfam:PF00562"
FT   misc_feature    113659..113697
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="ScanRegExp hit to PS01166, RNA_POL_BETA, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    114106..114336
FT                   /gene="rpoB"
FT                   /locus_tag="SSUBM407_0119"
FT                   /note="HMMPfam hit to PF04560, RNA_pol_Rpb2_7, score
FT                   2.9e-49"
FT                   /inference="protein motif:HMMPfam:PF04560"
FT   CDS_pept        114661..118308
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SSUBM407_0120"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0123"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54952"
FT                   /db_xref="GOA:A0A0H3MT34"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT34"
FT                   /protein_id="CAZ54952.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERDG
FT                   LFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPISHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEHKSIMTEREYRERLREYG
FT                   YGSFVAKMGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKAVRRLDVLDAFYKSGN
FT                   KPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARDIAGNVKAAKRLIERGDDRIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMVF
FT                   KDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKVMMTTVGKILFNAIMPEGLP
FT                   YLQEPNNANLTEGTPDKYFLEPGSDIKAAIAELPINPPFKKKNLGNIIAEIFKRFRTTE
FT                   TSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQIKKQFRRGMITD
FT                   DERYAAVTDEWRSAKEKLEKRLVEKQDPKNPIVMMMDSGARGNISNFSQLAGMRGLMSA
FT                   PNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLDIRSITDGKEMIEPLEERLQGRYTKKTVKHPETGAVIIGPNQLITED
FT                   IACEIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGEP
FT                   GTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKGEAVITEVKGEVIAIEEDASTR
FT                   TKKVFVKGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGSIQPKRLLEVRDVLAVETY
FT                   LLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDTDLLMGTLMDITDFTDANAE
FT                   VVIAGGIPATARPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKRDNLLGLKEN
FT                   VIIGKIIPAGTGMARYRNLEPQAINEVEIIEDTVAEELAAEAELEAVTE"
FT   misc_feature    114670..115656
FT                   /gene="rpoC"
FT                   /locus_tag="SSUBM407_0120"
FT                   /note="HMMPfam hit to PF04997, RNA_pol_Rpb1_1, score
FT                   1e-150"
FT                   /inference="protein motif:HMMPfam:PF04997"
FT   misc_feature    115660..116088
FT                   /gene="rpoC"
FT                   /locus_tag="SSUBM407_0120"
FT                   /note="HMMPfam hit to PF00623, RNA_pol_Rpb1_2, score
FT                   3.3e-83"
FT                   /inference="protein motif:HMMPfam:PF00623"
FT   misc_feature    116095..116649
FT                   /gene="rpoC"
FT                   /locus_tag="SSUBM407_0120"
FT                   /note="HMMPfam hit to PF04983, RNA_pol_Rpb1_3, score
FT                   1.8e-68"
FT                   /inference="protein motif:HMMPfam:PF04983"
FT   misc_feature    116734..116964
FT                   /gene="rpoC"
FT                   /locus_tag="SSUBM407_0120"
FT                   /note="HMMPfam hit to PF05000, RNA_pol_Rpb1_4, score 1e-25"
FT                   /inference="protein motif:HMMPfam:PF05000"
FT   misc_feature    116968..118074
FT                   /gene="rpoC"
FT                   /locus_tag="SSUBM407_0120"
FT                   /note="HMMPfam hit to PF04998, RNA_pol_Rpb1_5, score
FT                   3.9e-79"
FT                   /inference="protein motif:HMMPfam:PF04998"
FT   CDS_pept        118458..118823
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0124"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54953"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSS6"
FT                   /protein_id="CAZ54953.1"
FT                   /translation="MYQVIKMYGDFEPWWFLDGWEEDVTSRAAFDRYEDALNAFQKEWV
FT                   RLSEDFPMKKSKNGTMVAFWDESDQHWCEECDEYLQRYHSLMLVEARENLPAGFIKQPT
FT                   QPRVRPCKLKQNNCVNE"
FT   misc_feature    118458..118805
FT                   /locus_tag="SSUBM407_0121"
FT                   /note="HMMPfam hit to PF06279, DUF1033, score 8.7e-58"
FT                   /inference="protein motif:HMMPfam:PF06279"
FT   CDS_pept        complement(join(118858..119190,119190..119801))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0122"
FT                   /product="putative microcin immunity protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0125"
FT                   /note="CDS contains a frameshift after codon 204. Similar
FT                   to Escherichia coli MccF microcin C7 self-immunity protein
FT                   MccF UniProt:Q47511 (EMBL:ECPMC7A) (344 aa) fasta scores:
FT                   E()=1.2e-10, 31.776% id in 321 aa"
FT                   /db_xref="PSEUDO:CAZ54954.1"
FT   misc_feature    complement(join(118888..119190,119190..119774))
FT                   /locus_tag="SSUBM407_0122"
FT                   /note="HMMPfam hit to PF02016, Peptidase_S66, score
FT                   3.8e-96"
FT                   /inference="protein motif:HMMPfam:PF02016"
FT   CDS_pept        119887..120837
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0123"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0126"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54955"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX74"
FT                   /protein_id="CAZ54955.1"
FT                   /translation="MIQEKARKMIEEAVADRVSDIYLVPRGECYQVYHRIMDDREFVQD
FT                   LAEEEVTAIISHFKFLAGLNVGEKRRSQQGSCDYDYGSGEISLRLSTVGDYRGKESLVI
FT                   RLLYDNDKELKFWFEAAERLAEEIKGRGLYLFSGPVGSGKTTLMYHLARLKFPDKQILT
FT                   IEDPVEIKQEDMLQLQLNEAIGATYDNLIKLSLRHRPDLLIIGEIRDAETARAVIRASL
FT                   TGATVFSTVHARSISGVYARMLELGVGPEELNNALQGIAYQRLIGGGGVVDFAKGNYQN
FT                   HSADQWNAQIDRLFAAGHISLRQAETEKITLGSPA"
FT   misc_feature    119887..120693
FT                   /locus_tag="SSUBM407_0123"
FT                   /note="HMMPfam hit to PF00437, GSPII_E, score 2.5e-38"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    120472..120516
FT                   /locus_tag="SSUBM407_0123"
FT                   /note="ScanRegExp hit to PS00662, T2SP_E, score NA"
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS_pept        120758..121786
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0124"
FT                   /product="putative competence protein"
FT                   /product="competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0127"
FT                   /note="CDS differs in the length of the N-terminus in
FT                   comparison to orthologues, for example, similar to Bacillus
FT                   subtilis ComG operon protein 2 UniProt:P25954
FT                   (EMBL:BSJH6421) (323 aa) fasta scores: E()=5.6e-08, 25.000%
FT                   id in 324 aa. Possible alternative translational start site
FT                   after codons 5 and 22"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54956"
FT                   /db_xref="GOA:A0A0H3MT03"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT03"
FT                   /protein_id="CAZ54956.1"
FT                   /translation="MIGFLQQDISVFGRQKQKKLPLARQRKVIELFNNLFASGFHLGEI
FT                   VDFLKRSQLLADPYTQVLSDGLLAGKPFSSLLADLRFSDAVVTQVALAEVHGNTSLSLI
FT                   HIQSYLENVSKVRKKLIEVATYPIILLGFLLLIMLGLKNYLLPQLEEGNAATVLINHLP
FT                   TIFLSLSGLSLVAVLAGMVWFRKTNKIKVFSCLAALPFFGKLIQTYLTAYYAREWGSLI
FT                   GQGLDLPQIVGLMQEQQSQLFREIGQDLEQSLSNGQSFHEHIKTYAFFKRELSLIVEYG
FT                   QVKSKLGSELTVYAAECWEDFFSRVNRAMQLIQPLVFLFVALMVVLIYAAMLLPIYQNM
FT                   EL"
FT   misc_feature    120839..121198
FT                   /locus_tag="SSUBM407_0124"
FT                   /note="HMMPfam hit to PF00482, GSPII_F, score 4.6e-13"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   misc_feature    join(121115..121183,121241..121309,121700..121768)
FT                   /locus_tag="SSUBM407_0124"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0124 by TMHMM2.0 at aa 120-142, 162-184 and
FT                   315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    121397..121762
FT                   /locus_tag="SSUBM407_0124"
FT                   /note="HMMPfam hit to PF00482, GSPII_F, score 3.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   CDS_pept        121788..122069
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SSUBM407_0125"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0128"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54957"
FT                   /db_xref="GOA:A0A0H3N1M4"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1M4"
FT                   /protein_id="CAZ54957.1"
FT                   /translation="MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKK
FT                   GDAAVVKVVESQMELYELEHDEEATVADLQAKGYITEKQAKQYATAKK"
FT   sig_peptide     121788..121931
FT                   /gene="comYC"
FT                   /locus_tag="SSUBM407_0125"
FT                   /note="Signal peptide predicted for SSUBM407_0125 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.602) with
FT                   cleavage site probability 0.602 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121815..121886
FT                   /gene="comYC"
FT                   /locus_tag="SSUBM407_0125"
FT                   /note="HMMPfam hit to PF07963, N_methyl, score 7.4e-07"
FT                   /inference="protein motif:HMMPfam:PF07963"
FT   misc_feature    121815..121877
FT                   /gene="comYC"
FT                   /locus_tag="SSUBM407_0125"
FT                   /note="ScanRegExp hit to PS00409, PROKAR_NTER_METHYL, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00409"
FT   misc_feature    121824..121892
FT                   /gene="comYC"
FT                   /locus_tag="SSUBM407_0125"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0125 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122050..122457
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0126"
FT                   /product="putative competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0129"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT39"
FT                   /protein_id="CAZ54958.1"
FT                   /translation="MLRRKNKAFTLFESLLTLLVVSFLAVSLSGTVQTVFRSVQEEIFL
FT                   WEFEAIYKDSQKLAASSHKKVNLAIGGQEVTNGYQAVEVPRNVEVLEEKTIQFEEDGGN
FT                   SSLTKIRFHLSQKIVTYQLYIGSGRYKKTEE"
FT   sig_peptide     122050..122151
FT                   /locus_tag="SSUBM407_0126"
FT                   /note="Signal peptide predicted for SSUBM407_0126 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.963) with
FT                   cleavage site probability 0.732 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    122083..122151
FT                   /locus_tag="SSUBM407_0126"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0126 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122429..122722
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0127"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0130"
FT                   /note="Possible alternative translational start site after
FT                   codon 13"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54959"
FT                   /db_xref="GOA:A0A0H3MST1"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MST1"
FT                   /protein_id="CAZ54959.1"
FT                   /translation="MVAIRKQKNKAYILLESLVALATLVTICSLILSAVDAGRRRQVWE
FT                   LEQQEVFNLAQMAVQTKQDDLALNGVAVQVQRTAERVAVFHEGKEVLSVVKK"
FT   sig_peptide     122429..122530
FT                   /locus_tag="SSUBM407_0127"
FT                   /note="Signal peptide predicted for SSUBM407_0127 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.947) with
FT                   cleavage site probability 0.710 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    122465..122533
FT                   /locus_tag="SSUBM407_0127"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0127 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        122709..123143
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0128"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0131"
FT                   /note="Possible upstream alternative translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54960"
FT                   /db_xref="GOA:A0A0H3MX79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX79"
FT                   /protein_id="CAZ54960.1"
FT                   /translation="MLKSKIPAFTLLECLVVLVILSGSLLIFEGLSKLLVQEAHYQGQT
FT                   VQKEWLVFSSQLRSEWDQAELVKVENGKVYVNKGEQALAFGKSWSDDFRKTNDRGQGYQ
FT                   PMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS"
FT   misc_feature    122724..122792
FT                   /locus_tag="SSUBM407_0128"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0128 by TMHMM2.0 at aa 6-28"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        join(123121..123432,123436..123531)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0129"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0132"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   104. Similar to Streptococcus suis (strain 98HAH33)
FT                   putative uncharacterized protein UniProt:A4VYV5
FT                   (EMBL:CP000408) (136 aa) fasta scores: E()=3.7e-50, 99.265%
FT                   id in 136 aa"
FT                   /db_xref="PSEUDO:CAZ54961.1"
FT   misc_feature    123145..123213
FT                   /locus_tag="SSUBM407_0129"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0129 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        123588..124541
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0133"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54962"
FT                   /db_xref="GOA:A0A0H3MT08"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT08"
FT                   /protein_id="CAZ54962.1"
FT                   /translation="MNFEKIEQAYDLLLENVQTIQNQLGTNIYDAMIEQNATYVAGQHE
FT                   TDLVVKNNQTLKQLDLTKEEWRRAYQFLLIKANQTEPMQYNHQFTPDSIGFILSFLVDQ
FT                   LVPTQKVTVLEIGSGTGNLAQTILNASQKELDYLGIEVDDLLIDLSASIADVMQADISF
FT                   AQGDAVRPQILKESQVILGDLPIGYYPDDQIASRYQVASPKEHTYAHHLLMEQSLKYLE
FT                   KDGFAILLAPNDLLTSPQSDLLKGWLQEQANIVAMIALPPNLFGKTAMAKSIFVLQKKA
FT                   ARSLTPFVYPLQSLQEPEAIQKFMLNFKNWKQENAI"
FT   misc_feature    124074..124118
FT                   /locus_tag="SSUBM407_0130"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        124591..125778
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SSUBM407_0131"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0134"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54963"
FT                   /db_xref="GOA:A0A0H3N1M6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1M6"
FT                   /protein_id="CAZ54963.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEETVLAAGIVERIGLNDSISTVK
FT                   YDGKKESEVLDIPNHTVAVKILLEDLLKHNIIAAYEEITGIGHRVVAGGEIFKESVVIG
FT                   PKEVEQIEELSALAPLHNPAHVAAMRAFEEVLPEVLNVAVFDTAFHTTMPKHAYLYPIP
FT                   QKYYTDHKVRKYGAHGTSHYYVAHEAAKVLGRPIEELKLITAHIGNGVSITANYHGESV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIANVEELKDAADVVNMLNKQSGLFGVSGFS
FT                   SDMRDIEAGIQAHNPDAVLAYNIFIDRIKKFIGQYLAVLNGADAIVFTAGMGENAPLMR
FT                   NDVVEGLSWFGIELDPEKNVFGNYGDISTAESRVRVLVIPTDEELVIAREVERLK"
FT   misc_feature    124597..125757
FT                   /gene="ackA"
FT                   /locus_tag="SSUBM407_0131"
FT                   /note="HMMPfam hit to PF00871, Acetate_kinase, score
FT                   6.1e-201"
FT                   /inference="protein motif:HMMPfam:PF00871"
FT   misc_feature    124600..124635
FT                   /gene="ackA"
FT                   /locus_tag="SSUBM407_0131"
FT                   /note="ScanRegExp hit to PS01075, ACETATE_KINASE_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01075"
FT   misc_feature    125194..125247
FT                   /gene="ackA"
FT                   /locus_tag="SSUBM407_0131"
FT                   /note="ScanRegExp hit to PS01076, ACETATE_KINASE_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01076"
FT   CDS_pept        126092..126643
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0132"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0135"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54964"
FT                   /db_xref="GOA:A0A0H3MT43"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT43"
FT                   /protein_id="CAZ54964.1"
FT                   /translation="MEKKIPKLTVQLLAAIAMTLALVMIAENHFSVRLSDTLQVQFTFI
FT                   PNTILGAIAGPVWAAVFAAISDPAFVLFSGQSMLFSFILIEAVSAFIYGWFFYRKPLDT
FT                   KNKADWLYVAGVVVLIQVVISFIMTPIALHFHFGTPWIVLYSSRLIKAVFEIPLRIVVT
FT                   MLVLPSLQKIPELAKLMGIK"
FT   sig_peptide     126092..126268
FT                   /locus_tag="SSUBM407_0132"
FT                   /note="Signal peptide predicted for SSUBM407_0132 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.791) with
FT                   cleavage site probability 0.391 between residues 59 and 60"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(126119..126187,126221..126289,126317..126385,
FT                   126419..126487)
FT                   /locus_tag="SSUBM407_0132"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0132 by TMHMM2.0 at aa 10-32, 44-66, 76-98 and
FT                   110-132"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        126699..127955
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SSUBM407_0133"
FT                   /product="folypolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0136"
FT                   /note="Weakly similar to SSU0054, 35.680% identity (37.789%
FT                   ungapped) in 412 aa overlap (9-411:5-402)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54965"
FT                   /db_xref="GOA:A0A0H3MST6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MST6"
FT                   /protein_id="CAZ54965.1"
FT                   /translation="MNYQETRRWLSSRPASDLENGVARVNWILERLDNPQLQVPTVHFV
FT                   GTNGKGSTLNALQSILRSSDYTVGRFTSPSIIDFREQIVFEQEMISEEDFARIVTDLQP
FT                   LIEDLDQTAGLDAISEFEIVVVAMFVYFAHYQRPDILLVEAGMGGLQDATNVLAPLAVV
FT                   CPSIGLDHQAFLGETHAAIARHKVAVLRERVPLLYATDQSEVVAAFEDHASQLQSPTYA
FT                   VGREILLENSRAGFAVSSTLGRVEELTLQMQGRHQEVNAALAVTTAQLLSPDFPTITNE
FT                   TIRQGLSQAIWPGRLELIRPNLMIDGAHNNESIAVLTQLLEEKYADRDIEILFAAINTK
FT                   PVDQMLSQLSQFGPVSVTTFDDFRAVQLGDYPSGYERVQTYQEWLEQVDLDNPKQLYLI
FT                   TGSLYFITYVRKYILEELV"
FT   misc_feature    127122..127169
FT                   /gene="folC"
FT                   /locus_tag="SSUBM407_0133"
FT                   /note="ScanRegExp hit to PS01012, FOLYLPOLYGLU_SYNT_2,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS01012"
FT   misc_feature    127572..127802
FT                   /gene="folC"
FT                   /locus_tag="SSUBM407_0133"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 0.0047"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        complement(128000..129061)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SSUBM407_0134"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0137"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54966"
FT                   /db_xref="GOA:A0A0H3MX84"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX84"
FT                   /protein_id="CAZ54966.1"
FT                   /translation="MTLFGKIKEVTELQSLPGFEGQVRNHIRQKITPHVDRIETDGLGG
FT                   IFGIKDTAVENAPRILVVAHMDEVGFMISQIKPDGTFRVVELGGWNPLVVSSQAFTLQL
FT                   QDGRTIPAISGSVPPHLSRGANAPGMPAIADIIFDAGFANYDEAWAFGVRPGDVLIPKN
FT                   ETILTANGKNVISKAWDNRFGVLMVTELLESLSGQALPNQLIAGANVQEEVGLRGAHAS
FT                   TTKFNPDIFLAVDCSPAGDIYGDQGKIGDGTLLRFYDPGHIMLKNMKDFLLTTAEEAGV
FT                   KFQYYCGKGGTDAGAAHLKNHGVPSTTIGVCARYIHSHQTLYSMDDFLEAQAFLQTIVK
FT                   KLDRSTVDLIKNY"
FT   misc_feature    complement(128060..128932)
FT                   /gene="pepA"
FT                   /locus_tag="SSUBM407_0134"
FT                   /note="HMMPfam hit to PF05343, Peptidase_M42, score
FT                   1.2e-126"
FT                   /inference="protein motif:HMMPfam:PF05343"
FT   CDS_pept        129754..130038
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0135"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0139"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54967"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT12"
FT                   /protein_id="CAZ54967.1"
FT                   /translation="MKKKKTALLAGLLGAGVLTASAQFYRKIQEDRKKAQALQEVRDFF
FT                   ADLGEIATVYVDETASTQTTLIGGVVMEAGQVFLFENTKGSIQYREEER"
FT   sig_peptide     129754..129819
FT                   /locus_tag="SSUBM407_0135"
FT                   /note="Signal peptide predicted for SSUBM407_0135 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.959 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    129772..129828
FT                   /locus_tag="SSUBM407_0135"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0135 by TMHMM2.0 at aa 7-25"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        130035..130355
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0136"
FT                   /product="putative thioredoxin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0140"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54968"
FT                   /db_xref="GOA:A0A0H3N1N1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1N1"
FT                   /protein_id="CAZ54968.1"
FT                   /translation="MIFPTNHEEVAALIEDGKPTVFLFVTTWCGDCHYIKPHVPAIEEA
FT                   FPDLRFVQLDRDDFMPLAQEWAILGIPSLVVLENGKEIGRFVDKNRKTKEEIMNFLSGL
FT                   GR"
FT   misc_feature    130035..130346
FT                   /locus_tag="SSUBM407_0136"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 3e-05"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   CDS_pept        130400..131356
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0137"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0141"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54969"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT47"
FT                   /protein_id="CAZ54969.1"
FT                   /translation="MKKSLGKILLAPVVLGLSLSLAPLVQAEIQTDVINEKWGKPTLVY
FT                   GGGLSDAQATEVNNLFGISDVNNVSRQVVVGTDMDQYLGTSEADTASLYSSVLVQKQDA
FT                   GKGVVVDIKTPQNITLITETQYANAAITAGATDVLIDVASPIQVTGESALTGVYKALAA
FT                   NGETVDTARTEVAQQELETVNEVATAHTGDTNFDSSALDKAVAEIKTALADYKKSNGQV
FT                   ASEADINTIINDVLAQNGLENVITADEVSKLVTFAKAYQETSAIDSAEVAAQLNQFKQQ
FT                   AEQQISEAYKNLQDSGILEKIGAFFENLWKGLTGLFA"
FT   sig_peptide     130400..130480
FT                   /locus_tag="SSUBM407_0137"
FT                   /note="Signal peptide predicted for SSUBM407_0137 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.996 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    130532..131236
FT                   /locus_tag="SSUBM407_0137"
FT                   /note="HMMPfam hit to PF06207, DUF1002, score 4.5e-47"
FT                   /inference="protein motif:HMMPfam:PF06207"
FT   CDS_pept        131375..131998
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0138"
FT                   /product="putative tRNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0142"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54970"
FT                   /db_xref="GOA:A0A0H3MSU1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSU1"
FT                   /protein_id="CAZ54970.1"
FT                   /translation="MIFTYNKEHVGDVLMVIVAEDKGQAVQFERKGQVARVFLEETGKT
FT                   VAWNIFEASSLVELDGNGQVFLTDEQVATLNAELAKEGFTESLVNDNAPKFVVGQIVEL
FT                   VPHPDSDHLNICQVNVGDKTVQIVAGAPNAAQGLKTIVALPGAMMPSGSLIFPGKLRGE
FT                   DSFGMMCSPRELALPNAPQVRGIIELDDSAVVGEAFDPAKHWKG"
FT   misc_feature    131660..131968
FT                   /locus_tag="SSUBM407_0138"
FT                   /note="HMMPfam hit to PF01588, tRNA_bind, score 3.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01588"
FT   CDS_pept        complement(132031..132810)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0143"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54971"
FT                   /db_xref="InterPro:IPR021247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX90"
FT                   /protein_id="CAZ54971.1"
FT                   /translation="MKEFLMEKIQTSQPYTNAELDWLLENIGHPDPTIRDELVYASFCH
FT                   IFLEGLITREQAQSLLQFSQETKPFSLEGPTQKRSFTCLLYCLLLSVDNEPESIYHAFL
FT                   STDDHELLFQQALDYLTIENDWSGYDEKLGWIHTAAHGADFLLATSCHDQFPAEKSKEV
FT                   WQTIVTCLTKQSKVFSAGEEIRLAQIPVYLLLNEKVSSQELTEWISKLDFPNQEPVDYF
FT                   RWLNLQHFLSSLYFQLKSQQASTEEIEQAIEGKIEPA"
FT   CDS_pept        132865..133260
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0140"
FT                   /product="putative single stranded DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0144"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54972"
FT                   /db_xref="GOA:A0A0H3MT18"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT18"
FT                   /protein_id="CAZ54972.1"
FT                   /translation="MYNKTILIGRLTAQPELTQTPTGKNLTRVTVAVNRRFKTENGERE
FT                   ADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTRKYEKDGSNHYVTEILGQSFQLLES
FT                   RAQRAMRENNTGDDLADLVLEEEELPF"
FT   misc_feature    132868..133170
FT                   /locus_tag="SSUBM407_0140"
FT                   /note="HMMPfam hit to PF00436, SSB, score 1.1e-26"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS_pept        complement(133386..133526)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0141"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1N4"
FT                   /protein_id="CAZ54973.1"
FT                   /translation="MGENDIRLPTLASLVASLFPPSLHHLFLLRSSPTFSNYHADRMVE
FT                   I"
FT   CDS_pept        133822..134103
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSUBM407_0142"
FT                   /product="10 kDa chaperonin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0146"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54974"
FT                   /db_xref="GOA:A0A0H3MT52"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT52"
FT                   /protein_id="CAZ54974.1"
FT                   /translation="MLKPLGDRIAVKIEEKEQTVGGFVLAGASQEKTKEASVLAIGQGI
FT                   RTLNGDLVAPAVAVGDTVLIDAHAGLEVKDGDQNVHIIRETDILAIVE"
FT   misc_feature    133822..134097
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSUBM407_0142"
FT                   /note="HMMPfam hit to PF00166, Cpn10, score 5.2e-28"
FT                   /inference="protein motif:HMMPfam:PF00166"
FT   misc_feature    133825..133896
FT                   /gene="groES"
FT                   /gene_synonym="groS"
FT                   /locus_tag="SSUBM407_0142"
FT                   /note="ScanRegExp hit to PS00681, CHAPERONINS_CPN10, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00681"
FT   CDS_pept        134114..135736
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSUBM407_0143"
FT                   /product="60 kDa chaperonin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0147"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54975"
FT                   /db_xref="GOA:A0A0H3MSU7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSU7"
FT                   /protein_id="CAZ54975.1"
FT                   /translation="MAKEIKFAADARESMVRGVDILADTVKVTLGPKGRNVVLEKAYGS
FT                   PLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLK
FT                   NVTAGANPIGIRRGIEAAVATAVEALKAQASPVSNKAEIAQVAAVSSRSEKVGEYISEA
FT                   MERVGTDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELENPFILITD
FT                   KKISHIQDILPLLESILQANRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGTVITEDLGLDLKDATIEALGQAAKVVVDKDGATIVEGAGNPEAI
FT                   ANRVAVIKSQIEVTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALN
FT                   ATRAAVEEGIVAGGGTALVNVIDSVAKLELKGDDETGRNIVLRALEEPVRQIAYNAGYE
FT                   GSVIIDKLKNSELGTGFNAATGEWVNMMDAGIIDPVKVTRSALQNAASVASLILTTEAV
FT                   VANKPEPAAPAMPQGMDGMGMGY"
FT   misc_feature    134177..135679
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSUBM407_0143"
FT                   /note="HMMPfam hit to PF00118, Cpn60_TCP1, score 7.5e-197"
FT                   /inference="protein motif:HMMPfam:PF00118"
FT   misc_feature    135320..135355
FT                   /gene="groEL"
FT                   /gene_synonym="groL"
FT                   /locus_tag="SSUBM407_0143"
FT                   /note="ScanRegExp hit to PS00296, CHAPERONINS_CPN60, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00296"
FT   CDS_pept        135968..136381
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SSUBM407_0144"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0148"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54976"
FT                   /db_xref="GOA:A0A0H3MX95"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MX95"
FT                   /protein_id="CAZ54976.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKG"
FT   misc_feature    135971..136375
FT                   /gene="rpsL"
FT                   /locus_tag="SSUBM407_0144"
FT                   /note="HMMPfam hit to PF00164, Ribosomal_S12, score 3e-65"
FT                   /inference="protein motif:HMMPfam:PF00164"
FT   misc_feature    136133..136156
FT                   /gene="rpsL"
FT                   /locus_tag="SSUBM407_0144"
FT                   /note="ScanRegExp hit to PS00055, RIBOSOMAL_S12, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS_pept        136398..136868
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SSUBM407_0145"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0149"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54977"
FT                   /db_xref="GOA:A0A0H3MT22"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT22"
FT                   /protein_id="CAZ54977.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTAASIVYG
FT                   AFDQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARNRGEHTMIDRLAKEIMDAANNTGAAVKKREDTHKMAEANRAFAHFRW"
FT   misc_feature    136398..136844
FT                   /gene="rpsG"
FT                   /locus_tag="SSUBM407_0145"
FT                   /note="HMMPfam hit to PF00177, Ribosomal_S7, score 1.8e-82"
FT                   /inference="protein motif:HMMPfam:PF00177"
FT   misc_feature    136455..136535
FT                   /gene="rpsG"
FT                   /locus_tag="SSUBM407_0145"
FT                   /note="ScanRegExp hit to PS00052, RIBOSOMAL_S7, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS_pept        137425..139506
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="SSUBM407_0146"
FT                   /product="elongation factor G (EF-G)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0151"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54978"
FT                   /db_xref="GOA:A0A0H3N1N7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1N7"
FT                   /protein_id="CAZ54978.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHERLQANAHPIQ
FT                   LPIGSEDEFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAEEYREKLVEAVAETD
FT                   EELMMKYLEGEEITNDELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGVNPDTDAEEERHASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKIILES
FT                   IHVPEPVIQLMVEPKSKADQDKMGIALSKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLYDGSYHDVDSS
FT                   ETAFKVAASLALKEAAKSAQPTILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAR
FT                   GNTQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQDEIIKKNGGNA"
FT   misc_feature    137446..138270
FT                   /gene="fus"
FT                   /locus_tag="SSUBM407_0146"
FT                   /note="HMMPfam hit to PF00009, GTP_EFTU, score 1.1e-114"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    137575..137622
FT                   /gene="fus"
FT                   /locus_tag="SSUBM407_0146"
FT                   /note="ScanRegExp hit to PS00301, EFACTOR_GTP, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    138388..138591
FT                   /gene="fus"
FT                   /locus_tag="SSUBM407_0146"
FT                   /note="HMMPfam hit to PF03144, GTP_EFTU_D2, score 2.7e-18"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    138853..139212
FT                   /gene="fus"
FT                   /locus_tag="SSUBM407_0146"
FT                   /note="HMMPfam hit to PF03764, EFG_IV, score 6.3e-66"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    139216..139479
FT                   /gene="fus"
FT                   /locus_tag="SSUBM407_0146"
FT                   /note="HMMPfam hit to PF00679, EFG_C, score 2.9e-48"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   repeat_region   complement(139583..139686)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        140495..142486
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0147"
FT                   /product="putative endopeptidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0152"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54979"
FT                   /db_xref="GOA:A0A0H3MT56"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT56"
FT                   /protein_id="CAZ54979.1"
FT                   /translation="MRKKLKFSLVAVACATFLTACGTSNSSAPKAGEATPQTDFHSYIN
FT                   AQWLKNTKLGAGESQIDNLSQLSEKTQEAIQEMIDQLDMDYSKLQAGSDEKKLIDFYRL
FT                   AADFDTRNKLGLEPIKPYLEEIKKASTMEELNKILVALYGKNIRNLLHINVTQDIKDSN
FT                   KNTIYVDPHELSFPKENYDGTDEFSLKNQKAFKAYLQEVFSLSGETSKEASSKADLLFN
FT                   LEKEMAAVQRPKEEANNFEAMYNEKTWDEVKALVPNLPIAELVSELGLQNAPTTVVSDP
FT                   DALKKLNELYQEKNLDALKALLQYRVIAHYNAYLSSNLIEAKAKYDGVATGAVDTPSQK
FT                   EVAQAAIDANFSDMIGKVYVKHHFSEESKANILSMVQEIKATYAERIKAVQWMSEETKM
FT                   RALKKLDTLVVKIGYPDQWKDYSQLAIQSKEEGGSLLSNFDMVKTLELREEMGQFGKPF
FT                   DKSQFGMPSHTVNAYYSPTNNEIVFPAGILQAPLYDPKASPEENLGGIGAVIGHEISHA
FT                   FDKAGSQFDEKGNLVNWWKPEDLEKFNKKVQQAADIYSKLEVAPGYYVNGEISTGEIMA
FT                   DLGGLTVAIDIAQKKGYDTKKVFESYGKAWREVTTKEFAIANISDEHPPAKYRVNNIVN
FT                   QIDQFYTDFNVKEGDPMYVKPEDRLRVW"
FT   sig_peptide     140495..140587
FT                   /locus_tag="SSUBM407_0147"
FT                   /note="Signal peptide predicted for SSUBM407_0147 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.460 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    140597..141739
FT                   /locus_tag="SSUBM407_0147"
FT                   /note="HMMPfam hit to PF05649, Peptidase_M13_N, score
FT                   2.3e-82"
FT                   /inference="protein motif:HMMPfam:PF05649"
FT   misc_feature    141905..142474
FT                   /locus_tag="SSUBM407_0147"
FT                   /note="HMMPfam hit to PF01431, Peptidase_M13, score 3e-66"
FT                   /inference="protein motif:HMMPfam:PF01431"
FT   misc_feature    142019..142048
FT                   /locus_tag="SSUBM407_0147"
FT                   /note="ScanRegExp hit to PS00142, ZINC_PROTEASE, score NA"
FT                   /inference="protein motif:Prosite:PS00142"
FT   CDS_pept        142853..143863
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUBM407_0148"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0153"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54980"
FT                   /db_xref="GOA:A0A0H3MSV3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSV3"
FT                   /protein_id="CAZ54980.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLL
FT                   KYDTTQGRFDGTVEVKDGGFEVNGKFVKVSAEREPGNIDWATDGVDIVLEATGFFASKE
FT                   KAEQHIHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGVQKGLMTTIHGYTGDQMVLDGPHRGGDLRRARAAAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVATLDKKVTAEEVNAAMKAAATESFGYTEDQLVSS
FT                   DIVGISFGSLFDATQTKVIEVDGEQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   misc_feature    142859..143308
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUBM407_0148"
FT                   /note="HMMPfam hit to PF00044, Gp_dh_N, score 2.9e-80"
FT                   /inference="protein motif:HMMPfam:PF00044"
FT   misc_feature    143300..143323
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUBM407_0148"
FT                   /note="ScanRegExp hit to PS00071, GAPDH, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00071"
FT   misc_feature    143321..143794
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SSUBM407_0148"
FT                   /note="HMMPfam hit to PF02800, Gp_dh_C, score 1e-100"
FT                   /inference="protein motif:HMMPfam:PF02800"
FT   CDS_pept        144119..145318
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SSUBM407_0149"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0154"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54981"
FT                   /db_xref="GOA:A0A0H3MXA0"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXA0"
FT                   /protein_id="CAZ54981.1"
FT                   /translation="MAKLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YILEQGGRAILFSHLGRVKEEADKEGKSLAPVAADLAAKLGQDVAFIAGATRGAELEAA
FT                   INALEDGQVLLVENTRFEDVDGKKESKNDEELGKYWASLGDGIFVNDAFGTAHRSHASN
FT                   VGISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADK
FT                   VLIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKTLLEKANGKLILPVDSKEANAFAGYT
FT                   EVRDTDGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVM
FT                   DAIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK
FT                   "
FT   misc_feature    144119..145306
FT                   /gene="pgk"
FT                   /locus_tag="SSUBM407_0149"
FT                   /note="HMMPfam hit to PF00162, PGK, score 6.6e-177"
FT                   /inference="protein motif:HMMPfam:PF00162"
FT   misc_feature    144161..144193
FT                   /gene="pgk"
FT                   /locus_tag="SSUBM407_0149"
FT                   /note="ScanRegExp hit to PS00111, PGLYCERATE_KINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00111"
FT   CDS_pept        146125..146640
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0150"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0155"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54982"
FT                   /db_xref="GOA:A0A0H3MT27"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT27"
FT                   /protein_id="CAZ54982.1"
FT                   /translation="MFKKYTFDPKKFRLGMRTFKSGLTVFLVILLFGFMGWQGIQIAAL
FT                   TAVFSLREDFDQSVHFGASRILGNSIGGFYALLFFILDRLFLDHFWVTAVFVPIFVMLT
FT                   IMTNVAMNNKAGIIGGVSALLIITLSIPAGDTIQYVFIRVFETFIGVFIAILVNYDVNV
FT                   IKKRFQDK"
FT   sig_peptide     146125..146256
FT                   /locus_tag="SSUBM407_0150"
FT                   /note="Signal peptide predicted for SSUBM407_0150 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.995) with
FT                   cleavage site probability 0.784 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(146185..146253,146311..146370,146389..146457,
FT                   146467..146526,146539..146607)
FT                   /locus_tag="SSUBM407_0150"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0150 by TMHMM2.0 at aa 21-43, 63-82, 89-111,
FT                   115-134 and 139-161"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        146716..147087
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="SSUBM407_0151"
FT                   /product="MerR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0156"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54983"
FT                   /db_xref="GOA:A0A0H3N1P1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1P1"
FT                   /protein_id="CAZ54983.1"
FT                   /translation="MREKEFRRSLAIFPIGSVMKLTDLTARQIRYYEDQGLIKPDRNEG
FT                   NRRLYSLNDMDLLLEIKDFLDEGLNIAAIKKEYANREAKAKVQKQQKTLTDEDVRRILH
FT                   DEFSRQGRFSSPSSIFRSS"
FT   misc_feature    146755..146865
FT                   /gene="glnR"
FT                   /locus_tag="SSUBM407_0151"
FT                   /note="HMMPfam hit to PF00376, MerR, score 5.5e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    146761..146829
FT                   /gene="glnR"
FT                   /locus_tag="SSUBM407_0151"
FT                   /note="ScanRegExp hit to PS00552, HTH_MERR_1, score NA"
FT                   /inference="protein motif:Prosite:PS00552"
FT   CDS_pept        147116..148462
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SSUBM407_0152"
FT                   /product="putative glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0157"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54984"
FT                   /db_xref="GOA:A0A0H3MT60"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT60"
FT                   /protein_id="CAZ54984.1"
FT                   /translation="MTFTVADIKRDIKEKNVTFLRLMFTDIMGVMKNVEIPATDEQVEK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTIFPWGDENGRVAGLICDIYTTDAKP
FT                   FAGDPRGNLKKSLRHMEEAGFSSFNLGPEPEFFLFKMDEQGNPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTEMGFEVEASHHEVAVGQHEIDFKYADVLKACDNIQIFKLVVKTI
FT                   ARKHGMYATFMAKPKFGIAGSGMHCNMSLFDKDGNNAFFDPEDPRGMQLSQTAYHFLGG
FT                   LIKHAYNYTAITNPTVNSYKRLVPGFEAPVYIAWAGKNRSPLVRVPASRGMGTRLELRS
FT                   VDPTANPYLAMAVLLEVGLEGIQNKIEAPAPVESNIYAMSDEERREAGITDLPSTLHNA
FT                   LKALREDEVVRAALGDHIYTNFLEAKKIEWASYATYVSQWEIDNYLDMY"
FT   misc_feature    147161..147415
FT                   /gene="glnA"
FT                   /locus_tag="SSUBM407_0152"
FT                   /note="HMMPfam hit to PF03951, Gln-synt_N, score 1e-15"
FT                   /inference="protein motif:HMMPfam:PF03951"
FT   misc_feature    147272..147328
FT                   /gene="glnA"
FT                   /locus_tag="SSUBM407_0152"
FT                   /note="ScanRegExp hit to PS00180, GLNA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00180"
FT   misc_feature    147431..148201
FT                   /gene="glnA"
FT                   /locus_tag="SSUBM407_0152"
FT                   /note="HMMPfam hit to PF00120, Gln-synt_C, score 1.3e-149"
FT                   /inference="protein motif:HMMPfam:PF00120"
FT   CDS_pept        complement(148685..150364)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0153"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0158"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54985"
FT                   /db_xref="GOA:A0A0H3MSV8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSV8"
FT                   /protein_id="CAZ54985.1"
FT                   /translation="MSSVNLKPHEVGVFAIGGLGEIGKNTYGIEYKDEILIVDAGIKFP
FT                   EDDLLGIDYVIPDYSYIVENLDRVKGLVITHGHEDHIGGIPFLLKQANVPIYAGPLALA
FT                   LIRGKLEEHGLLRDATLHEINHNTELTFKHLKVSFFRTTHSIPEPLGIVVDTPQGKIVC
FT                   TGDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKLIE
FT                   GIHGRIIFASFASNIFRLQQAADAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVPKDTF
FT                   IEPNEIKEYPASEIMILCTGSQGEPMAALSRIAHGTHRQVQLQPGDTVIFSSSPIPGNT
FT                   TGVNKLINILIEAGVDVIHGKINNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRMQK
FT                   IHASLAVDTGVPKDNIFIMENGDVLALTKDSARLAGQFNAQDIYVDGNRIGEIGAAVLK
FT                   DRRDLSEDGVVLAVATVDFNSKMILAGPDILSRGFIYMRESGELIRESQRVLFNAIRIA
FT                   MRNKDANIQTVNGAIVNALRPFLYEKTEREPIIIPMILTPDR"
FT   misc_feature    complement(149177..149299)
FT                   /locus_tag="SSUBM407_0153"
FT                   /note="HMMPfam hit to PF07521, RMMBL, score 3.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07521"
FT   misc_feature    complement(149183..149269)
FT                   /locus_tag="SSUBM407_0153"
FT                   /note="ScanRegExp hit to PS01292, UPF0036, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01292"
FT   misc_feature    complement(149693..150298)
FT                   /locus_tag="SSUBM407_0153"
FT                   /note="HMMPfam hit to PF00753, Lactamase_B, score 3.6e-30"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS_pept        complement(150368..150598)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0159"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54986"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXA8"
FT                   /protein_id="CAZ54986.1"
FT                   /translation="MIYKVFYQESKISPRREQTRALYLDIDAASELEGRIIARELVETN
FT                   RPEYNIEFIDLLSDNHLEYEKEHADFKITEF"
FT   misc_feature    complement(150371..150595)
FT                   /locus_tag="SSUBM407_0154"
FT                   /note="HMMPfam hit to PF07288, DUF1447, score 4.5e-39"
FT                   /inference="protein motif:HMMPfam:PF07288"
FT   CDS_pept        151149..151832
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0155"
FT                   /product="glycoprotease family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0160"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54987"
FT                   /db_xref="GOA:A0A0H3MT31"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT31"
FT                   /protein_id="CAZ54987.1"
FT                   /translation="MKILALDSSNQALSVALVEDGRLQAETLLAVKKNHSISLMPVVDF
FT                   LVAQVGWTPKDLDRIVVAQGPGSYTGLRVAVATAKTLAYTLKIDLVGLSSLQSLVPPSL
FT                   TGLVVPLIDARRNCVYAGVYENGRAVEPDRYWSFEDLLSSLSGKENITFVGEVENFMEQ
FT                   IEQALPTAQYQASLPSAYQLAVIGQDLPAVDVTSFEPNYLKHVEAEENWLKDNQVGSES
FT                   YIKRV"
FT   misc_feature    151212..151784
FT                   /locus_tag="SSUBM407_0155"
FT                   /note="HMMPfam hit to PF00814, Peptidase_M22, score
FT                   1.4e-53"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS_pept        151829..152269
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0156"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0161"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54988"
FT                   /db_xref="GOA:A0A0H3N1P6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1P6"
FT                   /protein_id="CAZ54988.1"
FT                   /translation="MIEIKHYDGQENLAEAVLAVMQSVYDQSPWTLEQIVSSMTSQYED
FT                   YYLAYEGQELVGFLAVQTVLDEMEILQIAVKTDFQRLGIASQLMAAVMDWDGDIFLEVR
FT                   ESNSAAQALYTRQHFTKIGKRKDYYRHPVEDAVIMKRERDER"
FT   misc_feature    151967..152188
FT                   /locus_tag="SSUBM407_0156"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        152259..153266
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0157"
FT                   /product="putative glycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0162"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54989"
FT                   /db_xref="GOA:A0A0H3MT64"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT64"
FT                   /protein_id="CAZ54989.1"
FT                   /translation="MKDRLILAIETSCDETSVAVLRNDAELLSNVIASQIASHQRFGGV
FT                   VPEVASRHHVEVITACIEEALLEAEVTAEDLTAVAVTYGPGLVGALLVGISAAKAFAWA
FT                   NGLPLIPVNHMAGHLMAARAVKELEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLPYPAGRVIDELAHEGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   YHNAQQKGETLSNADLSASFQACVMDILMAKTKKALEQYPVKTLVVAGGVAANQGLRER
FT                   LAAEITDVEVIIPPLRLCGDNAGMIALAAVSEYNKENLAGWDLNAKPSLAFENL"
FT   misc_feature    152334..153182
FT                   /locus_tag="SSUBM407_0157"
FT                   /note="HMMPfam hit to PF00814, Peptidase_M22, score
FT                   3.1e-77"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS_pept        complement(153303..154139)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0158"
FT                   /product="AraC-family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0163"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54990"
FT                   /db_xref="GOA:A0A0H3MSW3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW3"
FT                   /protein_id="CAZ54990.1"
FT                   /translation="MKIQPEFYVFNNRSYVDFYPIQFGMEACKPLHSFGPTMKQHYLFH
FT                   YIISGSGTFYDTSDQREYHLTAGQGFLISPDAICSYEADEKDPWTYIWLEFDGLKTEHF
FT                   LRQAGLSKEQPIFSQREMPTSSPVYHEMKQILALHHQKSALVLGHLYLFISCLIDCSLT
FT                   KTSSKHDENKEFYIREAINFVERNYEKAISVDDLAQVCNLNRHYFSRLFKEQMNISPQQ
FT                   FIIQYRLSEACELLKNTTKTLQEIAEEIGYSNQFNFSTAFKRHYQISPNRWRKIHK"
FT   misc_feature    complement(153315..153449)
FT                   /locus_tag="SSUBM407_0158"
FT                   /note="HMMPfam hit to PF00165, HTH_AraC, score 2.5e-12"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(153330..153458)
FT                   /locus_tag="SSUBM407_0158"
FT                   /note="ScanRegExp hit to PS00041, HTH_ARAC_FAMILY_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    complement(153465..153605)
FT                   /locus_tag="SSUBM407_0158"
FT                   /note="HMMPfam hit to PF00165, HTH_AraC, score 2.8e-11"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(153501..153566)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1250.000, SD 3.44 at aa 192-213, sequence
FT                   ISVDDLAQVCNLNRHYFSRLFK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    complement(153660..154085)
FT                   /locus_tag="SSUBM407_0158"
FT                   /note="HMMPfam hit to PF02311, AraC_binding, score 4.4e-22"
FT                   /inference="protein motif:HMMPfam:PF02311"
FT   CDS_pept        154354..155628
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0159"
FT                   /product="extracellular solute-binding lipoprotein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0164"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54991"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXB2"
FT                   /protein_id="CAZ54991.1"
FT                   /translation="MKKIGRYVTLLAAAGLLAACSTSTESSKTTGGSSSGKTEISYAIW
FT                   DSGQEPGLRKIADEFEKKNPDIKINIQVSDWDSYWTMLEAGATGGSLPDTFWMHSNEIY
FT                   RYGSNEMLLPLDEYLAKSEDAKLANFPDGLNEIYNINGKQYAIPKDFDTIGLWYNKKLF
FT                   DEAGIPYPDDTWDWNKLKEVAKKLTKPDGSQYGFGAGLSNQEGYYNFIYQNGGKVITDD
FT                   LKSGYADPKTIEALDYYFSFVKEKISPAITVDKERAEAFQNGQVAMSVFGSWNLSGFTA
FT                   NDYIRENADVAVLPKGPDGTRATIFNGLGHAIAATTKHPDAAWKWVEYLSSKEAQEMQA
FT                   TLGVAISAYKGAADTWVDSNKNFTIKNYVDMVDYAQIRPYSQTTIKWEDKAYELLKPAY
FT                   LGEKATEEAAKETADMMNAELATEK"
FT   sig_peptide     154354..154434
FT                   /locus_tag="SSUBM407_0159"
FT                   /note="Signal peptide predicted for SSUBM407_0159 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.759 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    154372..155364
FT                   /locus_tag="SSUBM407_0159"
FT                   /note="HMMPfam hit to PF01547, SBP_bac_1, score 1.4e-40"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   CDS_pept        155697..156590
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0160"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0165"
FT                   /note="Possible alternative upstream translational start
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54992"
FT                   /db_xref="GOA:A0A0H3MT37"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT37"
FT                   /protein_id="CAZ54992.1"
FT                   /translation="MFRKKGSLNEAIWGWGMVAPTIIGLIVLNIIPIFQTMKMSFHKSG
FT                   DFGKGDIFVGLANYQRMLGDAQVWQATWNTLKYTILVVPATVALAMLLAVLLNSKIKGK
FT                   HIYRTIFFLPMVAAPAAVTMVWKWLYNTDFGLINYILRRLGLGAVNWIEDPKIALYSIA
FT                   LIGIWSTVGYSMILILAGLQEIPTDFYEAARIDGASPAKQFFSITLPLVSPTLFFVVVT
FT                   SVIQSMQVFDVIYMMEDVRSPAYDKTVSLVYLFYNNSFKYSDKGYGSTIVMLLLLIILV
FT                   ITFVQMKVQKKWVHYR"
FT   misc_feature    join(155730..155798,155928..155987,156024..156083,
FT                   156174..156242,156303..156371,156492..156551)
FT                   /locus_tag="SSUBM407_0160"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0160 by TMHMM2.0 at aa 12-34, 78-97, 110-129,
FT                   160-182, 203-225 and 266-285"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    155898..156581
FT                   /locus_tag="SSUBM407_0160"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 2.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        156601..157431
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0161"
FT                   /product="putative transport system permease"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0166"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54993"
FT                   /db_xref="GOA:A0A0H3N1Q0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Q0"
FT                   /protein_id="CAZ54993.1"
FT                   /translation="MKQSAFKSTIWMHAFLILVAMGMLIPFVWMVLTSFKTVTESTQMN
FT                   PFHFLPSNWMVSNYTEAIRTNNFPILYLNTILMMLWRIFSSVMFSAMAAYAFARLEFPG
FT                   RNFLFGLVLFQMMVPPQLFVIPQYLMIDQLGMRNTIFALVFPGIVSAFGTFLLRQFFMG
FT                   LPKELEESAKLDGCNIGQTFFKVMLPLAKSGLIALAIFTALFAFKDLLWPLIINSEADK
FT                   ATLSSALSKIQGAYAVNYPQLMAASVLAIWPMLVLYVIFQKQFIQGIATSGGKL"
FT   misc_feature    join(156637..156705,156832..156900,156919..156987,
FT                   157015..157083,157144..157212,157315..157383)
FT                   /locus_tag="SSUBM407_0161"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0161 by TMHMM2.0 at aa 13-35, 78-100, 107-129,
FT                   139-161, 182-204 and 239-261"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    156814..157413
FT                   /locus_tag="SSUBM407_0161"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 3.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        157441..159642
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0162"
FT                   /product="putative alpha-galactosidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0167"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54994"
FT                   /db_xref="GOA:A0A0H3MT70"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT70"
FT                   /protein_id="CAZ54994.1"
FT                   /translation="MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETAS
FT                   YQYVREDEYRALTSFVEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFV
FT                   YQGHAIYAGRSALKGLPHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAVTRS
FT                   ARFEQLGEKSVCLNRALSMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLK
FT                   GASSAEHNPFMALKRPTADEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERF
FT                   SWTLDKGEEFQTPEVVMVYSEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAM
FT                   SFDFDEETILSLAKEAAGLGVELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGII
FT                   DQVHAMGMKFGLWIEPEMVNRDSELYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQ
FT                   NIHDQLHRLLAEHDIDYIKWDMNRYMTEVFTCTREADRQGETFHRYILNLYRLYDSLIA
FT                   AFPTVLFESCSSGGARFDPGMLYYAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHV
FT                   SASPNQQLGRATPLNTRANVAFFGSFGYELDLFECSQEELEEMKEQIAFYKTHRKIFQQ
FT                   GIFTRLKSPFDGEITAWQVQSSDGQQVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLD
FT                   GEVYTGSQLMHTGLSIRHGDHVGDNKDFTSCLMVLQKQQ"
FT   misc_feature    158308..159504
FT                   /locus_tag="SSUBM407_0162"
FT                   /note="HMMPfam hit to PF02065, Melibiase, score 1.8e-233"
FT                   /inference="protein motif:HMMPfam:PF02065"
FT   misc_feature    158518..158565
FT                   /locus_tag="SSUBM407_0162"
FT                   /note="ScanRegExp hit to PS00512, ALPHA_GALACTOSIDASE,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00512"
FT   repeat_region   complement(159722..159825)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        159917..160618
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0163"
FT                   /product="AzlC family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0168"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54995"
FT                   /db_xref="GOA:A0A0H3MSW7"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSW7"
FT                   /protein_id="CAZ54995.1"
FT                   /translation="MKKYAFREGMRDAIPTVLGYASIGLACGVVSVNSGISTVEMGLMS
FT                   LLIYAGSAQFVMCAMIFAGAPLLSIAVTVFFVNLRNFLMCLHATTIFQGNRLGSNILIG
FT                   SFVTDESYAVLLRKQIEHHTITPEWMYGNNFASYASWVTFTTLGNLIGGLIPNPEQFGL
FT                   DFALVAMFVGIFAGQLEAMVRTIPLKKIGLILLAVGLAYIGLSMMVSSYVAVLLATLLG
FT                   CFVGVMIDDKN"
FT   misc_feature    join(159953..160021,160079..160147,160316..160384,
FT                   160412..160480,160499..160603)
FT                   /locus_tag="SSUBM407_0163"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0163 by TMHMM2.0 at aa 13-35, 55-77, 134-156,
FT                   166-188 and 195-229"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    159956..160384
FT                   /locus_tag="SSUBM407_0163"
FT                   /note="HMMPfam hit to PF03591, AzlC, score 3.4e-60"
FT                   /inference="protein motif:HMMPfam:PF03591"
FT   CDS_pept        160605..160928
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0164"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0169"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54996"
FT                   /db_xref="GOA:A0A0H3MXB6"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXB6"
FT                   /protein_id="CAZ54996.1"
FT                   /translation="MIKTNILLIILMAALVTWVPRVLPFVLTQNKSLPPKLVKFLSFLP
FT                   ITIIFALTLSSIMDEKVGSLPSFLPVESLAILPTFFVVLKTKNILLAVLVGVVTTALLR
FT                   LIF"
FT   sig_peptide     160605..160757
FT                   /locus_tag="SSUBM407_0164"
FT                   /note="Signal peptide predicted for SSUBM407_0164 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.769) with
FT                   cleavage site probability 0.486 between residues 51 and 52"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(160617..160685,160722..160775,160788..160856,
FT                   160869..160922)
FT                   /locus_tag="SSUBM407_0164"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0164 by TMHMM2.0 at aa 5-27, 40-57, 62-84 and
FT                   89-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    160620..160919
FT                   /locus_tag="SSUBM407_0164"
FT                   /note="HMMPfam hit to PF05437, AzlD, score 3.8e-31"
FT                   /inference="protein motif:HMMPfam:PF05437"
FT   CDS_pept        160938..161960
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0165"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0170"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54997"
FT                   /db_xref="GOA:A0A0H3MT41"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT41"
FT                   /protein_id="CAZ54997.1"
FT                   /translation="MVKENAKGVGLCFLLALVGQWLGHLFPLVGGPVFALLIGMGLYPY
FT                   FSSKNAFQSGLTFTSKKILQYAVICLGFGLNLSAVLAVGRQSLPIILSTISFALILAFL
FT                   MWKILPISSHLATLIGVGTSICGGSAIAATAPIIQADDEDVAQAISVIFLFNVLAALVF
FT                   PSLATWLGFSTDSGQAFGMFAGTAVNDTSSVTAAASTWDSLYGLGSQTLDTAVTVKLTR
FT                   TLAIIPITTVLAIWQTRGKGLKADKKSLLAGFPTFILYFILASLITTIAGGFGIGADWF
FT                   APLKSLSKFFICMAMVAIGLRTNVFALVKNGRAALMVGLVCWLGVTVLTLVWQAILGIW
FT                   "
FT   misc_feature    160956..161894
FT                   /locus_tag="SSUBM407_0165"
FT                   /note="HMMPfam hit to PF03601, Cons_hypoth698, score
FT                   2.7e-90"
FT                   /inference="protein motif:HMMPfam:PF03601"
FT   misc_feature    join(160998..161066,161124..161183,161196..161255,
FT                   161283..161351,161388..161456,161577..161645,
FT                   161682..161750,161793..161861,161880..161948)
FT                   /locus_tag="SSUBM407_0165"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUBM407_0165 by TMHMM2.0 at aa 21-43, 63-82, 87-106,
FT                   116-138, 151-173, 214-236, 249-271, 286-308 and 315-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        join(162423..167660,167664..168257)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0171"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   1746. N-terminal region of pseudogene is expressed"
FT                   /db_xref="PSEUDO:CAZ54998.1"
FT   sig_peptide     162423..162554
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="Signal peptide predicted for SSUBM407_0166 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.993 between residues 44 and 45"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    162441..162521
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF04650, YSIRK_signal, score 1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF04650"
FT   misc_feature    162480..162548
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0166 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    164739..164915
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 1.2e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    164970..165182
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 1.1e-14"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    165393..165605
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 4.5e-16"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    165621..165824
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 1.1e-16"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    166482..166694
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 5.9e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    166710..166922
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 4.2e-14"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    166938..167150
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 1.1e-11"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    167166..167378
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF07564, DUF1542, score 4.7e-13"
FT                   /inference="protein motif:HMMPfam:PF07564"
FT   misc_feature    168123..168242
FT                   /gene="epf"
FT                   /locus_tag="SSUBM407_0166"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   1.4e-08"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        complement(168477..170099)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0167"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0173"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ54999"
FT                   /db_xref="GOA:A0A0H3N1Q9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Q9"
FT                   /protein_id="CAZ54999.1"
FT                   /translation="MKTILRYSWYQEKYNLHRSVNGFFYYLRKLPLVGKCIPESIFKSY
FT                   SFKSSLFLVLHILSIPSRFLIKGFWLLFHFYHASFWMNMLVNGELTFWKILPNTWLLGF
FT                   MFWLLFVGLSYRLGKSLDPVISKADREFMQNFSLSQSSFLQSQLFIEPILTTIYYLPAS
FT                   TIFCMITKEWLVFPIGLMTVLAGHLAGHALNRLLFERRIFSRRNSWHAWLWIAFVFVLY
FT                   VLAIVFRNQLSSGMLVPILLVQPFLIWFSYGYLKQQTNHLDYLSYCMDESLQMDKKLFE
FT                   MTKGNEYTRQGLQMQAKLNAKTGKDLSHLSGMTYLNALLFDRYKKVLYKKVQNWVLAVV
FT                   VILAALEGIRYFLDPFTFTEAYLLQFLPLSFMIMYVASSGKVVAQMVFVNCDISMLHYP
FT                   FYREAKTIIAGFNYRFLQTCKLNLIFATSLFLAIMVLGRFAFSLETILLTALLLISLTA
FT                   LFSFHDLFIYYILQPFTNDMDVVNPLYKFLSGALYWVAYLNTRINVGSHTYILLVSLAM
FT                   IAYVSIGYWILLKKAPQTFRLKA"
FT   misc_feature    complement(join(168513..168581,168609..168662,
FT                   168699..168767,168780..168839,168951..169019,
FT                   169047..169106,169335..169403,169416..169475,
FT                   169509..169577,169590..169658,169755..169823,
FT                   169881..169949))
FT                   /locus_tag="SSUBM407_0167"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SSUBM407_0167 by TMHMM2.0 at aa 51-73, 93-115, 148-170,
FT                   175-197, 209-228, 233-255, 332-351, 361-383, 421-440,
FT                   445-467, 480-497 and 507-529"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(170109..170807)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0168"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0174"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55000"
FT                   /db_xref="GOA:A0A0H3MT76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT76"
FT                   /protein_id="CAZ55000.1"
FT                   /translation="MQLKLSSISKKFDHKSILEDASFQFEQGKIYGLLGRNGAGKTTLF
FT                   NCIARNLTLDNGSIQFVKGEETLDYDNTDIGFTQTYPQLPAFMTAYEFVRFYMDIHKDK
FT                   LKSPRSPEEWLNLVGIGEEDQHRLLKDFSHGMQNKVQLLLSLIVQPPVLLLDEPLTSFD
FT                   PVAAHEFKQLIREAKKDSVIIFSTHILQLAQDLCDEIVLLHHQELQAVPSDKLHDPDFE
FT                   QEVVALLTAD"
FT   misc_feature    complement(170190..170726)
FT                   /locus_tag="SSUBM407_0168"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 9.8e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(170370..170414)
FT                   /locus_tag="SSUBM407_0168"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        complement(171163..172338)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0169"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0175"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55001"
FT                   /db_xref="GOA:A0A0H3MSX2"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSX2"
FT                   /protein_id="CAZ55001.1"
FT                   /translation="MNTVDTIIIGAGPAGMMAAISSSFYGKKTLLLEKNKRLGKKLSGT
FT                   GGGRCNVTNNGTLEDLLAGIPGNGRFLYSVFSQFDNHDIMNFFQENGVKLKVEDHGRVF
FT                   PTTDRSQTIIKCLEMKMLENGVDIRTGTEVVSVRKMDDLFHVKTSEEVFTAPQLIVTTG
FT                   GKTYPSTGSTGFGHDIARHFKLEVTEIEAAESPVLTDFPHKKLQGISLDDVTLTYGKHV
FT                   ITHDLLFTHFGLSGPAALRLSSFVKGGETAFLDVLPTHSDQDLFEHLEKNREKSVKNTL
FT                   SELMPDRLADFFAENYDSKVKQVSQKDLTELVTLLKVLPIKITGKMSLAKSFVTKGGVD
FT                   LKEINPKTLESKKVPGLHFAGEVLDINAHTGGFNITYCLATGWVAGSSYSS"
FT   misc_feature    complement(171175..172329)
FT                   /locus_tag="SSUBM407_0169"
FT                   /note="HMMPfam hit to PF03486, HI0933_like, score 1.8e-203"
FT                   /inference="protein motif:HMMPfam:PF03486"
FT   misc_feature    complement(172261..172320)
FT                   /locus_tag="SSUBM407_0169"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0169 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        172576..173976
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0170"
FT                   /product="putative beta-glucosidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0176"
FT                   /note="Similar to SSU1861, 74.464% identity (74.464%
FT                   ungapped) in 466 aa overlap (1-466:1-466)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55002"
FT                   /db_xref="GOA:A0A0H3MXC1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXC1"
FT                   /protein_id="CAZ55002.1"
FT                   /translation="MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQ
FT                   EPELFHQQIGPEQTSTFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQAVE
FT                   FYRAVFAGIRERGIKLLVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLV
FT                   DHWITFNEPIVPVECGYLGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHPDHKI
FT                   SIVLNLTPAYPRSQSPEDLQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPET
FT                   TEEELTIIKENRVDFLGVNYYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDKKINPPR
FT                   GWEIYEEGLYDIAKNIQENYGNIEWLVTENGMGVEGEGVFEENGMIQDDYRIHFMEDHL
FT                   IQLHRGIDEGANCKGYMVWTFIDCWSWLNTYKNRYGLVSLDLQTQKRTVKKSGYWFKQV
FT                   SAKNGFIR"
FT   misc_feature    172591..173967
FT                   /locus_tag="SSUBM407_0170"
FT                   /note="HMMPfam hit to PF00232, Glyco_hydro_1, score
FT                   2.4e-114"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   CDS_pept        174146..174640
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0171"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0177"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55003"
FT                   /db_xref="GOA:A0A0H3MT45"
FT                   /db_xref="InterPro:IPR007489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT45"
FT                   /protein_id="CAZ55003.1"
FT                   /translation="MGIEKTVSELAEILGVSRQAMNNRVKSLPEEFVDKNDKGVTVVNR
FT                   AGLIKLEEIYKTTIFEDEPISDEVKHRELMEILVDEKNAEIIRLYSQLKAKDKQLAEKD
FT                   EQLKVKDVQIAEKDKQLDQQQQLTLKAMADKEVLKLELDEVKAQAEEVQAKGFFARLFG
FT                   K"
FT   misc_feature    174158..174223
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1683.000, SD 4.92 at aa 29-50, sequence
FT                   KTVSELAEILGVSRQAMNNRVK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    174443..174586
FT                   /locus_tag="SSUBM407_0171"
FT                   /note="HMMPfam hit to PF04394, DUF536, score 2.1e-11"
FT                   /inference="protein motif:HMMPfam:PF04394"
FT   CDS_pept        174908..176950
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0172"
FT                   /product="putative PTS multi-domain regulator"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0178"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55004"
FT                   /db_xref="GOA:A0A0H3N1R3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1R3"
FT                   /protein_id="CAZ55004.1"
FT                   /translation="MVDNRTMAILMELFATRKESLYELSIQTGIEKEQLHSNLELVNQL
FT                   LQEHSFPQIQYKDSEFVISTELYNQKESVFSLFRNRQIYLSQEERQLLIYLYTFIRKEF
FT                   VSNVHYQELLSVSRNTTLTDIKNVKELCLDFQVRLEYTRAKGYHLIGREEDKHRLALYA
FT                   LSNCLQSSIGVWALDYILKSWGEENPIEELKIVSQQACNYYKVSALEERLDEYLYFLIF
FT                   LFIRQARVGNRINWNFEGKGGFVKDFLQRLWKLLRLKSTSTLELNAATQEYLSHLLQGC
FT                   LEGESGEKDDLFYHLTVEIVEEMERLSLITFEHRSEMIEGLQRHLIPAYYRLTSRLVNV
FT                   NSYTETIKEEHADLFYLVKKALRPLEEHLGFTIPDSEVSYFVIHFGGYIEAGQQRSYRY
FT                   RALVVCPNGVSSSLIVKENLRQLFPNIYFADTHSLQDWKMLDMTDYDMVFGTIKLNIEL
FT                   PFFLVSQLMTSNHKKELFHLVNQHFPNAAYFPIEIEQLLSLVGKHATIHQEQALKYELV
FT                   QFLNQRSHEQRGRSPMLEELITKETFQWSEEVLDWQKAVALAARPLVDKGAIETRYIDA
FT                   MIAKVEEFGPFIDLGKGIAIPHARPEDGVNEVGMSMLVLDKPVYLLDDPSHEIRLFICI
FT                   AAVDNQTHLRALSHLTKILREEENIQQLVGTKEFADVQHLLKEEQ"
FT   misc_feature    175799..176071
FT                   /locus_tag="SSUBM407_0172"
FT                   /note="HMMPfam hit to PF00874, PRD, score 4.8e-15"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    176513..176944
FT                   /locus_tag="SSUBM407_0172"
FT                   /note="HMMPfam hit to PF00359, PTS_EIIA_2, score 4.6e-28"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   misc_feature    176654..176704
FT                   /locus_tag="SSUBM407_0172"
FT                   /note="ScanRegExp hit to PS00372, PTS_EIIA_TYPE_2_HIS,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00372"
FT   CDS_pept        176952..177236
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0173"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   lactose/cellobiose-specific family, IIB subunit protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0179"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55005"
FT                   /db_xref="GOA:A0A0H3MT82"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT82"
FT                   /protein_id="CAZ55005.1"
FT                   /translation="MLRIGTACGSGLGSSFMVQMNIESILRDLGVSDVHVEHYDLGGAN
FT                   PSEADVWIVGRDLADSATHLGDVRILNSIIDMNELRELVTAICQEKGLV"
FT   misc_feature    176958..177218
FT                   /locus_tag="SSUBM407_0173"
FT                   /note="HMMPfam hit to PF02302, PTS_IIB, score 1.3e-24"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS_pept        177290..178636
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0174"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0180"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55006"
FT                   /db_xref="GOA:A0A0H3MSX7"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSX7"
FT                   /protein_id="CAZ55006.1"
FT                   /translation="MILDFLIDIAKTPAILVALIAILGLALQKKPAADLVKGGLKTFVG
FT                   FIVVGGGANIIVGSLEPFGQMFEQAFNLKGVVPNNEAIVAMALDKYGTATSLIMLLGMV
FT                   FNIAIARFTRFKYIFLTGHHTLYMACMIAVIMSVAGFTSVGLIVMGGLALGLIMTLFPA
FT                   FVQKYMIQLTGNDHVALGHFSALGYWLSGVVGGLVGDKSKSTEDINFPKGLAFLRDSTV
FT                   SIAISMSLIYMIVALFAGGDYIKENLSGGTNSMIYALTLGGTFAAGVFVILSGVRLILA
FT                   EIVPAFKGISEKLVPNSKPALDCPVVYPYAPNAVLIGFISSFAGGIVSMIILALTGGVV
FT                   ILPGVVPHFFCGATAGVMGNASGGVRGAVCGAFMQGVLISFLPVFLLPVLGDLGFAGST
FT                   FSDADFGLSGIFLGVLAKNGGILTVSVGIFAVLALMLGLSLVKKEQKEG"
FT   misc_feature    177290..178513
FT                   /locus_tag="SSUBM407_0174"
FT                   /note="HMMPfam hit to PF04215, SgaT_UlaA, score 1.1e-118"
FT                   /inference="protein motif:HMMPfam:PF04215"
FT   misc_feature    join(177302..177370,177404..177472,177560..177619,
FT                   177638..177706,177716..177784,177953..178021,
FT                   178064..178132,178226..178294,178304..178372,
FT                   178391..178459,178544..178612)
FT                   /locus_tag="SSUBM407_0174"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSUBM407_0174 by TMHMM2.0 at aa 5-27, 39-61, 91-110,
FT                   117-139, 143-165, 222-244, 259-281, 313-335, 339-361,
FT                   368-390 and 419-441"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        178638..179486
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0175"
FT                   /product="putative transketolase subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0181"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55007"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXC4"
FT                   /protein_id="CAZ55007.1"
FT                   /translation="MTSGTADLKRFAKEIRYHTLATLNQLGFGHYGGSLSIVEVLAALY
FT                   GEILDIRVQNFSSKERDHFILSKGHAGPALYSTLYLKGFFDRDFLLSLNQNGTHLPSHP
FT                   DRNLTPGVDMTTGSLGQGMSVATGVAYGKKIEQSPYYTYTLVGDGELNEGQCWEAAQFA
FT                   AHHELSKMILFVDDNKKQLDGRTHDICQTFDFVEKFQAFGWESVRVNGADIDAIINAIL
FT                   TMKSSKSPQPKCIVLDTTKGQGVTFLEELESNHHLRLSGQLREDLEQVTLVLARELEVT
FT                   E"
FT   misc_feature    178656..179402
FT                   /locus_tag="SSUBM407_0175"
FT                   /note="HMMPfam hit to PF00456, Transketolase_N, score
FT                   1.4e-37"
FT                   /inference="protein motif:HMMPfam:PF00456"
FT   CDS_pept        179483..180409
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0176"
FT                   /product="putative transketolase subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0182"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55008"
FT                   /db_xref="GOA:A0A0H3MT49"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT49"
FT                   /protein_id="CAZ55008.1"
FT                   /translation="MRQTKEMRLVYSDFLAQVGQEDTTIAAIEADLSSSMATNKLSSVL
FT                   GGRYVNVGIMEQEMVGVAAGLSLLGYKPYIHTFGPFASRRVYDQVFISLAYAQLNATIV
FT                   GSDAGVSAEMNGGTHMPFEELGLMRLIPKARVYEVSDDVLFQAVLKETIKVDGLKYIRT
FT                   IRKAPTPIYQGGEDFSKGYCVLRQGEDMTLLASGIMVEQALKAADQLEAQGVSVQVIDL
FT                   FRIKPIHEDISALLSGRPVLTVENHNRIGGLGSSICELMATDLTTPVHRIGIEESFGQV
FT                   GQQAYLMDVYGLTAEYIVKQAQLMLQQ"
FT   misc_feature    179489..179890
FT                   /locus_tag="SSUBM407_0176"
FT                   /note="HMMPfam hit to PF02779, Transket_pyr, score 3.5e-17"
FT                   /inference="protein motif:HMMPfam:PF02779"
FT   misc_feature    180023..180376
FT                   /locus_tag="SSUBM407_0176"
FT                   /note="HMMPfam hit to PF02780, Transketolase_C, score
FT                   5.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02780"
FT   CDS_pept        180600..182360
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0177"
FT                   /product="putative glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0183"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55009"
FT                   /db_xref="GOA:A0A0H3N1R4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1R4"
FT                   /protein_id="CAZ55009.1"
FT                   /translation="MKKIQREFQKIYYNLDKILLLFFTLFTFMEFVWIPLNSWISEGLL
FT                   AMTGHAYLSPTNLLSVFAENLLVTGLFILLFFVNIAIAYLELALLFTGVWQLLDEKVKH
FT                   LTDYLRDVRDSMVAIIRHSSLPKVLFLLFYSVILLPFLRRVLNIYYFNKIVVPQFIVDY
FT                   LSNTVWLGILILIFLLLFFWLAARFMYALPNIYFEHRGVKESIAYSWEKTRGRKQIGSL
FT                   FRLIWLVTFPVLLFTGVGGLFYLVQLLAEHFVPSASYWLAVVCYALLKLAYYGVVALFM
FT                   MGFVSLLTGKQLPIYRRKRLRHHLRLAILLVSGLVFGTQGALALYFPFDTLPVTISHRG
FT                   VDDGNAVQNSIEALEKTSQLKPDYIEMDVQETKDGQFIVMHDTDLLALTGNPGGTHDYT
FT                   LAELTGMTASENGMAAPVPSFDEYLEKADELGQKLLVEIKVTKADSPKLTQNFLKKYGQ
FT                   RLIAKGHQMQSLDYRTIIEIKQYSEKLVSFFILPFNSIYPTTVADGYTMEYTSLDQNFM
FT                   TKSWIRGKSVYAWTPNEEESMTKMLLLQVDGIITDNMTDLQSLMEEMKENRRYPDLFFQ
FT                   QFQSLIYNFE"
FT   misc_feature    join(180654..180722,180780..180848,180981..181040,
FT                   181098..181157,181263..181331,181374..181442,
FT                   181518..181586)
FT                   /locus_tag="SSUBM407_0177"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUBM407_0177 by TMHMM2.0 at aa 19-41, 61-83, 128-147,
FT                   167-186, 222-244, 259-281 and 307-329"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    181611..182267
FT                   /locus_tag="SSUBM407_0177"
FT                   /note="HMMPfam hit to PF03009, GDPD, score 5.4e-15"
FT                   /inference="protein motif:HMMPfam:PF03009"
FT   CDS_pept        complement(182404..182703)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0184"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55010"
FT                   /db_xref="GOA:A0A0H3MT87"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT87"
FT                   /protein_id="CAZ55010.1"
FT                   /translation="MMNMQNMMRQAQKLQKQMEKSQAELAATQFTGSSVQDLVTATFTG
FT                   DKKLVSIDFKADVVDADDLETLQEMTIQAVNAALTKVDEATQKKLGAFAGKLPF"
FT   misc_feature    complement(182407..182682)
FT                   /locus_tag="SSUBM407_0178"
FT                   /note="HMMPfam hit to PF02575, DUF149, score 4.9e-33"
FT                   /inference="protein motif:HMMPfam:PF02575"
FT   CDS_pept        182970..184139
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SSUBM407_0179"
FT                   /product="putative tagatose-6-phosphate aldose/ketose
FT                   isomerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0185"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55011"
FT                   /db_xref="GOA:A0A0H3MSY1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSY1"
FT                   /protein_id="CAZ55011.1"
FT                   /translation="MFRLAKEELEKLGAIITATEIYQQPGLWKEAYQLYFDQLEKIESF
FT                   LKSIKEKHDFVHVVFTGAGTSDFVGQSIANYLNQVNDLKHIRFSAIGTVELVSRPHDYL
FT                   QADVPTVLVSFARSGNSPESVAAVEVAKQLVDKLYQVTITCAPEGKLALAAEGDAENLL
FT                   LLQPAGSNDKGFAMTGSYSCMALTALLVFSSASQEEKAAWVEIIARLGQDVLDREDYVQ
FT                   DLINLDFERVIYLGSGGFYGLAHEAQLKILELTAGKIATMYESPLGFRHGPKSFINEKT
FT                   LIFLFASNDAYTRQYDVDLLNEVHGDGIAERIVALSADKLVGTEAANFVLAEGGADLPD
FT                   VFLTFPYILFAQTVSIMAAIKCNNLPDTPSPTGTVNRVVQGVIIHPLEK"
FT   misc_feature    183120..183560
FT                   /gene="agaS"
FT                   /locus_tag="SSUBM407_0179"
FT                   /note="HMMPfam hit to PF01380, SIS, score 0.0063"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    183642..184052
FT                   /gene="agaS"
FT                   /locus_tag="SSUBM407_0179"
FT                   /note="HMMPfam hit to PF01380, SIS, score 0.0065"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   CDS_pept        184269..186158
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0180"
FT                   /product="putative surface-anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0186"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55012"
FT                   /db_xref="GOA:A0A0H3MXC9"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR031792"
FT                   /db_xref="InterPro:IPR038349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXC9"
FT                   /protein_id="CAZ55012.1"
FT                   /translation="METANKKFRYSIRKFKVGVGSVLIATCLLGAGVSTPTAFATTETS
FT                   TATQVEAMAKVEEVQKLVKELEKELGELDKVPSYGDAQDYSYQKALWEEFLRIGKDNMD
FT                   YASKMKADDKFFHKVKGDLNDFKYQIKVENYIRQVAELRKKYPGDNTIEEEYNAHLKQD
FT                   EGKSIASQEGATLRDYVDREASEAMGRIKQRVAELEKSKQPQPSPADEPAPAPKEEDTP
FT                   APTPKVEDETQEPKTEEKAPETKEETPTPTPKEEGIPAPKEDEVPAPKEEETPAPKEED
FT                   TPAPDAAPAPAPTPEVDPAPTPIPDTPKAEEEAPTPVPDTPAPKEDEVPAPIPDAPTPK
FT                   VEEETQEPKTEEKAPETKEETPTPAPDAEPAPTPVPDTPAPDTPAPKEDEVPAPMPDAP
FT                   APKAEEEVPAPTPMPETPMDKPKTDKVESDKQMPEAKQPEMEQPKAEDMPKEEMPKSEQ
FT                   PKAEDSAPKTAVPEVAPKTAEKPKLDFTTKERKVEEALPIKEEIRYDASLPLGKSYLLQ
FT                   EGKAGKKVSVYQDVIVDGKVVATNLLSETVVEGQNRILVKGSLEMKKEEVKTTPSVQSN
FT                   PTLSHKGAPSANKATLPATGEQRNNLALVGLGLAGISLAVVATAINKKSKDQI"
FT   sig_peptide     184269..184388
FT                   /locus_tag="SSUBM407_0180"
FT                   /note="Signal peptide predicted for SSUBM407_0180 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.797 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    184278..184358
FT                   /locus_tag="SSUBM407_0180"
FT                   /note="HMMPfam hit to PF04650, YSIRK_signal, score 7.3e-11"
FT                   /inference="protein motif:HMMPfam:PF04650"
FT   misc_feature    join(184317..184385,186072..186131)
FT                   /locus_tag="SSUBM407_0180"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0180 by TMHMM2.0 at aa 17-39 and 602-621"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    185718..185951
FT                   /locus_tag="SSUBM407_0180"
FT                   /note="HMMPfam hit to PF07501, G5, score 1.6e-14"
FT                   /inference="protein motif:HMMPfam:PF07501"
FT   misc_feature    186018..186140
FT                   /locus_tag="SSUBM407_0180"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   0.00033"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        complement(186435..188702)
FT                   /transl_table=11
FT                   /gene="pepXP"
FT                   /locus_tag="SSUBM407_0181"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0187"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55013"
FT                   /db_xref="GOA:A0A0H3MT53"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008252"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR015251"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT53"
FT                   /protein_id="CAZ55013.1"
FT                   /translation="MRFNQFSFIKKETSVYLQELDTLGFQLIPDASSKTNLETFVRKCH
FT                   FLTANTDFALSNMIAEWDTDLLTFFQSDRELTDQIFYQVAFQLLGFVPGMDYTDVMDFV
FT                   EKSNFPIVYGDIIDNLYQLLNTRTKSGNTLIDQLVSDDLIPEDNHYHFFNGKSMATFST
FT                   KNLIREVVYVETPVDTAGTGQTDIVKLSILRPHFDGKIPAVITNSPYHQGVNDVASDKA
FT                   LHKMEGELAEKQVGTIQVKQASITKLDLDQRNLPVSPATEKLGHITSYSLNDYFLARGF
FT                   ASLHVSGVGTLGSTGYMTSGDYQQVEGYKAVIDWLNGRTKAYTDHTRSLEVKADWANGK
FT                   VATTGLSYLGTMSNALATTGVDGLEVIIAEAGISSWYDYYRENGLVTSPGGYPGEDLDS
FT                   LTALTYSKSLQAGDFLRNKAAYEKGLAAERAALDRTSGDYNQYWHDRNYLLHADRVKCE
FT                   VVFTHGSQDWNVKPIHVWNMFHALPSHIKKHLFFHNGAHVYMNNWQSIDFRESMNALLS
FT                   QKLLGYENNYQLPTVIWQDNSGEQTWTTLDTFGGENETVLPLGTGSQTVANQYTQEDFE
FT                   RYGKSYSAFHQDLYAGKANQISIELPVTEGLLLNGQVTLKLRVASSVAKGLLSAQLLDK
FT                   GNKKRLAPIPAPKARLSLDNGRYHAQENLVELPYVEMPQRLVTKGFMNLQNRTDLMTVE
FT                   EVVPGQWMNLTWKLQPTIYQLKKGDVLELILYTTDFECTVRDNSQWQIHLDLSQSQLIL
FT                   PH"
FT   misc_feature    complement(186447..187166)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUBM407_0181"
FT                   /note="HMMPfam hit to PF08530, PepX_C, score 1.7e-85"
FT                   /inference="protein motif:HMMPfam:PF08530"
FT   misc_feature    complement(186696..186728)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUBM407_0181"
FT                   /note="ScanRegExp hit to PS00133, CARBOXYPEPT_ZN_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00133"
FT   misc_feature    complement(187206..188159)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUBM407_0181"
FT                   /note="HMMPfam hit to PF02129, Peptidase_S15, score
FT                   2.3e-130"
FT                   /inference="protein motif:HMMPfam:PF02129"
FT   misc_feature    complement(188274..188702)
FT                   /gene="pepXP"
FT                   /locus_tag="SSUBM407_0181"
FT                   /note="HMMPfam hit to PF09168, PepX_N, score 7.7e-82"
FT                   /inference="protein motif:HMMPfam:PF09168"
FT   CDS_pept        188884..189618
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0188"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55014"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032702"
FT                   /db_xref="InterPro:IPR032703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1R8"
FT                   /protein_id="CAZ55014.1"
FT                   /translation="MLRKNEAIVPILRINNRAINQGFLEENLGMKTKLEDGPFADFGDR
FT                   TSPEAKLVLTESPGNRTRAVEGLKKLNKIVIKVDNASEIEALLAQGSQYSKLYQGKNGY
FT                   GFEALSPEGDTFLLHAEASVDDLKAILPPVPFKVQDDFSGLTAFTVESVWINTPQASIS
FT                   QDYYEAILPQQAFLRFVGAEGKDLLTPAEQVWDLEGLRFPVEQDFDWAHLESRLERPFF
FT                   KDKKASFIQTVDPSGIELWFEK"
FT   CDS_pept        join(189615..189692,189692..190561)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0183"
FT                   /product="putative beta-lactamase (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0189"
FT                   /note="CDS contains a frameshift after codon 24. Frameshift
FT                   occurs at a poly T heptamer. Similar to Streptococcus
FT                   pneumoniae hypothetical protein sp1448 UniProt:Q97PZ0
FT                   (EMBL:AE007441) (311 aa) fasta scores: E()=3.2e-69, 60.526%
FT                   id in 304 aa"
FT                   /db_xref="PSEUDO:CAZ55015.1"
FT   misc_feature    join(189627..189692,189692..190516)
FT                   /locus_tag="SSUBM407_0183"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   4.8e-46"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   repeat_region   complement(190560..190665)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(190968..193313)
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUBM407_0184"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0191"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55016"
FT                   /db_xref="GOA:A0A0H3MT92"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT92"
FT                   /protein_id="CAZ55016.1"
FT                   /translation="MSTKVKTKNVAEDIFAQAWEGFKGTDWQDKASVTHFVQANYTPYD
FT                   GDESFLAGPTERSLHIKKIIEETKAGYEDTRFPMDVDRATSIADIPAGFIDKENELIFG
FT                   IQNDELFKLNFMPRGGIRMAETTLIENGYTPDPLLHEIYTKHATTVNDGIFRAYTADIR
FT                   RARHSHHVSGLPDAYSRGRIIGMYARLALYGADYLMEEKVADWNAITEIDEESIRLREE
FT                   INMQYQALQQVVRLGDHYGVDVRKPAMNTKEAIQWTNIAFMAVCRVINGAATSLGRVPI
FT                   VLDIYAERDLARGTFTEAEIQEFVDDFVLKLRTVKFARTKAFDEIYSGDPTFLTTSMAG
FT                   MGNDGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWSDQLPYSFRRYCMAMSHKHSSIQY
FT                   EGVTTMAKDGYGEMSCISCCVSPLDPESEDQRHNIQYFGARVNVLKALLSSWNNGYDDV
FT                   HKDYKVFDGVEPNTSEVFDYDQVVKNFEIALDWLTDTYVDAMNIIHYMTDKYNYEAVQM
FT                   AFLPTHLRANMGFGICGFANTVDSLSAIKYAQVKPIRDEDGFIYDYEVTGDFPRYGEDD
FT                   DRVDDIAKWLMEAFFTRLNKHKLYKNAEATVSILTITSNVAYSKQTGNSPVHRGVFLNE
FT                   DGSVNTTKVEFFPPGANPTSKARGGWLQNLNTLSKLNFKHANDGISLTTQVSPKALGKT
FT                   FDEQVNNLVTILDGYFEQGGQHVNLNVMDLNDVYEKIMAGEDVIVRISGYCVNTKYLTK
FT                   EQKTELTQRVFHEVLSMDDHAAEVSGQA"
FT   misc_feature    complement(191067..191375)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUBM407_0184"
FT                   /note="HMMPfam hit to PF01228, Gly_radical, score 6.7e-41"
FT                   /inference="protein motif:HMMPfam:PF01228"
FT   misc_feature    complement(191076..191102)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUBM407_0184"
FT                   /note="ScanRegExp hit to PS00850, GLY_RADICAL_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00850"
FT   misc_feature    complement(191457..193262)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SSUBM407_0184"
FT                   /note="HMMPfam hit to PF02901, PFL, score 7.5e-297"
FT                   /inference="protein motif:HMMPfam:PF02901"
FT   CDS_pept        193629..194696
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="SSUBM407_0185"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0192"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55017"
FT                   /db_xref="GOA:A0A0H3MSY6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSY6"
FT                   /protein_id="CAZ55017.1"
FT                   /translation="MLIFPLINDLSRKIIHVDMDAFFAAIEVRDSPALKGKPVIIGADP
FT                   RLSGGRGVVSTCNYEARAFGIHSAMSSKEAYERCPQAIFISGNYEKYQEVGRQVREIFH
FT                   RYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKFLAK
FT                   IASDMEKPHGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLDVPEM
FT                   VLIDRFGRFGFDLYRKARGISNSPVKVDRVRKSSGKERTYRKLLYREEDVLKELISLCQ
FT                   RVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIEEIGKIE
FT                   KGIRLLGVTVTNFQT"
FT   misc_feature    193677..194693
FT                   /gene="dinB"
FT                   /locus_tag="SSUBM407_0185"
FT                   /note="HMMPfam hit to PF00817, IMS, score 1e-103"
FT                   /inference="protein motif:HMMPfam:PF00817"
FT   CDS_pept        194739..195158
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0186"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0193"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55018"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXD6"
FT                   /protein_id="CAZ55018.1"
FT                   /translation="MQISSRFTIASHILVLLALEGEKEKQTSTSIAGSVGVNPVIIRNI
FT                   LSQLKEAGLVEVARGIGGARLAQGPDQITLLHVYQAVELFGEKGQLFAFHEQPNLSCQV
FT                   GRNIHPLLDSRLENAQSALENELAKTRLADLLAEL"
FT   misc_feature    194739..195119
FT                   /locus_tag="SSUBM407_0186"
FT                   /note="HMMPfam hit to PF02082, Rrf2, score 4.9e-41"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   CDS_pept        195397..196023
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0194"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55019"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT58"
FT                   /protein_id="CAZ55019.1"
FT                   /translation="MKIAIIAANGQAGQTIAKEAVERGHQVTAIVRSENKSVAQEVIQK
FT                   DAFALTKEDLAGFDVVVNAFGAWTPETLPDHARLAEHLATILAGSPTRLLVVGGAGSLY
FT                   LDESQTAMLKDTPDFPAEYLPIAEAMGTGLDLYRQATAVNWTYISPAADFDAEGQKSGA
FT                   YTLAGEVFQVNAQGESYISYADYAVALVDIAEKGGYQQERISVLA"
FT   CDS_pept        196125..197045
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0188"
FT                   /product="putative tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0195"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55020"
FT                   /db_xref="GOA:A0A0H3N1S3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1S3"
FT                   /protein_id="CAZ55020.1"
FT                   /translation="MIHLICPNPALDRTLLVEKIEKNIPLRPTEVRDYPGGKSFNVAYA
FT                   LRENGVTDYTIHTILGGQIGRYIQELNADGGNALRVVENSQNTRTCNIYVETSTGDVVL
FT                   FYEKGFELTEDLLNQFTQQIENSLQAGDILVFSGSLMKGMSDDYIQRFIEKYPEVLTIV
FT                   DTSGPALRAAYQARPALIKINNEELKDIYPELDEESPEAILGILKEVTPHENIIITMGD
FT                   KGSLAKIGQRFFRIQSPKKETRNPIAAGDFYLGLLVKGISQGQAPEIFLKEAAAFATAN
FT                   CLNYFPEVEAEQFEAIVDTIVLEEL"
FT   misc_feature    196599..196970
FT                   /locus_tag="SSUBM407_0188"
FT                   /note="HMMPfam hit to PF00294, PfkB, score 8e-11"
FT                   /inference="protein motif:HMMPfam:PF00294"
FT   CDS_pept        197111..197731
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0189"
FT                   /product="HhH-GPD superfamily base excision DNA repair
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0196"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55021"
FT                   /db_xref="GOA:A0A0H3MT99"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT99"
FT                   /protein_id="CAZ55021.1"
FT                   /translation="MEQLTVLYQNLKRRYGEFHWWNDENPIKDLVSMILIQQTTEANAK
FT                   RALEQLEGRLTIHSLLEMPVEDLQECIRPAGFFKQKSLYIRSVVEWANQFDGDFSRLDR
FT                   VETAVLRKELLSLKGVGNETADVILLYLCRRSVFVADQYALRLFNRLGLSQSQDYLSLR
FT                   QEFTEQIKDWSVKDAQELHALIDEHGKQFRLTKGQLDESWLMI"
FT   misc_feature    197201..197626
FT                   /locus_tag="SSUBM407_0189"
FT                   /note="HMMPfam hit to PF00730, HhH-GPD, score 1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00730"
FT   misc_feature    197441..197503
FT                   /locus_tag="SSUBM407_0189"
FT                   /note="HMMPfam hit to PF00633, HHH, score 3.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS_pept        complement(197732..197830)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0190"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0197"
FT                   /note="Similar to SSU0385, 62.500% identity (62.500%
FT                   ungapped) in 32 aa overlap (1-32:1-32);SSU1880, 59.375%
FT                   identity (59.375% ungapped) in 32 aa overlap
FT                   (1-32:1-32);SSU1884, 54.839% identity (56.667% ungapped) in
FT                   31 aa overlap (2-32:1-30); and to an internal region of
FT                   SSU0853, 53.125% identity (53.125% ungapped) in 32 aa
FT                   overlap (1-32:43-74)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ3"
FT                   /protein_id="CAZ55022.1"
FT                   /translation="MKIKIKLGDANADRTEVHQIMSTTSDFDFRRV"
FT   CDS_pept        complement(198014..199213)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0191"
FT                   /product="putative repressor protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0198"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55023"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXE0"
FT                   /protein_id="CAZ55023.1"
FT                   /translation="MGKKEETIRNISGNILKTLFRHQKSSRTRISKSLKITPATITNMI
FT                   SYLVAEKKVIETGDEVRDYIGSGRSRRLITVNSQYRHYIGIEINANGIYLAVTDTIGNL
FT                   ITNSNIKITEYDSKQINEIIIQLVTETLDKFSYLEFGALGIAVPGHFDSKSGHIISNNV
FT                   KWIYFDLAVIKQSISIPIFLENNINCMAIGSYLFHPESSPEQFLFIHIGPGLFCSFFDS
FT                   EHILQNKNFYIGEIGHTVVDLNGPSCECGKRGCLQTYISDTWLINNARFLFENVQGSII
FT                   KTLVEKPEDITLDVVYNAYRLGDGFIIEKIESGIDFLTTSIANTLIIYDSKKIFINSQL
FT                   LNYPGFSEKVNNLVDNQLQFIPSKNNLDIEFLSFNIFRGAIGAASLAVYNHFILENNSN
FT                   "
FT   misc_feature    complement(198419..198514)
FT                   /locus_tag="SSUBM407_0191"
FT                   /note="HMMPfam hit to PF00480, ROK, score 8.3e-09"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   misc_feature    complement(199076..199141)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1405.000, SD 3.97 at aa 25-46, sequence
FT                   SSRTRISKSLKITPATITNMIS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        199406..200734
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0192"
FT                   /product="sugar phosphotransferase system (PTS), IIC
FT                   component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0199"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55024"
FT                   /db_xref="GOA:A0A0H3MT61"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT61"
FT                   /protein_id="CAZ55024.1"
FT                   /translation="MNGLMHFLEHKLAPFGTKVGNQRHLKAVRDGFMMAMPLVLVGSFF
FT                   LLLISWPDQASGGFSVVGFLEQIGLLGILNRLNQSTMAIISLIATFGIAYRLSESYETD
FT                   GPSAGVIALSSFILLAPRFSTMVFNESGEQINQVFAGAIPFGSLNASALFVAIAVGLVS
FT                   AEIYRFFIQRGITIKMPKNVPDVVGKSFAALLPALTTLIFWACVFQGLEAAGVEGGLGA
FT                   VLGLIVGKPLGLIAGSLGGMVLVVLVNSLFWFTGVNGGQVLNAFVDPVWLQFTEANQLA
FT                   AAAGEKLPHIITLPFKDLFVFMGGGGATVGLALCLLVFSKSRTFKSLGRISFIPSLFNI
FT                   NTAILFSFPTVLNPIMMIPFILTPTVNAIITYFAMATGLVPMTTGVVLPWTMPPILGGF
FT                   LATGGSIQGAILQIILIGVSFIIYYPFFKVADNKNLELEESGE"
FT   misc_feature    199490..200497
FT                   /locus_tag="SSUBM407_0192"
FT                   /note="HMMPfam hit to PF02378, PTS_EIIC, score 1.2e-86"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    join(199496..199564,199622..199690,199724..199792,
FT                   199850..199918,199976..200044,200102..200170,
FT                   200300..200365,200423..200491,200510..200578,
FT                   200621..200686)
FT                   /locus_tag="SSUBM407_0192"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUBM407_0192 by TMHMM2.0 at aa 31-53, 73-95, 107-129,
FT                   149-171, 191-213, 233-255, 299-320, 340-362, 369-391 and
FT                   406-427"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        200739..202625
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0200"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55025"
FT                   /db_xref="InterPro:IPR032287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1S7"
FT                   /protein_id="CAZ55025.1"
FT                   /translation="MKLTIFDKVQNKTSQFAIDELTYYLKAIFDFELGKTTVEEDANVL
FT                   LSKEYLDNNDTIGIEMKNGNAILTGNSDVSILIAVYRLLSEFGAVFTRPGRKHELIPSL
FT                   TITDWNEKELSIHETASYKHRGVCIEGADSYQNTKEFLDWLPKINMNSFFIQFENPYSF
FT                   LKRWYEHEFNPYADKEDFNTEIAQQMSDLLDEELSKRGLIHHRVGHGWTGEVLGYSSKY
FT                   GWESGLKLPEEKKPLVAELNGKRELFNTAPILTSLCFSNPDVGERMCELIVNYAKERKD
FT                   VDYLHVWLSDARNNICECEKCKQEIPSDQYVRILNQLDRKLSEEGLNTKICFLLYHELL
FT                   FAPKHEVLENPERFTMMFAPITRTFEMSYADVDYENDVPLPNEYSRNNIVLPNSLEENL
FT                   SYLFSWQKVFNGDSFVYDYPLGRAHYGDLGYMKISKVIFRDVVYLKKLGLNGYISCQEL
FT                   RAGFPHNFPNFVMGQMLWNRNLEYDELKALYFSSLYGSEWKSVVTYLEKLSDYSSCDYF
FT                   NSIGDRQNAELSMKYNISSKLAFNFINTLEENVAKNNGIQRDAWRQLGYHREYVVKLAN
FT                   ALHLMASGDHLDGQIRWKDFLDYIRNHEPDFQQYLDVYRIIEVAKNYAGFKL"
FT   CDS_pept        202745..206461
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0194"
FT                   /product="putative surface-anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0201"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55026"
FT                   /db_xref="GOA:A0A0H3MTA4"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTA4"
FT                   /protein_id="CAZ55026.1"
FT                   /translation="MNKKIFLKSAIILLSVTCLINAIKALDSSGVSSSTGEIVNQDRIY
FT                   NITLKVKTDGVYNDLGGNVISENNVLSGISGTKINLKVSTNSGYRFVGYQSFLESGNST
FT                   DGLLPIENDSFEISDKTGNVTVVAMFEKIPIDETIYFSDEFSTENINNYLLSENLIGKI
FT                   AVSNGKLNIHAPGVSSIKPILSRQIDESSTLGYEIQFSIQQIGEVKQWNTFRVVFKENS
FT                   DGSVYALEFTGKAVSIKKLSSIDAPNQTGEKYAETGHNLGSEEHRIRLVVRGDTVTVSD
FT                   NEIPLLSYSSPENWEGATASIVFTPISNRSVSLDDIIIRQTRALRSLLVVSRIDGQEVT
FT                   DIQPGSIRGNTSQVFVGDSLPLEVIEKPGYQFIGFKDEFGNVVDLSTFSVPNDESDLVI
FT                   YADFQTAEVVNRETKTFYIDSIEGNDTNSGESETNAWKTLEQLRKNTLIAGDRVLLKRG
FT                   SRFVGEDAALTFKGSGLEDAPILISSYGEGELPLLEAQGKIESVIKLYNQEYITIENLE
FT                   ITNLDPNFSTSFELNSNNNRSKILRGVHVIAEDYGVVHDIVLRNMYLHDINGNLNSKWN
FT                   GGIFFDVYGTTVPTKYDGILIENNYLERVDRSGIKLVGSTWANQNLKNNKNIPLNWYPS
FT                   TNVVVRGNRIEKAGGDSITVRDTDGALIEYNISADARYQDTGYNAGIWPFQASNTVIQY
FT                   NESFRTHGVQDGQGLDLDHVSNNSVMQYNYSHDNEGGFMLIMNWYEQTSPTVRYNISQN
FT                   DKDKIFELARGGAQGTAIYNNTIFSDSKLTGRAGVIDMPSTSGGTGVKDIFLFNNIFYF
FT                   TDGEKMFVEASDAGKYKDSIHFYNNAYVGVEVPDDPKAITEGITLKGVGTGPTENKSMI
FT                   ANAGKFLTGQLDGYRLPENSSLAKLGVSKEEAISYFYKKLGVQPTIDFQDNGSLTMSPT
FT                   EAFALARQTNSVDAIARVYPAIEGVTYDTDFFGETLSSENLSVGAAQEKKSVFEEKISD
FT                   IEISDVKTGIGMRYKRSNQLADVNLSIRLINKDELQYTINANNPTFSYEIQLQKNFGEY
FT                   MDLSESVTITIPIEADKKILNVLKINKNEQTESVKELPYRIENNKIILETDELGSFIIE
FT                   YQMEKIKKENNTNATISESGKSSLGLQNKENSDVQAVGDKDYFSGLELSNKGEELSRED
FT                   SKLMGNSINNLQTIKESESIFEGNLGRNKELSDMYQKSLPKTGESNQAYIVLIGLFSLF
FT                   VVLICQIFKKSID"
FT   sig_peptide     202745..202819
FT                   /locus_tag="SSUBM407_0194"
FT                   /note="Signal peptide predicted for SSUBM407_0194 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.997) with
FT                   cleavage site probability 0.584 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    206384..206443
FT                   /locus_tag="SSUBM407_0194"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0194 by TMHMM2.0 at aa 1214-1233"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        206480..207241
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0195"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0202"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MSZ9"
FT                   /protein_id="CAZ55027.1"
FT                   /translation="MTKKIIFILLFFVVCVYFYSFIPLVQTVPSVFQTPYRTLVQSEFE
FT                   AIYKYNGIEISERNFWNKPINGRKPQDTLNEKATILFKKYNLLEKEAKKHEYKKEALDF
FT                   NKVDWKTVSNRYIELKQIVIDEKIKDINQDEIERYYLANTENFERQDFISGNISIWNDG
FT                   IIISTESVDITEETVRNITERYPDLELELKNIEVGHQVSWGQNGVYYTFTCLSREEKGI
FT                   IPLSEITDAVAMQCAEELVDNWLNKEIDSLK"
FT   sig_peptide     206480..206560
FT                   /locus_tag="SSUBM407_0195"
FT                   /note="Signal peptide predicted for SSUBM407_0195 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.751) with
FT                   cleavage site probability 0.605 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    206492..206560
FT                   /locus_tag="SSUBM407_0195"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0195 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        207458..208222
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0196"
FT                   /product="binding-protein-dependent transport system
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0203"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55028"
FT                   /db_xref="GOA:A0A0H3MXE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXE4"
FT                   /protein_id="CAZ55028.1"
FT                   /translation="MKMKSNKEQKYFWLTFSLIVALMIWWFLSNYDRTSRSFPNIILVW
FT                   NALLIMIDKGFIFEDIFSSLTSVFFGFTSGFLLSAPNALLMAWYSPYRNIVKPWIQFIR
FT                   NIPPLAYVPLVVISAGVGLLPQVIVIAIATFLTMTVTIYQGIINIDPNLIKAARILGAS
FT                   DFEIFKRILVPSSIPFIMTAVRLGTSISLTTIIAAESTGATSGMGMRIRSLNNSFDSSG
FT                   MLLYIILIGVIGLLLNKLVDLIERKLTGWQQK"
FT   misc_feature    join(207491..207544,207659..207727,207761..207829,
FT                   207839..207898,207983..208051,208121..208189)
FT                   /locus_tag="SSUBM407_0196"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0196 by TMHMM2.0 at aa 12-29, 68-90, 102-124,
FT                   128-147, 176-198 and 222-244"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    207638..208207
FT                   /locus_tag="SSUBM407_0196"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 6.2e-29"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS_pept        208207..208989
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0197"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0204"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55029"
FT                   /db_xref="GOA:A0A0H3MT65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT65"
FT                   /protein_id="CAZ55029.1"
FT                   /translation="MATEVKKIKVKIEDVSKSFQTNHGEVVALNQINLEIFENEIVTVV
FT                   GPSGCGKSTLLNLVAGLEPVTSGKIYCDDNEIVGIGVERGVVFQQYALFPWMSVLQNVM
FT                   FGPEMQGKSKLEASEIANKYIKMVGLQEFSNHYPKELSGGMKQRVAIARAYAVNPSILL
FT                   MDEPFGALDALTRIQLQEELIEMLGQEQKTCFFITHDIEEAVLLGNRVIVMSPRPGEIK
FT                   EIVNVDLPFPRNQLTKFEKNFMDIKNHIWSLVYKDFLI"
FT   misc_feature    208321..208857
FT                   /locus_tag="SSUBM407_0197"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    208627..208671
FT                   /locus_tag="SSUBM407_0197"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        209028..210059
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0198"
FT                   /product="extracellular solute binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0205"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55030"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1T1"
FT                   /protein_id="CAZ55030.1"
FT                   /translation="MAKYMKYKNFIWFICSIITLIFLSSCSSIQTSSSGHSAKVDTIRI
FT                   AYMPNFASLHDIITGINSGIFKEEGLEVELIEFADGPTIIASLESGSIDIGNIGPGAHK
FT                   LAIEGRAEVVAFSQLGNADELIARSDRGIDSIEDLRGKKIGTASGTSAETILKLALLEA
FT                   DLSEKDVEIIDMDASAIVTAMLSGSIDVAATWSPNTTFIKRELKEKVVVLADNSRYREQ
FT                   SPAIASYVTFPGYSEKNNEKISKFLKGLYRAMDYRAEHMKEVSKWVATQIGSDITAVQD
FT                   QLQDGEWLTSRQMIQLINTGILQQYYEKQQKNLIESEIVDTSRNINEYVLIDQMNSILM
FT                   EIK"
FT   sig_peptide     209028..209129
FT                   /locus_tag="SSUBM407_0198"
FT                   /note="Signal peptide predicted for SSUBM407_0198 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.999) with
FT                   cleavage site probability 0.560 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    209052..209120
FT                   /locus_tag="SSUBM407_0198"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0198 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209169..209819
FT                   /locus_tag="SSUBM407_0198"
FT                   /note="HMMPfam hit to PF09084, NMT1, score 3.7e-18"
FT                   /inference="protein motif:HMMPfam:PF09084"
FT   CDS_pept        210153..210962
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0199"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0206"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55031"
FT                   /db_xref="GOA:A0A0H3MTA9"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTA9"
FT                   /protein_id="CAZ55031.1"
FT                   /translation="MIEYYNFSKSELENHSRIPLIIKKNNEEIFISLALEMVELIKENN
FT                   KKNEKTVIICPVGPVGHYPHFVRLVNQFKIDLSDVWFINMDEYLSEDLHWIDVVHPLSF
FT                   RGFMQKTVYSQIHPTLIMPEEQRIFPDPLDIDLISNKIKELGKIDLCIGGIGLNGHIAF
FT                   NEPDSTLTVQEFLKLESRVLPISVETKVMNCLTELKGAVEEVPNYCVTIGMSEIFQAKK
FT                   IRLAVFRDWHHAVIRKTVCSKPDTGFPSTLMQIHTNCSIYLNESLAN"
FT   misc_feature    210249..210953
FT                   /locus_tag="SSUBM407_0199"
FT                   /note="HMMPfam hit to PF01182, Glucosamine_iso, score
FT                   1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF01182"
FT   misc_feature    210576..210632
FT                   /locus_tag="SSUBM407_0199"
FT                   /note="ScanRegExp hit to PS01161, GLC_GALNAC_ISOMERASE,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01161"
FT   CDS_pept        join(211124..211294,211293..212040,212043..212248,
FT                   212252..213031)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0200"
FT                   /product="copper-transporting P-type ATPase CopA
FT                   (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0207"
FT                   /note="Probable gene remnant. CDS contains frameshifts
FT                   after codons 57 and 309, and a nonsense mutation (amber)
FT                   after codon 376. Similar to an internal region of Bacillus
FT                   subtilis copper-transporting P-type ATPase CopA
FT                   UniProt:O32220 (EMBL:BSUB0018) (803 aa) fasta scores:
FT                   E()=1.2e-88, 43.396% id in 636 aa"
FT   misc_feature    join(211136..211293,211294..211328)
FT                   /locus_tag="SSUBM407_0200"
FT                   /note="HMMPfam hit to PF00403, HMA, score 4.6e-16"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    211145..211234
FT                   /locus_tag="SSUBM407_0200"
FT                   /note="ScanRegExp hit to PS01047, HMA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01047"
FT   misc_feature    join(211398..211457,211485..211553,211611..211679,
FT                   211707..211760,212168..212236,212252..212320)
FT                   /locus_tag="SSUBM407_0200"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0200 by TMHMM2.0 at aa 93-112, 122-144, 164-186,
FT                   196-213, 349-371 and 376-398"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    join(211734..212040,212043..212248,212252..212398)
FT                   /locus_tag="SSUBM407_0200"
FT                   /note="HMMPfam hit to PF00122, E1-E2_ATPase, score 6.4e-89"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    212408..213031
FT                   /locus_tag="SSUBM407_0200"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 4.9e-27"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    212426..212446
FT                   /locus_tag="SSUBM407_0200"
FT                   /note="ScanRegExp hit to PS00154, ATPASE_E1_E2, score NA"
FT                   /inference="protein motif:Prosite:PS00154"
FT   CDS_pept        213035..213214
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="SSUBM407_0201"
FT                   /product="probable thiol peroxidase (fragment)"
FT                   /EC_number="1.11.1.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0207A"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus parasanguis Tpx probable thiol
FT                   peroxidase UniProt:P31307 (EMBL:SSSTRA) (163 aa) fasta
FT                   scores: E()=8.6e-16, 72.881% id in 59 aa"
FT                   /db_xref="PSEUDO:CAZ55033.1"
FT   misc_feature    213035..213208
FT                   /gene="tpx"
FT                   /locus_tag="SSUBM407_0201"
FT                   /note="HMMPfam hit to PF08534, Redoxin, score 5.7e-10"
FT                   /inference="protein motif:HMMPfam:PF08534"
FT   CDS_pept        complement(213253..215742)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0211"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55034"
FT                   /db_xref="GOA:A0A0H3MT04"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT04"
FT                   /protein_id="CAZ55034.1"
FT                   /translation="MNEVYFTGTIDRIIFENPSNFYKILLLEIEETDADYDDYEIIVTG
FT                   TIADVIEGEDYRFYGNLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSEHFKGIGRKTA
FT                   EKIVELYGEDTIDKILAEPEKLTQITGLSSKNMQAFVEKLRLNYGTELILAKLAEYGIP
FT                   NKLAFQIQDQYKEKTLQIIEENPYQLVEDVQGLGFTIADRIAENLGIASDSPQRFRAGM
FT                   LFSLIHRSMETGDTYVEARDLLEATLELLEKSRHTELDPAAVAKELTGLIADDKVQQEG
FT                   TKIFDNSLYFAEHGIHTNLTRLMGKNGFKPFPRADVEAAIAELESISSLTYDNIQKEAI
FT                   VQAITNPLFILTGGPGTGKTTVINGIIAVYAILHKIDLTRNREECPVLLAAPTGRATRR
FT                   MNELTGLPSATIHRHLGLVEGQEESYRDDYLDADFIIVDEFSMVDTWLANQLFQNISSQ
FT                   TQVLIVGDAEQLPSVSPGQVLADLLKIDKLPSITLERIYRQSDDSTIVTLASQIRQGAL
FT                   PSDFREKKADRSYFEAQNEQIPALIERIVGAAIKSGIPANEVQILAPMYRGAAGIDQLN
FT                   TMTQALLNPLEEGELEFLHNEQAFRQGDRVIHLVNDAEANVFNGDLGYITDLLPAKYTD
FT                   SKQDEITINFDGSEVTYPRNEWYKITLAYAMSIHKSQGSEFQVVILPITRTSHRMLQRN
FT                   LVYTAITRSKSKLILLGEISAFDYAVKNAGTVRKTYLVPRFQGEMAEQESKESLIKKDE
FT                   SKTATTTQTQPPTQPDRKEQVKVVKENNQQLSLLDQDQPEKTSPQPTEYILTVDNLLTI
FT                   DPMIGIEQADIEEFFKA"
FT   CDS_pept        complement(215983..216612)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0203"
FT                   /product="putative signal peptidase I 4"
FT                   /EC_number="3.4.21.89"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0212"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55035"
FT                   /db_xref="GOA:A0A0H3MXE9"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXE9"
FT                   /protein_id="CAZ55035.1"
FT                   /translation="MGAIQKTKRSPLVAFLAEWGIFLLFMAAFFASRYFIWNPVSVDGH
FT                   SMDPTLQHQEKLIMLKTSSIDRFDIVVASETDSDGKEKLIVKRVIGMPGDTIRYENDVL
FT                   YVNDQKVDEPYLDEYLAAFQKDKLQEVYSYNKQFQAVAQSAEAFTQDANGYVDFTVTVP
FT                   EGQYYLMGDDRLVSLDSRSVGTFSRENIKGEVVFRMWPLNRIGTVD"
FT   misc_feature    complement(216286..216492)
FT                   /locus_tag="SSUBM407_0203"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score
FT                   3.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    complement(216316..216354)
FT                   /locus_tag="SSUBM407_0203"
FT                   /note="ScanRegExp hit to PS00760, SPASE_I_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00760"
FT   misc_feature    complement(216460..216483)
FT                   /locus_tag="SSUBM407_0203"
FT                   /note="ScanRegExp hit to PS00501, SPASE_I_1, score NA"
FT                   /inference="protein motif:Prosite:PS00501"
FT   misc_feature    complement(216520..216579)
FT                   /locus_tag="SSUBM407_0203"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0203 by TMHMM2.0 at aa 12-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(216622..217512)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0204"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0213"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55036"
FT                   /db_xref="GOA:A0A0H3MT68"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT68"
FT                   /protein_id="CAZ55036.1"
FT                   /translation="MNTVVLKASAQQKQAMMAHYDRYRQTSKNPYIEAFFKLTGASLSI
FT                   YTSGKVVFQGEMAEQEASRWGYEPESSGQATIPGQNLPMIGTDEVGNGSYFGGLAVVAG
FT                   FVRPEDHSFLKSLGVDDSKKMTDQKICQIAPLLKEKIPHQALLLSPKKYNEVIEQGYNA
FT                   VSVKVALHNQAIFLLLQKGVQPEKIVIDAFTSSQNYQKYLKKEANQFANPVTLEEKAEG
FT                   RYLAVAVSSIIARSMFLENLVQLGQLVGMHLPSGAGSKSDQVAASILKQYGMAGLNQTA
FT                   KLHFANTQKAQKLLK"
FT   misc_feature    complement(216649..217260)
FT                   /locus_tag="SSUBM407_0204"
FT                   /note="HMMPfam hit to PF01351, RNase_HII, score 4.6e-64"
FT                   /inference="protein motif:HMMPfam:PF01351"
FT   CDS_pept        217597..218580
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0205"
FT                   /product="putative oxidoreductase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0214"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55037"
FT                   /db_xref="GOA:A0A0H3N1T4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1T4"
FT                   /protein_id="CAZ55037.1"
FT                   /translation="MEVQMKYKWATLGTGVIANELVQALQAMGGNLYSVANRTYDKGVE
FT                   FAQKYGIEKVYREIDEVFEDPEVDIIYISTPHNTHINYLRKALKAGKHVLCEKSITLNS
FT                   EELAEAIQLAEENQVVLAEAMTIFHMPIYRQLSEVVASGKLGELKMIQMNFGSYKEYDM
FT                   TNRFFNKNLAGGALLDIGVYALSFVRWFMIEKPNQVLSQVKLAPTGVDEQVGILLSNDA
FT                   GEMATIALTLHAKQPKRGTIAYDKGYIELYEYPRGQKAVITYTEDGSQEVIEAGETAKA
FT                   LSYEVADMEKAVAGIENTMHLAYTQDVMEIMTQLRKEWGLVYPEEM"
FT   misc_feature    217615..217971
FT                   /locus_tag="SSUBM407_0205"
FT                   /note="HMMPfam hit to PF01408, GFO_IDH_MocA, score 3.5e-25"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   misc_feature    218005..218337
FT                   /locus_tag="SSUBM407_0205"
FT                   /note="HMMPfam hit to PF02894, GFO_IDH_MocA_C, score 0.011"
FT                   /inference="protein motif:HMMPfam:PF02894"
FT   misc_feature    218107..218175
FT                   /locus_tag="SSUBM407_0205"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0205 by TMHMM2.0 at aa 171-193"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        218989..219906
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0206"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0215"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55038"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTB4"
FT                   /protein_id="CAZ55038.1"
FT                   /translation="MKNNKKMLYTSSLALSLFSTGMISTNVLAIEWAPRTVSEISPEIV
FT                   QEEGMMTYTVQYGDTLSAIASAMNIDMDLLAKINQIADINLIFPDTVLTTTVDQNNQVT
FT                   QVEIEAPVQGNTNETVQATVDLTTNQVTVEDTVVPLDQISSVTDSAPVEEVVEQPVVEA
FT                   PVEEVVEQPVVETPQVTALSTTTTSTSAYDVGLQPQVAAFRAEVANAFGITSFSGYRPG
FT                   DSGDHGKGLAIDFMVPESSALGDQVAAYAVANLASKNINYIIWKQRFYAPYDSIYGPAY
FT                   TWNLMPDRGSITENHYDHVHVSFN"
FT   sig_peptide     218989..219075
FT                   /locus_tag="SSUBM407_0206"
FT                   /note="Signal peptide predicted for SSUBM407_0206 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.981 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    219145..219276
FT                   /locus_tag="SSUBM407_0206"
FT                   /note="HMMPfam hit to PF01476, LysM, score 3.6e-11"
FT                   /inference="protein motif:HMMPfam:PF01476"
FT   CDS_pept        complement(220320..221945)
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /gene_synonym="treC"
FT                   /locus_tag="SSUBM407_0207"
FT                   /product="putative trehalose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.93"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0216"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55039"
FT                   /db_xref="GOA:A0A0H3MT09"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT09"
FT                   /protein_id="CAZ55039.1"
FT                   /translation="MTIDKRKVVYQIYPKSYKDTTGNGVGDLRGIIEKLPYLKELGIDM
FT                   IWLNPFYPSPQRDNGYDISDYTAVNPDFGTMADFEEMVTVGKELGIEFMLDMVLNHCST
FT                   DHEWFQKALAGDKYYQDFFILRDQPTDWVSKFGGNAWAPFGDTGKYYLHLFDVTQADLN
FT                   WRNPHIREELFKVVNFWKDKGVKGFRFDVINLIGKDEVLEDCPINDGKPAYTDRPITHD
FT                   YLKMMNNATFGSEKGFMTVGEMSATTIENCILYTAPERKELSMAFNFHHLKVDYKDGQK
FT                   WTIMDFDFEELKHLFHTWGEEMSVGNGWNALFYNNHDQPRALNRFVDVENFRKEGATML
FT                   AASIHLSRGTPYIYMGEEIGMIDPDYDSMDDYVDVESINAYQMLLDQGHTPKQAFKIIQ
FT                   AKSRDNSRTPMQWDASDNAGFSTGTPWLKAGKSYQTINVEQEKTGPIFTFYQELIRLRK
FT                   ELPLISEGDYKAAYKDSQKVYAFERLLNDEKLLVLNNFFAEEVELDLADDYAHGQVLIS
FT                   NYPDNKLGKKIILKPYQALAIQVK"
FT   misc_feature    complement(220725..221915)
FT                   /gene="treA"
FT                   /gene_synonym="treC"
FT                   /locus_tag="SSUBM407_0207"
FT                   /note="HMMPfam hit to PF00128, Alpha-amylase, score
FT                   1.8e-107"
FT                   /inference="protein motif:HMMPfam:PF00128"
FT   CDS_pept        complement(222026..224020)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0208"
FT                   /product="sugar phosphotransferase system (PTS), IIABC
FT                   component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0217"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55040"
FT                   /db_xref="GOA:A0A0H3MXF5"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXF5"
FT                   /protein_id="CAZ55040.1"
FT                   /translation="MGKFEKEAKQLLEAIGGKENVNAVTHCATRMRFVLADEKKANVKV
FT                   IEDIPAVKGTFTNAGQFQVIIGNDVPIFYNDFTAVSGIEGVSKEAAKSAAKSNQNAIQR
FT                   VMTMLAEIFTPIIPALIVGGLILGFRNVLEGVQMEWLGQAMKDGQLVFDADGNPVWNTI
FT                   VQVSPFWNGVNHFLWLPGEAIFHFLPVGITWSVSRKMGTSQILGIVLGICLVSPQLLNA
FT                   YAVPGTDAATIASDWSWNFGAFSIARIGYQAQVIPALLAGLALSYLEIFWRKVVPEVVS
FT                   MIFVPFLSLLPAIILAHTVLGPIGWTIGQWLSTVVLAGLTGPLKWLFGAVFGALYAPFV
FT                   ITGLHHMTNAIDTQLIADAGGTGLWPMIALSNIAQGSAVFAYFLMNRKNEKEAQVSLPA
FT                   TISAYLGVTEPALFGVNVKYIYPFVAAMIGSSIAGLLSVTFNIQAASIGIGGLPGILSI
FT                   KAEYWGAFFMTMVVAIVVPMILTAVFKRTGAFSKKEETVEEVVAPTEAVVETGAAIELI
FT                   SPLTGQTKELSQATDPVFASGVMGQGVLIDPSEGILVAPVDGEVSVLFPTNHAVGITAT
FT                   NGVELLMHIGMDTVGLEGKGFTAHVKQGDKVKAGDKLISFDIDVIKAAGLIAETPVIVT
FT                   NQTDFDTQVIGNLPRAISQGEAILTVTKN"
FT   misc_feature    complement(222092..222490)
FT                   /locus_tag="SSUBM407_0208"
FT                   /note="HMMPfam hit to PF00358, PTS_EIIA_1, score 1.9e-61"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    complement(222251..222289)
FT                   /locus_tag="SSUBM407_0208"
FT                   /note="ScanRegExp hit to PS00371, PTS_EIIA_TYPE_1_HIS,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00371"
FT   misc_feature    complement(join(222569..222637,222695..222763,
FT                   222776..222844,222872..222940,222977..223045,
FT                   223103..223171,223208..223276,223340..223408,
FT                   223427..223495,223634..223702))
FT                   /locus_tag="SSUBM407_0208"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUBM407_0208 by TMHMM2.0 at aa 107-129, 176-198, 205-227,
FT                   249-271, 284-306, 326-348, 361-383, 393-415, 420-442 and
FT                   462-484"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(222731..223693)
FT                   /locus_tag="SSUBM407_0208"
FT                   /note="HMMPfam hit to PF02378, PTS_EIIC, score 3.2e-38"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    complement(223895..223999)
FT                   /locus_tag="SSUBM407_0208"
FT                   /note="HMMPfam hit to PF00367, PTS_EIIB, score 3.1e-16"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    complement(223910..223963)
FT                   /locus_tag="SSUBM407_0208"
FT                   /note="ScanRegExp hit to PS01035, PTS_EIIB_TYPE_1_CYS,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS01035"
FT   CDS_pept        224254..224967
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0209"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0218"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55041"
FT                   /db_xref="GOA:A0A0H3MT72"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT72"
FT                   /protein_id="CAZ55041.1"
FT                   /translation="MKKYQEIYNDLKEKIRTNVYPAESSLPTEQQLQEIYGVSRDTVRK
FT                   ALAILTEGGLIQKVQGRGSMVLKQEILNFPVSGLTSYQELTNVLQLSTKTDVVSLDMIT
FT                   VNSSLSHLTGFEPYSKVWKVVRTRSIDGKVSVVDTDYLAVDVVPELTTAIAEKSIYEYL
FT                   ENKLGLDIAYAQKEITVEPTNREERELMQSKDDYLVLIKSRVYLGDTQQFQYTESKHKI
FT                   DKFRFVDFARRKHSL"
FT   misc_feature    224260..224451
FT                   /locus_tag="SSUBM407_0209"
FT                   /note="HMMPfam hit to PF00392, GntR, score 6.9e-22"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    224332..224397
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1371.000, SD 3.86 at aa 27-48, sequence
FT                   PTEQQLQEIYGVSRDTVRKALA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    224515..224931
FT                   /locus_tag="SSUBM407_0209"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 6.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   CDS_pept        225025..225336
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0219"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55042"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1T7"
FT                   /protein_id="CAZ55042.1"
FT                   /translation="MANLNRYKFTFGEKQLTLTTEHDNLFMEEIERIAQEKYQAIKEKM
FT                   PTADPETLALLLAINALSVQLTREMAFEQKEQELASVKEKVLKKNVTLIDLDELEDKV"
FT   CDS_pept        225333..225881
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0211"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0220"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55043"
FT                   /db_xref="GOA:A0A0H3MTB8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTB8"
FT                   /protein_id="CAZ55043.1"
FT                   /translation="MISLAIILILAWSFYIGYSRGLVLQAFYSMGSIIALVVATATYKK
FT                   LASFLYLWVPFANATQGSSNYYFDEKYLFDLDMVFYAGLAFLLIYVLVYAIVRFIGIFV
FT                   HLLEAFNPDTKTTNLISGALAVLVTFISLQIVMVLLSTIPLAMIQDKLHSSFLANIMIQ
FT                   YTPFTSSFLKSLWLSNIAG"
FT   misc_feature    225333..225854
FT                   /locus_tag="SSUBM407_0211"
FT                   /note="HMMPfam hit to PF02674, Colicin_V, score 9.3e-36"
FT                   /inference="protein motif:HMMPfam:PF02674"
FT   misc_feature    join(225393..225461,225564..225623,225684..225752,
FT                   225795..225863)
FT                   /locus_tag="SSUBM407_0211"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0211 by TMHMM2.0 at aa 21-43, 78-97, 118-140 and
FT                   155-177"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        226032..228365
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="SSUBM407_0212"
FT                   /product="putative DNA mismatch repair protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0221"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55044"
FT                   /db_xref="GOA:A0A0H3MT16"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT16"
FT                   /protein_id="CAZ55044.1"
FT                   /translation="MNNKIIETLEFHKVRQKIEPYLLTEQGFEELRQLEPMVEVHRIQQ
FT                   AFDELTDIAQIFVENPYFSLAATSDIGPAMRRLELDTDLNIAELLAVKKVLEVSKSLLD
FT                   FYGNLENVSLSQLDKLFEKIELFPHLQGSLQSINDAGFVEDFASEKLARIRRKIREAED
FT                   QVRQVMQDILKTKGDMLSDSILASRNGRNVLPVKNTYRNKIAGVVHDISASGSTVYIEP
FT                   RAVVTLNEEISHLRAEERHELNRILQELSDMLRPHGGVIRNNAWLIGHIDFVRAKHLFA
FT                   RDHQAVVPKLSEKQDIALLNVRHPLIAKPVPNDLYFGSQLTAIVITGPNTGGKTIMLKT
FT                   LGLTHLMAQSGLPILADKGSRVAIFKEIFADIGDEQSIEQSLSTFSSHMTHTVEILRAA
FT                   DQDSLILFDELGAGTDPQEGASLAMAILDDLRLRGIKTMATTHYPELKAYGIETSGIEN
FT                   ASMEFDSNSLRPTYKFMQGVPGRSNAFEIARRLGLSDIIIQSAQSWTDTDSDVNRIIEK
FT                   LESQTVESRQRLDKIRDVEQENYKMNRALRKLYDELNRERENELNKARLEAKEIVDMAL
FT                   AESEDILKNLHAAASLKPHQIIEAKAELKKLAPEVVDLSKNKVLKKAKIKREAKVGDDI
FT                   IVTAYGQRGTLTNQLKDGRWEAQVGLIKMTLAKDEFELVKAEKAEQPKKRQVHTVKRAN
FT                   VRGPKARLDLRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTGVIREGVTKYLRRN
FT                   KQIKEFGYAPQNAGGSGCTIVTFK"
FT   misc_feature    226887..227594
FT                   /gene="mutS2"
FT                   /locus_tag="SSUBM407_0212"
FT                   /note="HMMPfam hit to PF00488, MutS_V, score 5e-16"
FT                   /inference="protein motif:HMMPfam:PF00488"
FT   misc_feature    227238..227288
FT                   /gene="mutS2"
FT                   /locus_tag="SSUBM407_0212"
FT                   /note="ScanRegExp hit to PS00486, DNA_MISMATCH_REPAIR_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00486"
FT   misc_feature    228135..228362
FT                   /gene="mutS2"
FT                   /locus_tag="SSUBM407_0212"
FT                   /note="HMMPfam hit to PF01713, Smr, score 2.9e-33"
FT                   /inference="protein motif:HMMPfam:PF01713"
FT   CDS_pept        228389..229042
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0213"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0222"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55045"
FT                   /db_xref="GOA:A0A0H3MXG0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXG0"
FT                   /protein_id="CAZ55045.1"
FT                   /translation="MIIRKYQTSDEKGWVYCKALSYLFSPFFDDRETEKPELMTDVYDH
FT                   RVEWVAEVDGQIVGLIDIDIYTEECSQSYIYAPSKRTAYFTNLAVHPDFQGQGIAQALF
FT                   EKAEQELRAQGVEKLAIFTREDDAANHLYQKWGGEVVCSDYLVVGAPQDVPTFRFGIDL
FT                   ERGRLSFSDMEGQPVPYYLREGVYVVSEEAGLDLFDIEDVYQELTYVVDLTEKS"
FT   misc_feature    228533..228805
FT                   /locus_tag="SSUBM407_0213"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   1.1e-19"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        229249..229563
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0214"
FT                   /product="putative thioredoxin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0223"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55046"
FT                   /db_xref="GOA:A0A0H3MT78"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT78"
FT                   /protein_id="CAZ55046.1"
FT                   /translation="MVQVITDANFEVETQEGVVLVDFWAPWCGPCRMQAPILEQLADEV
FT                   DEDELRIYKMDVDENPNTARQFGIMSIPTLLFKKDGQVVKQVAGVHTKDQIKAILAEIG
FT                   "
FT   misc_feature    229249..229557
FT                   /locus_tag="SSUBM407_0214"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 2.5e-36"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   misc_feature    229306..229362
FT                   /locus_tag="SSUBM407_0214"
FT                   /note="ScanRegExp hit to PS00194, THIOREDOXIN, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS_pept        229831..231360
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0215"
FT                   /product="AMP-binding enzyme"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0224"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55047"
FT                   /db_xref="GOA:A0A0H3N1U2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1U2"
FT                   /protein_id="CAZ55047.1"
FT                   /translation="MSTISYKPLNLYRQFKTAAQEFPNVAIYFDKPYASFPELGLENTY
FT                   QTVFEAIQKRAAQFAAAGIGYGDKVILYKSPAFDTYLLAVAVTALGAVPVMISYHLPSS
FT                   NLDVFAERLEKSFIVYDQETEERVAGMTRTDLVTKIFLPQVLVQEAVAFEENLLPEDVI
FT                   QYMTHTSGTTGVPKLICHTAQTMGWRVAWQQTIFDKMTERGLLAFHISPVHSRYNIGVS
FT                   SAIGLGFPLYPLSSARKDDVERALALHRPSALETHPNNFVQWARLAKEKPEVFSSIRYY
FT                   HSTFDAINIGTLRAFLEASKEQDPVFMQVYGQSECGPMILRYHRLENLGTVSGRDMGIG
FT                   LEGYTEARITDAQGNPLPAGENGHIQFLSKGRAVTYYKEDARFQDNVYGAWWDSGDYGC
FT                   MTPEGTLLLKDRQVDLIEHIDSNLALEDLLLDKLDFLSEVVIIRDVNGAPQPIVALAED
FT                   AEMNWEAWWAMVADLPLLKEPILMAYDDIPRTATMKVQRLKMEAEMKEKNL"
FT   misc_feature    229960..231063
FT                   /locus_tag="SSUBM407_0215"
FT                   /note="HMMPfam hit to PF00501, AMP-binding, score 3.6e-32"
FT                   /inference="protein motif:HMMPfam:PF00501"
FT   misc_feature    230326..230361
FT                   /locus_tag="SSUBM407_0215"
FT                   /note="ScanRegExp hit to PS00455, AMP_BINDING, score NA"
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS_pept        231400..232338
FT                   /transl_table=11
FT                   /gene="msrAB"
FT                   /locus_tag="SSUBM407_0216"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0225"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55048"
FT                   /db_xref="GOA:A0A0H3MTC2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTC2"
FT                   /protein_id="CAZ55048.1"
FT                   /translation="MKEIYLAGGCFWGMEGYFSQIDGILDTSVGYANGQVETTNYQLLK
FT                   QTDHAETLYLAYDETRINLREILLYYFRVIDPFSVNQQGPDKGRQYRTGIYYTDEADLP
FT                   TIEQVMTEQSQLFGGRPLAVEVEPLAHYIPAEDYHQDYLKKNPQGYCHIDLGQAKIPLI
FT                   DVADYQKPDQQVLKDSLTDLQYQVTQEAATERPFENEFWNSEQAGIYVDITTGEPLFLS
FT                   TDKFDSGCGWPSFTKPISKEVATYFQDKSHGMNRIEVRSRAGHAHLGHVFDDGPRDKGG
FT                   LRYCINSAALRFIPREEMEEAGYGLFLDLLK"
FT   misc_feature    231403..231867
FT                   /gene="msrAB"
FT                   /locus_tag="SSUBM407_0216"
FT                   /note="HMMPfam hit to PF01625, PMSR, score 7.1e-82"
FT                   /inference="protein motif:HMMPfam:PF01625"
FT   misc_feature    231916..232287
FT                   /gene="msrAB"
FT                   /locus_tag="SSUBM407_0216"
FT                   /note="HMMPfam hit to PF01641, SelR, score 6.1e-85"
FT                   /inference="protein motif:HMMPfam:PF01641"
FT   CDS_pept        232477..233334
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0217"
FT                   /product="putative transcriptional regulator"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0226"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55049"
FT                   /db_xref="GOA:A0A0H3MT21"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT21"
FT                   /protein_id="CAZ55049.1"
FT                   /translation="MILSKRFKNRRKELGFTQKELAEGICEQSLISRVEKLGVAPTSDI
FT                   LFALSQRLQVSMDYFFDESVSDKAPDITVFKRLVDKALFTRSYDQLAYLVEAEKQKEAV
FT                   HSQESSEYLTYLACIVDFHHYHKEDIAIGCMEELSHRISKKSSFYLDVYNSLVNFYALA
FT                   SRDEDLDGLYEGISEKLSHLDISNTECFHKYIKIRYNHAHYLFKRKRQSQAIDELTDLI
FT                   ETLRDKKSCYFLADMLCLIANVGEGFLSKDEILSYYREAECLFKFFGPQNSYLSLKEYL
FT                   SKVI"
FT   misc_feature    232495..232656
FT                   /locus_tag="SSUBM407_0217"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 9e-11"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        233518..235503
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0218"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0227"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55050"
FT                   /db_xref="GOA:A0A0H3MXG5"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXG5"
FT                   /protein_id="CAZ55050.1"
FT                   /translation="MKKVFTYLSTFSVCLFCIWLVSLQLDSLIYHYYPSVSILSRGEEV
FT                   TYEEVSDALTNLAEKENSLIAKTITETDDSGRTTTSYDVFGKGELPQGLVKADRLVASQ
FT                   ANLAENYYVVKGNLDIKVVENVLQSLGLVDSYIYRPTLLNSLSLFLGRGAPSLGLIIFI
FT                   LTNLALTVVGQIVYLRSAGIEMLSGVRSWQIASRFLRVDGRDIALATGGALVFGLIAIL
FT                   ILGWPMVYYRFVAIGIAFYACLLFFLSLSTSIGFMIALNISQLQKLIKGALPLKAIFAI
FT                   LLVGQCLAVCIISIGASRTLTYVGVLHTLTIGEKAWQERQDVFSLSLNREAFIADEAMA
FT                   QQQRMAWSHVILESYAKNNVMLVQHHLRHNTIKEHTIIESSKEIPLERVLYVTPNYIQS
FT                   EGGLYDFNQLEEIKQLGKGEIALLLPKSLQNDASVYQAYFEDMVGKLLADGEGSISLHS
FT                   NVYYISDEKRWFIYNHTPINYEQFLQAPLIVVLSPESFEETSYFWENALPDFVFFKDKE
FT                   MLEQLLDKYNLQNTIGSLLSSKQHYNTLRKNVQLEILMTLSPTILGIFTSILLFNTMNL
FT                   LYFETFKREIAIKRIAGMGFIELHGSYLGEQVGSALIGMGLAMFMTKSVIVSLGVVVAL
FT                   LINSWMLLNNQAKREEKIQLSVLNGR"
FT   misc_feature    join(233536..233604,233983..234051,234133..234201,
FT                   234229..234297,234334..234402,235186..235254,
FT                   235312..235380,235390..235449)
FT                   /locus_tag="SSUBM407_0218"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUBM407_0218 by TMHMM2.0 at aa 7-29, 156-178, 206-228,
FT                   238-260, 273-295, 557-579, 599-621 and 625-644"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    235198..235497
FT                   /locus_tag="SSUBM407_0218"
FT                   /note="HMMPfam hit to PF07242, DUF1430, score 1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF07242"
FT   CDS_pept        235523..237508
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0219"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0228"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55051"
FT                   /db_xref="GOA:A0A0H3MT83"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT83"
FT                   /protein_id="CAZ55051.1"
FT                   /translation="MKGKFVLVSTIILAVFMIWLGVSQKETMLVHYYPSVTTLSVSEDV
FT                   TYSDVRQRLEDYSQQTDSVIARRVIEPSKSGGRTFSYDNFSQSPLPRGLEEFQASEKVE
FT                   SALLTKYFIFQGKATVEELRSLLVSLGLDEVQIRKPSTIATLLVFLTQGGQFLAVLVFL
FT                   ITYMALVVIANVRQLRTAGIRLIAGDSRWHLFLLSLQENAKEIALTIPFAVLPAVGLAY
FT                   LVGLDGYSVYYLVAALVGYHFLLGLIVLFFAATFTLAIRTYHFLPLLKGKMPLQGILTI
FT                   MVMGQMLALLVVSFGMAQTVYYSGIWQEYQAGAQQWENEGDYYSLAWNISADGRSGLNS
FT                   PENWYPLLRQALEEDGALFVKSNLNAYLMGFQLEDGTRLDSYHPAGNTLYVSPNYLQIQ
FT                   DVDLAEGEVALPLQEGEFQLLLPEKLRPESDAYLHLYQDYINRMVRPANQARSATIKGK
FT                   VAYLKNGQKQFIYNHRSGQHVQYLTDPILVVLAPSSLGKESADFWLNEVDSSMLFKNRD
FT                   KLLRELKARNLFQFVNEVRSSSSLFTELLDRIRIETISTSMGAILGIVTSIVLFNTMNL
FT                   LYFEEFKREIVIKEIAGMGFLGIHKKYLTLQLLSLLLALGASMVVTGHIFISSISFALF
FT                   MVNALCLLRWQARKEGAWNVRILKGA"
FT   misc_feature    join(235535..235588,235958..236026,236138..236197,
FT                   236234..236302,236345..236413,237191..237259,
FT                   237380..237448)
FT                   /locus_tag="SSUBM407_0219"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUBM407_0219 by TMHMM2.0 at aa 5-22, 146-168, 206-225,
FT                   238-260, 275-297, 557-579 and 620-642"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    237203..237502
FT                   /locus_tag="SSUBM407_0219"
FT                   /note="HMMPfam hit to PF07242, DUF1430, score 5.4e-25"
FT                   /inference="protein motif:HMMPfam:PF07242"
FT   CDS_pept        237510..238142
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0220"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0229"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55052"
FT                   /db_xref="GOA:A0A0H3N1U5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1U5"
FT                   /protein_id="CAZ55052.1"
FT                   /translation="MFSVQSIQKKFGKRSLFSDVTLDLQAGKVYALIGASGSGKTTLLN
FT                   ILAKLESYDAGDILYKGKDLKKLKPHLFFREELGYLFQNFGLLESQTIKENLDLGLISQ
FT                   KLSKDERKSRQEAALDAVGLSYLDLSQPIYELSGGEAQRVALAKVILKNPPLILADEPT
FT                   AALDPKSSQEIMDILLSLKSPDRLIVIATHNPLIWERADLIIKMEDL"
FT   misc_feature    237588..238139
FT                   /locus_tag="SSUBM407_0220"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.6e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    237915..237959
FT                   /locus_tag="SSUBM407_0220"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   repeat_region   complement(238149..238252)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   misc_RNA        238355..238459
FT                   /locus_tag="SSUBM407_m0001"
FT                   /note="gcvT element (RF00504) as predicted by Rfam, score
FT                   69.81"
FT   CDS_pept        238566..239900
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0221"
FT                   /product="sodium:alanine symporter family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0230"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55053"
FT                   /db_xref="GOA:A0A0H3MTC7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTC7"
FT                   /protein_id="CAZ55053.1"
FT                   /translation="MLELFKAINNLVWGPPLLLLLVGTGVYFTLRLGVFQIGKLPTAFR
FT                   LIFSSDQSGQGDVSSFAALCTALAATVGTGNIVGVATAITTGGPGALFWMWVAAFFGMA
FT                   TKYAEGFLAIKYRTKDANGQAAGGPMHYITLGMGQKWKPLAVFFAISGVLVALLGIGTF
FT                   SQVNSITASLETSFGLEPPLVSVITAISIAFVVFGGIEKISDVSTKIVPFMAILYILAS
FT                   ITVLAVHWDQLLPTLALVFKSAFTPAAAVGGFAGATVQQAIQRGIARGVFSNESGLGSA
FT                   PIAAAAAKSDNPVEQGLISMTGTFIDTLIICTLTGFTILVTDQWSVEGLAGAPLTQAAF
FT                   ATVFGNTGSIALTISLVLFAFTTILGWSYYGERCIEFLFGTKSILPYRLVFVAMVALGG
FT                   FLKLDLIWTIADIVNGLMALPNLIALLALSPVIIKETRQYFAKKK"
FT   misc_feature    join(238602..238670,238743..238811,238839..238907,
FT                   238995..239063,239091..239159,239193..239246,
FT                   239274..239342,239457..239525,239610..239678,
FT                   239715..239768,239796..239864)
FT                   /locus_tag="SSUBM407_0221"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SSUBM407_0221 by TMHMM2.0 at aa 13-35, 60-82, 92-114,
FT                   144-166, 176-198, 210-227, 237-259, 298-320, 349-371,
FT                   384-401 and 411-433"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    238683..239897
FT                   /locus_tag="SSUBM407_0221"
FT                   /note="HMMPfam hit to PF01235, Na_Ala_symp, score 8.6e-180"
FT                   /inference="protein motif:HMMPfam:PF01235"
FT   misc_feature    238824..238871
FT                   /locus_tag="SSUBM407_0221"
FT                   /note="ScanRegExp hit to PS00873, NA_ALANINE_SYMP, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00873"
FT   CDS_pept        239965..240813
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0222"
FT                   /product="mechanosensitive ion channel protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0231"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55054"
FT                   /db_xref="GOA:A0A0H3MT26"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT26"
FT                   /protein_id="CAZ55054.1"
FT                   /translation="MNDFITKYLSQFNIEAIVTAGLNKVLSLVLLFVAFYIIKKIAKAS
FT                   VKKVLVPSLKVSTQDIGRQKTISRLVESILNYLLYFILIYCILSILGLPVSSLLAGAGI
FT                   AGVAVGLGAQGFLSDLVNGFFILIERQFDVGDVVKLTNGPITISGTIVSMGIRTTQVRD
FT                   ADGTLHFIPNRNILVVSNQSRGDMRAQIDIPLKFNTDLEQVYRVIEEVNLREISNFDQI
FT                   TGVTVLGPQNAISGQFVFRVNLFVANGQQNKIYHQFFGFYQDALRQAGIDLPSSGPTVL
FT                   K"
FT   misc_feature    join(240007..240075,240181..240249,240277..240345)
FT                   /locus_tag="SSUBM407_0222"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0222 by TMHMM2.0 at aa 15-37, 73-95 and 105-127"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    240178..240786
FT                   /locus_tag="SSUBM407_0222"
FT                   /note="HMMPfam hit to PF00924, MS_channel, score 1.9e-47"
FT                   /inference="protein motif:HMMPfam:PF00924"
FT   CDS_pept        240881..241411
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0223"
FT                   /product="putative lipoprotein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0232"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55055"
FT                   /db_xref="GOA:A0A0H3MXG9"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXG9"
FT                   /protein_id="CAZ55055.1"
FT                   /translation="MHKQPLFWTTIAGAVLSFILGVTCFIFMIGLSSANFDNWDTGSDG
FT                   YIDETVEYTEYQVGDSVDFSNGLHVTVTSMGKDDSIELVDSYYSTAYVVEMEVENSTAK
FT                   ELYFDEYYFSLMDPVSQIPFTLDLRTYDVNLVEKLKPGEKVQVKLIYGIDNETNFGFTY
FT                   EDAMWTELVAEGI"
FT   sig_peptide     240881..240982
FT                   /locus_tag="SSUBM407_0223"
FT                   /note="Signal peptide predicted for SSUBM407_0223 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.992) with
FT                   cleavage site probability 0.891 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    240899..240967
FT                   /locus_tag="SSUBM407_0223"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0223 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        241466..241594
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0224"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0233"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT88"
FT                   /protein_id="CAZ55056.1"
FT                   /translation="MVQIVRLGNCTISDLSVIFTFKKGEYVYPLFSSSFNEKYPQN"
FT   CDS_pept        complement(241647..242993)
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="SSUBM407_0225"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0234"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55057"
FT                   /db_xref="GOA:A0A0H3N1U8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1U8"
FT                   /protein_id="CAZ55057.1"
FT                   /translation="MSNAKAYIQASFEAVKARNPHETEFLQAVEELFSTLEPVFEAHPE
FT                   YIEENILARIVEPERIISFRVPWTDKDGNVQVNRGYRVQFNSAVGPYKGGLRFHPTVNQ
FT                   SILKFLGFEQIFKNVLTGLPIGGGKGGSDFDPKGKTDAEIMRFCQSFMTELQKHIGPSL
FT                   DVPAGDIGVGGREIGYMYGQYKRLRQFDAGVLTGKPLGFGGSLIRPEATGYGLVYFTDN
FT                   MLAANGKSFKDQTVLISGSGNVAQYAVQKATELGAKVISVSDSNGYIIDETGIDFDLLV
FT                   DIKEKRRARLTEYAAEKSTAKYFKGSVWNYDGKADIALPCATQNEINGKQAAALVKNGV
FT                   YCVAEGANMPSDLDAIKVYKENGVLYGLAKAANAGGVAVSALEMSQNSLRLSWTREEVD
FT                   GRLKDIMANIFNTAKETAEKYDLGTDYLAGANIAAFEQIADSMIAQGLV"
FT   misc_feature    complement(241656..242387)
FT                   /gene="gdh"
FT                   /locus_tag="SSUBM407_0225"
FT                   /note="HMMPfam hit to PF00208, ELFV_dehydrog, score
FT                   8.6e-137"
FT                   /inference="protein motif:HMMPfam:PF00208"
FT   misc_feature    complement(242430..242822)
FT                   /gene="gdh"
FT                   /locus_tag="SSUBM407_0225"
FT                   /note="HMMPfam hit to PF02812, ELFV_dehydrog_N, score
FT                   1.3e-83"
FT                   /inference="protein motif:HMMPfam:PF02812"
FT   misc_feature    complement(242586..242627)
FT                   /gene="gdh"
FT                   /locus_tag="SSUBM407_0225"
FT                   /note="ScanRegExp hit to PS00074, GLFV_DEHYDROGENASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00074"
FT   CDS_pept        243215..244153
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="SSUBM407_0226"
FT                   /product="putative dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0235"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55058"
FT                   /db_xref="GOA:A0A0H3MTD2"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033886"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTD2"
FT                   /protein_id="CAZ55058.1"
FT                   /translation="MVSTVTTLGGFTFDNCLMNAAGVWCMTKEELDAVKNSKAGTFVTK
FT                   TATLDYRAGNPEPRYQNVPLGSINSMGLPNQGLAYYLDYLLELQETEPERTFVLSVVGM
FT                   SPDETHEILRTVEASDFKGLTELNLSCPNVPGKPQIAYDFETTETILQEVFTYFTKPLG
FT                   IKLPPYFDIVHFDQAAAIFNQFPLKFVNCVNSIGNGLYIKDESVVIKPKNGFGGIGGEY
FT                   IKPTALANVHAFYQRLKPEIQIVGTGGILTGRDAFEHILCGASMVQVGTTLQKEGVAAF
FT                   GRITAELQAIMAEKGYETIEDFRGKLQHLDD"
FT   misc_feature    243221..244090
FT                   /gene="pyrD"
FT                   /locus_tag="SSUBM407_0226"
FT                   /note="HMMPfam hit to PF01180, DHO_dh, score 1.2e-110"
FT                   /inference="protein motif:HMMPfam:PF01180"
FT   misc_feature    243332..243391
FT                   /gene="pyrD"
FT                   /locus_tag="SSUBM407_0226"
FT                   /note="ScanRegExp hit to PS00911, DHODEHASE_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00911"
FT   misc_feature    243944..244006
FT                   /gene="pyrD"
FT                   /locus_tag="SSUBM407_0226"
FT                   /note="ScanRegExp hit to PS00912, DHODEHASE_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00912"
FT   CDS_pept        244486..245718
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0227"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0236"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55059"
FT                   /db_xref="GOA:A0A0H3MT32"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT32"
FT                   /protein_id="CAZ55059.1"
FT                   /translation="MERRANYIRRKRYASYRTKMHLFFICGLATIILAIIIVSEHLVPR
FT                   LNQASESMHSDNSVRIMAHGDLLYHLPILRGAEQPDGSYDFSENFTYVKPWIEQADFAI
FT                   ADFEGTISPDIELAGYPLFNAPAIVANNIHDAGYDLVDLAHNHILDSHLSGLISTVNTF
FT                   RDAGVDTVGVYVEGNRATAPLYIREVNGIRIAVLAYAYGFNGMEALLSQEEYDAYLSDF
FT                   DKEKMRAEIERAEKEADITIVMPQTGVEYQLEPTEEQTSLYHQMIDWGADIVLGGHPHV
FT                   VEPTEILEKDGQRKLIIYSMGNFLSNQRIESMEDTPNAQWTERGVLMDLTIQKENGQTS
FT                   IQTAQAHPTWVNRLSKGTYSTDGYEQFSYQTYILEDWVAGGRYYGQLDLDTQARVDTAY
FT                   QEMKDFVNLVW"
FT   sig_peptide     244486..244602
FT                   /locus_tag="SSUBM407_0227"
FT                   /note="Signal peptide predicted for SSUBM407_0227 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.950) with
FT                   cleavage site probability 0.600 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    244546..244614
FT                   /locus_tag="SSUBM407_0227"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0227 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        245730..246557
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0228"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0237"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55060"
FT                   /db_xref="GOA:A0A0H3MXH3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXH3"
FT                   /protein_id="CAZ55060.1"
FT                   /translation="MIVRLIATDMDGTFLDGQGNFDRERFSRVLDQLDQKKIPFVIASG
FT                   NGIGRLLQLCQGFEDRLIFVADNGAHVYQNGKTVIRRAIQQVEVEAILHFFKGRWADVC
FT                   LMLSNDGNIYMQAGAGMPFAGTDLPIELAQMAAFQNRVTYLDNLSAYPVSESIHKVGLW
FT                   VPEARVESITEAFNQGFHGQLVAVTSGYGSVDILPQGIHKAWGLEQVLTGLDIEPEQVM
FT                   AFGDSDNDIELLSYVGYSYAMENATDKVKAVAKYMAPSHLEAGVLQVIEEYIL"
FT   misc_feature    245745..246539
FT                   /locus_tag="SSUBM407_0228"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 5.6e-60"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    246399..246467
FT                   /locus_tag="SSUBM407_0228"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score NA"
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS_pept        complement(246606..247388)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0229"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0238"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55061"
FT                   /db_xref="GOA:A0A0H3MT93"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT93"
FT                   /protein_id="CAZ55061.1"
FT                   /translation="MKKYISLYLYNIKVYMMAQMSFRVDFFIGLFSSLIEQIVYLIFLN
FT                   ILFGNIKEIAGFNYGQMLFIYGIATVGRSIHLIFFDNLWMFGSRYIRQGEFERLLLMPM
FT                   NPLFQLICERIQPQGIGTTLIGSLALVQASNELGMEWSLGKLALLIFIAICIGLLYAAI
FT                   QLGPTALAFWIVESFPLTMGIFALNQMAQYPLNIYPKIIQILLIFVFPYAFTAYFPALY
FT                   FLDLSMWGLALPLVVVVLFSINYNLFRYGMTKFTSVGN"
FT   misc_feature    complement(246609..247298)
FT                   /locus_tag="SSUBM407_0229"
FT                   /note="HMMPfam hit to PF06182, DUF990, score 1.7e-42"
FT                   /inference="protein motif:HMMPfam:PF06182"
FT   misc_feature    complement(join(246645..246713,246741..246809,
FT                   246828..246887,246900..246968,247149..247217,
FT                   247245..247313))
FT                   /locus_tag="SSUBM407_0229"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0229 by TMHMM2.0 at aa 26-48, 58-80, 141-163,
FT                   168-187, 194-216 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(247390..248169)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0230"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0239"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55062"
FT                   /db_xref="GOA:A0A0H3N1V2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1V2"
FT                   /protein_id="CAZ55062.1"
FT                   /translation="MRKYLYMTRLTMMNAMQYKAFFLATFVSLAVKILVALYVWKTIFF
FT                   TQSEVNGFTLQTFTTYIIFANLLASLNSFSLGEDLSYSILKGSIAGEFLRPYSFILALF
FT                   FKDLGNKLLELIKFAIVFIGILLVHQDFYLPDGKTILLFLVSSILGMFIVQLLDMAFGF
FT                   LAFFTVNAWGVMLLRMGLFNLASGALLPLSFYPQAVENFLKLLPYNYAVNVPVSILLGQ
FT                   ESDLTALGLQVIWIPILACFIAALWSQAKRRIVIFGG"
FT   misc_feature    complement(247393..248094)
FT                   /locus_tag="SSUBM407_0230"
FT                   /note="HMMPfam hit to PF06182, DUF990, score 2.2e-06"
FT                   /inference="protein motif:HMMPfam:PF06182"
FT   misc_feature    complement(join(247426..247494,247582..247650,
FT                   247669..247737,247780..247848,247942..248010,
FT                   248053..248112))
FT                   /locus_tag="SSUBM407_0230"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0230 by TMHMM2.0 at aa 20-39, 54-76, 108-130,
FT                   145-167, 174-196 and 226-248"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(248162..249145)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0231"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0240"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55063"
FT                   /db_xref="GOA:A0A0H3MTD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTD9"
FT                   /protein_id="CAZ55063.1"
FT                   /translation="MIQAEHLSKTYSIIDKEVGLKGSIKAFFKPKKKSIPAVQDISLQV
FT                   GKGKIIGYIGSNGSGKSTTIKMLTGVLFPDQGQVRINGLNPQENRKAVNKQIGVLFGQK
FT                   SHLDWNLPVQESFILHAKIYDVPDKVFKERLAVLIELLDLADIMKQPIRNLSLGQRVRC
FT                   EFAAIFIHQPAVVFLDEPTIGLDASVKETIRSFIRYMNQEYQTTFLITSHDMKDIESLC
FT                   ERIFIIDKGKKVYDGSLTVLKERFSTVKTILFSTEKPIEKDLQLEGWEFIRKDDFHFEI
FT                   HYQSKVWTSAQVIEQVFNHYSIEDVTMKELEIETMVRQIYEEGIHA"
FT   misc_feature    complement(248453..249004)
FT                   /locus_tag="SSUBM407_0231"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 2.9e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        complement(249230..249763)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0232"
FT                   /product="TetR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0241"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55064"
FT                   /db_xref="GOA:A0A0H3MT38"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT38"
FT                   /protein_id="CAZ55064.1"
FT                   /translation="MRTDSRKERTRQAILEAMVTCLESQGFNDITTTHLAQTAGISRSS
FT                   FYTHYKDKYELIDSYQQGLFHKLEAIFDHYDGNRQSSFLEIFELLYREKLLSALLTHNG
FT                   TQEIQNFLINKVRLLVANDLAERLGKENLSQLEKEYSSIYFSHAFFGIMQVWIKNGKQE
FT                   SPQYMTDFLIKMLP"
FT   misc_feature    complement(249584..249724)
FT                   /locus_tag="SSUBM407_0232"
FT                   /note="HMMPfam hit to PF00440, TetR_N, score 3.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(249611..249676)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1431.000, SD 4.06 at aa 30-51, sequence
FT                   ITTTHLAQTAGISRSSFYTHYK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        249889..252348
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0233"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0242"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55065"
FT                   /db_xref="GOA:A0A0H3MXH7"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXH7"
FT                   /protein_id="CAZ55065.1"
FT                   /translation="MLQKVKNIFKKPMTLITILGIACVPALYNISFLTSMWDPYGRLDQ
FT                   LPVAVVNQDQSASFQDKTLTIGDDMVDNMKESKSLDFHFVSEKNAEKGLEEGDYYMVIT
FT                   LPEDLSEKATSLLTNQPEPITISYQTSKGHSFVASKMGESAMEKLKTSVSETITKTYTT
FT                   AVFDSMREIQTGMIEAADGSQKLTNGASQLESGSQTLSNGLTTLTTSGQVLVTGANQLA
FT                   TGVVSYTDGVNQAATGSQTLSSGLTIYTNGVASLVSGAEQLNANSSQLITGVGQLQSGA
FT                   SQVEQLVTGANQLQAGLEQLANSTSLSAEQSSQIQALLTGLPQLQVAINQLNDSLSSIG
FT                   GLAVDNSTLSSLLTEMGAQAQGLLTAAQADKTASIEALQTTATYQNLTADQQAELVGAL
FT                   QNSPSATATVAQTILDQLSQLSQTLSSLQSLSGMATQMNQLQSAVGQINTAANQALPGA
FT                   TTAIESLSSGLSQVNTALNQQVLPGTQTLTSGVSQLQTQLSSGASQLMFGVTAYTAGVA
FT                   QLAAGGAQLVANNSSIQSGGGQLTSGLATLASNSSQLVSGSEQLASGSQQLIAGADQLA
FT                   SGGQALTSGISSLRTGSETLTNSLSSASQQLSVVSVEDKNAQAVSQPVTLEHSDQDDVK
FT                   TNGVGMAPYMVSVALMVAALSANVIFVKHIDNRSYKNRWDWAKGKLLLNGIIASLAAVI
FT                   LYGVLRLIGIEPAHPMATLGIILLASWTFMALVTALVGWNNRFGSFASLIILLLQLGSS
FT                   AGTYPIELSPRFFQVIQPYLPMTYSVSSLRQTISMVGNSSHQVWMLSLFLVGFMGLGLL
FT                   IYNQKDE"
FT   misc_feature    join(249925..249993,251806..251874,251932..252000,
FT                   252010..252078,252097..252165,252274..252333)
FT                   /locus_tag="SSUBM407_0233"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0233 by TMHMM2.0 at aa 13-35, 640-662, 682-704,
FT                   708-730, 737-759 and 796-815"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    251614..252249
FT                   /locus_tag="SSUBM407_0233"
FT                   /note="HMMPfam hit to PF01061, ABC2_membrane, score 0.0024"
FT                   /inference="protein motif:HMMPfam:PF01061"
FT   CDS_pept        complement(252398..253456)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0234"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0243"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55066"
FT                   /db_xref="GOA:A0A0H3MT98"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT98"
FT                   /protein_id="CAZ55066.1"
FT                   /translation="MKKKLTIAIIIGFVSLIAGLILAGIGFFTGGITRLEEVAAPTEVH
FT                   KTFTDLNTIKIDFIPHSVYIKESSDNNYHVTYANSDNNIQNPLKLSEKDGVLTLSAQEL
FT                   EFAIEGIMQYLGESLAQRRINVFSVTIEVPKGKTLDKLEGHNLHFYDFGGFTIENIHIK
FT                   EANLSGGVTLDKVTIDSGQIEAGYFQATQSTLKDMHINLQGSSVRLYETSLENVTIEGY
FT                   SQLDSRQTTLLGDNRFTPSDTYSSTTFLDVTDKSLADSNLLITNQIDKKKLVEAQGYYY
FT                   EDGNDLGEMVNQDPYLKERLGEVGIFTSDKYTKFPVKTENDLQTLTLENKGSKNKLTIE
FT                   ATNATINLGTPK"
FT   sig_peptide     complement(253337..253456)
FT                   /locus_tag="SSUBM407_0234"
FT                   /note="Signal peptide predicted for SSUBM407_0234 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.989) with
FT                   cleavage site probability 0.452 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(253370..253438)
FT                   /locus_tag="SSUBM407_0234"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0234 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(253453..254208)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0235"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0244"
FT                   /note="CDS contains additional internal amino acids,
FT                   residues 90 to 145, in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55067"
FT                   /db_xref="GOA:A0A0H3N1V6"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1V6"
FT                   /protein_id="CAZ55067.1"
FT                   /translation="MTRTEYMEQLEKYLKKLPHKEYFEAISFFNEYFDEAGPERETEII
FT                   EELGSPKEAASELINNMLNKQIQEEKDQQEPIQLNWKLWVGLGALSMTGLFSFFLLFIM
FT                   GEFIGVIPLFATLILGAFFLGRYFRNFSQTKRTLWLAILAVISLPIAIPLLLILLASLL
FT                   GLVALILALIVGAFVLGVGLLTSGGYLIWEAFSLMSEGFNIFLMGFGSGLSLIGGAILI
FT                   YILTGFFAYWSWRLVKACFKWILKRGKRA"
FT   misc_feature    complement(join(253531..253599,253633..253701,
FT                   253729..253797,253834..253887,253900..253968))
FT                   /locus_tag="SSUBM407_0235"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0235 by TMHMM2.0 at aa 81-103, 108-125, 138-160,
FT                   170-192 and 204-226"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(254035..254208)
FT                   /locus_tag="SSUBM407_0235"
FT                   /note="HMMPfam hit to PF08006, DUF1700, score 2.8e-05"
FT                   /inference="protein motif:HMMPfam:PF08006"
FT   CDS_pept        complement(254195..254521)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0236"
FT                   /product="PadR-like family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0245"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55068"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTE6"
FT                   /protein_id="CAZ55068.1"
FT                   /translation="MHFPVPAVLTEFLIMAILESDDSYGYEICQTIKLIANIKESALYP
FT                   ILKRLEQNDFLTTYSQEYQGRMRKYYSLTQLGHEELVRLKDDWDTYTNTINGIIEGSVR
FT                   HDKN"
FT   misc_feature    complement(254270..254497)
FT                   /locus_tag="SSUBM407_0236"
FT                   /note="HMMPfam hit to PF03551, PadR, score 1e-18"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        254830..255210
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0237"
FT                   /product="LrgA family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0246"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55069"
FT                   /db_xref="GOA:A0A0H3MT44"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT44"
FT                   /protein_id="CAZ55069.1"
FT                   /translation="MKLYVQFMIILVFSFLGEAISTIFHLPIPGSIIGLILLFLALEFK
FT                   LIRLRHIHTVGNFLLANMTILFLPAAVGIMERFDAIKDYLLPIIVVILGAIFLNILVIG
FT                   FVVQFVKQKFEGDYIDAEGNHD"
FT   misc_feature    254836..255165
FT                   /locus_tag="SSUBM407_0237"
FT                   /note="HMMPfam hit to PF03788, LrgA, score 5.4e-41"
FT                   /inference="protein motif:HMMPfam:PF03788"
FT   misc_feature    join(254887..254955,254992..255051,255079..255147)
FT                   /locus_tag="SSUBM407_0237"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0237 by TMHMM2.0 at aa 20-42, 55-74 and 84-106"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        255185..255898
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0238"
FT                   /product="LrgB-like family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0247"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55070"
FT                   /db_xref="GOA:A0A0H3MXI1"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXI1"
FT                   /protein_id="CAZ55070.1"
FT                   /translation="MMRREIMTELFSNPIFGIMLSIAAYLIGMLIYRRFPHPITTPLLV
FT                   ATGLIIVFLKMTGISYKEYYAGGSYLNMLIVPSTVALGIPLYRSFHLMKHHIRSILLGI
FT                   FVACIVNTVFTALIAKWFGMDFFLAISLFPKSVTTAMAVGITDKMQGIATVTLVVVVAT
FT                   GILTSVLGPVFLKLLKIEDPVAVGLALGGTGHAIGTGTAIKCGHTQGAMAGLAIGITGI
FT                   MYVVISPIVAQIILQ"
FT   misc_feature    join(255212..255280,255299..255367,255377..255445,
FT                   255482..255550,255560..255619,255638..255706,
FT                   255734..255802,255821..255889)
FT                   /locus_tag="SSUBM407_0238"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUBM407_0238 by TMHMM2.0 at aa 10-32, 39-61, 65-87,
FT                   100-122, 126-145, 152-174, 184-206 and 213-235"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    255245..255889
FT                   /locus_tag="SSUBM407_0238"
FT                   /note="HMMPfam hit to PF04172, LrgB, score 3.4e-106"
FT                   /inference="protein motif:HMMPfam:PF04172"
FT   CDS_pept        complement(255931..256731)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0239"
FT                   /product="putative formate/nitrite transporter family
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0248"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55071"
FT                   /db_xref="GOA:A0A0H3MTA2"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTA2"
FT                   /protein_id="CAZ55071.1"
FT                   /translation="MGANQETLMYTLEKSIKKKADLFEHSFSAYAVRSILASLYLGLGI
FT                   VISLYTADKLNHVAEGLGKFSYGLMFGWGLLMILYMNAELGTSNMMYMTVASHRKTIPT
FT                   KTALKMLATCILFNFVGAVLVCYLVSLTLPYQHVDAHSYLFEATVAKLSKTPLTQFIEG
FT                   IFANIVVNIGVFTFLRIKDDAGRLISVIFIIFIFAFLGYEHVIANFSLFSLAFFANGGP
FT                   VEGMTLLSVLSNFLFSGLGNYVGGGLFIGLLYSWLNNQSKLYVD"
FT   misc_feature    complement(255949..256722)
FT                   /locus_tag="SSUBM407_0239"
FT                   /note="HMMPfam hit to PF01226, Form_Nir_trans, score
FT                   1.1e-16"
FT                   /inference="protein motif:HMMPfam:PF01226"
FT   misc_feature    complement(join(255961..256029,256111..256179,
FT                   256198..256266,256324..256392,256453..256521,
FT                   256579..256647))
FT                   /locus_tag="SSUBM407_0239"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0239 by TMHMM2.0 at aa 29-51, 71-93, 114-136,
FT                   156-178, 185-207 and 235-257"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        256872..257717
FT                   /transl_table=11
FT                   /gene="gla"
FT                   /locus_tag="SSUBM407_0240"
FT                   /product="glycerol facilitator-aquaporin"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0249"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55072"
FT                   /db_xref="GOA:A0A0H3N1X8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1X8"
FT                   /protein_id="CAZ55072.1"
FT                   /translation="MDVTWTVKYITEFLATALLIIIGNGTVANVDLKGTKGNNSGWILI
FT                   AIGYGLAVMMPALMFGNVSGNHINPAFTLGLAVSGLFPWAHVAQYIVAQLLGAMFGQLV
FT                   VVAVYKPYFLKTENSNHILGSFSTISALDNGTKESRKAATTNGFLNEFVGSFVLFFGAL
FT                   ALTKHFFGSELVGKLIEQGYDKTVAETMTAPYTSGSIAVAHLGIGFLVMALVAALGGPT
FT                   GPGLNPARDLGPRIVHALLPKSVLGENKADSKWWYAWVGVCAPIIASIAAVALFKFLYL
FT                   "
FT   misc_feature    256872..257699
FT                   /gene="gla"
FT                   /locus_tag="SSUBM407_0240"
FT                   /note="HMMPfam hit to PF00230, MIP, score 3.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    join(256884..256952,256995..257063,257082..257150,
FT                   257325..257393,257454..257522,257640..257708)
FT                   /gene="gla"
FT                   /locus_tag="SSUBM407_0240"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0240 by TMHMM2.0 at aa 5-27, 42-64, 71-93,
FT                   152-174, 195-217 and 257-279"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    257070..257096
FT                   /gene="gla"
FT                   /locus_tag="SSUBM407_0240"
FT                   /note="ScanRegExp hit to PS00221, MIP, score NA"
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS_pept        257846..259378
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0250"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTH9"
FT                   /protein_id="CAZ55073.1"
FT                   /translation="MSDVIAFGYGSSRAKMQLKRLNRHGIIAGATGTGKTVTLKVLAEQ
FT                   LSDAGIPVFLSDIKGDLNSLVAANTKEIDPSRLEKTHYLDYSPVGYPVELWDVLGENGT
FT                   PIRMTISELGPVLLTRLLGLNDTQESILNIVFSVADERGLLLIDLMDLRAMLNFVAENA
FT                   AELSQYYGNIPARSVGAILRSLVVLEQQGGKIFFGEPSLDIADLMRTAEDGRGVINVLQ
FT                   ATQLFNQPTLYSTVLLSLLSELYEVLPEVGDLDKPKMVFFFDEAHVLFKDAPKVLLEKI
FT                   ELIVRLIRSKGVGVFFVTQNPTDIPDSVAAQLGNRIQHGLRAFTPKELKTVATVAETFR
FT                   QEGDEDLAKVIQELQVGEAVVSTLQADGTPSFADRVLIYPPKSMLGTVEPSALLSVINN
FT                   SPLMEKYADAVNRESAHEQILAMTEAKEAELIKKAEQAEAEKQAEKEAKAAAKMEEKAQ
FT                   KEAAKTAQKTSQPASRKTDSMMDRFTKNLMSQVGREVGRVVTRGIMGMLKGK"
FT   misc_feature    257849..259372
FT                   /locus_tag="SSUBM407_0241"
FT                   /note="HMMPfam hit to PF05872, DUF853, score 6e-248"
FT                   /inference="protein motif:HMMPfam:PF05872"
FT   CDS_pept        259490..260098
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0242"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0251"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55074"
FT                   /db_xref="GOA:A0A0H3MT74"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT74"
FT                   /protein_id="CAZ55074.1"
FT                   /translation="MTDQLQALLKDYQPQPLGEKRSYAVFLPLVWSDNQWQVLYEIRSE
FT                   SISQPGEVSFPGGGVEVGETPQQAAVREVMEELNIQPEQIDILGEIDYLVLECSTVHCF
FT                   VGRLNLDWTTILPNEEVARIFTVPLSTLLTTQPVYYQLDSQIVPDCDFPFERLRGGVDY
FT                   PFSHHKRSVPFYENLSENIWGMTAQFTHRFTEIVKSNLS"
FT   misc_feature    259637..259888
FT                   /locus_tag="SSUBM407_0242"
FT                   /note="HMMPfam hit to PF00293, NUDIX, score 1.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    259661..259726
FT                   /locus_tag="SSUBM407_0242"
FT                   /note="ScanRegExp hit to PS00893, NUDIX, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        260100..260225
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0243"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0252"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXJ7"
FT                   /protein_id="CAZ55075.1"
FT                   /translation="MIGYFWEEKPAFAICINEKNGDKAQCEPMYIKTQKKQMHGR"
FT   CDS_pept        260388..262685
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0244"
FT                   /product="putative surface-anchored protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0253"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55076"
FT                   /db_xref="GOA:A0A0H3MTC5"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTC5"
FT                   /protein_id="CAZ55076.1"
FT                   /translation="MSKQKVVSSLLLSTVVLGGLAFYSTTTVKAESLEPDVTSVNASDA
FT                   TNKPVVPNEEGGDFLAEEELEDDDTLEEELNEKAEEVTEPSSPEALLQPRAMMSDSETS
FT                   GMEEIPMNDEPSDNTEEKVEKQQSPLIQTSNADYKSGKDQEKLRTSVSINLLKAEEGQI
FT                   QWKVTFDTSEWSFNVKHGGVYFILPNGLDLTKIVDNNQHDITASFPTDINDYRNSGQEK
FT                   YRFFSSKQGLDNENGFNSQWNWSAGQANPSETVNSWKSGNRLSKIYFINQITDTTELTY
FT                   TLTAKVTEPNQQSFPLLAVMKSFTYTNSKSTEVTSLGAREITLEKEKTLPPKENPKPEP
FT                   EAPKPDAPQAPSAPESPTEEPKKEDAPQTPQAPSTPEKQPEVPESPNPETPDAPSTPKD
FT                   EPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAPSTPEKQPE
FT                   VPESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQAPSTPKEEAP
FT                   KEEVPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVESDKQMPETKKPDMKQPK
FT                   ADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKQLPETKQPDMKQP
FT                   KADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKPMPETKQPDMKQ
FT                   PKADKPEAEKAQMPRTEGMKPESKASMMPKAEAPKATLPNTGEASSAIGWLGGALATLA
FT                   TGLYLFKNKKEE"
FT   sig_peptide     260388..260477
FT                   /locus_tag="SSUBM407_0244"
FT                   /note="Signal peptide predicted for SSUBM407_0244 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.998 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(260406..260465,262605..262664)
FT                   /locus_tag="SSUBM407_0244"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0244 by TMHMM2.0 at aa 7-26 and 740-759"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    262557..262676
FT                   /locus_tag="SSUBM407_0244"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        join(263120..263836,263840..264880)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0245"
FT                   /product="putative surface-anchored protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0254"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   239. C-terminal region is simlar to Streptococcus
FT                   pneumoniae surface protein PspC UniProt:Q8RQ77
FT                   (EMBL:AF276620) (612 aa) fasta scores: E()=6.3e-25, 35.897%
FT                   id in 429 aa"
FT                   /db_xref="PSEUDO:CAZ55077.1"
FT   sig_peptide     263120..263209
FT                   /locus_tag="SSUBM407_0245"
FT                   /note="Signal peptide predicted for SSUBM407_0245 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.995 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    263138..263206
FT                   /locus_tag="SSUBM407_0245"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0245 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    264743..264862
FT                   /locus_tag="SSUBM407_0245"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   0.00041"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        join(264988..265017,265021..265080)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0246"
FT                   /product="transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0254A"
FT                   /note="Probable gene remnant. CDS contains a nonsense
FT                   mutation (opal) after codon 10. Similar to an internal
FT                   region of Streptococcus pneumoniae (strain ATCC BAA-255/R6)
FT                   IS861-truncation degenerate transposase (Orf1)
FT                   UniProt:Q8DQ22 (EMBL:AE008462) (65 aa) fasta scores:
FT                   E()=0.58, 40.000% id in 30 aa"
FT   CDS_pept        265123..265257
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0247"
FT                   /product="integrase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0256"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae (serotype V) phage
FT                   integrase family site-specific recombinase UniProt:Q8DWV1
FT                   (EMBL:AE014287) (494 aa) fasta scores: E()=0.00046, 55.814%
FT                   id in 43 aa"
FT                   /db_xref="PSEUDO:CAZ55079.1"
FT   CDS_pept        complement(265351..265500)
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSUBM407_0248"
FT                   /product="50S ribosomal protein L33 1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0257"
FT                   /note="Similar to SSU1221, 44.898% identity (44.898%
FT                   ungapped) in 49 aa overlap (1-49:1-49)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55080"
FT                   /db_xref="GOA:A0A0H3N1Y1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Y1"
FT                   /protein_id="CAZ55080.1"
FT                   /translation="MRVNITLEHKESGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVIF
FT                   TEVK"
FT   misc_feature    complement(265354..265497)
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSUBM407_0248"
FT                   /note="HMMPfam hit to PF00471, Ribosomal_L33, score
FT                   5.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00471"
FT   misc_feature    complement(265393..265452)
FT                   /gene="rpmG1"
FT                   /gene_synonym="rpmGA"
FT                   /locus_tag="SSUBM407_0248"
FT                   /note="ScanRegExp hit to PS00582, RIBOSOMAL_L33, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00582"
FT   CDS_pept        complement(265516..265698)
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="SSUBM407_0249"
FT                   /product="50S ribosomal protein L32"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0258"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55081"
FT                   /db_xref="GOA:A0A0H3MTI4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTI4"
FT                   /protein_id="CAZ55081.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHYKVAAPTVKFDETTGDYSRSHRVSLK
FT                   GYYKGRKIAKAASAE"
FT   misc_feature    complement(265531..265695)
FT                   /gene="rpmF"
FT                   /locus_tag="SSUBM407_0249"
FT                   /note="HMMPfam hit to PF01783, Ribosomal_L32p, score
FT                   4.8e-22"
FT                   /inference="protein motif:HMMPfam:PF01783"
FT   CDS_pept        265974..267257
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="SSUBM407_0250"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0259"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55082"
FT                   /db_xref="GOA:A0A0H3MT77"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT77"
FT                   /protein_id="CAZ55082.1"
FT                   /translation="MKLQKPKGTQDLLPQDSAKWQYVENFTRSIFKQYNYAEIRTPIFE
FT                   HYEVISRSVGDTTDIVTKEMYDFYDKGERHITLRPEGTAPVVRSYVENKLFAPEVQKPA
FT                   KFYYMGPMFRYERPQAGRLRQFHQIGVECFGSNNPATDVETIAMAYHFFEELGIKDIRL
FT                   HLNSLGNPESRAAYRQALIDYLTPLKEQLSKDSQRRLEENPLRVLDSKEKEDKVAVENA
FT                   PSILDYLDEESTVHFEAVRSMLDNLGITYTIDTNMVRGLDYYNHTIFEFMTEVGGNDLT
FT                   ICAGGRYDGLVTYFGGPETPAFGFGMGIERLILVLEKQGIELPLDTQLDVYIAVLGQEA
FT                   NGGALDLVQAIRKQGFRAERDYLDRKLKAQFKSADVFGAKAIITLGGSEIESGQVVVKN
FT                   NQTRSQVETSLEALKTDFASILEELEKQ"
FT   misc_feature    266028..266537
FT                   /gene="hisS"
FT                   /locus_tag="SSUBM407_0250"
FT                   /note="HMMPfam hit to PF00587, tRNA-synt_2b, score 9.9e-58"
FT                   /inference="protein motif:HMMPfam:PF00587"
FT   misc_feature    266961..267233
FT                   /gene="hisS"
FT                   /locus_tag="SSUBM407_0250"
FT                   /note="HMMPfam hit to PF03129, HGTP_anticodon, score
FT                   3.4e-20"
FT                   /inference="protein motif:HMMPfam:PF03129"
FT   CDS_pept        complement(267338..268363)
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="SSUBM407_0251"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0260"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55083"
FT                   /db_xref="GOA:A0A0H3MXK2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXK2"
FT                   /protein_id="CAZ55083.1"
FT                   /translation="MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVA
FT                   NGDFGKVPGRVLGHEGIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPG
FT                   QWIAIYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPG
FT                   YIKEITGGGVHSTVVTAVSKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIK
FT                   VVGSLVGTRKDLEEAFHFGAMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHS
FT                   H"
FT   misc_feature    complement(267458..267880)
FT                   /gene="adhP"
FT                   /locus_tag="SSUBM407_0251"
FT                   /note="HMMPfam hit to PF00107, ADH_zinc_N, score 3.7e-37"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    complement(267968..268291)
FT                   /gene="adhP"
FT                   /locus_tag="SSUBM407_0251"
FT                   /note="HMMPfam hit to PF08240, ADH_N, score 3.2e-47"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    complement(268148..268192)
FT                   /gene="adhP"
FT                   /locus_tag="SSUBM407_0251"
FT                   /note="ScanRegExp hit to PS00059, ADH_ZINC, score NA"
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS_pept        268816..271467
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="SSUBM407_0252"
FT                   /product="aldehyde-alcohol dehydrogenase [includes: alcohol
FT                   dehydrogenase; acetaldehyde dehydrogenase]"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0261"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55084"
FT                   /db_xref="GOA:A0A0H3MTC9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTC9"
FT                   /protein_id="CAZ55084.1"
FT                   /translation="MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDYI
FT                   VAKASVAALDKHGELAMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDD
FT                   VTGLTLIAEPVGVVCGITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARV
FT                   VYEAAVAAGAPENCIQWVTKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALG
FT                   VGAGNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYK
FT                   TYFVNKKEKALLEEYCFGVKANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILA
FT                   AEVAEIGEKEPLTREKLSPVIAVLKVEGRAEGLEAARQMVEFHGLGHSAAIHTEDAELA
FT                   KEFGTIVRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIK
FT                   KVGRRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLD
FT                   LRRNKVVYQIFSDVEPDPDITTVYKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQ
FT                   PTVDFHDLVQKFMDIRKRAFKFPELGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKY
FT                   PIADYSLTPTVAIVDPALVLTVPAHVTADTGMDVLTHATEAYVSTVANDFTDGLALQAI
FT                   KLVFENLESSVKNADFVSREKMHNASTMAGMAFANAFLGISHSMAHKIGGRFHTVHGRT
FT                   NAILLPYVIRYNGTRPAKTATWPKYNYYKADEKYQDIARLLGLPCSTPEEAVAAYAQAV
FT                   YDLGERIGIQMNLKAQGIDEKELKEHSRELALLAYEDQCTPANPRLAMVDHMQEIIEDA
FT                   YYGYKERPGRIK"
FT   misc_feature    269992..270057
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1186.000, SD 3.23 at aa 393-414, sequence
FT                   TEDAELAKEFGTIVRAIRVIWN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    270232..271407
FT                   /gene="adhE"
FT                   /locus_tag="SSUBM407_0252"
FT                   /note="HMMPfam hit to PF00465, Fe-ADH, score 1.9e-144"
FT                   /inference="protein motif:HMMPfam:PF00465"
FT   misc_feature    270754..270840
FT                   /gene="adhE"
FT                   /locus_tag="SSUBM407_0252"
FT                   /note="ScanRegExp hit to PS00913, ADH_IRON_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00913"
FT   misc_feature    271012..271074
FT                   /gene="adhE"
FT                   /locus_tag="SSUBM407_0252"
FT                   /note="ScanRegExp hit to PS00060, ADH_IRON_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00060"
FT   misc_feature    271168..271233
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1004.000, SD 2.61 at aa 785-806, sequence
FT                   EKYQDIARLLGLPCSTPEEAVA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        271881..273365
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0253"
FT                   /product="putative threonine synthase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0262"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55085"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Y4"
FT                   /protein_id="CAZ55085.1"
FT                   /translation="MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFS
FT                   VLKDASYQDVAKLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELF
FT                   RGSTIAFKDMALSILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQII
FT                   VFYPRDGVSKVQELQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQ
FT                   FSSANSMNIGRLVPQIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQI
FT                   GLPVGKLICASNDNNVLTDFFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGND
FT                   AAKTAELMEALNTAGQYDIQGADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHT
FT                   AVASAVYKQYVEQTGDQTPTVIASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISG
FT                   VDLPPAVDGLETAPVRHNTVVAAADMQTEVERYLGV"
FT   misc_feature    272127..273059
FT                   /locus_tag="SSUBM407_0253"
FT                   /note="HMMPfam hit to PF00291, PALP, score 9.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    272184..272228
FT                   /locus_tag="SSUBM407_0253"
FT                   /note="ScanRegExp hit to PS00165, DEHYDRATASE_SER_THR,
FT                   score NA"
FT                   /inference="protein motif:Prosite:PS00165"
FT   CDS_pept        join(273494..273676,273682..275259)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0254"
FT                   /product="ABC transporter ATP-binding membrane protein
FT                   (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0263"
FT                   /note="CDS contains a frameshift after codon 61. Similar to
FT                   Streptococcus equi subsp. zooepidemicus MGCS10565 ABC
FT                   transporter ATP-binding protein UniProt:B4U185
FT                   (EMBL:CP001129) (587 aa) fasta scores: E()=1e-130, 64.566%
FT                   id in 587 aa"
FT                   /db_xref="PSEUDO:CAZ55086.1"
FT   misc_feature    join(273581..273649,273697..273756,273973..274041,
FT                   274246..274314,274333..274401)
FT                   /locus_tag="SSUBM407_0254"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0254 by TMHMM2.0 at aa 30-52, 67-86, 159-181,
FT                   250-272 and 279-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274606..275160
FT                   /locus_tag="SSUBM407_0254"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 5.3e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        275252..276913
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0255"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0264"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55087"
FT                   /db_xref="GOA:A0A0H3MTI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTI9"
FT                   /protein_id="CAZ55087.1"
FT                   /translation="MDKKEMPTRVLIPRLLQSMKHLLPRIAVAVCFAVLGQVVTIAIPV
FT                   MLVYLAFNALTGNPAPLWTLGILILLALLRGAFRYGEHYFGHYVAFHTLAAYRRLIFAK
FT                   LRALAPGKLDRQDSGSLLKMIGEDIEALEVFFAHTIAPICTGILVALGLTVYFGLSSWG
FT                   LAFLALVTYALLAIAIPNQFAQQLQPLLKEQNASRKGYVSYFIESLKSMKDLMQFQQTD
FT                   ARFANLTQKSQEVNGQERRVAQTNFMQYAVSFLVVGLSIMGFAWLTFDLVGSQSLDLAT
FT                   GVALLVSFISSFAPFLELSRLPLGFKRAMNAGRNIYALLDEKEAERTGELVEVSVTDIA
FT                   IEQLDFDYDVRETGLYRNLSVQFEQGGIIGLVGESGAGKSTLMKLIMRWYDWQQGQIRL
FT                   SGLDSRQVDKAHLQGAFAYVPQVPQIFRQTIRENLVLGRTDISDETIMDLAEKCHMKER
FT                   ILAAPQGLDRLVEASDFSAGEGQRLELMRALLKNADCYIFDEPTSNLDSLNEARFIQLV
FT                   KEHCQGMVFLISHRSSTMACADTIFRLEDGQLVKEK"
FT   misc_feature    275327..276139
FT                   /locus_tag="SSUBM407_0255"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 1.8e-05"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    join(275333..275401,275429..275485,275651..275719,
FT                   275732..275800,275999..276067,276095..276163)
FT                   /locus_tag="SSUBM407_0255"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0255 by TMHMM2.0 at aa 28-50, 60-78, 134-156,
FT                   161-183, 250-272 and 282-304"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    276347..276892
FT                   /locus_tag="SSUBM407_0255"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 8e-46"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   CDS_pept        276914..277507
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0256"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0265"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55088"
FT                   /db_xref="GOA:A0A0H3MT81"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT81"
FT                   /protein_id="CAZ55088.1"
FT                   /translation="MKKLQVKDLMVTGAFAALYFVCVGLGTLLSLVFDRSGNMMYAPAG
FT                   AALLAGPVYMLLVAKVGKFGSISLVGAVMACFFFLSGYMTAAFLPSLTFGFLAEMVAKS
FT                   GHYKQKWTNLFSYIIFSFGNLGPIILMWFMRDAYEANLLARGKSAEYIARVMLDFTPEN
FT                   VLWLSTTIILTALISGLFGQYMLQRYFKQSGYLS"
FT   misc_feature    join(276941..277009,277028..277096,277139..277207,
FT                   277244..277312,277403..277471)
FT                   /locus_tag="SSUBM407_0256"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0256 by TMHMM2.0 at aa 10-32, 39-61, 76-98,
FT                   111-133 and 164-186"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        277504..278163
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0257"
FT                   /product="putative transporter protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0266"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55089"
FT                   /db_xref="GOA:A0A0H3MXK7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXK7"
FT                   /protein_id="CAZ55089.1"
FT                   /translation="MKLDARTKIILVIFTSFTYGMRLTILENAVLVLGLSLLFWFSGKR
FT                   KMAIMSPIAYSIFCLLSYITFLPAWLTHLLLVLTYTWPPLLAGHLLLMTTSGYELIHGL
FT                   RKWHLPEVFLLTLGVMFRFLPAIKQDARTICASLKVRGIFLRKRDVVCKPLQYMEFFLV
FT                   PLMMSLLRTAQELTVASLTKGLAVSTKSPAYIWSSWTVLDWSLCLCCLGFLILVRL"
FT   misc_feature    join(277561..277629,277666..277734,278086..278154)
FT                   /locus_tag="SSUBM407_0257"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0257 by TMHMM2.0 at aa 20-42, 55-77 and 195-217"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277756..278085
FT                   /locus_tag="SSUBM407_0257"
FT                   /note="HMMPfam hit to PF02361, CbiQ, score 7.5e-11"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   CDS_pept        278127..279554
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0258"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0267"
FT                   /note="Possible alternative translational start sites after
FT                   codons 1 and 11"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55090"
FT                   /db_xref="GOA:A0A0H3MTD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTD3"
FT                   /protein_id="CAZ55090.1"
FT                   /translation="MLSRFSDSRPAVTVKNVALTYSGADKPALQIEDLTIPEGQCVVLC
FT                   GQSGSGKSSFLKVLNGLTPEYYPAQLSGQIFLGDLDLQKSSLEEISRHIASVFQHPSTQ
FT                   FFHSQVLQELVFPCENQGLSREEIENRLAWVMELFGLASLSQRTISSLSGGQQQRLALA
FT                   VATMQGTDVLVLDEPTANLDQEGIVIVEDILKTLKSQGKTIIIAEHRLSYLSQLADRYL
FT                   YFQDGQVVTDYLADEFLSRTEECRQDMGLRCYDSEPYGRAIAELADQFVNDKEGLLVEN
FT                   LSVSQKENTLYEIEKLCLAPGQVVGLVGANGSGKTSLARYLVGLAEDKKSRISWQGQTL
FT                   SSRQRLEKTAFVMQDVRLQLFAESVERELTLGRKNRAVDEHLVARFGLSDLLERHPVSL
FT                   SGGEQQRVMIVASLLADKEIFIFDEPTSGLDLRRMQQVASALVDLKMKNKLVLLISHDE
FT                   ELLNLVCDKIVDIKQLK"
FT   misc_feature    278241..278807
FT                   /locus_tag="SSUBM407_0258"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.3e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    278250..278291
FT                   /locus_tag="SSUBM407_0258"
FT                   /note="ScanRegExp hit to PS00675, SIGMA54_INTERACT_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00675"
FT   misc_feature    278580..278624
FT                   /locus_tag="SSUBM407_0258"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    279030..279548
FT                   /locus_tag="SSUBM407_0258"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 8e-35"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    279321..279365
FT                   /locus_tag="SSUBM407_0258"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        279560..280837
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0259"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0268"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55091"
FT                   /db_xref="GOA:A0A0H3N1Y9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Y9"
FT                   /protein_id="CAZ55091.1"
FT                   /translation="MNKQTYKEILTIAFPAMGENLLQMLMGVVDSYLVASIGIVALSGV
FT                   SLANNILAVYQAVFIALAVAVSSRLAQALGEGGSEGIGGTASESVKFTVFIGLLLGIFS
FT                   VLAGPIVLTSLGAESEVVQAGGLYLILVGGGAPFLGLMTSLSAILRTLGEPRFPMYISL
FT                   LSNVLNALFSAFAVFVLHAGVAGVAIGTVLSRLIGCSLLWSRLPISLKPWTWSFDKELL
FT                   RLALPATGERLMMRVGDVVVVALITSLGTATVAGNAIGETLTQFNYMPALGIATATIIL
FT                   TAKHRQDKAMVRHIFRTSFGISLLFMFLVAGVTYFAGSFLIDLYTKDIQAAQASQTVLF
FT                   YAMLGVPFTAGTLIMTALWQGLGNARLPFYATTIGMWLVRIGIAYLLVTFFKIGLSAIW
FT                   IATILDNAFRSGVLFFQYRYSKQESI"
FT   misc_feature    279602..280084
FT                   /locus_tag="SSUBM407_0259"
FT                   /note="HMMPfam hit to PF01554, MatE, score 4.1e-31"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    join(279623..279691,279710..279778,279836..279904,
FT                   279938..280006,280070..280138,280277..280336,
FT                   280349..280408,280457..280525,280568..280636,
FT                   280700..280768)
FT                   /locus_tag="SSUBM407_0259"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUBM407_0259 by TMHMM2.0 at aa 22-44, 51-73, 93-115,
FT                   127-149, 171-193, 240-259, 264-283, 300-322, 337-359 and
FT                   381-403"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    280238..280717
FT                   /locus_tag="SSUBM407_0259"
FT                   /note="HMMPfam hit to PF01554, MatE, score 2e-20"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   CDS_pept        281192..282127
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="SSUBM407_0260"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0269"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55092"
FT                   /db_xref="GOA:A0A0H3MTJ4"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTJ4"
FT                   /protein_id="CAZ55092.1"
FT                   /translation="MSVVGKANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEA
FT                   LTVACDFYKGLVHKMPKIWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSA
FT                   AVAVAVARALFAYYEKELTDSELWDIVQSSEKIAHGNPSGIDAATTSGKSPVFFIKHQP
FT                   IEPFELKLHAHLVVADTGVTGNTLEAISDVADLLEKKPEAIKLVEELGNLTRQAKEDLA
FT                   TDQAELLGSRMNQAHALLQKLGVSDPSLDKLVSLAQENGALGAKLTGGGRGGCMIALAR
FT                   TAQDAQKLAHILDQAGARQTWIQYLGETND"
FT   misc_feature    281450..281650
FT                   /gene="mvaK1"
FT                   /locus_tag="SSUBM407_0260"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   1.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    281840..282088
FT                   /gene="mvaK1"
FT                   /locus_tag="SSUBM407_0260"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   1.9e-12"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        282120..283145
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="SSUBM407_0261"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0270"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55093"
FT                   /db_xref="GOA:A0A0H3MT85"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT85"
FT                   /protein_id="CAZ55093.1"
FT                   /translation="MTKQIGIARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTD
FT                   TKVVFDPELTADEFYLNGILQKEKEILKISRFLDLFCEYIGERAFARVESLNFVPTAAG
FT                   LASSASAFAALALATATALDLDLSPATLSTLARRGSGSSTRSLFGGFVEWGMGTGSEDS
FT                   MAHPIDDADWDIGMVVLAVNTGPKKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAA
FT                   IASRDFEKLGQITEHNGMKMHATTLSANPPFTYWSADSLVAQEAVRQVREATGLSAYMT
FT                   MDAGPNVKVLCRASQMDELVAGLAKVFPREKIITSKPGPAAYVLSEKDWQASQTAFEKG
FT                   I"
FT   misc_feature    282393..282569
FT                   /gene="mvaD"
FT                   /locus_tag="SSUBM407_0261"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   1.7e-10"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    282774..283049
FT                   /gene="mvaD"
FT                   /locus_tag="SSUBM407_0261"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   0.00032"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        283147..284226
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SSUBM407_0262"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0271"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55094"
FT                   /db_xref="GOA:A0A0H3MXL0"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXL0"
FT                   /protein_id="CAZ55094.1"
FT                   /translation="MKVQVKIPGKLFLAGEYAVVEAGYPAVIAAVGQYLTVTIETSDQG
FT                   SLHSSQKADLYLTWERKEGAVRIQGSHPYALIESAMQVTEAYLTAKGYACHGTYSLSVQ
FT                   SDLDDQASGAKYGLGSSGAVTVATVKALLTYYGHQADALLTYKLAALTQSKLGMTGSFG
FT                   DLAASSFGGLIAYHSLDRSWLLGKMAELSLLDVVESDWQSLSISPIQLPQGLDLLVGWT
FT                   GSAASTDSLVSQMESQKSQTEKEQIHSQFLADSKTCVEQLIVACQTNDSVSARQALSAN
FT                   RKLLQDFARGMGLVIETPQLSQLCDLAQTYGAVAKSSGAGGGDCGICLVDSKEQKAAIE
FT                   TAWQEAGIFPLTLNIASRE"
FT   misc_feature    283444..283662
FT                   /gene="mvaK2"
FT                   /locus_tag="SSUBM407_0262"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   7.6e-10"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    283930..284193
FT                   /gene="mvaK2"
FT                   /locus_tag="SSUBM407_0262"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   2.4e-08"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        284237..285334
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SSUBM407_0263"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0272"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55095"
FT                   /db_xref="GOA:A0A0H3MTD7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTD7"
FT                   /protein_id="CAZ55095.1"
FT                   /translation="MFYLGEFGLDRKDQHVGLANQQYSATPAKDFTETLFVHHSLPQTK
FT                   VDEVDISTSVAGLDFAFPFFINAMTGGSKKTREINRLLGIMGHFGKIALASGSVSAAIK
FT                   DPSVAETFSVMRRENPYGIIFANLGAHHSVENAKRAVDLLEANAIQIHVNAPQEIVMPE
FT                   GDRDFTMWLKNIETLVREMEVPVIVKEVGFGMSRETVAQLASAGVQTIDVSGTGGTDFA
FT                   KIENARRTFNDYAYLEGWGQSTVTSLVEAMSVSEEVCPSLIASGGIKTPLDIVKSLALG
FT                   ADLVGMSNHFLQYVKDGKGHRFDDGLQAIKVYQWQIAEIMTMLGAKNIAELRQKDLVLA
FT                   PNVQNWCEARGIDWKAYARRSANVS"
FT   misc_feature    285017..285100
FT                   /gene="fni"
FT                   /locus_tag="SSUBM407_0263"
FT                   /note="HMMPfam hit to PF01645, Glu_synthase, score 1.8e-06"
FT                   /inference="protein motif:HMMPfam:PF01645"
FT   CDS_pept        complement(285429..287177)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0264"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0273"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55096"
FT                   /db_xref="GOA:A0A0H3N1Z2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Z2"
FT                   /protein_id="CAZ55096.1"
FT                   /translation="MLSKTKQASVFLRLLSYLKAYRLLTVLALSFLLLTTVVRSLIPLL
FT                   ASYFIDHYISTISETAVAILAAYFALYLLQMVLQYFGNLWFAKVSYSIVRDIRRDAFGR
FT                   MEKLGMAYFDQTPSGSIVSRITNDTESISEMFSGILSSFISALFIIVTTLSTMFALDWK
FT                   LTSLIVLFLPVIFILVDQYRKRSAPIVAKTRSLLSAINSKLAESIEGIWIIQAFSQEER
FT                   LKEEFEAINQEHLDYASRSMALDSLFLRPALSLVKILAYALLMTYFGLDWSQAGISAGL
FT                   IYAFIQYVNRLFDPLLDVTQHFSTLQTSMVSAGRVFTLMDQTIEEPLQLDRGAKIDKGH
FT                   IVFEDVYFSYDGKRQILDKVSFEVRQGQTIAFVGATGSGKSSIINVFMRFYEFQSGRIL
FT                   IDGQDIRSFSQEELRSAIGLVLQDPFLFHGTIASNIQMYQDISQEEIEEAARFVDAAPF
FT                   IEKLPEKYDHLVTERGSAFSTGQRQLLAFARTMASQPKILILDEATANIDSETEKTVQT
FT                   SLEKMRKGRTTIAIAHRLSTIQDADCIYVLDKGKIIESGNHEELLALKGHYHRMYQLQA
FT                   GQLTAT"
FT   misc_feature    complement(285528..286079)
FT                   /locus_tag="SSUBM407_0264"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 9.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(286290..287105)
FT                   /locus_tag="SSUBM407_0264"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 1.8e-32"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    complement(join(286371..286439,286641..286694,
FT                   286704..286772,286956..287024,287052..287120))
FT                   /locus_tag="SSUBM407_0264"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0264 by TMHMM2.0 at aa 20-42, 52-74, 136-158,
FT                   162-179 and 247-269"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(287058..287177)
FT                   /locus_tag="SSUBM407_0264"
FT                   /note="Signal peptide predicted for SSUBM407_0264 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.915) with
FT                   cleavage site probability 0.419 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(287167..288909)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0265"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0274"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55097"
FT                   /db_xref="GOA:A0A0H3MTK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK0"
FT                   /protein_id="CAZ55097.1"
FT                   /translation="MKIIKQLWWFFSLEKKAYLIGILSLCLVSLLNLLPASIMGQLIDQ
FT                   IASGQLTEHRLLLGVAGLILSALAMYGLRYLWRMNILATSYRLGKIMRARLFDHFMHLS
FT                   PSFFQQHRTGDLMAHATNDINALTRLAGGGVMSFVDATVTALVTLITMSLSISWQMTLV
FT                   AILPLPFMTLTTNFLGRRTHENFKASQAAFSELNNKVQEAVSGIKVTKSFGYQEQETAA
FT                   FQEVNQAAFLQNIKTMRYDALFNPAVLFFIGLSYLLTLLVGSHFISQGQVSLGQLVTFM
FT                   TYLDLLVWPLMAIGFLVNISQRGDVSYNRIQTLLSISSEVIETDQPLPAPSNGELVYEI
FT                   SEFAYDNIPVLQDIQFQIKKGQTIGLVGLTGSGKTSLLKLLMREYDVINGQILLNQENI
FT                   KNYKLADLRRLIGYVPQDQFLFATSITENIRFGNPDLSLNQVEEAARAVHVYEDIQDMP
FT                   DRFETMVGEKGISLSGGQKQRLAMARAMILNPDILLLDDSLSAVDAKTEHAILETIKQE
FT                   RLDKTTIITAHRLSAIVHADLILVLEDGKIVERGRHQELLDEKGWYYDTYMMQQLEKEE
FT                   SDAL"
FT   misc_feature    complement(287275..287829)
FT                   /locus_tag="SSUBM407_0265"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 2.1e-53"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(287452..287496)
FT                   /locus_tag="SSUBM407_0265"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(join(288007..288075,288118..288186,
FT                   288376..288444,288454..288522,288679..288738,
FT                   288781..288849))
FT                   /locus_tag="SSUBM407_0265"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0265 by TMHMM2.0 at aa 21-43, 58-77, 130-152,
FT                   156-178, 242-264 and 279-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(288037..288858)
FT                   /locus_tag="SSUBM407_0265"
FT                   /note="HMMPfam hit to PF00664, ABC_membrane, score 1.9e-39"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   sig_peptide     complement(288790..288909)
FT                   /locus_tag="SSUBM407_0265"
FT                   /note="Signal peptide predicted for SSUBM407_0265 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.808) with
FT                   cleavage site probability 0.621 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        289166..289432
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0275"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55098"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT89"
FT                   /protein_id="CAZ55098.1"
FT                   /translation="MKAIVTVVGKDKSGIVAGVATKIAELGLNIDDISQTVLDEYFTMM
FT                   AVVSSDEKKDFTKLRAELEAYGQALNVKINIQSAAIFDAMHNL"
FT   misc_feature    289172..289369
FT                   /locus_tag="SSUBM407_0266"
FT                   /note="HMMPfam hit to PF01842, ACT, score 8e-09"
FT                   /inference="protein motif:HMMPfam:PF01842"
FT   CDS_pept        289444..290781
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0276"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55099"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXL6"
FT                   /protein_id="CAZ55099.1"
FT                   /translation="MDIRQVRETIEMIEEQNFDIRTITMGISLLDCIDSDIDKAAEKVY
FT                   TKIVTKAKNLVAVGDEIAAELGIPIVNKRVSVTPIALIGAATDATDYLPLAHALDKAAH
FT                   EIGIDFIGGFSALAQKGYQKGDEILINSIPQALAQTSKVCSSVNIGSTKTGINMTAVRD
FT                   MGRIIKETAEASDMGAAKLVVFANAVEDNPFMAGAFHGVGEADVVINVGVSGPGVVKRA
FT                   LEKVRGESFDVVAETVKKTAFKITRIGQLVGNMASERLGVKFGIVDLSLAPTPAVGDSV
FT                   ARVLEEMGLETVGTHGTTAALALLNDAVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAV
FT                   QNGSLNLEKLEAMTAICSVGLDMIAIPETTPAETIAAMIADEAAIGVINQKTTAVRIIP
FT                   LGKEGDMIEFGGLLGTAPVMKVNQASSVDFINRGGQIPAPIHSFKN"
FT   misc_feature    289444..290778
FT                   /locus_tag="SSUBM407_0267"
FT                   /note="HMMPfam hit to PF05167, DUF711, score 7.5e-278"
FT                   /inference="protein motif:HMMPfam:PF05167"
FT   CDS_pept        290857..291552
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0268"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0277"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55100"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTE1"
FT                   /protein_id="CAZ55100.1"
FT                   /translation="MADVRLYISRHGKTMFNTIGRVQGWCDTPLTKVGEEGIRELGLGL
FT                   KDAGLDFKLAVSSDLGRTVQTMTIAQRELGILGKIPYYQDKRIREWCFGSFEGMYDAEL
FT                   FQGVLPRLKGTVDATGMSFAEIAAGIQEADTAGWAESWEVLSNRILTGFESIAQDLEKQ
FT                   GGGNALVVSHGMTIATLAHLLEPERGANVFLDNGSITVLKYENGKLLIEAVGDLSYRKR
FT                   GAELIAQGK"
FT   misc_feature    290869..291396
FT                   /locus_tag="SSUBM407_0268"
FT                   /note="HMMPfam hit to PF00300, PGAM, score 7.3e-35"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   repeat_region   complement(291739..291830)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        291871..292905
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SSUBM407_0269"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0278"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55101"
FT                   /db_xref="GOA:A0A0H3N1Z7"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N1Z7"
FT                   /protein_id="CAZ55101.1"
FT                   /translation="MITQRQNDILNLIVELFTRHHEPVGSKALQEMIASSSATIRNDMA
FT                   KLEQLGLLEKAHTSSGRMPSRAGFQYFVNHSLNLKHINEEDVYQVVKAFDFEAFKLEDI
FT                   LERASQVLADLTGYTSVILDVEPTSQQLTSFDIVQLSSHDALAVLTLDQSKPVTVQFAI
FT                   PKNFLTRDLEVLKRLVDERFVGQTVLAIHYKLRTEIPQVVQRYFATTDNVLDLMDYIFS
FT                   NLFQESVFISGKVASLTYGNLATYQLLDSPQLLAPELRQGLAPNQQTSISVAEHREPAL
FT                   ADVTVIHHRFPIPYRGMGQMSLLGPVDMDYRRQMSLINIISRILFMKLTDYYRYLSSNH
FT                   YEVN"
FT   misc_feature    292171..292815
FT                   /gene="hrcA"
FT                   /locus_tag="SSUBM407_0269"
FT                   /note="HMMPfam hit to PF01628, HrcA, score 6.2e-53"
FT                   /inference="protein motif:HMMPfam:PF01628"
FT   CDS_pept        292918..293430
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SSUBM407_0270"
FT                   /product="GrpE protein (HSP-70 cofactor)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0279"
FT                   /note="CDS is truncated at the N-terminus in comparison to
FT                   some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55102"
FT                   /db_xref="GOA:A0A0H3MTK5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK5"
FT                   /protein_id="CAZ55102.1"
FT                   /translation="MSEEIKNEEIVEEVEATEEVVETPEKSELDLANERAEEFENKYLR
FT                   AHAEMQNIQRRANEERQTIQRYRSQDLAKKILPSLDNLERALQVEGLTEDVKKGLEMVQ
FT                   ESLIQALKEEGVEEVATDVFDPNLHMAIQTVPATDDCPAEHIAQVFQKGYKLHERLLRP
FT                   AMVVVSE"
FT   misc_feature    292951..293427
FT                   /gene="grpE"
FT                   /locus_tag="SSUBM407_0270"
FT                   /note="HMMPfam hit to PF01025, GrpE, score 2.8e-60"
FT                   /inference="protein motif:HMMPfam:PF01025"
FT   misc_feature    293287..293421
FT                   /gene="grpE"
FT                   /locus_tag="SSUBM407_0270"
FT                   /note="ScanRegExp hit to PS01071, GRPE, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01071"
FT   CDS_pept        293527..295356
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SSUBM407_0271"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0280"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55103"
FT                   /db_xref="GOA:A0A0H3MT94"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT94"
FT                   /protein_id="CAZ55103.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTIISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEEY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKDEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDHMVAEFKKENGIDL
FT                   SADKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGAAGPLHLEMTLTRAKFDELTYD
FT                   LVERTKIPVRQALSDAGLSLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPD
FT                   EVVAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFS
FT                   TAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSV
FT                   KAKDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNDVDQAIFA
FT                   TEKTLKETEGKGFDAERDQAQAALDELKAAQEANNLDDMKAKLENLNEKAQALAVKLYE
FT                   QAAAAQQAAAGQEGAQTANNADDDVVDGEFTEK"
FT   misc_feature    293536..295254
FT                   /gene="dnaK"
FT                   /locus_tag="SSUBM407_0271"
FT                   /note="HMMPfam hit to PF00012, HSP70, score 0"
FT                   /inference="protein motif:HMMPfam:PF00012"
FT   misc_feature    293545..293568
FT                   /gene="dnaK"
FT                   /locus_tag="SSUBM407_0271"
FT                   /note="ScanRegExp hit to PS00297, HSP70_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00297"
FT   misc_feature    294022..294063
FT                   /gene="dnaK"
FT                   /locus_tag="SSUBM407_0271"
FT                   /note="ScanRegExp hit to PS00329, HSP70_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00329"
FT   misc_feature    294451..294495
FT                   /gene="dnaK"
FT                   /locus_tag="SSUBM407_0271"
FT                   /note="ScanRegExp hit to PS01036, HSP70_3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS_pept        295788..296924
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUBM407_0272"
FT                   /product="chaperone protein DnaJ"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0281"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55104"
FT                   /db_xref="GOA:A0A0H3MXM0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXM0"
FT                   /protein_id="CAZ55104.1"
FT                   /translation="MNNTEFYDRLGVSKNASPDEIKKAYRKLSKKYHPDINKDPGAEDK
FT                   YKEVQEAYETLSDPQKRSAYDQYGPAGANGGFGGGAGGFGGFDGAGFGGFEDIFSSFFG
FT                   GGGATRNPNAPRQGDDLQYAVNLKFEEAIFGVEREVSYNREATCRTCTGSGAKPGTSPV
FT                   TCGRCHGSGVINVDTQTPLGTMRRQMTCDVCHGRGKQIKDPCTTCHGTGHEKQAHTVTV
FT                   KVPAGVETGQRIRLAGQGEAGFNGGPYGDLYVVIQVQPSDKFEREGTTIHYKLNLNFVQ
FT                   AALGDTVHVPTVHGDVDMVIPEGTQTGKTFRLKGKGAPSVRGGAIGDQYVTVNIVTPTG
FT                   LNDRQKAALKEFAAAGNIDVKPHKKGFFDKVKDAFEDL"
FT   misc_feature    295800..295985
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUBM407_0272"
FT                   /note="HMMPfam hit to PF00226, DnaJ, score 1.2e-37"
FT                   /inference="protein motif:HMMPfam:PF00226"
FT   misc_feature    295923..295982
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUBM407_0272"
FT                   /note="ScanRegExp hit to PS00636, DNAJ_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00636"
FT   misc_feature    296190..296444
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUBM407_0272"
FT                   /note="HMMPfam hit to PF00684, DnaJ_CXXCXGXG, score
FT                   8.1e-34"
FT                   /inference="protein motif:HMMPfam:PF00684"
FT   misc_feature    296481..296846
FT                   /gene="dnaJ"
FT                   /locus_tag="SSUBM407_0272"
FT                   /note="HMMPfam hit to PF01556, DnaJ_C, score 1.2e-67"
FT                   /inference="protein motif:HMMPfam:PF01556"
FT   CDS_pept        297200..298027
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0282"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55105"
FT                   /db_xref="GOA:A0A0H3MTE4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTE4"
FT                   /protein_id="CAZ55105.1"
FT                   /translation="MKSWVENVTIKKYEDRSGLTGLKQEPLVWTEVFLREVNRQSNTGI
FT                   LHFWPMDQTVILGMMDSQVAQLDKGLASIGQAGYSPIIRSLGGLAVVADEGILNVTLIL
FT                   SNPSGHKVDLRESYQVMVDLIAQALSDFPFEVVSGEVATSYCPGTYDLSIKGRKFAGLA
FT                   QRIYQEAIAISAYISVSGNQVKRGQVVADFYVASFAPQEVSDRFPQVNPDSMANLSDLV
FT                   GQDVTVEDMKKRIEQVLVENGTRLSTFYPSSDNMADFMTFGKTIKQSMEKYGI"
FT   CDS_pept        298037..299485
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0274"
FT                   /product="putative amidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0283"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55106"
FT                   /db_xref="GOA:A0A0H3N202"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N202"
FT                   /protein_id="CAZ55106.1"
FT                   /translation="MIWKDATAMAQAVNQKQVFAKELVQETIDRIEKLNPTLNAVVSKQ
FT                   YEEALKEAEKEDYLGKPFAGVPFLLKDLGQNEKGQPSSAGSRLLAGRPAGHTDTYVQRL
FT                   KDLGFIIVGRTNTPEFGFKNISDASLHGPVNLPLDPSRNAGGSSGGAAAALASGMVSIA
FT                   AASDGGGSIRIPASFNGLIGLKTSRGRIPVGPKSYRGWQGASVNFALTKSVRDTQRLLY
FT                   HFQDYQLEAPFPLAKLSEEEVFGKLSRPLKIAYYTKSPVGSKVSLEAVEAVQKACHHLA
FT                   NLGHEVVELTEYPLDGVALMKSFYLMNSVDTAQMFDEIEAAFGRQMTLDDMEVMSWAIY
FT                   QSGQTIPAKLYSKALLDWDQFGASMARFHEEYDLLLTPTVADVAPKHGQFDLPVDLLDR
FT                   LKQTQNYSMEEQQDLIWQMFEDSLALTPFTQQANICGQPAISLPTYVRADSLPIGVQLT
FT                   ASKGREDLLLQLADQMEAAGLLNL"
FT   misc_feature    298100..299440
FT                   /locus_tag="SSUBM407_0274"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 9.6e-70"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    298469..298564
FT                   /locus_tag="SSUBM407_0274"
FT                   /note="ScanRegExp hit to PS00571, AMIDASES, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        299610..300485
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0275"
FT                   /product="extracellular solute-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0284"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55107"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTL0"
FT                   /protein_id="CAZ55107.1"
FT                   /translation="MLKKVLASALLVSTLTLAACSSSSSNTSSSSAEQTQWEKIQEAGV
FT                   LKVATPGTLFPTSYYNDAKELVGYEIDMINEIGKRLKLEIEYQEIGVAEAFTAVDSGKV
FT                   DISVNNFDMTEARKEKYNFSIPYKYSVGGYIVREDGSSGIEAADLSDWTGKKAGGGAGT
FT                   QYMKIAEKQGAEPVIYDNVTNDVYLRDVSTGRTDFIPNDYYTQVMAIKWANANFPDIKV
FT                   KMGEAKYNPTEQGIVMSKADTSLKEKIDEALEAMKADGTLKAISEKYYAGQDLTVPVEN
FT                   ADKLPVIEVE"
FT   sig_peptide     299610..299705
FT                   /locus_tag="SSUBM407_0275"
FT                   /note="Signal peptide predicted for SSUBM407_0275 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.640 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    299745..300425
FT                   /locus_tag="SSUBM407_0275"
FT                   /note="HMMPfam hit to PF00497, SBP_bac_3, score 3.3e-58"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   misc_feature    299811..299852
FT                   /locus_tag="SSUBM407_0275"
FT                   /note="ScanRegExp hit to PS01039, SBP_BACTERIAL_3, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS01039"
FT   CDS_pept        300576..301247
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0276"
FT                   /product="transport system membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0285"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55108"
FT                   /db_xref="GOA:A0A0H3MT97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MT97"
FT                   /protein_id="CAZ55108.1"
FT                   /translation="MDINWQAVFNADIAREAIPQILEGLPYTLSLSLIGFALGTFCGFF
FT                   VALMRMSKFGPLRWLAMAHISLMRGIPLMVLLFFIYFGLPFMGLQLDAISASIIAFTSM
FT                   SSAYISEIIRASLSAIDKGQWEAARSLGLRTNVIHRKIIIPQAFRIALPPLSNVLLDMV
FT                   KSTSLTAMITVPEIFNKAKIVGGAKSDYMTVYICVALIYWVICTLYAFGQLKLEKRLAT
FT                   Y"
FT   misc_feature    300636..301241
FT                   /locus_tag="SSUBM407_0276"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 1.5e-23"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(300654..300722,300783..300842,301146..301214)
FT                   /locus_tag="SSUBM407_0276"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0276 by TMHMM2.0 at aa 27-49, 70-89 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(301371..301580)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0277"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0286"
FT                   /note="Possible alternative translational start site after
FT                   codon 2"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55109"
FT                   /db_xref="GOA:A0A0H3MXM4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXM4"
FT                   /protein_id="CAZ55109.1"
FT                   /translation="MEMIRVNLDKVLKDRQMTSKDLAEQVGITEANLSILKTGKAKGIR
FT                   FNTLMSICRILDCQPGDILEYVEE"
FT   misc_feature    complement(301467..301532)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1554.000, SD 4.48 at aa 17-38, sequence
FT                   MTSKDLAEQVGITEANLSILKT"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        complement(301582..302106)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0278"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0287"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55110"
FT                   /db_xref="GOA:A0A0H3MTE9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTE9"
FT                   /protein_id="CAZ55110.1"
FT                   /translation="MKTNLLKTAGIVAACVRYFFYLLIASYIFFSLAGLGGDSFAIGSW
FT                   EYTFNKPIDQISVWLILLATGLILVVLVALSHIAHLIQKLCKLLLEEDYFASASMELYQ
FT                   KLFISLLVLTAGQFCLTSLITLTNAAGPNNFLNLRWSDFILNALFIFLTYFVWTLVQKG
FT                   QQLETENSEFI"
FT   misc_feature    complement(join(301627..301680,301723..301791,
FT                   301870..301938,301981..302049))
FT                   /locus_tag="SSUBM407_0278"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0278 by TMHMM2.0 at aa 20-42, 57-79, 106-128 and
FT                   143-160"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(301984..302106)
FT                   /locus_tag="SSUBM407_0278"
FT                   /note="Signal peptide predicted for SSUBM407_0278 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.754) with
FT                   cleavage site probability 0.752 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(302241..304109)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0279"
FT                   /product="putative cation-transporting ATPase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0288"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55111"
FT                   /db_xref="GOA:A0A0H3N206"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N206"
FT                   /protein_id="CAZ55111.1"
FT                   /translation="MTLVTNLKQHSHIITTALCLALILIGILLFQTGQGWAPILFISAF
FT                   VIGGYQSAKEGISELIFDKHLSVDLLMILAAIGSGLIGYWMEGALLIFIFSLSSTLEEL
FT                   AMEKSKNAIAALMNMTPPTARKIEENGDITVLDTAAIRIGDLLQVRKGDTVPLDATLIS
FT                   PQSIFDESMITGEPLPAEKMAGDAVIGGTINQGPTVTVQVTAEKGDALFDKIVQMVENA
FT                   QESKSKTATFIENMEDTYVKVVLVVVPLFILLAHFALGWDWLTAFYRGMILLTIASPCA
FT                   LVASSSPATLSAISRAARKGMIIKGGDIADNIANLEAIVFDKTGTLTIGKPEVVGATYL
FT                   GDEELIKQVVQAVEKQSSHPIAQALMTYTADSSAIALQSLEDVTGKGLVAGYEGDSWKI
FT                   GKAGFVADSLVSPLSAGLLAQIDEAESTGKTLVYVSQNDVLVAIFMVEDSLKPESKQLI
FT                   AQLKEMGVTPILLTGDQEKTARYVASQVGIDRVIANCLPTDKAAVIQELQTEFASVGMV
FT                   GDGINDAPALAQANVSYAMGSGTDIAMESADIVLMEDLTRIPYSIRLSKKMRGIIKQNI
FT                   IFALSVIALLIISNLFQSINLPLGVVGHEGSTILVILNGLRLLYFK"
FT   misc_feature    complement(join(302247..302315,302325..302384,
FT                   303231..303299,303327..303395,303825..303893,
FT                   304005..304073))
FT                   /locus_tag="SSUBM407_0279"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0279 by TMHMM2.0 at aa 13-35, 73-95, 239-261,
FT                   271-293, 576-595 and 599-621"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(302490..303164)
FT                   /locus_tag="SSUBM407_0279"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 2.9e-32"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    complement(302493..302561)
FT                   /locus_tag="SSUBM407_0279"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score NA"
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    complement(303126..303146)
FT                   /locus_tag="SSUBM407_0279"
FT                   /note="ScanRegExp hit to PS00154, ATPASE_E1_E2, score NA"
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    complement(303174..303842)
FT                   /locus_tag="SSUBM407_0279"
FT                   /note="HMMPfam hit to PF00122, E1-E2_ATPase, score 2.8e-65"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    complement(303723..303788)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1444.000, SD 4.11 at aa 108-129, sequence
FT                   KSKNAIAALMNMTPPTARKIEE"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   sig_peptide     complement(303999..304109)
FT                   /locus_tag="SSUBM407_0279"
FT                   /note="Signal peptide predicted for SSUBM407_0279 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.984) with
FT                   cleavage site probability 0.642 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(304272..304727)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0280"
FT                   /product="ferric uptake regulator family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0289"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55112"
FT                   /db_xref="GOA:A0A0H3MTL6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTL6"
FT                   /protein_id="CAZ55112.1"
FT                   /translation="MELHSHFNAENQTAFEHVIQHLKEKGIRITETRKAVVAYIIESDD
FT                   HPSAEMIYQDLIPNYPNMSLATVYNNLKLLLEEGFVTKLKRTNDNTTYYDFMGHEHLNV
FT                   ICEVCGKITDFMDVEIPSLKKEAHTQTGYKITKEVLSIYGICPDCQN"
FT   misc_feature    complement(304299..304658)
FT                   /locus_tag="SSUBM407_0280"
FT                   /note="HMMPfam hit to PF01475, FUR, score 3.3e-46"
FT                   /inference="protein motif:HMMPfam:PF01475"
FT   CDS_pept        304894..305643
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SSUBM407_0281"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0290"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55113"
FT                   /db_xref="GOA:A0A0H3MTA1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTA1"
FT                   /protein_id="CAZ55113.1"
FT                   /translation="MTRYKAIISYDGHDFSGFQRQPHARTVQEEIEKTLVRLNSGQPVT
FT                   VHGAGRTDAGVHAYGQVIHFDLAGSRDVEKLRFALDTQTSEDIDVVSVEQVADDFHCRY
FT                   AKHSKTYEFLVDIGRPKNPMMRHYATFYPYDLDLSLIEEAIQDLVGTHDFTGFTASGTS
FT                   VEDKVRTITVASMEYDQQRQFLIFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVGQIKRI
FT                   LAEKDRGLAGPTAAGNGLYLKEIIYED"
FT   misc_feature    304909..305208
FT                   /gene="truA"
FT                   /locus_tag="SSUBM407_0281"
FT                   /note="HMMPfam hit to PF01416, PseudoU_synth_1, score
FT                   3.8e-40"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   misc_feature    305323..305637
FT                   /gene="truA"
FT                   /locus_tag="SSUBM407_0281"
FT                   /note="HMMPfam hit to PF01416, PseudoU_synth_1, score
FT                   1.1e-30"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   CDS_pept        305633..306394
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SSUBM407_0282"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0291"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55114"
FT                   /db_xref="GOA:A0A0H3MXM9"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXM9"
FT                   /protein_id="CAZ55114.1"
FT                   /translation="MKTKYILALSGNDIFSGGGLHADLTTYTVHGLHGFVAVTCLTAMT
FT                   EKGFEVIPTETAVFAQQLASLKDVPFSAIKIGLLPSVEIAEQALEFIKTHQEIPVVLDP
FT                   VLVCKETHDTEVSQLRDEILKFLPYVSIITPNLAEAQLLLQKDIKTVEEMKQVAVALYD
FT                   LGAKAVVIKGGNRLGGSEAVDVFYDGQEVVVLQSPLLSENNVGAGCTFASSIASQLLLG
FT                   QEPLEAVRLSKDFVHAAIEKSDDYGVVQYEK"
FT   misc_feature    305669..306382
FT                   /gene="thiD"
FT                   /locus_tag="SSUBM407_0282"
FT                   /note="HMMPfam hit to PF08543, Phos_pyr_kin, score 8.8e-74"
FT                   /inference="protein motif:HMMPfam:PF08543"
FT   CDS_pept        306384..306869
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0283"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0292"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55115"
FT                   /db_xref="GOA:A0A0H3MTF2"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTF2"
FT                   /protein_id="CAZ55115.1"
FT                   /translation="MRNKQTQELVLLAILTALSLVLAFVHVPTATGFVTLLDVGVYFTA
FT                   FYLGKKEGAIVGGLSGLLIDFLLGYPQWAFFSLVFHGAQGYFAGWTGKKRILGLVLATL
FT                   SMVGGYYLASRLYFNDLKAIESVLSNTLQNTVGLVVGYVLAQAIERIGAVNHVIKGN"
FT   sig_peptide     306384..306479
FT                   /locus_tag="SSUBM407_0283"
FT                   /note="Signal peptide predicted for SSUBM407_0283 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.999) with
FT                   cleavage site probability 0.864 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(306408..306461,306471..306530,306543..306611,
FT                   306669..306737)
FT                   /locus_tag="SSUBM407_0283"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0283 by TMHMM2.0 at aa 9-26, 30-49, 54-76 and
FT                   96-118"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        306850..307416
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0293"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55116"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N208"
FT                   /protein_id="CAZ55116.1"
FT                   /translation="MLLREIKDQTKQVVQEVLELSDLQKGQIFVLGLSSSEVIGGHIGK
FT                   NSSLEVGEVVVETILEILDQKGIYLAVQGCEHLNRALVVERELAIQKDLEIVNVLPTLH
FT                   AGGSGQLAAFKYMKDPVEVEFITAQAGVDIGDTAIGMHIKHVQVPIRPSLREIGQAHVT
FT                   ALASRPKLIGGVRAAYQEDEIRKGS"
FT   misc_feature    306871..307386
FT                   /locus_tag="SSUBM407_0284"
FT                   /note="HMMPfam hit to PF04260, DUF436, score 5.8e-121"
FT                   /inference="protein motif:HMMPfam:PF04260"
FT   CDS_pept        307416..308030
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0294"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55117"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTM2"
FT                   /protein_id="CAZ55117.1"
FT                   /translation="MKEFTVKDLVWTRPPRQFTISDEEITITTHPQTDLWQKTYYHFVN
FT                   DNAPVLQMETEEDYFSFTVKTDFAGSHTRFDQCGIVLYQDSENWLKCSIEYENDDFQHL
FT                   GSVVTNHGFSDWATTEVSSQIKSMWFRLSRRGADYCFENFEDGIHFKQMRVCHFHQGAG
FT                   KIAFGLYACSPENSSFTARFTNMELSDCKWQAHDGQEPDEI"
FT   misc_feature    307443..308003
FT                   /locus_tag="SSUBM407_0285"
FT                   /note="HMMPfam hit to PF07081, DUF1349, score 2.8e-51"
FT                   /inference="protein motif:HMMPfam:PF07081"
FT   repeat_region   complement(308074..308177)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        308303..309067
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0286"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0296"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTA5"
FT                   /protein_id="CAZ55118.1"
FT                   /translation="MTKGYQQRFSLSILLWMRQDKARQEGMDYWSGGHAQIIAASPGLL
FT                   EYRQQHLSETEHSFWPKATGLETAVPEDRRIDGIAEVTYQKLLAPIGGRRQTALAFEDE
FT                   VNVFRRTLMHMGFPYSSRWYHTSTQAQTQLRDVLYFRRKDGVKSGSFKKFVQDGLASQL
FT                   ATISGVTEVRTQVYLPWNKATWNTPNVAHDNPKEDHLHASIIPGFADQAAREAFYANQA
FT                   PQLNAEVVQYSSAVHAYHIEKTLPFVLDGKRM"
FT   misc_feature    309011..309043
FT                   /locus_tag="SSUBM407_0286"
FT                   /note="ScanRegExp hit to PS00133, CARBOXYPEPT_ZN_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00133"
FT   CDS_pept        309348..309779
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0287"
FT                   /product="putative transcription regulation protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0297"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55119"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXN3"
FT                   /protein_id="CAZ55119.1"
FT                   /translation="MDTKFSVALHILTMISESKEILSSQALAESVGTNASYIRKVIALL
FT                   KNAGLITSHQGRSGYQLSKSPKDISLLEIYLATQEVEHIRLFQIHQNANLSCPVGQHIE
FT                   GAMVPIFSSVEQELENQLSRQSLDNVITNLYQSAQVTRI"
FT   misc_feature    309348..309713
FT                   /locus_tag="SSUBM407_0287"
FT                   /note="HMMPfam hit to PF02082, Rrf2, score 2.1e-31"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   misc_feature    309411..309476
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1320.000, SD 3.68 at aa 22-43, sequence
FT                   LSSQALAESVGTNASYIRKVIA"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        309859..310860
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0288"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0298"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55120"
FT                   /db_xref="GOA:A0A0H3MTF5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTF5"
FT                   /protein_id="CAZ55120.1"
FT                   /translation="MKAAQHTSYNKNNIALNLTEIAKPQIKPNQVLVKVTAAGVNPLDN
FT                   MISRGDVKLIVPYKLPQTAGNEVVGLVEEVGSSVTTFAAGDRVFGRLPLDSIGAFAEYV
FT                   AVDAQALAKVPAYLTDEEAAAVPLTALTIMQALDLMGAQSGKTIFISGGTGGVGGMAIP
FT                   IAKAKGLTVITNGDGASAERVLSLGADRFIDYKTEDYTKTLSDVDYVLDTLGGAETEKQ
FT                   MSIMKKGGQLVSLRAMPNGEFAKRMNLPKWKQILFGLAGRSFDKMAKKYGVHYHFIFVE
FT                   SNGRQLQEVADIFNKLEIKPSIDTVYPFEEVNAALDKVANGRSRGKTVLSFN"
FT   misc_feature    309940..310200
FT                   /locus_tag="SSUBM407_0288"
FT                   /note="HMMPfam hit to PF08240, ADH_N, score 1.6e-23"
FT                   /inference="protein motif:HMMPfam:PF08240"
FT   misc_feature    310288..310704
FT                   /locus_tag="SSUBM407_0288"
FT                   /note="HMMPfam hit to PF00107, ADH_zinc_N, score 6.7e-13"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   CDS_pept        310886..311731
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0289"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0299"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55121"
FT                   /db_xref="GOA:A0A0H3N212"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N212"
FT                   /protein_id="CAZ55121.1"
FT                   /translation="MSYITTKNQYITVSNNKIAYRELSKGKSDIPLVMLVHLAATLDNW
FT                   DPKLLDLLAEKHHVIILDLPGVGASQGKVAPTIPGMAEQAVAIIKALGHEKINLLGLSM
FT                   GGFIAQEIVRLDSQLVNRLILAGTGPRGGFEVDKVTGKTFRYMLKAGLERVDPKRYIFY
FT                   NHDEAGRLEAEKVLGRMGQRSAAHADKDMNVPGFLTQLKAIKRWGREPQDDMTFITQPT
FT                   LIVNGDKDMQVPTENSYTMHEKIKNSQLIIYPNAGHGSIFQNAEEFSKALLAFLEESNA
FT                   "
FT   misc_feature    311054..311707
FT                   /locus_tag="SSUBM407_0289"
FT                   /note="HMMPfam hit to PF00561, Abhydrolase_1, score 7e-22"
FT                   /inference="protein motif:HMMPfam:PF00561"
FT   CDS_pept        311724..312593
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0290"
FT                   /product="short chain dehydrogenase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0300"
FT                   /note="Similar to the C-terminal region of Homo sapiens
FT                   (Human) RDH13 retinol dehydrogenase 13 UniProt:Q8NBN7
FT                   (EMBL:AY358473) (331 aa) fasta scores: E()=3.4e-16, 32.806%
FT                   id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55122"
FT                   /db_xref="GOA:A0A0H3MTM7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTM7"
FT                   /protein_id="CAZ55122.1"
FT                   /translation="MPKTILITGSTDGIGKHLAMKLASEGHEVILHGRNSEKLRVALSD
FT                   IQLKTGSKKIHGYLADFSKLADVYRFSQEIKRDFEQIDVLLNNAGAYFGDARVATAENI
FT                   EMTFMLSVQVPYILTTELLPLLEKAAGRVIHTSSLMHHFAQTRGLDFGLEQSYSAAMAY
FT                   NNAKLYTIWLAIAQAEALEKQGSSVTVNAYHPGLIATNLGNDGIKRNLRSRILTSLMKP
FT                   FSKDLDQGIETGYYLSLSPEVAGVSGRYFAEKRLANVSLKGFDLAKSQALLAYLDKKIQ
FT                   VFKESYGD"
FT   misc_feature    311730..311996
FT                   /locus_tag="SSUBM407_0290"
FT                   /note="HMMPfam hit to PF00106, adh_short, score 8.7e-09"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    312171..312257
FT                   /locus_tag="SSUBM407_0290"
FT                   /note="ScanRegExp hit to PS00061, ADH_SHORT, score NA"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS_pept        312586..313761
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0291"
FT                   /product="NADH:flavin oxidoreductase / NADH oxidase family
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0301"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55123"
FT                   /db_xref="GOA:A0A0H3MTA8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTA8"
FT                   /protein_id="CAZ55123.1"
FT                   /translation="MTKILLENLQLPNGQVLDNRFFKSAMSETLADSQGAPSDDLIALY
FT                   DFWAKQGVGVLVTGNVMVDGRYLGEPGNVVLDSDAHLAQFRKWAAVGKKNGVPIWLQLN
FT                   HPGKQMYRSINQTPIAPSAIPISGGSASAFRPPREMTVFDIKEARDKFIAAGLRAKAAG
FT                   FTGVQLHAAHGYLTNQFLSPADNQRTDRYGGSLDNRMQFLVEVYQGLREKVGPDFTIAL
FT                   KLNASDFKEEGFGFEDCKHVVKIMSDLGIDLIEISGGNYETPVFGSDYENGAGFVTYAL
FT                   ALADLTSVSIVSTGGFRKVTQMEEAIKDGVSMIGLARPFVLRPSLVNDYRQVGDLQADG
FT                   ERTGRYILGGEELVLNSKGESVISYADYAIGMIDEIATGDHLKARISLVSE"
FT   misc_feature    312595..313596
FT                   /locus_tag="SSUBM407_0291"
FT                   /note="HMMPfam hit to PF00724, Oxidored_FMN, score 4.9e-41"
FT                   /inference="protein motif:HMMPfam:PF00724"
FT   CDS_pept        313771..314220
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0292"
FT                   /product="putative transcription regulation protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0302"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55124"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXN8"
FT                   /protein_id="CAZ55124.1"
FT                   /translation="MQISNKFTIAIHALAFIHLFQDQQRVTSKVLANSIQANPVIIRSV
FT                   LSGLKEAGIVDAKQGSGGFRLAKTLDDISLYDIFVTVDNIDKKGLFNFHENPHPDCIVE
FT                   GNIHAAVDDKLVQVQTAMEKELKTMYMSDVLVDLEKAIEEKVKRI"
FT   misc_feature    313771..314148
FT                   /locus_tag="SSUBM407_0292"
FT                   /note="HMMPfam hit to PF02082, Rrf2, score 6.7e-36"
FT                   /inference="protein motif:HMMPfam:PF02082"
FT   CDS_pept        complement(314480..314998)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0293"
FT                   /product="TetR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0303"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55125"
FT                   /db_xref="GOA:A0A0H3MTF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTF8"
FT                   /protein_id="CAZ55125.1"
FT                   /translation="MFRMERVKRKESLFVESVVEALWELLEDKSFEKISVSELVERAGI
FT                   GRVTFYRNFSNKEEVLERSFNLESQAWLTERQIDLSDWSDAHLLLALRQFFDFWYEQQD
FT                   KIRLLTANHLDYLLEEVLDRYFKEKLGDLTDDFHLQFIVGGFFRVLKTWVARGCKESPD
FT                   DIMRLMSEQ"
FT   misc_feature    complement(314807..314947)
FT                   /locus_tag="SSUBM407_0293"
FT                   /note="HMMPfam hit to PF00440, TetR_N, score 2.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(314834..314899)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1126.000, SD 3.02 at aa 34-55, sequence
FT                   ISVSELVERAGIGRVTFYRNFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        315130..316053
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0294"
FT                   /product="putative lipase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0304"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N219"
FT                   /protein_id="CAZ55126.1"
FT                   /translation="MKKVLIGIGILIACFGIGFLYLASKPSVASNYTEVVETGGAVEKK
FT                   YLGQGNYDVSYLEINALQNFKKYELYYPTNIETETRKFPVVIFSNGTGVRASKYASVLK
FT                   HLASWGFIVIGTEEEYSWNGFSSEMSLRLAIKLNDNKTVEGLKSNPFFSKVDLDKIGLS
FT                   GHSQGGVGVFNAVTEQKHGHMIKTIYAASPANLELSSNLEWDYDPSLISVPTFLVSGTG
FT                   GGYEDLVVSGKQLTQIYETLPATITKVMARRKEAGHGDMLRLPNGYMVAWFMWRLQGAP
FT                   EAETAFQGNSPEIVQNKLYQDQRIMN"
FT   sig_peptide     315130..315216
FT                   /locus_tag="SSUBM407_0294"
FT                   /note="Signal peptide predicted for SSUBM407_0294 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.993) with
FT                   cleavage site probability 0.816 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    315139..315198
FT                   /locus_tag="SSUBM407_0294"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0294 by TMHMM2.0 at aa 4-23"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    315376..315471
FT                   /locus_tag="SSUBM407_0294"
FT                   /note="HMMPfam hit to PF07224, Chlorophyllase, score
FT                   0.00047"
FT                   /inference="protein motif:HMMPfam:PF07224"
FT   CDS_pept        316160..317179
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0295"
FT                   /product="putative lipase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0305"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55127"
FT                   /db_xref="GOA:A0A0H3MTN1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN1"
FT                   /protein_id="CAZ55127.1"
FT                   /translation="MKKFKKIILWTLGIVASLGIIAYVSVTNHPQLVVGVIQSFMYKES
FT                   SPNSYSPLYDPIDGLKENGQYLKSEIAYSKDYPNSFLDITYPDQNLEADRPTLFYFHGG
FT                   GFFGGSKNMGAPLSASQATYLIDDIVSKGYNVVNVDYALVPDHHFPTPVIQMNQAIAYM
FT                   KEHAEEYHLNMDNVVLMGSSAGAIMAAQYGSVLANQEYAQLLNIEPSIAKEDVKALVID
FT                   DAPLDYAKFSLGTKILVGNYVSETIYLSEEEINAYNPISHVNKDYPASFLLGSEDRTDM
FT                   VSLNKALKQAGVENELVDPLAEEGLEKPHGFVANLRTDPVSAKAFERLMIFIDDRTKE"
FT   sig_peptide     316160..316225
FT                   /locus_tag="SSUBM407_0295"
FT                   /note="Signal peptide predicted for SSUBM407_0295 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.954) with
FT                   cleavage site probability 0.656 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    316178..316237
FT                   /locus_tag="SSUBM407_0295"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0295 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    316451..316732
FT                   /locus_tag="SSUBM407_0295"
FT                   /note="HMMPfam hit to PF07859, Abhydrolase_3, score
FT                   3.7e-13"
FT                   /inference="protein motif:HMMPfam:PF07859"
FT   CDS_pept        317401..318684
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SSUBM407_0296"
FT                   /product="trigger factor (prolyl isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0306"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55128"
FT                   /db_xref="GOA:A0A0H3MTB1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTB1"
FT                   /protein_id="CAZ55128.1"
FT                   /translation="MSVSFEAKETNRGVLTFTIGQDAIKPELDRVFNKVKKDINLPGFR
FT                   KGHLPRAVFNQKFGEEALYQDVVNALLPAAYEAAVAEAGLEVVAQPKIDVVSMEKGQDW
FT                   TITAEVVTKPEVKLGDYKNLAVSVEATKEVTDEEVDAKIEAARNNLAELVIKEGPAAEG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEAQLVGHAAGEEVNVEVTFPED
FT                   YQAADLAGKQALFVTKIHEVKAKEVPALDDELAKDIDEEVETLDELKAKYRKELEASKE
FT                   VAFDDAVESAALELAVENAEIVELPEEMIHEEVHRAINEFLGGMQQQGISPDMYFQITG
FT                   TTREDLHKQYEADAEKRTKTNLVVEAVAKAEGFEATEEEINKEIEDLAATYNMEVAQVR
FT                   SLLSPEMLKHDIAVKKAVEVITSTATVK"
FT   misc_feature    317401..317841
FT                   /gene="tig"
FT                   /locus_tag="SSUBM407_0296"
FT                   /note="HMMPfam hit to PF05697, Trigger_N, score 1.6e-64"
FT                   /inference="protein motif:HMMPfam:PF05697"
FT   misc_feature    317860..318120
FT                   /gene="tig"
FT                   /locus_tag="SSUBM407_0296"
FT                   /note="HMMPfam hit to PF00254, FKBP_C, score 3.6e-26"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    318121..318651
FT                   /gene="tig"
FT                   /locus_tag="SSUBM407_0296"
FT                   /note="HMMPfam hit to PF05698, Trigger_C, score 1.3e-66"
FT                   /inference="protein motif:HMMPfam:PF05698"
FT   misc_feature    318544..318609
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1100.000, SD 2.93 at aa 382-403, sequence
FT                   KEIEDLAATYNMEVAQVRSLLS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        318735..319619
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0297"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0307"
FT                   /note="Similar to the C-terminal region of Staphylococcus
FT                   epidermidis biofilm PIA synthesis
FT                   N-acetylglucosaminyltransferase IcaA UniProt:Q8GLC5
FT                   (EMBL:AY138959) (412 aa) fasta scores: E()=3.7e-10, 30.328%
FT                   id in 244 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55129"
FT                   /db_xref="GOA:A0A0H3MXP3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXP3"
FT                   /protein_id="CAZ55129.1"
FT                   /translation="MLQRNSLKNLVRPMQKWENVISVGGVVQVSQGVRITDGEVSHYQL
FT                   PWSVLPCLQAIEYDCSFLGSRILLDYLQSNLIISGAFGLFYKEYVIAVGGYDRQTLGED
FT                   MELVMKLHYFCRNNNIPYRICYETSAICWSQAPSSIGDLCKQRRRWFLGLYQCLKKYRK
FT                   MLSRVRFGAVGYFSYAYYMLFEFLAPFIETFGCFVILLSLIYHQLNISFFISLFFLHSA
FT                   FCSLITFASFLQRVYSQDLFIGPMDLCKAFLATLFRYFFLHWVLNIVRLTSFIGYKKRK
FT                   REWGEIKRVKQFV"
FT   misc_feature    join(319227..319280,319290..319349,319362..319430,
FT                   319488..319556)
FT                   /locus_tag="SSUBM407_0297"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0297 by TMHMM2.0 at aa 165-182, 186-205, 210-232
FT                   and 252-274"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        319728..320648
FT                   /transl_table=11
FT                   /gene="lmb"
FT                   /locus_tag="SSUBM407_0298"
FT                   /product="laminin binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0308"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55130"
FT                   /db_xref="GOA:A0A0H3MTG2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTG2"
FT                   /protein_id="CAZ55130.1"
FT                   /translation="MLKKVIRGCFVALFGFVLAACSAQKEASQVQPGMKIVTSFYPIYS
FT                   LVKEVSGNKNDVRMIGSRQGIHSYEPSAADIKAIYDADVFIYHSRILESWAGRLEPNLQ
FT                   GSSVKVLEASTNLPLTKVPGLEDMEAGQGIDEASLYDPHTWLDPVLVGQEAVAIGELLA
FT                   ESDPKNADYYRQNAATLEGKAQKLADKYSPIFLKATSKTFVTQHTAFSYTAQRFGLKQL
FT                   GIAGVSEEEPSPRQLAEIKEFVDTYNVQTIFTEKGASDKLAKALASSTGVDLKVLDPLE
FT                   ADPENNLTYLENLEQVLETLAQELK"
FT   sig_peptide     319728..319811
FT                   /gene="lmb"
FT                   /locus_tag="SSUBM407_0298"
FT                   /note="Signal peptide predicted for SSUBM407_0298 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.999) with
FT                   cleavage site probability 0.776 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    319752..320645
FT                   /gene="lmb"
FT                   /locus_tag="SSUBM407_0298"
FT                   /note="HMMPfam hit to PF01297, SBP_bac_9, score 8.4e-89"
FT                   /inference="protein motif:HMMPfam:PF01297"
FT   CDS_pept        320682..323837
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0299"
FT                   /product="Streptococcal histidine triad-family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0309"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55131"
FT                   /db_xref="InterPro:IPR006270"
FT                   /db_xref="InterPro:IPR023832"
FT                   /db_xref="InterPro:IPR037228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N225"
FT                   /protein_id="CAZ55131.1"
FT                   /translation="MKKKAVVGSVAALVLGMSLCSYQLGRFQAMEEQKNRVSYIEDSQS
FT                   VQTTVAEQLTPDQVSAKENIDAEQIVVKITDQGYVTSHGDHFHYYNGKVPFDAIFSEEL
FT                   VMKDPNYVLQDSHIINEVQDGYVIKVDGKYYLYLKDPSKHKNVRSKEEVERQKGISSAD
FT                   SKNQAAGNSKDGRYRTDDGYVFNPTDVIEDTGDGFIVPHGDHFHFIPKKDLSAAELKAA
FT                   QDYWNQKGSVSSASGSQYGDRNNRAQQTTISAGQGQDLASLLAQLDATPLSQRHVEADG
FT                   LVFDPRTITKKTAAGVIVPHGDHYHFIPYSQMSPLEEKISRMIGVNGAGVSSGAQASRS
FT                   QHTLTQPNRPVTPIGTVTTQPVSPTQPVLPTQPKQSTGKVVSYKGRQIPAYGKGLDGKA
FT                   YFTSDGYTFSKDSITSVDDQGLIASHGDHFHYVGFGELEDFEIKQVEEWVNEKAGKQVP
FT                   PKTSEQVGNDAKPTTPSQGNDSKPVKPIQEENRPAFEYKQVTAKRKLAGKVVYEMEVGG
FT                   KTYTYGRDELDLMKISFAELTLAEKDKQYIFDIAPLAEGDLKPAMLVGMDQIPMKGANA
FT                   TYDTGQSFIIPHIDHIHVLPYTWLSKEQIATIRYIMQHPEIRPSAWTTSGHGDGEATDL
FT                   VPPILNATPKANRLGLKNWQIIHTAEEVMDARAKGKFATNDGYIFSAEDVLDPASFVFS
FT                   QAFSLPRATGGSLRSISKKDLSKEELEAVQTLLDKRDAEELAKNVTPIEKRAGLKNWQI
FT                   VHSAEELAEAKAAGKYTTKDGYIFDPADLLDPKVKIGTDNYRIPRVITDGYRRINKSDL
FT                   NYLSELIPAEAMVAQREKSNSSLPSTPAPTETGASAGETTTPEQPQVAKETAEEIYNRV
FT                   EAKKVVPFEALTYNAGYATEVRNGTLVIPHQDHYHYVSFKWFDQGSARSPEGYSLEDFL
FT                   ATVKYYMTNPQERPVSDDGWGVFTPNTPSESTEETETEESDEEIISEETEEIDEFTEEL
FT                   KRRAEEFGMDFKTFEQSLVTLSDRYKVSFEAFEYDAASKVVRLVDKDGVKRTISLPSLE
FT                   EQV"
FT   sig_peptide     320682..320744
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="Signal peptide predicted for SSUBM407_0299 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.699) with
FT                   cleavage site probability 0.553 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    320694..320762
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0299 by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    320916..320948
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score 4.9"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    321210..321368
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   4.3e-31"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    321507..321665
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   7.8e-05"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    321879..322037
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   5.1e-05"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    322416..322523
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   0.016"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    322695..322871
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   0.00077"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    322986..323165
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score
FT                   0.00014"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   misc_feature    323373..323405
FT                   /locus_tag="SSUBM407_0299"
FT                   /note="HMMPfam hit to PF04270, Strep_his_triad, score 3.9"
FT                   /inference="protein motif:HMMPfam:PF04270"
FT   CDS_pept        323964..324545
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SSUBM407_0300"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0310"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55132"
FT                   /db_xref="GOA:A0A0H3MTN5"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN5"
FT                   /protein_id="CAZ55132.1"
FT                   /translation="MELNVFAGQEKSELSMIEVARAILEERGRDNEMYFNDLVNEIQNY
FT                   LEKSNSEIRAALPTFYSDLNVDGSFIPLGENKWGLRSWYAIDEIDEEVITLEEDDEDAP
FT                   KRKKKRVNAFMDGDDDAIDYGHDDPEDEDNYPGSVSSEYDDENPDDEKDEVESYDSEIN
FT                   EIIPDDELDEEDVDLGEDDDEYSDEEVVDE"
FT   misc_feature    323964..324533
FT                   /gene="rpoE"
FT                   /locus_tag="SSUBM407_0300"
FT                   /note="HMMPfam hit to PF05066, RNA_pol_delta, score
FT                   3.2e-85"
FT                   /inference="protein motif:HMMPfam:PF05066"
FT   CDS_pept        324738..326342
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SSUBM407_0301"
FT                   /product="putative CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0311"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55133"
FT                   /db_xref="GOA:A0A0H3MTB5"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTB5"
FT                   /protein_id="CAZ55133.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERK
FT                   GEYLGATVQVIPHITDALKDKIKRAARTTDADVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQGIK
FT                   NKLAQFCDVAPEAVIESLDVEHLYQIPLNMQAQNMDQIVCDHLKLDVPPADMTEWTAMV
FT                   NKVLNLQKKVKIALVGKYVELQDAYISVVEALKHSGYANDAAIELDWVNANDLTAENVA
FT                   ERLGQAQGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCVEFARHVLGLE
FT                   GANSFELDPETKYPIIDIMRDQIGVEDLGGTLRLGLYPSKLKRGSKAAAAYDNQEVVQR
FT                   RHRHRYEFNNDFREQFEKAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELQSRPNR
FT                   PEGLYTAFVSAAMENEK"
FT   misc_feature    324741..325568
FT                   /gene="pyrG"
FT                   /locus_tag="SSUBM407_0301"
FT                   /note="HMMPfam hit to PF06418, CTP_synth_N, score 3.1e-215"
FT                   /inference="protein motif:HMMPfam:PF06418"
FT   misc_feature    325638..326321
FT                   /gene="pyrG"
FT                   /locus_tag="SSUBM407_0301"
FT                   /note="HMMPfam hit to PF00117, GATase, score 1.6e-68"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   tRNA            326623..326708
FT                   /locus_tag="SSUBM407_t0031"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:326657..326659,aa:Leu)"
FT                   /note="tRNA Leu anticodon AAG, Cove score 53.84"
FT   CDS_pept        326943..327824
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SSUBM407_0302"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0312"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55134"
FT                   /db_xref="GOA:A0A0H3MXP6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXP6"
FT                   /protein_id="CAZ55134.1"
FT                   /translation="MPLVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKQAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLIESMNITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLAKAKEVVELAHAKGISVEAEVGTIGGEEDGIVGSGELAPIEDAVAMV
FT                   ATGIDFLAAGIGNIHGPYPANWEGLDLDHLRKLTEAVPGFPIVLHGGSGIPDAQIQEAI
FT                   KLGVAKVNVNTECQIAFANATRKFAAAYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSANKA"
FT   misc_feature    326946..327821
FT                   /gene="fba"
FT                   /locus_tag="SSUBM407_0302"
FT                   /note="HMMPfam hit to PF01116, F_bP_aldolase, score
FT                   4.3e-115"
FT                   /inference="protein motif:HMMPfam:PF01116"
FT   misc_feature    327162..327203
FT                   /gene="fba"
FT                   /locus_tag="SSUBM407_0302"
FT                   /note="ScanRegExp hit to PS00602, ALDOLASE_CLASS_II_1,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00602"
FT   misc_feature    327339..327374
FT                   /gene="fba"
FT                   /locus_tag="SSUBM407_0302"
FT                   /note="ScanRegExp hit to PS00806, ALDOLASE_CLASS_II_2,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00806"
FT   CDS_pept        328217..328405
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SSUBM407_0303"
FT                   /product="50S ribosomal protein L28"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0313"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55135"
FT                   /db_xref="GOA:A0A0H3MTG6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTG6"
FT                   /protein_id="CAZ55135.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   misc_feature    328223..328399
FT                   /gene="rpmB"
FT                   /locus_tag="SSUBM407_0303"
FT                   /note="HMMPfam hit to PF00830, Ribosomal_L28, score
FT                   4.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00830"
FT   rRNA            329026..330569
FT                   /locus_tag="SSUBM407_r0007"
FT                   /note="16S rRNA"
FT   tRNA            330621..330693
FT                   /locus_tag="SSUBM407_t0032"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:330654..330656,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            330973..333877
FT                   /locus_tag="SSUBM407_r0008"
FT                   /note="23S rRNA"
FT   rRNA            333955..334082
FT                   /locus_tag="SSUBM407_r0009"
FT                   /note="5S rRNA"
FT   tRNA            334083..334155
FT                   /locus_tag="SSUBM407_t0033"
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:334116..334118,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 82.38"
FT   tRNA            334178..334249
FT                   /locus_tag="SSUBM407_t0034"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:334211..334213,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 66.12"
FT   CDS_pept        334368..336386
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="SSUBM407_0304"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0314"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55136"
FT                   /db_xref="GOA:A0A0H3N228"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N228"
FT                   /protein_id="CAZ55136.1"
FT                   /translation="MKRLCDELSVLPGIGPKSAEKFLKISIQNINDLLTYYPFRYEDFE
FT                   SKSIYDLQDGEKAVVVGEVVSPANVQYYGYKRNRLRFSMKQGEVVLAVSFFNQPYLADK
FT                   IVLGQDIAVWGKWDKAKASLTGMKILAQVSDELQPVYHVAQGISQVNLVKAIKTAIDQG
FT                   YLHLLEENLPSVLRERYRLMNRREAVFAMHFPTNLEEYRQALRRMKFEELFYFQLQLQM
FT                   LKANNRDILNGLKIAYDADRLAMQIRQLPFVLTDAQSGALAEILSDMKSYGHMNRLLQG
FT                   DVGSGKTVVAGLAMFAAVTAGMQAAIMVPTEILAEQHFESLRQLFPELSIALLTGGMKA
FT                   AERRTALEAISSGQVDIIVGTHALIQESVTYHKLGLVVTDEQHRFGVKQRRLFREKGDN
FT                   PDVLMMTATPIPRTLAITAFGDMDVSIINQLPAGRKPIITRWVKHQQLPTVLDWLEREL
FT                   EVGAQVYFISPLIEESEALDLKNAVDLQSDLQAHFGEQVTVDLLHGKMKNDEKDAIMQA
FT                   FKERKTNILVSTTVIEVGVNVPNATVMVIMDADRFGLSQLHQLRGRVGRGHKQSYAVLV
FT                   ANPKTESGKERMKIMTETTDGFILAEADLKMRGSGEIFGTRQSGLPEFQVANIIEDYPI
FT                   LEEARRVASQIVSVENWQEDPNWSILLANLKDREELD"
FT   misc_feature    335130..335618
FT                   /gene="recG"
FT                   /locus_tag="SSUBM407_0304"
FT                   /note="HMMPfam hit to PF00270, DEAD, score 5.8e-39"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    335841..336071
FT                   /gene="recG"
FT                   /locus_tag="SSUBM407_0304"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 1.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        complement(336450..337409)
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SSUBM407_0305"
FT                   /product="putative L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0315"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55137"
FT                   /db_xref="GOA:A0A0H3MTN8"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN8"
FT                   /protein_id="CAZ55137.1"
FT                   /translation="MKKILVLHTGGTISMQTNHQGEVAASKTNPMTQIDSPLEETQVTS
FT                   LDFLNVPSPHIRLEHMMTLYQKIKEEQMNFDGFVITHGTDTLEETAYFLDTMAIPEKPI
FT                   VLTGAMRSSNELGSDGIYNYRTALRVATDDKSADKGVLVVMNDEIHAAKYVTKTYTTNV
FT                   STFQTPTHGPLGLVTKREILYFKTAEPRVRFDLSTVTGTVPIIKAYADMDSILLDSLTA
FT                   SSISGLVIEALGAGNLPPTILPAIKKLLDQKIPIILVSRCFNGIAEPVYAYQGGGIQLE
FT                   KDGILFVKELNAQKARLKLLIALNAGLEEQSLADYIQG"
FT   misc_feature    complement(336468..337403)
FT                   /gene="asnB"
FT                   /locus_tag="SSUBM407_0305"
FT                   /note="HMMPfam hit to PF00710, Asparaginase, score 7e-134"
FT                   /inference="protein motif:HMMPfam:PF00710"
FT   misc_feature    complement(337149..337181)
FT                   /gene="asnB"
FT                   /locus_tag="SSUBM407_0305"
FT                   /note="ScanRegExp hit to PS00917, ASN_GLN_ASE_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00917"
FT   misc_feature    complement(337347..337400)
FT                   /gene="asnB"
FT                   /locus_tag="SSUBM407_0305"
FT                   /note="ScanRegExp hit to PS01076, ACETATE_KINASE_2, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS01076"
FT   misc_feature    complement(337368..337394)
FT                   /gene="asnB"
FT                   /locus_tag="SSUBM407_0305"
FT                   /note="ScanRegExp hit to PS00144, ASN_GLN_ASE_1, score NA"
FT                   /inference="protein motif:Prosite:PS00144"
FT   CDS_pept        join(337479..338318,338317..338844)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0306"
FT                   /product="haloacid dehalogenase-like hydrolase
FT                   (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0316"
FT                   /note="CDS contains a frameshift after codon 280. Similar
FT                   to Streptococcus pneumoniae Cof family protein
FT                   UniProt:Q97NM3 (EMBL:AE007488) (462 aa) fasta scores:
FT                   E()=3.5e-89, 52.772% id in 451 aa"
FT                   /db_xref="PSEUDO:CAZ55138.1"
FT   misc_feature    337491..337526
FT                   /locus_tag="SSUBM407_0306"
FT                   /note="ScanRegExp hit to PS01228, COF_1, score NA"
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    337494..338297
FT                   /locus_tag="SSUBM407_0306"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 8.2e-82"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   CDS_pept        complement(338860..339312)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0307"
FT                   /product="putative universal stress protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0318"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55139"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTB9"
FT                   /protein_id="CAZ55139.1"
FT                   /translation="MTQSYKTILVAVDGSKGAELALHKAIHVALRNQARLIIAHVIDTR
FT                   ALHNVVAFDASVYESLEREAELLLEEYKQEALNAGLTDVQIRIEFGNPKTLLAIDIPKE
FT                   TGADLMLLGATGLNAFERLLIGSSSEYIMRHATIDLLIVRDGEKSL"
FT   misc_feature    complement(338881..339303)
FT                   /locus_tag="SSUBM407_0307"
FT                   /note="HMMPfam hit to PF00582, Usp, score 1.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS_pept        339467..340681
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0308"
FT                   /product="putative aminotransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0319"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55140"
FT                   /db_xref="GOA:A0A0H3MXQ1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXQ1"
FT                   /protein_id="CAZ55140.1"
FT                   /translation="MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAE
FT                   FGFTAPDEVIRDLIHNARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGV
FT                   SELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMES
FT                   KVTSRTKAIVLINPNNPTGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIP
FT                   IATLAPDLFVVTMNGLSKSHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVL
FT                   AQQVVQTSLGGYQSVDELLMPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDR
FT                   EMYRVEDDEQFVLDFLKQEKVLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFL
FT                   RQYRR"
FT   misc_feature    339563..340660
FT                   /locus_tag="SSUBM407_0308"
FT                   /note="HMMPfam hit to PF00155, Aminotran_1_2, score 4e-36"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS_pept        341090..341878
FT                   /transl_table=11
FT                   /gene="codY"
FT                   /locus_tag="SSUBM407_0309"
FT                   /product="GTP-sensing transcriptional pleiotropic
FT                   repressor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0320"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55141"
FT                   /db_xref="GOA:A0A0H3MTH0"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTH0"
FT                   /protein_id="CAZ55141.1"
FT                   /translation="MTTLLEKTRNITSILKRSEEQLAEELPYNAIAEHLSAIIDCNSCI
FT                   INSEGEVLGYHMSYETNNDRVEEFFQNKQFPEGYVKAVAQVYDTQVNLPVESELTAIPV
FT                   ESRSTYPNGLTTIAPIHVTGIRFGSLIIWRNDEQFHDDDLILVEIAATVVGIQLLNFQR
FT                   EEDEKNIRRRAAVNMAVNTLSYSEMKAVAAILGELDGNEGQLTASVIADRIGITRSVIV
FT                   NALRKLESAGIIESRSLGMKGTYLKVLIPAIFDEIKKRDY"
FT   misc_feature    341096..341653
FT                   /gene="codY"
FT                   /locus_tag="SSUBM407_0309"
FT                   /note="HMMPfam hit to PF06018, CodY, score 2.5e-105"
FT                   /inference="protein motif:HMMPfam:PF06018"
FT   misc_feature    341690..341872
FT                   /gene="codY"
FT                   /locus_tag="SSUBM407_0309"
FT                   /note="HMMPfam hit to PF08222, HTH_CodY, score 1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF08222"
FT   misc_feature    341702..341767
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1428.000, SD 4.05 at aa 205-226, sequence
FT                   LTASVIADRIGITRSVIVNALR"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        join(341868..341888,341888..342421)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0310"
FT                   /product="isochorismatase family protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0321"
FT                   /note="CDS contains a frameshift after codon 7. Possible
FT                   alternative translational start site after codon 4. Similar
FT                   to Streptococcus mutans putative
FT                   pyrazinamidase/nicotinamidase PncA UniProt:Q8DSG2
FT                   (EMBL:AE015009) (183 aa) fasta scores: E()=3.2e-54, 78.022%
FT                   id in 182 aa"
FT                   /db_xref="PSEUDO:CAZ55142.1"
FT   misc_feature    341891..342418
FT                   /locus_tag="SSUBM407_0310"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase, score
FT                   2.6e-08"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        342675..343022
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="SSUBM407_0311"
FT                   /product="50S ribosomal protein L19"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0322"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55143"
FT                   /db_xref="GOA:A0A0H3N233"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N233"
FT                   /protein_id="CAZ55143.1"
FT                   /translation="MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGNRERIQIFEG
FT                   VVISRKGQGISEMYTVRKISGGVGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRALQ
FT                   GKAARIKEIRR"
FT   misc_feature    342678..343016
FT                   /gene="rplS"
FT                   /locus_tag="SSUBM407_0311"
FT                   /note="HMMPfam hit to PF01245, Ribosomal_L19, score
FT                   1.5e-71"
FT                   /inference="protein motif:HMMPfam:PF01245"
FT   misc_feature    342930..342977
FT                   /gene="rplS"
FT                   /locus_tag="SSUBM407_0311"
FT                   /note="ScanRegExp hit to PS01015, RIBOSOMAL_L19, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01015"
FT   CDS_pept        343183..343857
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0323"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55144"
FT                   /db_xref="GOA:A0A0H3MTP1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP1"
FT                   /protein_id="CAZ55144.1"
FT                   /translation="MSEQFIPSVLSDLRQDIVQMPEVIKECSGIRIYGRRIRSVLFTTD
FT                   VSIIANHNADAILAVYPFTPSPAIIKSIMLVASVPVLAGVGGGLTTGMRSANMSLLSES
FT                   EGAYAVVVNGPTDVKTIEAINKVVDIPIIYTVVSEKSDLTSRIKAGVDILNVSCGMETP
FT                   RVVKKIREAFPDFPIIATGGPTEDSIRRVIEAGANAVSYTAPSNGELFKGKMEKYRKHA
FT                   KD"
FT   CDS_pept        344074..344376
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SSUBM407_0313"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0324"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55145"
FT                   /db_xref="GOA:A0A0H3MTC3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTC3"
FT                   /protein_id="CAZ55145.1"
FT                   /translation="MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVD
FT                   TTGVAVTTTMADRKNVLRADIAQKGESREELFKNVPESQDNFIKVPAILDGGGDA"
FT   misc_feature    344128..344343
FT                   /gene="gatC"
FT                   /locus_tag="SSUBM407_0313"
FT                   /note="HMMPfam hit to PF02686, Glu-tRNAGln, score 1.2e-15"
FT                   /inference="protein motif:HMMPfam:PF02686"
FT   CDS_pept        344376..345842
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SSUBM407_0314"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0325"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55146"
FT                   /db_xref="GOA:A0A0H3MXQ6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXQ6"
FT                   /protein_id="CAZ55146.1"
FT                   /translation="MTFNNKTIDELHDLLVKKEISAVELTKATLEDIKSREGAVDAFLT
FT                   ITEDAALAQAAALDEKGIDADNVMAGIPLAVKDNISTKGILTTAASKMLYNYEPIFDAT
FT                   SVAQAYAKDMIIVGKTNMDEFAMGGSNENSAFKPTKNAWDQTKVPGGSSGGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGMKPTYGTVSRFGLIAFGSSLDQIGPFSQTVKENA
FT                   QLLNVISGHDVKDATSTINEIADFTSKIGQDIKGMKIALPKEYMGEGIDPQVKETILKA
FT                   AKHLESLGAIIEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGFRAEDATNLDEI
FT                   YVKTRSQGFGEEVKRRIMLGTFSLSSGYYDAYFKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPTVAFGLDTLNHDPVAMYLADLLTIPVNLAGLPGLSIPAGFVEGLPVGLQLIGPKY
FT                   SEETIYQVAAAFEATTDYHKQQPVIFGGAN"
FT   misc_feature    344445..345767
FT                   /gene="gatA"
FT                   /locus_tag="SSUBM407_0314"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 7.4e-186"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   misc_feature    344823..344918
FT                   /gene="gatA"
FT                   /locus_tag="SSUBM407_0314"
FT                   /note="ScanRegExp hit to PS00571, AMIDASES, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00571"
FT   CDS_pept        345842..347281
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SSUBM407_0315"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0326"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55147"
FT                   /db_xref="GOA:A0A0H3MTH4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTH4"
FT                   /protein_id="CAZ55147.1"
FT                   /translation="MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDIHKDMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEIELEDGSTKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFNYV
FT                   RKGLQHEVERQAKILRSGGQIQQETRRYDESTGETILMRVKEGSADYRYFPEPDLPLYE
FT                   IDDSWIEEVRAELPVFPKARRAHYVENLGLTAYDAGQLTSTKALSDFFEAAVAAGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTIEQIALTPENLVEMIALIADGTISSKIAKKVFVHLAKEG
FT                   GSAKAYVEKAGLVQISDPAVLIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVAQQLLAQELAKLLD"
FT   misc_feature    345842..346561
FT                   /gene="gatB"
FT                   /locus_tag="SSUBM407_0315"
FT                   /note="HMMPfam hit to PF02934, GatB_N, score 1e-146"
FT                   /inference="protein motif:HMMPfam:PF02934"
FT   misc_feature    346268..346312
FT                   /gene="gatB"
FT                   /locus_tag="SSUBM407_0315"
FT                   /note="ScanRegExp hit to PS01234, GATB, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01234"
FT   misc_feature    346610..346816
FT                   /gene="gatB"
FT                   /locus_tag="SSUBM407_0315"
FT                   /note="HMMPfam hit to PF01162, GatB, score 4.5e-30"
FT                   /inference="protein motif:HMMPfam:PF01162"
FT   misc_feature    346820..347263
FT                   /gene="gatB"
FT                   /locus_tag="SSUBM407_0315"
FT                   /note="HMMPfam hit to PF02637, GatB_Yqey, score 3.7e-61"
FT                   /inference="protein motif:HMMPfam:PF02637"
FT   repeat_region   complement(347332..348961)
FT                   /note="putative IS element"
FT   CDS_pept        complement(347512..348714)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0316"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55148"
FT                   /db_xref="GOA:A0A0G2PMG7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMG7"
FT                   /protein_id="CAZ55148.1"
FT                   /translation="MRVVFGIDVSKASSEVAILVNGEKVHGYTISNDAIGFARLLGDLR
FT                   TVHKPEIIFEATGVYSRRLQTFLDDNGYAYTRLNPLEAKKQLDSLRVRKTDQIDAEKLA
FT                   QSQFVLNRKPTYVQEEVYQNLRDLSRFYQNLTEDIVRAKNRLHKVLQVTFPELENILST
FT                   PSGEQYWNLVIAFPCKDCVLELSNDELSKSIRLSTSKRISDKRVAYLAEKLIALANQSY
FT                   CAVKKTSPILEEVRYYTKELLRLSEQRQAVLDEMVELAQPLPEYDILLSIPGIAETTAT
FT                   SIIGELGDIRRFQSANQINAFIGIDLRHYESGNFLAKEHITKRGNPYARKILFKCIHNI
FT                   ASANHTNPCHIADFYKKRKRQSQTTSTKLHTIASIHRLIRTMYYLIMHNKFYDYASTQN
FT                   R"
FT   misc_feature    complement(347707..347916)
FT                   /locus_tag="SSUBM407_0316"
FT                   /note="HMMPfam hit to PF02371, Transposase_20, score
FT                   1.2e-20"
FT                   /inference="protein motif:HMMPfam:PF02371"
FT   misc_feature    complement(348226..348513)
FT                   /locus_tag="SSUBM407_0316"
FT                   /note="HMMPfam hit to PF01548, Transposase_9, score
FT                   7.2e-05"
FT                   /inference="protein motif:HMMPfam:PF01548"
FT   CDS_pept        349025..350374
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0317"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0327"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55149"
FT                   /db_xref="GOA:A0A0H3N238"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N238"
FT                   /protein_id="CAZ55149.1"
FT                   /translation="MSKDFDDFLREHEENVNKLKKRDKETESDKERARDEFSRDYSRVI
FT                   YSNSFRRQQGKMQLFAVNGRAFHRNRLTHSFEVAQIARGIVDYLKKNTSNNIDIDFNSM
FT                   SVVVETGALVHDIGNPPFGHHGERILNDLAKDIGFEGNAQGLRVLKNIEKKSPDHKGLN
FT                   LTYRTLASILKYYVPYRKSRKTEKFIYKEDYEEFKKRFKEMDVFVRTIDVQIVDLADEI
FT                   AYCAHDLEDALASNYFTIDQFVFLLEQKLGEDQTLEDFKEWIEEAKNKAKRSKSNDDYD
FT                   FYFRRELLSIIVNKFIEDIDIVELNEKDKKKLGTDQDQELGLGHYKKLAGALKKTIFEG
FT                   VTNSDDIILYENVGTKVLTRLFALFMNEEYNRESFLMPIEYRFEKDDTQSDKKRKVLDY
FT                   ISGMMDTYAIEMYIKHFGTDPFLEKYDAAIFKKGTGKKLIECLAQNFLHK"
FT   misc_feature    349235..349699
FT                   /locus_tag="SSUBM407_0317"
FT                   /note="HMMPfam hit to PF01966, HD, score 1.3e-07"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        complement(350433..351431)
FT                   /transl_table=11
FT                   /gene="galR"
FT                   /locus_tag="SSUBM407_0318"
FT                   /product="galactose operon repressor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0328"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55150"
FT                   /db_xref="GOA:A0A0H3MTP4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP4"
FT                   /protein_id="CAZ55150.1"
FT                   /translation="MVTIKDIAKQAHLSSATVSRVLKGDLTLSVSQETRDRIFNLAQEL
FT                   GYTKHIKKQAPQQKGTIGIVQWYTESEELADLYYYSIRASIEHTASLLGYQIVRSFNDL
FT                   TNPLLQEVDGIIAVGKFSSGQIAELSSLSSKIIFVDSDTLTEGFSCVTTDFEHSVQTVI
FT                   DHFHSQGLTDIGLLVGQEETTDGHQLPTDPRLTAFRDYLDTLGMLQEDYIYQGKFSTQS
FT                   GYELMSQAIEDLGDKLPPAFFMANDTLAVGALRALQERQIAVPDRIQLITFNDTAITRQ
FT                   VYPALSSISVFTEEMGQEAMQLLDRIITSPTPHHPRKIKLGTQLVIRESSY"
FT   misc_feature    complement(350445..351257)
FT                   /gene="galR"
FT                   /locus_tag="SSUBM407_0318"
FT                   /note="HMMPfam hit to PF00532, Peripla_BP_1, score 0.0018"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   misc_feature    complement(351351..351428)
FT                   /gene="galR"
FT                   /locus_tag="SSUBM407_0318"
FT                   /note="HMMPfam hit to PF00356, LacI, score 3.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    complement(351363..351428)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2067.000, SD 6.23 at aa 2-23, sequence
FT                   VTIKDIAKQAHLSSATVSRVLK"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        351565..352737
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="SSUBM407_0319"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0329"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55151"
FT                   /db_xref="GOA:A0A0H3MTC8"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTC8"
FT                   /protein_id="CAZ55151.1"
FT                   /translation="MNTEQLKQAFLDVFGQEADATFFSPGRINLIGEHTDYNGGHVFPA
FT                   AITLGTYGAARKRDDQVLRFYSANFEELGIIEVDLNNLVFDKADNWTNYAKGVLKFLKE
FT                   AGHVIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEELYGLELTRLDLVKIGKQTEN
FT                   HFIGVNSGIMDQFAIGMGADNRAIYLDTNSLEYELVPLDLGDHVIVIMNTNKRRELADS
FT                   KYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIKDENRIKRARHAVLENQRT
FT                   LQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAHTAWEQEGVLGARMTGAG
FT                   FGGCGIAIVHKDKVEAFKENVGKTYTEVVGYAPSFYVAEIAGGSRVLSRK"
FT   misc_feature    351640..351675
FT                   /gene="galK"
FT                   /locus_tag="SSUBM407_0319"
FT                   /note="ScanRegExp hit to PS00106, GALACTOKINASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00106"
FT   misc_feature    351904..352110
FT                   /gene="galK"
FT                   /locus_tag="SSUBM407_0319"
FT                   /note="HMMPfam hit to PF00288, GHMP_kinases_N, score
FT                   8.4e-19"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   misc_feature    351925..351960
FT                   /gene="galK"
FT                   /locus_tag="SSUBM407_0319"
FT                   /note="ScanRegExp hit to PS00627, GHMP_KINASES_ATP, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00627"
FT   misc_feature    352414..352665
FT                   /gene="galK"
FT                   /locus_tag="SSUBM407_0319"
FT                   /note="HMMPfam hit to PF08544, GHMP_kinases_C, score
FT                   8.4e-15"
FT                   /inference="protein motif:HMMPfam:PF08544"
FT   CDS_pept        352747..354228
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="SSUBM407_0320"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0330"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55152"
FT                   /db_xref="GOA:A0A0H3MXR1"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXR1"
FT                   /protein_id="CAZ55152.1"
FT                   /translation="MMTGLVDRFVEQVIANSDFEEMDAIYLRNRVLALVGDQVLTVQTD
FT                   LEDLIELKDELLAHGVRTGFVGELLEEQDMVGSCLMDLMTPSPSQVNRDFWQTYQDSPE
FT                   QAISDFYELSKRNDYIKMAAIAKNIYYPVSTEYGDLEITINLSKPEKDPKSIAAATKAE
FT                   ASNYPKCLLCMENEGYQGRINHPARANHRIIRLELGQEKWGFQYSPYAYYNEHAIFLNQ
FT                   EHVPMVISPRTFEQLLDLLDLLPGYFVGSNSDLPISGGSILTHNHYQGGRHSFAMDQAP
FT                   IEHQLVFEGFESVSAGIVKWPMSVIRLSSADKPSLLGLAAKILEKWRSYSDDSVQIKAE
FT                   TDGTPHHTITPIARKRGDLYELDLVLRDNQTSEEFPDGIYHPHPDVQHIKKENIGLIEV
FT                   MGLAILPPRLKAELAEVEKFLLGQDSQVADYHQPWAESLKTAHPDVTEETVEQVVRESV
FT                   GQIFARVLEDAGVYKRTPEGQAAFLRFVEFVGLAT"
FT   misc_feature    352795..353424
FT                   /gene="galT"
FT                   /locus_tag="SSUBM407_0320"
FT                   /note="HMMPfam hit to PF01087, GalP_UDP_transf, score
FT                   1.2e-79"
FT                   /inference="protein motif:HMMPfam:PF01087"
FT   misc_feature    353428..354054
FT                   /gene="galT"
FT                   /locus_tag="SSUBM407_0320"
FT                   /note="HMMPfam hit to PF02744, GalP_UDP_tr_C, score
FT                   1.5e-85"
FT                   /inference="protein motif:HMMPfam:PF02744"
FT   misc_feature    353506..353559
FT                   /gene="galT"
FT                   /locus_tag="SSUBM407_0320"
FT                   /note="ScanRegExp hit to PS01163, GAL_P_UDP_TRANSF_II,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01163"
FT   CDS_pept        354304..355212
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0321"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0331"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55153"
FT                   /db_xref="GOA:A0A0H3MTH8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTH8"
FT                   /protein_id="CAZ55153.1"
FT                   /translation="MAEKRLGTLITVIAGIAWGLSGVSGQYLMSRGVSVDMITSLRLLV
FT                   SGLFLVGLAYATAKEQLLAVLKDKNALLGIFIFAMLGLVLNQTAYLQAIYHTNAGTATV
FT                   LQYLCPILVLAYTCLKNREKPSGIELISIILAIAGTFLIATHGKLDELAVTPIGLFWGI
FT                   FSAFTYALYIILPGKLIRQYGSITVIGLGMLMGGFVVTLGLQTWQHRLPIDGGSFLGLL
FT                   GIVGVGTIFAYTAFLKGVSMVGPVNGSLLASIEPIASVFFAVWLVNEQFYAIDFVGMLL
FT                   ILLAVLLISLKDILVAQKSIG"
FT   misc_feature    join(354322..354390,354418..354477,354514..354582,
FT                   354592..354660,354679..354735,354763..354831,
FT                   354850..354918,354946..355014,355033..355101,
FT                   355114..355176)
FT                   /locus_tag="SSUBM407_0321"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SSUBM407_0321 by TMHMM2.0 at aa 7-29, 39-58, 71-93, 97-119,
FT                   126-144, 154-176, 183-205, 215-237, 244-266 and 271-291"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    354349..354738
FT                   /locus_tag="SSUBM407_0321"
FT                   /note="HMMPfam hit to PF00892, DUF6, score 3.8e-16"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   misc_feature    354802..355176
FT                   /locus_tag="SSUBM407_0321"
FT                   /note="HMMPfam hit to PF00892, DUF6, score 7.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00892"
FT   CDS_pept        355260..355889
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0322"
FT                   /product="CutC family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0332"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55154"
FT                   /db_xref="GOA:A0A0H3N243"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N243"
FT                   /protein_id="CAZ55154.1"
FT                   /translation="MIKEFCSENHVGVMKALSLGAKRIELCDNLAVGGTTPSYGVVKHV
FT                   CQLAHENEATVMTMIRPRGGDFCYDKAEVEMMVEDCKAAIELGADGLVYGLLTEENWLD
FT                   EPALERLFAVSQDCQIVFHMAFDQIPRERQFEALDWLVEHGVTRILMRGSLTGSALNNV
FT                   EWLQEIVAYAQGKIEILIGGGLTVDNVPTLLEALPINQVHGTRLFW"
FT   misc_feature    355260..355883
FT                   /locus_tag="SSUBM407_0322"
FT                   /note="HMMPfam hit to PF03932, CutC, score 2.1e-72"
FT                   /inference="protein motif:HMMPfam:PF03932"
FT   CDS_pept        356096..356470
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0323"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0333"
FT                   /note="No significant database matches"
FT                   /note="Possible alternative translational start site after
FT                   codon 7"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP7"
FT                   /protein_id="CAZ55155.1"
FT                   /translation="MNPLRKELRTVAVEVSDLALDYAVRLAQSLNSTLRYHNYDSLIAI
FT                   AKTKGVEPKGKDCQSFSEYRQRYSLYDAKKLIYRALAWRLFDDSHADYGHALTILGLDE
FT                   DESGVEQIGFAFSKFTLDID"
FT   CDS_pept        356654..357181
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0324"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0334"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55156"
FT                   /db_xref="GOA:A0A0H3MTD4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTD4"
FT                   /protein_id="CAZ55156.1"
FT                   /translation="MSLENYMPDFALEKAYDVTVESLKKHGIKVVFVDLDNTLIAWNNP
FT                   DGTPEMRQWLHDLQDAGIPVVVVSNNKYERVKRAVEKFGIEFEAFALKPFTFGINRALK
FT                   RFDVQPYEVIMIGDQLMTDIRAAKRAGLKSVLVKPLIKTDSINTQINRWRERRTMKKII
FT                   AKYGAIDYKREM"
FT   misc_feature    356798..357073
FT                   /locus_tag="SSUBM407_0324"
FT                   /note="HMMPfam hit to PF00702, Hydrolase, score 4.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS_pept        357182..358288
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0325"
FT                   /product="GTP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0335"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55157"
FT                   /db_xref="GOA:A0A0H3MXR6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXR6"
FT                   /protein_id="CAZ55157.1"
FT                   /translation="MEELFCIGCGAQIQTLDKAVAGFTPQSALEKGLETGQLYCQRCFR
FT                   LRHYNEISDVNISDDDFLKLLHSVGESDALVVNVIDIFDFNGSVIPGLPRFISGNDVLL
FT                   VGNKQDILPKSVKTGKVTQWLTERAHEIGMRPVDVVLTSAQNKQAIKDLIEKIEQHRKG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSYIYDTPG
FT                   IIHRHQMAHYLTAKNLKYISPRKEIKPKTYQLNPEQTLFLAGLGRFDFVAGERQGFTAF
FT                   FDNELQLHRTKLQGASEFYQKHAGSLLVPPTSKELKEFPELVRHEFTINEKTDVVFSGL
FT                   GWIRVNEKAKIAAWAPKGVDVVIRKAII"
FT   misc_feature    357671..357988
FT                   /locus_tag="SSUBM407_0325"
FT                   /note="HMMPfam hit to PF01926, MMR_HSR1, score 6.5e-12"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   CDS_pept        358561..358869
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0336"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55158"
FT                   /db_xref="GOA:A0A0H3MTI3"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTI3"
FT                   /protein_id="CAZ55158.1"
FT                   /translation="MLTSKQRAFLNSQAHSLKPIIQIGKNGLNDQIKTSVRQALDAREL
FT                   IKVTLLQNTDENIHEVAEILEEEIGVDTVQKIGRILILFKQSSKKENRKISKQVKEI"
FT   misc_feature    358564..358815
FT                   /locus_tag="SSUBM407_0326"
FT                   /note="HMMPfam hit to PF01985, CRS1_YhbY, score 2.6e-33"
FT                   /inference="protein motif:HMMPfam:PF01985"
FT   CDS_pept        358882..359514
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0327"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0337"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55159"
FT                   /db_xref="GOA:A0A0H3N246"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N246"
FT                   /protein_id="CAZ55159.1"
FT                   /translation="MAIELLTPFTKVELEVEKKETNRKQVGILGGNFNPVHNAHLIVAD
FT                   QVRQQLKLDQVLLMPEFIPPHVDKKETIDEYHRYSMLKMAIAGIEGLGIETIELERRGV
FT                   SYTYDTMKLLKEKNPDTDYYFIIGADMVDYLPKWHRIDELVQLVQFVGVQRPRYKAGTS
FT                   YPVIWVDVPLMDISSSMVRSFIKQGRVPNFMVPHEVLDYIEEKGLYQ"
FT   misc_feature    358963..359433
FT                   /locus_tag="SSUBM407_0327"
FT                   /note="HMMPfam hit to PF01467, CTP_transf_2, score 5.5e-62"
FT                   /inference="protein motif:HMMPfam:PF01467"
FT   CDS_pept        359511..360098
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0328"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0338"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55160"
FT                   /db_xref="GOA:A0A0H3MTQ0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTQ0"
FT                   /protein_id="CAZ55160.1"
FT                   /translation="MIAADLTFDRQALLEKIRVAMKPARFQHVLGVEQAALVLADQYGC
FT                   DPKKASLAALLHDYAKEVEDQVFLDLIAKYDLDKDLLNWDNNIWHGVVGAYKIAEDFGL
FT                   EDEEIFQAIQRHTVGAGQMTLLDKVLYVADYIEPNRDFPGVDEARRIAKESLDKAVAYE
FT                   TAQTISYLAKKGIPIYPQILETYNGYVVWLKE"
FT   misc_feature    359583..359927
FT                   /locus_tag="SSUBM407_0328"
FT                   /note="HMMPfam hit to PF01966, HD, score 1.5e-21"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        join(360208..360333,360611..360931)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0329"
FT                   /product="acetyltransferase (GNAT) family (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0339"
FT                   /note="CDS lacks a translational start codon, and is
FT                   disrupted by a 277bp DNA region. Similar to Bacillus
FT                   thuringiensis serovar konkukian str. 97-27
FT                   acetyltransferase UniProt:Q5LK91 (EMBL:CP000047) (148 aa)
FT                   fasta scores: E()=6.8e-14, 36.429% id in 140 aa"
FT   misc_feature    360623..360868
FT                   /locus_tag="SSUBM407_0329"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   6.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        join(360928..361014,361018..361101,361103..361438)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0330"
FT                   /product="isochorismatase family protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0341"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   29, and a frameshift after codon 57. Similar to
FT                   Streptococcus agalactiae (serotype III) hypothetical
FT                   protein GBS1704 UniProt:Q8E3Q2 (EMBL:SAG766852) (173 aa)
FT                   fasta scores: E()=1.7e-21, 42.262% id in 168 aa"
FT                   /db_xref="PSEUDO:CAZ55162.1"
FT   misc_feature    join(360931..361014,361018..361101,361103..361429)
FT                   /locus_tag="SSUBM407_0330"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   CDS_pept        361440..361799
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0342"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55163"
FT                   /db_xref="GOA:A0A0H3MTE0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTE0"
FT                   /protein_id="CAZ55163.1"
FT                   /translation="MKELDLVKVVVQAADDKRAEDLVVIDVQGVTSLTDYFVIASSMNS
FT                   RQLEAIAENIREKVADVGIKSSRVEGDSNGGWVLLDLGGVVVHIFSEEMRDLYNLEKLW
FT                   HEGSFLEVADFLEEE"
FT   misc_feature    361449..361754
FT                   /locus_tag="SSUBM407_0331"
FT                   /note="HMMPfam hit to PF02410, DUF143, score 4.5e-45"
FT                   /inference="protein motif:HMMPfam:PF02410"
FT   CDS_pept        362101..362844
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0332"
FT                   /product="SAM dependent methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0343"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55164"
FT                   /db_xref="GOA:A0A0H3MXS0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXS0"
FT                   /protein_id="CAZ55164.1"
FT                   /translation="MATYETFAAVYDEIMDDSLYDKWTDFSLRNLPQDTKTILELACGT
FT                   GIQAVRFAQKGYEVTGLDLSYEMLELAQKKAEAAGVMMELAQADMMALEGVGDFDAVTC
FT                   YSDSLCYMSDREAVLRVFEGVHSVLNQGGTFLFDVHSIYQMEEVFAGYSYHENYEDFAF
FT                   VWDTYEGEHAHSIVHELTFFVKDEASQEERFIRRDEVHEERTYPIETYVELLKEAGFAS
FT                   VEVFADFEDEAPTETSQRWFFKCKK"
FT   misc_feature    362215..362511
FT                   /locus_tag="SSUBM407_0332"
FT                   /note="HMMPfam hit to PF08241, Methyltransf_11, score
FT                   4.8e-16"
FT                   /inference="protein motif:HMMPfam:PF08241"
FT   CDS_pept        362939..366991
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0333"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0344"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55165"
FT                   /db_xref="GOA:A0A0H3MTI5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTI5"
FT                   /protein_id="CAZ55165.1"
FT                   /translation="MESLHRKISNWGQKIFLQFKNRTPNVEGISFNRLTSNKNIDLERE
FT                   NPSFKQALDFAIQDDELKNVAITGNYGSGKSSLLDSYEAKYSNKKFLHISLADYKENDL
FT                   SGYKENDSSESGKKLNVRQINVIEGKIINQLLHQIHPKHVKKSIFKTLSRTPRRIPLLL
FT                   TVYIVLFFITLSYFLKPNFLKALVTADKVFGWDANTVFSWLFLILLFIGSLTTIWYIVE
FT                   NKTIKSLTIGGKNVSSEIDIFSDQSMRVSYFDKYLDDVLYLLNESRADVIVFEDIDRFE
FT                   NNTIFAKIKELNVLVNNKRKIAKKSSKLVFLYLIRDDLFISKERTKFFDFIIPVLPVIT
FT                   SSNSSDKLTTTLKEMGIKSGLADDFLFRISLYIDDMRLLNNICNEFYSYQLELTHDKTG
FT                   EKNALDLDLKKIFAMIVYKNIFPKDFSELQNNQGFLYSLFNEKEVRRSEKLTKIDSEKL
FT                   HLENKLRKIQSEHIQDEIELYGTIFKIPNGRKVVSVNDKFQDEFTSYHDFISEMLVEGS
FT                   RIISYVDFDDAYRNVGIKTENMDSIFPEKDSPEFKERLDTVRSRNNSKELQQKIASLNQ
FT                   KRSFVEKQLIADIYTNQEIHEFAKSREEFIDIEKNQQFDIIYFLLKNSYIDETYPDYLT
FT                   YFYGNVLTKNDKEFLRNISSGRGAGFDFRLVNISNIYHHLQLKDFRNEEVLNFDLIEYM
FT                   LKNLELQSREENLSAILLQEDNLDFLVELAKKLYDSKSEKYNLEQFGQLMEFWLSTNPQ
FT                   RFIDYMKSTKVEYQAPLKNKFIRALMNQVNLDSVDNEIKALVARYINENNDLISPNEDF
FT                   TSFFKTNLKAINLKFTHFREPDDDAPRTTTFLELIDFIFGNSLYEINKENLRFFMRWFK
FT                   GSTDWSEEDFKHKNFELLHTNDNYSPLLEYSRLKITDYVYAYLEICEGTILDNSEYIVE
FT                   LLQRNEVYESGFNLGTLEEERQIDRILQFLPDNSINFNSDDFRQLVEEDILEEGNYLTL
FT                   LSLLVQTSKAVVDTDIILSYFTENQNYDNSLINFINNARDLKFEEDIFNLLEKEEQRNF
FT                   FTKTVECMELDDTKYELILSTLGWHYTDTFNKSGIESSKLRILIDLEIIQFNSKNIEFF
FT                   RDNYPEDTLYLIKKHLSEYLDTKSKIYKEDELLALLDDDIISDDEKTNIADHILKISIK
FT                   NKQYSEKLTAHILENQFDEEDLSYIISSQFFDNQSLSLKELVKQIAIENLDTIAEEFYA
FT                   QISNNLMRKLIAESQLNTLKKLIYNYYVYTPNLDENEKREQFSKYLNLFALSDNITALK
FT                   ELNVFDEWDSVLKTLNKPGTRWGQVQKTTINLAFARYLDSNNFVSSINERSNDIRLNSY
FT                   KDKTIPL"
FT   misc_feature    join(363413..363472,363533..363601)
FT                   /locus_tag="SSUBM407_0333"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0333 by TMHMM2.0 at aa 159-178 and 199-221"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        367050..368141
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0345"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55166"
FT                   /db_xref="GOA:A0A0H3N253"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N253"
FT                   /protein_id="CAZ55166.1"
FT                   /translation="MSISGIIAEYNPFHTGHKYLLEQAEGLKIVVMSGNFMQRGEPAIV
FT                   DKWTRAQMALEHGADLVVEMPFLVSVQSADHFAKGAISILHRLGVEKLVFGTEEMLDYQ
FT                   KIADIYVDKSEEMENFVKNLPDNFSYPQKTQAMWQEFAGLTFTGDTPNHILALAYAKGV
FT                   AGTGIQLSPVQRQGAGFHSEEVETSYASAIAIRKGADQLDLVRDFLPSASLFEEATKVS
FT                   WRNYFPLLRYQITTHPDLSQVFQVNEELASRIRSAIGSVATVEELVEAVTTKRYTKARV
FT                   RRVLTYILINAVETPLPDAVHVLGFSARGQAYLKQVKERVGLVTRIGKEPWDSLTQQAD
FT                   LVYQLGADAMAEQTYGRVPVRVE"
FT   misc_feature    367050..368129
FT                   /locus_tag="SSUBM407_0334"
FT                   /note="HMMPfam hit to PF05636, DUF795, score 1.8e-181"
FT                   /inference="protein motif:HMMPfam:PF05636"
FT   CDS_pept        368237..368956
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0335"
FT                   /product="MerR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0346"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55167"
FT                   /db_xref="GOA:A0A0H3MTQ4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTQ4"
FT                   /protein_id="CAZ55167.1"
FT                   /translation="MKTVKEMSQLSGISVRTLHYYDEINLLTPSFIAENGYRYYDNEAF
FT                   EKLQEILLFRELEFPLKEIKKIVGNAAYDRESALKDQIRLLELKKKHLEKVIKHAKSLQ
FT                   QKGENYMNFEVFDKSDLLAFQEEAKERWGNTAAFQEFSAKTNQEGFAHISAEMSGIMME
FT                   FGKMKSLSADDSKVHKQVEVLKAYISENFYNCTNEILASLGQMYIADNRFTQFIDQVGG
FT                   EGTASFVSQAIAVYCKE"
FT   misc_feature    368243..368356
FT                   /locus_tag="SSUBM407_0335"
FT                   /note="HMMPfam hit to PF00376, MerR, score 2.4e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    368567..368947
FT                   /locus_tag="SSUBM407_0335"
FT                   /note="HMMPfam hit to PF07739, TipAS, score 1.4e-50"
FT                   /inference="protein motif:HMMPfam:PF07739"
FT   CDS_pept        369052..371586
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0347"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55168"
FT                   /db_xref="GOA:A0A0H3MTE5"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTE5"
FT                   /protein_id="CAZ55168.1"
FT                   /translation="MTKIKIISNPFHKSIVFQKQQPITEVWEEITFESNPNSRLVRENI
FT                   QKGVLSFHIQEIVDILVAEYDDGTGIDLLFEGNSDEFQELKTFVQSLNNSSISLKKSAY
FT                   SLTNARDILPEVLSIFDKTQVILPEELEHDAAIQKFQDATKPQIPLLVLGNYSAGKSTF
FT                   INSLVGYELLPASDQPTTAKIIQIEKFAEKWIEIEGTLLRNKVCIRIDEDGFEVEGDRI
FT                   DETIIKDLESIRQSLPQTTPQILARAVLAYLNAREDSDLNIITVKTAFTDSPLSKSSHR
FT                   YIIFDTPGSNSSTNMEHLQLLREAMAGMSNGLPIFISEYTSLDTVDNDKLYQELEQIDG
FT                   IDLRYTILVVNKADTAALSTFQDHQVLNQALPRKLSTKRVYFLSSLMGLGSKTSGLFQE
FT                   PDYERVYQKSLAEFTDASNPYYQQLYTYNILPTQQKLAQELQSKEERNLLYANSGLYSL
FT                   ESEIEVFSTKYAAYNKCVQADQYLQHIISQTQSIIEDSKKTIEQEKDRLEKKLEKDKLA
FT                   LVNDLKRQQADFFNSSSTVYQQNLNEKVRDEKHYAPLQLFIKERDSLWSKAVDDFQLKS
FT                   YQKEMAESPKKALNNIKNSLGKAWDKKNIEILGSAFVNGFNDTGKVFSKVDDYNKMKTK
FT                   AKGQVRDQLITFARFEYIKQVEEVGKDFTTLSIHYWKEQTGLIKDRFSQLIGDASVLSD
FT                   QKRAAIKEIIFQFQQPVLYHDSKQLFDQKSLVEGFRLGDIQIFGDANKIDLQKLEKRYN
FT                   SLLKTAYKHINEQLISHHQATFYKWVEALLHLVTENIVEFSPDLHSTNLLIQDNRVKIE
FT                   ELSTNLQNLHEYSKDLHDLMAWKDDEEVANGY"
FT   CDS_pept        371576..374914
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0348"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55169"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXS5"
FT                   /protein_id="CAZ55169.1"
FT                   /translation="MVIKKMIKKVATKAADGVSKLSELSPEQLEKVQAQMATYRDQIPD
FT                   LSGEAAEEYFRKQLAIAGVEVYNAYLPQLKDLYLPIDNKTEFRLEDEGVLIDEGEFKSG
FT                   YNIRYINITKWVTDKQENSLEKLVSVYEVLSTTPCNISLVFHRKQEETSVYLAVTNTEN
FT                   ADSNADVDSYRKRLVSAIKGNFPGAAWKEEVGRGSLPCFEDYIPYSVATASNIPTEKSE
FT                   KFISQTIEKLLDGIVPENKEQEYILVLLATPVLDVTDRKLHLSQIYSNLSPYATWQTQF
FT                   QLTESDSRGSSATVGVNIGASVGSQTGHNLTQTHSQGQTESRGTSETETNTKGSGWQAG
FT                   VNIKILNGGHNWNKSKSIAKGITNTIGKTASVANAVGKTVSSSLGANFGANFARTSSVT
FT                   ATIGKNEGISQSFVNHHVQHALKNLDKQMERLELSTALGLWDFSAYVLSEDPTIANNVA
FT                   HSYLALTQGEESHLSQTVVNLWRGDVQMERDKAKALTAYLRDLRHPLFGFNPEILEIDE
FT                   EFAVYPEIVTAATPLSGKELAYALNFPQKSIAGLPVLECAQFGRNISTFEEKDDQEQLP
FT                   LGNIFHMNHEENTAVQLSLPSLASHTFITGSTGTGKSNTVYQLLAQAREKGIKFLVVEP
FT                   AKGEYKQVFGSDEDVAVFGTNPTITPLLKINPFSFPEGIHILEHLDRLVELFNVCWPMY
FT                   AAMPAVLKKAIEQAYQDCGWDLISSVNTYSKTIFPTFADVLRTIREIIDSSEYDNDNKG
FT                   AYKGALLTRLESLTTGIYQLMFTEDEISSEKLFDENVIVDLSRLGSSETKSLIMGLLIL
FT                   KMQEYRMVSSQGMNQQLRHVTVLEEAHNLLKRTSTEQATESSNLLGKSVEMLTNAIAEM
FT                   RTYGEGFIIADQSPGLLDLAVIRNTNTKIILRLPEYSDRELVGKSANLNEEQINELAKL
FT                   PKGVAAVYQNEWLEPVLCKVAKYDSTEMVFQQPTQLVRTESPYHRLAILELLTTSPNLD
FT                   STLSFEELQELTLAVGLDSLTQVRIFNFLRTTSPDNFSMHELAHILGKVYPELVEKIRL
FT                   KAEKGLEPPALTQVLQQEIDSSIPETISEQARRDLVQGLMTCYYLFELKDHKAMQDWLR
FT                   NGDLI"
FT   CDS_pept        374911..375510
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0349"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55170"
FT                   /db_xref="InterPro:IPR026834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTJ1"
FT                   /protein_id="CAZ55170.1"
FT                   /translation="MIEGLKTVAEAVKPVVNEVGKRAIDAFEKPIDSDKRLEAASDNKT
FT                   TFRYDGLSKPQEFLAQAQGFPKEIAKDIYNSQELKHYMDIGMRAVQFGQKENGEPRFCL
FT                   IPKDLSFDRVVDSQGRTNAERLQSGLLPIKDGQPLEVHHIGQKNGGHYALLTKEEHIKN
FT                   GNKEMLHKPGKSDVDHSLDFARDKRSITKVLMEEQV"
FT   CDS_pept        375507..375917
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0350"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55171"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N258"
FT                   /protein_id="CAZ55171.1"
FT                   /translation="MSQLVDKIKVVQGLYSGSPASEQEVAVAESKLQLIFPAEYKDYLK
FT                   EYGVISFYGTEWNGLKGDTWTDVVATTLEARSLYENFPKEKFILEDLHFDDMLVLADST
FT                   GKVFLWHNGLEKEIHSSIASYLEECVARKDTP"
FT   CDS_pept        375914..376324
FT                   /transl_table=11
FT                   /gene="fms"
FT                   /locus_tag="SSUBM407_0340"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0351"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55172"
FT                   /db_xref="GOA:A0A0H3MTR0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTR0"
FT                   /protein_id="CAZ55172.1"
FT                   /translation="MIQPIMKDIFFLQQKSEPATQLDVQVGQDLQDTLAANAHACVGMA
FT                   ANMIGVKKRIIIVNMGFTNLVMYNPVLISKAKPYQTEEGCLSLEGTRPTTRYQEIEVEF
FT                   FDASWKKISLKLTDFQAQIVQHELDHLEGIII"
FT   misc_feature    375929..376321
FT                   /gene="fms"
FT                   /locus_tag="SSUBM407_0340"
FT                   /note="HMMPfam hit to PF01327, Pep_deformylase, score
FT                   2.8e-12"
FT                   /inference="protein motif:HMMPfam:PF01327"
FT   CDS_pept        376629..378728
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="SSUBM407_0341"
FT                   /product="putative ATP-dependent protease ATP-binding
FT                   subunit ClpL"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0352"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55173"
FT                   /db_xref="GOA:A0A0H3MTF0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTF0"
FT                   /protein_id="CAZ55173.1"
FT                   /translation="MNNNFNNFNNMDDIFNQLMGNMGGYSTERRRYSINGREVTPEEFA
FT                   MYRQTGRLPQTEEVAQTQAKGQIKSDGILAKLGRNLTQDAREGKLDPVIGRNKEIQETS
FT                   EILARRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAGTQ
FT                   YRGAFEENVQNLVDEVKKAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSRGE
FT                   LTVIGATTQDEYRNTIHKNAALARRFNEVKVNAPSAEDTYQILKGIKPLYEAHHNIELP
FT                   DEVLRAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDIQTLEAEMAEAKQLQL
FT                   EAAEKEDYEKALNEKVRIDKLQKQIDNHTEQQKVVATVNDVAQAVERMTGIPVSQMGAS
FT                   DIERLKELKNRLAANVIGQDDAVEAVSRAIRRNRAGFDDGNHPIGSFLFVGPTGVGKTE
FT                   LAKQLALDLFGNKDAIIRLDMSEYSDRTAVSKLIGTTAGYIGYDDNSHTLTERVRRNPY
FT                   SIVLMDEIEKADPQVITLLLQVLDDGHLTDGQGNQVNFKNTIIIATSNAGFGYGMAEGE
FT                   ENQDIMDRIAPFFRPEFLNRFNAVIEFKHLDKDDLKAIVELLLAQVNNTLAKKGIQLTV
FT                   TEAAKEFLMEEGYDKAMGARPLRRVIENQIRDKVTDFYLDHVDVKYLEADVVDGSIQIK
FT                   EQSFA"
FT   misc_feature    376968..377432
FT                   /gene="clpL"
FT                   /locus_tag="SSUBM407_0341"
FT                   /note="HMMPfam hit to PF00004, AAA, score 4.7e-18"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    377949..378428
FT                   /gene="clpL"
FT                   /locus_tag="SSUBM407_0341"
FT                   /note="HMMPfam hit to PF07724, AAA_2, score 3.6e-75"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    378054..378110
FT                   /gene="clpL"
FT                   /locus_tag="SSUBM407_0341"
FT                   /note="ScanRegExp hit to PS00871, CLPAB_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00871"
FT   CDS_pept        378911..380419
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /gene_synonym="malQ"
FT                   /locus_tag="SSUBM407_0342"
FT                   /product="putative 4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0353"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55174"
FT                   /db_xref="GOA:A0A0H3MXT0"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXT0"
FT                   /protein_id="CAZ55174.1"
FT                   /translation="MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQI
FT                   LPLTTTSYGDSPYQSFSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALI
FT                   YQVRRPILEKAVQAFLQDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWED
FT                   KKVVARNEEALDKYRLELANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVS
FT                   ADSVEVWTKPQLFKLDSERKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIY
FT                   RIHESFKLYDVLRIDHFKGFSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPI
FT                   IAEDLGNIDAKARKLLADCGYPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNE
FT                   VVNGWYNNLDPEQQEYVDAYSNRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEES
FT                   RMNMPSTIGGNWEWRMKAEDLTQERKDFLTKMTLLYQRGNENHD"
FT   misc_feature    378938..380392
FT                   /gene="malM"
FT                   /gene_synonym="malQ"
FT                   /locus_tag="SSUBM407_0342"
FT                   /note="HMMPfam hit to PF02446, Glyco_hydro_77, score
FT                   5.6e-200"
FT                   /inference="protein motif:HMMPfam:PF02446"
FT   CDS_pept        380412..382676
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="SSUBM407_0343"
FT                   /product="putative glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0354"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55175"
FT                   /db_xref="GOA:A0A0H3MTJ6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTJ6"
FT                   /protein_id="CAZ55175.1"
FT                   /translation="MTKFTTFAETNTSKKLADLTNEEIYLQLLNYVKDAAASKPKNTGK
FT                   RKVYYISAEFLIGKLLSNNLINLGVYKDVQAELAAAGKSLAQVEDVEPEPSLGNGGLGR
FT                   LASCFVDSMSTLAINGEGVGLNYHCGLFRQVFKKNEQEAEPNFWIENDSWLIPTTISYD
FT                   VPFKNFTLKSKLDRLDILGYKKETKNYLNLFDIESVNYDLITDGISFDKTDIKENLTLF
FT                   LYPDDSDKNGELLRIYQQYFMVSNAAQLLIDEAIERGSNLHDLADYAYVQINDTHPSMV
FT                   IPELIRLLTEKHGIEFAEAVAIVKNMTGYTNHTILAEALEKWPLEFLEEVVPHLVDIIK
FT                   ELDALIRAEIKDPAVQIIDESGRVHMAHMDIHFSNSVNGVAALHTEILKNSELKAFYEL
FT                   YPEKFNNKTNGITFRRWLEFANQDLADYIKELIGDEYLTDATKLEKLLAFADDKEVHAK
FT                   LAEIKFNNKLALKRYLKDNKGIELDENSIIDTQIKRFHEYKRQQMNALYVIHKYLEIKN
FT                   GNLPKRKITVIFGGKAAPAYIIAQDIIHLILCLSELINNDPEVNKYLNVHLVENYNVTV
FT                   AEKLIPATDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELAGMDNIYTF
FT                   GKDSDTIIDLYDKAGYVSADYYNGDANIKRAVDFIVSDEVKALGNEERLGRLHHELISK
FT                   DWFMTLIDLAEYIEVKEQVFADYEDQDSWNKKVVHNIAKAGFFSSDRTIEQYNEDIWHS
FT                   N"
FT   misc_feature    380643..382667
FT                   /gene="glgP"
FT                   /locus_tag="SSUBM407_0343"
FT                   /note="HMMPfam hit to PF00343, Phosphorylase, score
FT                   2.3e-190"
FT                   /inference="protein motif:HMMPfam:PF00343"
FT   misc_feature    382197..382235
FT                   /gene="glgP"
FT                   /locus_tag="SSUBM407_0343"
FT                   /note="ScanRegExp hit to PS00102, PHOSPHORYLASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00102"
FT   CDS_pept        complement(382904..383611)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0344"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0355"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55176"
FT                   /db_xref="GOA:A0A0H3N263"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N263"
FT                   /protein_id="CAZ55176.1"
FT                   /translation="MSKYKKVYQDIKKKIEEQVWSTGQALPTENELMEVYSYSKDTIRK
FT                   ALSLLEMDGYIQKKQGKSSIVIEHGLMKDQYLSEIKTAGELNKRSQHQIQTQLTSLYII
FT                   QGQEDLMSTFEVDDKVDFYRVSRVRTIDGERLEYDISYFDRRVVPYLSKEIAESSIYRY
FT                   LEEELHLTISHSRREISFRFANEEEKQLMDLGDYDMVVVVTSITYLSNGQAFQYGTISY
FT                   RPDKVSFVSMAKR"
FT   misc_feature    complement(382928..383344)
FT                   /locus_tag="SSUBM407_0344"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 2.8e-30"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   misc_feature    complement(383414..383605)
FT                   /locus_tag="SSUBM407_0344"
FT                   /note="HMMPfam hit to PF00392, GntR, score 5.4e-17"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   CDS_pept        383810..384601
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0345"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0356"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55177"
FT                   /db_xref="GOA:A0A0H3MTR5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTR5"
FT                   /protein_id="CAZ55177.1"
FT                   /translation="MKLLTINVHAWLEERQDEKLDVLAQTIAEKAYDVIALQEVNQLIT
FT                   ADLVTKDLKADNYGLILLEKLRTLGQFDYSYYWSNSHIGYDKYEEGIAFLTKLPVYEVD
FT                   QFYCSQNKSIDSILSRKIMGLTVFYQDQLIDLYSCHINLPGSEEEDQLDNIRTIVERTG
FT                   NRRFKILMGDFNTDAFSDREAYEAITELGLYDSYNLAMEKDQGITVEKAIDGWAGHSQE
FT                   KRLDYIFLNQKKEVLSSLVIFNGENRPIISDHFGVEVEINV"
FT   misc_feature    383810..384592
FT                   /locus_tag="SSUBM407_0345"
FT                   /note="HMMPfam hit to PF03372, Exo_endo_phos, score
FT                   1.9e-11"
FT                   /inference="protein motif:HMMPfam:PF03372"
FT   CDS_pept        384635..386803
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0346"
FT                   /product="putative glucose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0357"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55178"
FT                   /db_xref="GOA:A0A0H3MTF6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTF6"
FT                   /protein_id="CAZ55178.1"
FT                   /translation="MKKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPESE
FT                   LLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHFFG
FT                   VTTDMLADAAATVTTVFGTEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYN
FT                   YRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPI
FT                   LAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGAQAGTQVFGQDPLWLAWIT
FT                   DLINLKDAGDMAQYNDLLANITPARFKVGQMIGSSGILMGLTYAMYRNVDEDKKHKYKG
FT                   MFISSALAVFLTGVTEPIEFMFMFAAMPLYVVYAFVQGAAFAMADIVNLRMHSFGNIEF
FT                   LTRTPMAIKAGIGMDVINFIWVTALFAVGMYFIANFMIKKFNLATAGRNGNYDTETTDV
FT                   VSNSNVDTADANSQVVQIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGA
FT                   MGLIIKDSGVQAVYGPKADVLKSDIQDLLESGVAIPRTEIVATEEVAPETQFKGVTETV
FT                   YSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILS
FT                   DKGVEVLVHVGLDTVALNGAPFSTKVTDGQRVEAGDLLLVADLEAIRSAGRETTIVVAF
FT                   TNTAEIKSVSLENLGQVSQDSQVATVEL"
FT   sig_peptide     384635..384742
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="Signal peptide predicted for SSUBM407_0346 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.944) with
FT                   cleavage site probability 0.452 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    384674..385768
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="HMMPfam hit to PF02378, PTS_EIIC, score 1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    join(384680..384748,384791..384859,384878..384946,
FT                   384974..385042,385061..385129,385172..385240,
FT                   385646..385699,385712..385780,385877..385945)
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SSUBM407_0346 by TMHMM2.0 at aa 16-38, 53-75, 82-104,
FT                   114-136, 143-165, 180-202, 338-355, 360-382 and 415-437"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    386051..386155
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="HMMPfam hit to PF00367, PTS_EIIB, score 5.2e-16"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    386087..386140
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="ScanRegExp hit to PS01035, PTS_EIIB_TYPE_1_CYS,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS01035"
FT   misc_feature    386345..386743
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="HMMPfam hit to PF00358, PTS_EIIA_1, score 5.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    386546..386584
FT                   /locus_tag="SSUBM407_0346"
FT                   /note="ScanRegExp hit to PS00371, PTS_EIIA_TYPE_1_HIS,
FT                   score 8e-5"
FT                   /inference="protein motif:Prosite:PS00371"
FT   CDS_pept        complement(386874..387500)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0347"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0358"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55179"
FT                   /db_xref="GOA:A0A0H3MXT5"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXT5"
FT                   /protein_id="CAZ55179.1"
FT                   /translation="MIRHKLFTSLQEEEHWINSIQSEGYQLVKVTPWTATYHFEKCSRT
FT                   PHPVRLDFHEHIAKGEYSNYLSLFEDCGWQPIQGSRRCGIHYFQQTIETSSTEIFSDTE
FT                   SKKAFYSRYQNYAYSYFGLFLTLFFIHYQVGLQNGYTLWNPKSWYLTPGLWERTGTSFW
FT                   FGFLFETPFALFRSGIIPLFFLAWSIYFLHIAEKGKKEAKKLEKY"
FT   misc_feature    complement(join(386919..386987,387096..387155))
FT                   /locus_tag="SSUBM407_0347"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0347 by TMHMM2.0 at aa 116-135 and 172-194"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(387511..387822)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0348"
FT                   /product="PadR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0359"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55180"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK1"
FT                   /protein_id="CAZ55180.1"
FT                   /translation="MKRNKHLPLTETTYYILLALLEPAHGYHIMQKVEDMSDGDVKIAA
FT                   GTMYGAIENLLKLKWICSVPSSDKRRKVYQVTATGQEIIKLETQRIQKLHHIAKELGF"
FT   misc_feature    complement(387577..387807)
FT                   /locus_tag="SSUBM407_0348"
FT                   /note="HMMPfam hit to PF03551, PadR, score 3e-08"
FT                   /inference="protein motif:HMMPfam:PF03551"
FT   CDS_pept        387983..388699
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0360"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55181"
FT                   /db_xref="GOA:A0A0H3N268"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N268"
FT                   /protein_id="CAZ55181.1"
FT                   /translation="MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETNS
FT                   ALKFVIDRAKQAQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRSAFGKNGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDDVEA
FT                   EDGTITVYTAPTDLHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKLYDAL
FT                   EDDEDVQKIYTNVDGF"
FT   misc_feature    387989..388690
FT                   /locus_tag="SSUBM407_0349"
FT                   /note="HMMPfam hit to PF01709, DUF28, score 7.7e-130"
FT                   /inference="protein motif:HMMPfam:PF01709"
FT   CDS_pept        389200..390048
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0361"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55182"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTS2"
FT                   /protein_id="CAZ55182.1"
FT                   /translation="MSNNLLVLQSDFGLVDGAVSAMIGVALQESRDLVVHHLTHDITPY
FT                   NIFEGSYRLFQTVEYWPEGTTFVSVVDPGVGSKRKSVVALTEQNHYIVTPDNGTLSFIK
FT                   KYVGIKAVREISEVANRRANTEHSYTFHGRDVYAYTGAKLASGHISFEEVGPELSVDKI
FT                   VEIPTVPTEVGSDYVKGAIDILDVRFGSLWTSITREEFYTLQPQFEDRFEVTIYNNDML
FT                   VYQNQVTYGKSFADVRIGQPLIYINSLYRVGVAINQGSFAKAYNVGVGQNWHIEIKRIS
FT                   N"
FT   misc_feature    389212..390033
FT                   /locus_tag="SSUBM407_0350"
FT                   /note="HMMPfam hit to PF01887, DUF62, score 5.8e-76"
FT                   /inference="protein motif:HMMPfam:PF01887"
FT   CDS_pept        390069..390614
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0351"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0362"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55183"
FT                   /db_xref="GOA:A0A0H3MTG0"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTG0"
FT                   /protein_id="CAZ55183.1"
FT                   /translation="MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQS
FT                   LLAVVFGPVVGFLVGFIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFE
FT                   GKDILFFNLVQIAANVLAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTL
FT                   LLVVYAKSQTKTGSLSKD"
FT   misc_feature    390075..390611
FT                   /locus_tag="SSUBM407_0351"
FT                   /note="HMMPfam hit to PF07155, DUF1393, score 4.2e-120"
FT                   /inference="protein motif:HMMPfam:PF07155"
FT   misc_feature    join(390096..390164,390201..390260,390288..390341,
FT                   390390..390458,390501..390569)
FT                   /locus_tag="SSUBM407_0351"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SSUBM407_0351 by TMHMM2.0 at aa 10-32, 45-64, 74-91,
FT                   108-130 and 145-167"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        390722..391642
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0352"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0363"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXT9"
FT                   /protein_id="CAZ55184.1"
FT                   /translation="MVWTEEKLGPIIHSILNPDEEVLSLYQSKTTKSIYGCILWNNYYY
FT                   KVFRVSNHPSQSTYKQPTFYDFHGEFYMKGAIRTYLYHTNSWYELSKQGYYLLLFFQKL
FT                   WDEKQEVEASWQNGRMQIRLVVEEEGWQVHYRFPDNQAREVERLLGSGMLVAIRSSRNF
FT                   IKIRTSRFVAPYIALIKQRQLYRKKPSKAMLQWEKYQSQLIEIQRTYRLVEESAPQTFF
FT                   GHWLNKVQLYLCSAIASYWEEVIKGVEWQEAREIKEQRKAEKPHNPIEDKWKENIARRH
FT                   KRKMDQLIGHDTLEKLRQLKTELDD"
FT   CDS_pept        391855..392838
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0364"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55185"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK6"
FT                   /protein_id="CAZ55185.1"
FT                   /translation="MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADEG
FT                   INGTVSGDYETTQKYMDYVHANPLFSDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVR
FT                   GELWDGKMYVFDERIAVDVNHVNPVVVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   HKYVRGCSAECRAHERNRYISENGLTRQEWAERLEAIGETLTPANA"
FT   misc_feature    392215..392508
FT                   /locus_tag="SSUBM407_0353"
FT                   /note="HMMPfam hit to PF00581, Rhodanese, score 6.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00581"
FT   repeat_region   complement(392978..393076)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        join(393063..393092,393096..393407)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0354"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0365"
FT                   /note="CDS contains a nonsense mutation (opal) after codon
FT                   10, and lack a translational start codon. Similar to
FT                   Staphylococcus aureus (strain Mu50/ATCC 700699)
FT                   hypothetical protein UniProt:Q99R63 (EMBL:BA000017) (125
FT                   aa) fasta scores: E()=3.4e-06, 34.513% id in 113 aa"
FT   CDS_pept        393525..395198
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0355"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0366"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55187"
FT                   /db_xref="GOA:A0A0H3N273"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N273"
FT                   /protein_id="CAZ55187.1"
FT                   /translation="MKKIIEFKDFTFKYQAQQEPTLKDIQLTIYQGEKVLIIGPSGSGK
FT                   STIGQCLNGIIPNIYKGEHSGSLLLDGQEAFNLSVYDKSLLVSTVLQDTDGQFIGLSVA
FT                   EDLAFALENDMESQVVMKQKVGDWAERLSLTDLLAHRPQDLSGGQKQRVSLGGVLIDES
FT                   PILLFDEPLANLDPKSGQDTIDLIDRLHKQEGTTTIIIEHRLEDVLYRQVDRVVLINDG
FT                   RILFNGGPDDLLRTSLLQENGIREPLYLSTLRALGYPIAQAERLSSVWEIDIEALNIAS
FT                   LPTLHFENGEKEALLEVKHLYFSYPNKQVLTDIQLTIHKGERLAIVGKNGAGKSTLAKV
FT                   LCGFIQGEGEILWKGQSIKEDSVKERAERIGYVLQNPNQMISQTMIFDEVALGLRMRGV
FT                   TEEEIEHRVHHILKVCGLYPFRNWPISALSYGQKKRVTIASILVLNPEIILLDEPTAGQ
FT                   DQRHYREMMEFLDQLNAQGHTIVMITHDMQLMLDYSDRAVVVVDGQIIEDASPAEILSD
FT                   DTVIERANLKETSIFHLAERVGVNPLELTTFYMQEERRGR"
FT   misc_feature    393618..394190
FT                   /locus_tag="SSUBM407_0355"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 2.4e-33"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    393957..394001
FT                   /locus_tag="SSUBM407_0355"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    394485..395033
FT                   /locus_tag="SSUBM407_0355"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 3.5e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    394806..394850
FT                   /locus_tag="SSUBM407_0355"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    395055..395129
FT                   /locus_tag="SSUBM407_0355"
FT                   /note="ScanRegExp hit to PS00963, RIBOSOMAL_S2_2, score NA"
FT                   /inference="protein motif:Prosite:PS00963"
FT   CDS_pept        395195..396028
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0356"
FT                   /product="putative transport protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0367"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55188"
FT                   /db_xref="GOA:A0A0H3MTS8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTS8"
FT                   /protein_id="CAZ55188.1"
FT                   /translation="MSQQKLIGYHPGTGLIHSLSAVSKLLFFLIVSILAMITYDTRLIL
FT                   FIAVFSLALFKMSGIRYKEISLVLILTIIFAAMNALMVHLFAPRYGVELYGADTPLLSG
FT                   LGVYSLTSQQAFYLVNLLLKYFCTVPLAIIFLMTTHPSQFASSLNQIGVSYKVAYAVSL
FT                   TMRYIPDIQEEFYTIRMSQEARGLELSKKGKLMDRIKGNLSLVIPLIFSSLERIDTIST
FT                   AMELRRFGKNKKRTWYTQQPLQRIDYAVLLFILALVVVTIYLFFVNQGRFYNPWR"
FT   misc_feature    395228..395908
FT                   /locus_tag="SSUBM407_0356"
FT                   /note="HMMPfam hit to PF02361, CbiQ, score 2.9e-21"
FT                   /inference="protein motif:HMMPfam:PF02361"
FT   misc_feature    join(395237..395305,395387..395455,395537..395605,
FT                   395936..395995)
FT                   /locus_tag="SSUBM407_0356"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0356 by TMHMM2.0 at aa 15-37, 65-87, 115-137 and
FT                   248-267"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        396188..396391
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0357"
FT                   /product="cold shock protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0368"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55189"
FT                   /db_xref="GOA:A0A0H3MTG4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTG4"
FT                   /protein_id="CAZ55189.1"
FT                   /translation="MVQGTVKWFNAEKGFGFIAQENGPDVFAHFSEIQSNGFKSLEDGQ
FT                   KVTFEVEQGQRGLQATNITKIG"
FT   misc_feature    396188..396385
FT                   /locus_tag="SSUBM407_0357"
FT                   /note="HMMPfam hit to PF00313, CSD, score 1.5e-40"
FT                   /inference="protein motif:HMMPfam:PF00313"
FT   misc_feature    396230..396286
FT                   /locus_tag="SSUBM407_0357"
FT                   /note="ScanRegExp hit to PS00352, COLD_SHOCK, score NA"
FT                   /inference="protein motif:Prosite:PS00352"
FT   CDS_pept        complement(396433..397146)
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SSUBM407_0358"
FT                   /product="methyltransferase GidB"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0369"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55190"
FT                   /db_xref="GOA:A0A0H3MXU3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXU3"
FT                   /protein_id="CAZ55190.1"
FT                   /translation="MKPEVFYKTLADQGIQLTDQQKHQFHRYFQLLVEWNEKINLTAIT
FT                   EESEVYLKHFYDSIAPLLQGHIQNEPLRLLDIGAGAGFPSLPMKIIFPQLDVTIIDSLN
FT                   KRINFLHLLAEELELEGVHFYHGRAEDFAQDKNFRAQFDLVTARAVARMQILSELTIPY
FT                   LKLHGKLIALKASSAEDELTQAKNALNLLFAKVIENHDYTLPNGDPRTLTIVEKKKETP
FT                   NKFPRKAGMPNKRPL"
FT   misc_feature    complement(396511..397086)
FT                   /gene="gidB"
FT                   /locus_tag="SSUBM407_0358"
FT                   /note="HMMPfam hit to PF02527, GidB, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF02527"
FT   CDS_pept        complement(397205..399391)
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUBM407_0359"
FT                   /product="putative penicillin-binding protein 1A"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0370"
FT                   /note="Possible alternative translational start site after
FT                   codons 1 and 4"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55191"
FT                   /db_xref="GOA:A0A0H3MTK9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK9"
FT                   /protein_id="CAZ55191.1"
FT                   /translation="MVNLLKTTTIKKALLITANILLAGAIIACLAGAALVVYYIQSAPE
FT                   LTEESLTATVSSKIYDKNGNLIADLGAEKRSSAKTEEIPTDLVNAIVAIEDQRFFNHRG
FT                   VDVIRIAGSLINNLSGGRLQGGSTLDQQFIKLTYFSTSVEDQNLKRKIQEAWLATQLER
FT                   RNTKQEILTYYINKVYMSNGNYGMKTAALAFYGKELKDLTLPQLALLAGMPQAPNQYDP
FT                   YTNPEDAKARRDLVLAEMLEEKYIDNTQYEQAVLTPVTDGLQPLSNAAAYPAYMDNYLK
FT                   QVVEEVEAKTGYNLLTTGMDVYTNVDPAAQQQLWNIYNTDMYVSYPDDLLQVASTVVDV
FT                   SNGKVVAQLGGRKQETNVSFGTNQAVETNRDFGSTMKPITDYAPAFENGIYTSTADLIL
FT                   DGPYNYPGTPTPVNNWDKQYYGNISVKTAIQYSRNVTAVKALEATGLENALKFLNSVGI
FT                   NYPDIHYSNAISSNTSDTSSKYGASSEKMAAAYAAFANGGTYYAPQYVNKIVFSDGTVT
FT                   EYAPKGTKVMSAETAYMMTDMMKAVMSYGYGLNASVSGVPMAGKTGTSNYTDSETDTIL
FT                   ASIPEANYSYMVVPDENFVGYSSQYAMAVWTGYTNRMTPILDNSMRIATDVYHNMMLFM
FT                   HSDYTATDWEMPSGLVRYGSNYYLRGSRSLSNAYNTYTSSSTSSSSSTETSETTEATTT
FT                   SSETSSGTATETATSSTETATTGNNPATGQTDGQ"
FT   misc_feature    complement(397700..398395)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUBM407_0359"
FT                   /note="HMMPfam hit to PF00905, Transpeptidase, score
FT                   8.5e-28"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(398714..399223)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUBM407_0359"
FT                   /note="HMMPfam hit to PF00912, Transgly, score 1.2e-80"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    complement(399287..399355)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUBM407_0359"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0359 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(399293..399391)
FT                   /gene="pbp1A"
FT                   /locus_tag="SSUBM407_0359"
FT                   /note="Signal peptide predicted for SSUBM407_0359 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.999) with
FT                   cleavage site probability 0.978 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(399360..399977)
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SSUBM407_0360"
FT                   /product="putative recombination protein U homologue"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0371"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55192"
FT                   /db_xref="GOA:A0A0H3N278"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N278"
FT                   /protein_id="CAZ55192.1"
FT                   /translation="MVNYPHKVSKKINRTSPISSQRVNFANRGMSFEAAINDSNQYYLA
FT                   HDIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVFKRHYIDFEAKETRQ
FT                   KASMPMKNFHAHQIEHMKQVVKQGGICFVLLHFSTLKETYLLPATHLIEFYQVDMGSKS
FT                   MPLTFIRQYGFEIQMGRFPSIPYLEIVEKNLLGGESFENYNN"
FT   misc_feature    complement(399399..399899)
FT                   /gene="recU"
FT                   /locus_tag="SSUBM407_0360"
FT                   /note="HMMPfam hit to PF03838, RecU, score 7.4e-112"
FT                   /inference="protein motif:HMMPfam:PF03838"
FT   CDS_pept        400043..400582
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0372"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55193"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTT1"
FT                   /protein_id="CAZ55193.1"
FT                   /translation="MDTKSLLVTGYRHTDLGIFSEKDPRLHIIKSAIRRNFIRFLEEGV
FT                   SWFILTGQLGFEYWSLEVLEDLRAEGYQLSIATIFPFENHGEQWNEANQAKLARFKQVD
FT                   FVKYAYPRYENPGQFRDYNQFLLDNTTGCYLFYDSENETNLKYLYHMVLKKEGYNRKTL
FT                   TFEELNEEAENFSNSE"
FT   misc_feature    400043..400564
FT                   /locus_tag="SSUBM407_0361"
FT                   /note="HMMPfam hit to PF06908, DUF1273, score 6.3e-99"
FT                   /inference="protein motif:HMMPfam:PF06908"
FT   CDS_pept        400653..400988
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0362"
FT                   /product="DivIVA protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0373"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55194"
FT                   /db_xref="GOA:A0A0H3MTG8"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTG8"
FT                   /protein_id="CAZ55194.1"
FT                   /translation="MASIKFTTKDIFEQDFKIGFRGYDQDEVNDFLDDIMKDYDAYEAI
FT                   IKELKGEIARLKAQAANSPKTTLPTEESNDVLRTERPSSATNFDILRRLNRLEKEVFGK
FT                   QIVQDQE"
FT   misc_feature    400653..400985
FT                   /locus_tag="SSUBM407_0362"
FT                   /note="HMMPfam hit to PF05103, DivIVA, score 2.2e-16"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        401127..401494
FT                   /locus_tag="SSUBM407_m0002"
FT                   /note="RNase P class B (RF00011) as predicted by Rfam,
FT                   score 350.89"
FT   CDS_pept        401545..402711
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0363"
FT                   /product="putative RNA methylase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0374"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55195"
FT                   /db_xref="GOA:A0A0H3MXU8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXU8"
FT                   /protein_id="CAZ55195.1"
FT                   /translation="MKKQFELIATAAAGLEAVVGREIRNLGYECQVENGRVRFQGDVKS
FT                   IIETNIWLRSADRIKIIVGQFPAKTFEELFQGVFNLDWENYLPLGCKFPISKAKCVKSK
FT                   LHNEPSVQAISKKAVVKKLQKHFSRPEGVPLQEMGAEFKIEVSILKDVATVMIDTTGSS
FT                   LFKRGYRVEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAAMLAKNIAPG
FT                   LKRSFAFEEWPWVEDQLVVALRKEAQASIKTDLVLDITGSDIDARMIEIAKKNAFAAGV
FT                   EQDIVFKQMRVQDLRTDKINGVIISNPPYGERLLDDEAIVTLYREMGETFEPLKTWSKF
FT                   ILTSDELFETRFGQQADKKRKLYNGTLKVDLYQFFGQRVKRQVQEVQG"
FT   misc_feature    402043..402663
FT                   /locus_tag="SSUBM407_0363"
FT                   /note="HMMPfam hit to PF01170, UPF0020, score 3.1e-65"
FT                   /inference="protein motif:HMMPfam:PF01170"
FT   misc_feature    402454..402474
FT                   /locus_tag="SSUBM407_0363"
FT                   /note="ScanRegExp hit to PS00092, N6_MTASE, score NA"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS_pept        402721..404175
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0364"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0375"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55196"
FT                   /db_xref="GOA:A0A0H3MTL4"
FT                   /db_xref="InterPro:IPR030858"
FT                   /db_xref="InterPro:IPR040532"
FT                   /db_xref="InterPro:IPR041295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTL4"
FT                   /protein_id="CAZ55196.1"
FT                   /translation="MGEKNSHHLPLDEEKVLDFEVAKDLTIEEAVKKHKEIEAGVTEDD
FT                   GLLDRYIKQHRAEIESQKFETKINHLPLVEVADEEKNQGHESAEEVEANESSLTEVSEE
FT                   IAPIVEELSVTPMETLEETVIASTVAMEGLSSVADDSSLELEEDETEDLDHSEGADRDQ
FT                   KKKFYFWSAVGLSMIGVMATALVWMNSVNKSNTATSSSSTSTSQTSSTASSSTDANVTA
FT                   FEQLYNSFFTDSSLTKLKNSEFGKLAELKVLLEKLDKNSDSYTKAKEQYDHLEKAIAAI
FT                   QAINGQFDKEVVVNGEIDTTATVKSGESLSATTTGISAVDSLLASVVNFGRSQQEVASA
FT                   TVASEAAVTRNQGADETVSTGVPATTEVASTTVSGSTTDFGIAVPAGVVLQRDRSRVPY
FT                   NQAMIDDVNNEAWNFNPGILENIVTISQQRGYITGNQYILEKVNIINGNGYYNMFKPDG
FT                   TYLFSINCKTGYFVGNGAGHSDALDY"
FT   misc_feature    403219..403287
FT                   /locus_tag="SSUBM407_0364"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0364 by TMHMM2.0 at aa 167-189"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(404558..405040)
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SSUBM407_0365"
FT                   /product="S-ribosylhomocysteinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0376"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55197"
FT                   /db_xref="GOA:A0A0H3N283"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N283"
FT                   /protein_id="CAZ55197.1"
FT                   /translation="MKKEVTVESFELDHTIVKAPYIRLISEEVGPKGDIITNFDIRLIQ
FT                   PNENAMDTAGLHTIEHLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDSEKIAQVIK
FT                   SSLEEIAEGITWEDVPGTTIESCGNYKDHSLHSAKEWAKLILSQGISTDAFERKPI"
FT   misc_feature    complement(404591..405028)
FT                   /gene="luxS"
FT                   /locus_tag="SSUBM407_0365"
FT                   /note="HMMPfam hit to PF02664, LuxS, score 1.6e-50"
FT                   /inference="protein motif:HMMPfam:PF02664"
FT   CDS_pept        405170..406783
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0366"
FT                   /product="putative phosphohydrolase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0377"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55198"
FT                   /db_xref="GOA:A0A0H3MTT7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTT7"
FT                   /protein_id="CAZ55198.1"
FT                   /translation="MNIITVVVTLVSALIGLVLGYFAISLKMKSAKETAELTLLNAEQE
FT                   ASNVRGRAEEQAEVILKTAERDRQTLKKELLLEAKEEARKYREEIAEEFKSERQELKQI
FT                   ESRLTERATSLDRKDDNLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKALELER
FT                   VAALSQEEAKEIILTDTRDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRISGEY
FT                   VAEQTITSVHLPDDAMKGRIIGREGRNIRTFESLTGIDVIIDDTPEVVVLSGFDPIRRE
FT                   IARMTMETLLQDGRIHPARIEELVEKHRVEMDNRIREYGEAAAYEVGAPNLHPDLIKIM
FT                   GRLHFRTSYGQNVLRHSIEVAKLAGVLAAELGENVNLARRAGFLHDVGKAIDREVDGSH
FT                   VEIGTELAKKYKENPIVINAIASHHGDVEATSTIAVIVAAADALSAARPGSRRESMEAY
FT                   IKRLQDLEEIANSFEGIKQSYAIQAGREIRIIVHPNKVTDDQITILAHDVREKIENNLD
FT                   YPGNIKITVIRETRATDVAK"
FT   misc_feature    405173..405241
FT                   /locus_tag="SSUBM407_0366"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0366 by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    405851..406030
FT                   /locus_tag="SSUBM407_0366"
FT                   /note="HMMPfam hit to PF00013, KH_1, score 1.1e-08"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   misc_feature    406226..406507
FT                   /locus_tag="SSUBM407_0366"
FT                   /note="HMMPfam hit to PF01966, HD, score 1.4e-25"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS_pept        406938..407564
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SSUBM407_0367"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0378"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55199"
FT                   /db_xref="GOA:A0A0H3MTH2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTH2"
FT                   /protein_id="CAZ55199.1"
FT                   /translation="MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQR
FT                   PGEVDGVDYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIE
FT                   VQGALQVKKKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREY
FT                   DYAVVNDEVPLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER"
FT   misc_feature    407055..407108
FT                   /gene="gmk"
FT                   /locus_tag="SSUBM407_0367"
FT                   /note="ScanRegExp hit to PS00856, GUANYLATE_KINASE_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00856"
FT   misc_feature    407058..407372
FT                   /gene="gmk"
FT                   /locus_tag="SSUBM407_0367"
FT                   /note="HMMPfam hit to PF00625, Guanylate_kin, score
FT                   1.2e-47"
FT                   /inference="protein motif:HMMPfam:PF00625"
FT   CDS_pept        407591..407902
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="SSUBM407_0368"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0379"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55200"
FT                   /db_xref="GOA:A0A0H3MXV3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXV3"
FT                   /protein_id="CAZ55200.1"
FT                   /translation="MLKPSIDTLLDKVPSKYSLVILEAKRAHELEAGAKPTQEFTSVKS
FT                   TLRALEEIESGNVVIHPDPEAKREAVRRRAEEAKRLAEEEERKIKAQIAKEKEEGEKI"
FT   misc_feature    407624..407782
FT                   /gene="rpoZ"
FT                   /locus_tag="SSUBM407_0368"
FT                   /note="HMMPfam hit to PF01192, RNA_pol_Rpb6, score 2.7e-16"
FT                   /inference="protein motif:HMMPfam:PF01192"
FT   CDS_pept        408095..410485
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SSUBM407_0369"
FT                   /product="putative primosomal protein N'"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0380"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55201"
FT                   /db_xref="GOA:A0A0H3MTL9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTL9"
FT                   /protein_id="CAZ55201.1"
FT                   /translation="MLAQIIVDVPLMQTDQAYSYRVPAELEEGLKVGVRVHVPFGKGNR
FT                   LIQGIVVDLIDEDDENSLQDLKELAEVLDYSPVLNQEQFWLADQMRKSVFSYKITLLKS
FT                   MLPSLLNSTYDKLIRPGIGLEMAEQISLFGDKEQIRFSDLDVTEQGKIMRLAQSGKILV
FT                   DYVAKDKKQIKTEKWYRVCLEKLREADISNRAKKRQQLREFLLEQSEDQLLSNLKSDYS
FT                   ADTLRYFQEKGYIEVWEEEVSRTQGVFDKVEKTQALDLNPEQAIAVREIVASIGQESQT
FT                   FLLQGVTGSGKTEVYLQVIDRVLKMGKTAIMLVPEISLTPQMTNRFISRFGQQVAILHS
FT                   GLSDGEKYDEWRKIEAGNAQVVVGARSAIFAPLTNLGVIIIDEEHEATYKQDSNPRYHA
FT                   RDVAKLRADYNRATLVLGSATPSLETRARASRGVYGRLTLNQRANPLARIPEVEVVDFR
FT                   DYIGQQEASNFTPVLIEKIREKLARKEQVVLMLNRRGYSSFVMCRDCGSVDQCPNCDIS
FT                   LTLHMDTKTMNCHYCGFQKGIPQTCPNCQSRSIRYYGTGTQKAYDELQELLPEARILRM
FT                   DVDTTKKKGAHEDLLERFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFR
FT                   SSERTFQLLTQVAGRAGRADKEGEVLIQTYNPNHYAIAFAKEQDYEGFYRYEMDIRKNL
FT                   GYPPYYFTVGLTFSHKSEEFVVKKAYETVAFLRQHLTDAIQILGPTPKPIARTHNLYHY
FT                   QIILKYRHEDRLEEVLNQILDWTQERENQDLRLIIDNEPQNMM"
FT   misc_feature    408863..409363
FT                   /gene="priA"
FT                   /locus_tag="SSUBM407_0369"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    408869..408907
FT                   /gene="priA"
FT                   /locus_tag="SSUBM407_0369"
FT                   /note="ScanRegExp hit to PS00018, EF_HAND_1, score NA"
FT                   /inference="protein motif:Prosite:PS00018"
FT   misc_feature    409856..410059
FT                   /gene="priA"
FT                   /locus_tag="SSUBM407_0369"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 7.2e-10"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        410617..411555
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SSUBM407_0370"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0381"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55202"
FT                   /db_xref="GOA:A0A0H3N287"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N287"
FT                   /protein_id="CAZ55202.1"
FT                   /translation="MTKLIFMGTPAFSATVLRGLLADGNYNILAVVTQPDRAVGRKKVI
FT                   QMTPVKEVALEYNLPVYQPEKLSGSQEMDELMNLGADGIVTAAFGQFLPTKLLNSVDFA
FT                   VNVHASLLPKYRGGAPIHYALINGDERAGVTIMEMVKEMDAGDMISSDSIAIEESDNVG
FT                   TLFEKLAVVGRDLLLQTLPAYIAGDLKPVAQNPEQVTFSPNIQPEEEVLDWNKTARQLF
FT                   NQIRGMYPWPVAHTYWQGERFKIQEAVEAEGEGSVGRVIARSKKELIIATGQGALSLKT
FT                   VQPAGKPKMTIADFLNGAGRDIAVGDQFGDQ"
FT   misc_feature    410620..411159
FT                   /gene="fmt"
FT                   /locus_tag="SSUBM407_0370"
FT                   /note="HMMPfam hit to PF00551, Formyl_trans_N, score
FT                   7.1e-38"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   misc_feature    411013..411084
FT                   /gene="fmt"
FT                   /locus_tag="SSUBM407_0370"
FT                   /note="ScanRegExp hit to PS00373, GART, score NA"
FT                   /inference="protein motif:Prosite:PS00373"
FT   misc_feature    411232..411516
FT                   /gene="fmt"
FT                   /locus_tag="SSUBM407_0370"
FT                   /note="HMMPfam hit to PF02911, Formyl_trans_C, score
FT                   2.7e-34"
FT                   /inference="protein motif:HMMPfam:PF02911"
FT   CDS_pept        411542..412855
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0371"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0382"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55203"
FT                   /db_xref="GOA:A0A0H3MTU4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTU4"
FT                   /protein_id="CAZ55203.1"
FT                   /translation="MVINKHETARSLALSVLEQVFDQGAYSNIALNKALESSRLSAQDK
FT                   GLATELVYGTVSRKITLEWYLAHFIEDREKLDTWVYYLLMLSLYQLVYLDKLPTHAVVN
FT                   EAVNIAKRKPGTDKFVNAILRKLSQDSLPKPADIKRKNKRLSVQYSVPVWLVQTLIAEY
FT                   GDERAEKIFQSLHDRNKASVRVTDGQQVERLAEELGAQHSQLSPVGLVKPHGHFAGTDY
FT                   FKEGLITIQDETSQLVAPTLDIQGDEIILDACAAPGGKTCHMASYLTDGKVYALDLYDH
FT                   KLNLIEENARRLGLADKIETKGLDASRVHEEFGPDTFDKILVDAPCSGIGLIRRKPDIR
FT                   YNKASMDFDSLKTIQLQILDSVCQSLKIGGIITYSTCTIIAKENQEVIQEFLQNHPNFE
FT                   QVTLEHPQTDIMVDGCLLITPEQYKTDGFFIGQLRRKS"
FT   misc_feature    411560..411934
FT                   /locus_tag="SSUBM407_0371"
FT                   /note="HMMPfam hit to PF01029, NusB, score 4.1e-35"
FT                   /inference="protein motif:HMMPfam:PF01029"
FT   misc_feature    412208..412843
FT                   /locus_tag="SSUBM407_0371"
FT                   /note="HMMPfam hit to PF01189, Nol1_Nop2_Fmu, score
FT                   2.3e-49"
FT                   /inference="protein motif:HMMPfam:PF01189"
FT   misc_feature    412493..412528
FT                   /locus_tag="SSUBM407_0371"
FT                   /note="ScanRegExp hit to PS01153, NOL1_NOP2_SUN, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS01153"
FT   CDS_pept        412893..413630
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0372"
FT                   /product="putative protein phosphatase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0383"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55204"
FT                   /db_xref="GOA:A0A0H3MTH7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTH7"
FT                   /protein_id="CAZ55204.1"
FT                   /translation="MEIALLTDVGQKRSNNQDYINRYKNRAGIDLVVLADGMGGHRAGH
FT                   IASEMAATDLGAAWVDTQLVTLNDVREWMVAIIDAENQKIHELGQTEEYKGMGTTLEAV
FT                   VVIDNQMIYAHVGDSRVGLIRDGEYTRLTNDHSLVGALVRAGQLTEEEAQRHPQKNIVT
FT                   QSIGQAEPIEPDIALKTLEVGDYVLINSDGLTNMIPTEDIRDIVLSDVSIESKVETLVR
FT                   FANNAGGLDNITVGLLHITEEAR"
FT   misc_feature    412896..413591
FT                   /locus_tag="SSUBM407_0372"
FT                   /note="HMMPfam hit to PF00481, PP2C, score 3.9e-06"
FT                   /inference="protein motif:HMMPfam:PF00481"
FT   CDS_pept        413630..415624
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0373"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0384"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55205"
FT                   /db_xref="GOA:A0A0H3MXV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXV7"
FT                   /protein_id="CAZ55205.1"
FT                   /translation="MIQIGKIFAGRYRIVRQIGRGGMADVYLARDLILDGEEVAVKVLR
FT                   TNYQTDQIAIQRFQREARAMAELDHPNIVRISDIGEEDGQQYLAMEYVNGLDLKRYIKE
FT                   NAPLSNDVAVRIMGQILLAMRMAHTRGIVHRDLKPQNVLLTSNGVAKVTDFGIAVAFAE
FT                   TSLTQTNSMLGSVHYLSPEQARGSKATIQSDIYAMGIILFEMLTGRIPYDGDSAVTIAL
FT                   QHFQKPLPSVREENANVPQALENVVLKATAKKLNERYKSVAEMYADLASALSMDRQNEP
FT                   RVELEGNKVDTKTLPKLSQANVETKVPHTNSSAQVSATDKGSGKKEVAKSGNKPVSKPR
FT                   PGIRTRYKVLIGAILLTVIAAGLMFFNTPRTVTVPDVSGQTVEKATEMIEVAGLEVGNI
FT                   TEEATATVDEGLVIRTSPAAKTTRRQGSKIDIVVATAALASIPDVVDKESDTARQELEA
FT                   LGFQVTIKEEYSEKVAQGLVIKTDPGANSSAEKGAKITLYVSKGVAPQVVPNVVGKSQE
FT                   NATQILQTAGFSIGTITQEYSSSVTAGQVISTDPVANTELAKGSIINLVISKGKELIMP
FT                   DLTSGNYTYSQARSQLQALGVNAESIEKQEDRSYYSTTSDIVIGQYPAAGATIDGTVTL
FT                   YVSVASTRTSSDSSAGSSTSTSTSTGSGQ"
FT   misc_feature    413663..414286
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="HMMPfam hit to PF00069, Pkinase, score 2e-62"
FT                   /inference="protein motif:HMMPfam:PF00069"
FT   misc_feature    413681..413755
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="ScanRegExp hit to PS00107, PROTEIN_KINASE_ATP, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    414023..414061
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="ScanRegExp hit to PS00108, PROTEIN_KINASE_ST, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    414743..414934
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 1.7e-12"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    414944..415132
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 1.7e-15"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    415145..415336
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 6.8e-14"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    415346..415546
FT                   /locus_tag="SSUBM407_0373"
FT                   /note="HMMPfam hit to PF03793, PASTA, score 8.2e-09"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   repeat_region   415648..415761
FT                   /note="Region similar to ISSs2"
FT   repeat_region   complement(415760..415863)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        416045..416740
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0374"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0386"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55206"
FT                   /db_xref="GOA:A0A0H3MTM4"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTM4"
FT                   /protein_id="CAZ55206.1"
FT                   /translation="MRKVQFFLLIESMIFTMAAFDVVANEASRTLLLFSALLLVIWYFL
FT                   GRKVNSVLLVSSLSLLFLVFVLNPFFIIGIMLLVVYMLINFFSRYEKRNQYTHIVFSDY
FT                   SLQVQKEKNRWFGNHDHSQDRFGFEDINIVRLFGNDVVDLDKTVLVGRDNIVVIRKTFG
FT                   RTKIIVPIDVEVALSATSIYGRVSFLGESYWDLRNESIAVNSPDYQESHKRVKVVTNNI
FT                   LGDVEVVRV"
FT   misc_feature    join(416063..416116,416129..416182,416216..416284)
FT                   /locus_tag="SSUBM407_0374"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0374 by TMHMM2.0 at aa 7-24, 29-46 and 58-80"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        416737..417753
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0375"
FT                   /product="sensor histidine kinase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0387"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55207"
FT                   /db_xref="GOA:A0A0H3N292"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N292"
FT                   /protein_id="CAZ55207.1"
FT                   /translation="MRKRTYLLLAWFACLIVFVVIASTLPLLNYSLLDVTLWISTEQLV
FT                   FTLILLVIVLTLFLAVMVQTVSLASTQVMRTKLQAILKNKSIRTDTESDQLLLQLSDKV
FT                   RNLTRQVQLVDNQDLVKKEEIVEGERKRIARDLHDTVSQELFATSMILSGLSSNLSTLP
FT                   QETLQEQLMLVKDMIESAQRDLRILLLHLRPSELESKTLVEGFELILREVSDKSNIIVH
FT                   FQHEVEELPKLIEEHLFRIAQEIISNTLRHAKAKHLDVYLLQKETELQLKMTDDGIGFQ
FT                   QGADDELSYGLQNIRERVEDMAGTIKIRTAPNKGVAIDIRIPLLKGKEDEYDSSDAG"
FT   sig_peptide     416737..416802
FT                   /locus_tag="SSUBM407_0375"
FT                   /note="Signal peptide predicted for SSUBM407_0375 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.997) with
FT                   cleavage site probability 0.983 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(416755..416823,416866..416934)
FT                   /locus_tag="SSUBM407_0375"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0375 by TMHMM2.0 at aa 7-29 and 44-66"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    417121..417327
FT                   /locus_tag="SSUBM407_0375"
FT                   /note="HMMPfam hit to PF07730, HisKA_3, score 1.2e-20"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   misc_feature    417433..417711
FT                   /locus_tag="SSUBM407_0375"
FT                   /note="HMMPfam hit to PF02518, HATPase_c, score 1.3e-15"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS_pept        417725..418366
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0376"
FT                   /product="response regulator protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0388"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55208"
FT                   /db_xref="GOA:A0A0H3MTV8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTV8"
FT                   /protein_id="CAZ55208.1"
FT                   /translation="MNTIRVMLVDDHEMVRLGLKSYLNLQPDVEVVAEASDGEEGLAKA
FT                   LEVKPDVVVMDLVMPKMTGVEATLALLKEWPQAQIVILTSYLDNEKIYPVLEAGARGYM
FT                   LKTSSADEILAAIRKVALGEYAIETEVEKKVEHHKRHPDLHDDLTAREREILTLLAKGY
FT                   DNQRIADESFISLKTVKTHVSNILSKLAVSDRTQAVVYAFQHGLVAQEDQ"
FT   misc_feature    417734..418078
FT                   /locus_tag="SSUBM407_0376"
FT                   /note="HMMPfam hit to PF00072, Response_reg, score 7.8e-34"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    418157..418330
FT                   /locus_tag="SSUBM407_0376"
FT                   /note="HMMPfam hit to PF00196, GerE, score 5.3e-23"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   CDS_pept        418416..419816
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0377"
FT                   /product="cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0389"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55209"
FT                   /db_xref="GOA:A0A0H3MTI2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTI2"
FT                   /protein_id="CAZ55209.1"
FT                   /translation="MDAKLRYKAKKIKIVFFDIDDTLRVKNTGYIPESIQQVFKSLKEK
FT                   GILTGIASGRTPYGLVPEIKALKPDFFAMINGSYVEDAKGQVVYHQPMPQNLVESVLNW
FT                   AKEIGIEYGMLSSQKGTLSARTDRISQVIDLIYEGLETKPTFYKENDIYQLLTFEKDGH
FT                   EVELPEELQAELRSVRWDAISSDIVLKGSSKATGVAKVVEKLGLKPENVLVFGDGLNDI
FT                   ELFDYAGISIAMGHSHPELQKHADYITKKVEEDGIFDALEKLGMVEKEKYFPQLDLENV
FT                   TGPVAHIKTNHGKLTVKLFPEIAPKTVANFVALSKDGYYDGIIFHRIIKDFMIQGGDPT
FT                   GTGMGGESIYGTAFEDEFSMEAFNLRGALSMANAGPNTNGSQFFIVQNQNFPYNAKELE
FT                   RGGWPKEVAEAYVKNGGTPYLDQRHTVFGHLVDEESFVVLDAIAAVATDSADCPHEDVV
FT                   IETIEIED"
FT   misc_feature    418458..419198
FT                   /locus_tag="SSUBM407_0377"
FT                   /note="HMMPfam hit to PF08282, Hydrolase_3, score 5.5e-71"
FT                   /inference="protein motif:HMMPfam:PF08282"
FT   misc_feature    419058..419126
FT                   /locus_tag="SSUBM407_0377"
FT                   /note="ScanRegExp hit to PS01229, COF_2, score NA"
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    419268..419807
FT                   /locus_tag="SSUBM407_0377"
FT                   /note="HMMPfam hit to PF00160, Pro_isomerase, score
FT                   1.8e-52"
FT                   /inference="protein motif:HMMPfam:PF00160"
FT   CDS_pept        419818..420189
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0378"
FT                   /product="putative S1 RNA binding domain protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0390"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55210"
FT                   /db_xref="GOA:A0A0H3MXW2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXW2"
FT                   /protein_id="CAZ55210.1"
FT                   /translation="MKIGDKLKGTVTGIQPYGAFVQLENGTTGLIHISEIKTGFVDNIY
FT                   DHLKLGQEVLVQVVDFDEYTEKASLSIRTLEEEQQKIPCHHRFTNERNKIGFSPLAKQL
FT                   PKWIEEAKGYLKEHKEKKV"
FT   misc_feature    419821..420036
FT                   /locus_tag="SSUBM407_0378"
FT                   /note="HMMPfam hit to PF00575, S1, score 1.5e-19"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS_pept        complement(420215..421141)
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="SSUBM407_0379"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0391"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55211"
FT                   /db_xref="GOA:A0A0H3MTM8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTM8"
FT                   /protein_id="CAZ55211.1"
FT                   /translation="MAIYQNITQLVGKTPVIKLNNIVPEGAAEVYVKLEAFNPGSSVKD
FT                   RIALAMIEDAEKAGTIKPGDTIVEPTSGNTGIGLAWVGAAKGYNVIIVMPETMSVERRK
FT                   IIQAYGAELVLTPGSEGMKGAIAKAKEIAEEKNGWVPFQFANPSNPKVHEDTTGQEILE
FT                   DFGTTGLDAFVSGVGTGGTVSGVSHVLKTANPDIAIYAVEADESAVLSGEAPGPHKIQG
FT                   ISAGFIPDTLDTSAYDGIIRVKSDDALATGRAIGGKEGFLVGISSGAAIHAAIEVAKEL
FT                   GTGKKVLAILPDNGERYLSTALYEFND"
FT   misc_feature    complement(420260..421123)
FT                   /gene="cysM"
FT                   /locus_tag="SSUBM407_0379"
FT                   /note="HMMPfam hit to PF00291, PALP, score 6.5e-115"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    complement(420989..421045)
FT                   /gene="cysM"
FT                   /locus_tag="SSUBM407_0379"
FT                   /note="ScanRegExp hit to PS00901, CYS_SYNTHASE, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00901"
FT   CDS_pept        complement(421231..421869)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0392"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55212"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N297"
FT                   /protein_id="CAZ55212.1"
FT                   /translation="MVMKEFKTIREDGIVEEEIKKSRFICFMKRVTSEEEARDFINKIK
FT                   KEHYKATHNCSAFVLGENMEIKRSSDDGEPSGTAGVPMLTVLENHELTNVATVVTRYFG
FT                   GIKLGAGGLIRAYAGAVANAVKEIGVVEVKEQEGISLSMSYAQYQEFANWRAEQGLEEF
FT                   DTQFTTEVSTMIFVDKEFLEQTLASLTDFYHGKVSTEKANSRIVEVPVY"
FT   misc_feature    complement(421492..421815)
FT                   /locus_tag="SSUBM407_0380"
FT                   /note="HMMPfam hit to PF01205, UPF0029, score 2.8e-60"
FT                   /inference="protein motif:HMMPfam:PF01205"
FT   misc_feature    complement(421543..421632)
FT                   /locus_tag="SSUBM407_0380"
FT                   /note="ScanRegExp hit to PS00910, UPF0029, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00910"
FT   CDS_pept        421920..423212
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="SSUBM407_0381"
FT                   /product="putative late competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0393"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55213"
FT                   /db_xref="GOA:A0A0H3MTW8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTW8"
FT                   /protein_id="CAZ55213.1"
FT                   /translation="MKELENYYGRLFTKYQLTAKEREIAEKVPSITKKNNCFRCGTTFE
FT                   EENKLPNDAYYCRACLLLGRVRSDEKLYHFPQKDFPITKCLKWKGQLTDWQQRISDGLV
FT                   ANVENNRATLVHAVTGAGKTEMIYHTVASVIDKGGAVCLASPRIDVCIELYKRLQNDFS
FT                   VPISLLHGESEPYFRTPLVVATTHQLLKFYQAFDLVLIDEVDAFPYADNPMLYRAADNA
FT                   VKEAGVQVFLTATSTDELDKKVRTGKLSRLSLPRRFHGNPLVVPQKVWFSKFDDTLKKN
FT                   RLVPKLKKAIEEQRKSCFPLLIFVPEISKGQEFTKIMKKTFPEETIGFVSSQTENRLEI
FT                   VEGFRKREITVLISTTILERGVTFPCVDVFVVQANHYLYTVSSLVQIAGRVGRSMERPT
FT                   GLLQFYHEGSTGAIEKAVAEIKQMNKEAGYV"
FT   misc_feature    422184..422633
FT                   /gene="comFA"
FT                   /locus_tag="SSUBM407_0381"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 1.9e-05"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    422874..423104
FT                   /gene="comFA"
FT                   /locus_tag="SSUBM407_0381"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 8.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        423205..423870
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="SSUBM407_0382"
FT                   /product="putative late competence protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0394"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55214"
FT                   /db_xref="GOA:A0A0H3MTI6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTI6"
FT                   /protein_id="CAZ55214.1"
FT                   /translation="MSNCLLCGQAMKNKTRFSDLIFFSKEKSGICEECFSTFEEIAEQH
FT                   CPHCYKNGESESCKDCQYWQNQGKPVVHTALYQYNQAMAHYFSRYKFQGDYVLRNIFAK
FT                   KLRIALSQFPDYTIVPIPISQKRLSERGFNQVEGLLDATNIPYQSLLGKYESQKQSSKN
FT                   RAERLEAKQMFYLLDEKEVPEKILLFDDIYTTGATIQLAVELFMKIGRKEIKTFSLTR"
FT   CDS_pept        423947..424489
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0383"
FT                   /product="sigma 54 modulation protein / S30EA ribosomal
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0395"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55215"
FT                   /db_xref="GOA:A0A0H3MXW7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXW7"
FT                   /protein_id="CAZ55215.1"
FT                   /translation="MIKFSIRGENLEVTEALRTYVEEKVAKIEKYFNEEQELNAKVNLK
FT                   VYRDKRAKVEVTIPVGAVTLRAEDISQEMYGSIDLVVDKIERQIRRNKTKIERKHRQKV
FT                   ATGQVFTDELVEQTGEEVKVVRTKQVDLKPMDMEEAVLQLELLGHDFFIYTDANDGTTN
FT                   VLYRREDGDLGLLEVRQ"
FT   misc_feature    423953..424243
FT                   /locus_tag="SSUBM407_0383"
FT                   /note="HMMPfam hit to PF02482, Ribosomal_S30AE, score
FT                   1.8e-30"
FT                   /inference="protein motif:HMMPfam:PF02482"
FT   rRNA            424827..426370
FT                   /locus_tag="SSUBM407_r0010"
FT                   /note="16S rRNA"
FT   tRNA            426422..426494
FT                   /locus_tag="SSUBM407_t0035"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:426455..426457,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 73.15"
FT   rRNA            426774..429678
FT                   /locus_tag="SSUBM407_r0011"
FT                   /note="23S rRNA"
FT   rRNA            429756..429884
FT                   /locus_tag="SSUBM407_r0012"
FT                   /note="5S rRNA"
FT   tRNA            429885..429957
FT                   /locus_tag="SSUBM407_t0036"
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:429918..429920,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 68.42"
FT   tRNA            429960..430032
FT                   /locus_tag="SSUBM407_t0037"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:429993..429995,aa:Asp)"
FT                   /note="tRNA Asp anticodon GTC, Cove score 82.91"
FT   tRNA            430078..430150
FT                   /locus_tag="SSUBM407_t0038"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:430111..430113,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 81.85"
FT   tRNA            430154..430235
FT                   /locus_tag="SSUBM407_t0039"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:430188..430190,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAG, Cove score 45.48"
FT   tRNA            430250..430322
FT                   /locus_tag="SSUBM407_t0040"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:430283..430285,aa:Thr)"
FT                   /note="tRNA Thr anticodon TGT, Cove score 71.26"
FT   tRNA            430335..430406
FT                   /locus_tag="SSUBM407_t0041"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:430367..430369,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 77.41"
FT   tRNA            430414..430497
FT                   /locus_tag="SSUBM407_t0042"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:430448..430450,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 51.48"
FT   tRNA            430516..430589
FT                   /locus_tag="SSUBM407_t0043"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:430550..430552,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 72.48"
FT   tRNA            430637..430710
FT                   /locus_tag="SSUBM407_t0044"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:430671..430673,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 61.18"
FT   CDS_pept        complement(431267..432619)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0384"
FT                   /product="putative RNA methyltransferase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0396"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55216"
FT                   /db_xref="GOA:A0A0H3MTN2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN2"
FT                   /protein_id="CAZ55216.1"
FT                   /translation="MNLQVNQRIPLKIKRMGINGEGIGFYQKTLVFVPGALKGEEIFCQ
FT                   ITSVKRNFVEAKLLKINKESKFRVKPACDIYRACGGCQIMHLRYDKQLDFKQDLLQQAL
FT                   KKFKPAGYENYTIYPTIGMDKPSHYRAKLQFQTRSFKDQVKAGLYAENSHRLIGITNCY
FT                   VQDAETQEIINGIAKLLTKHRIPIYNERKQHGIRTVMVRKARKTGQVQVIFITSCQVNL
FT                   IKLIDELTSQFPSIITIALNWNRQKTSDIYGEKTEILWGEQAIDEAVLDYEFSLSPRAF
FT                   YQLNPQQTEILYGEAVKALDISGDEDLIDAYCGVGTIGFAFAKKVKSVRGMDIIPEAIE
FT                   DAKANAKRMGLSNTHYEAGKAEEIIPKWYQEGYRADALVVDPPRTGLDEKLLKTILNYK
FT                   PAKMVYVSCNVSTLARDLVELSKAYKVEYIQSVDMFPHTARTEAVVKLSKK"
FT   misc_feature    complement(431270..432358)
FT                   /locus_tag="SSUBM407_0384"
FT                   /note="HMMPfam hit to PF05958, tRNA_U5-meth_tr, score
FT                   1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF05958"
FT   misc_feature    complement(431294..431326)
FT                   /locus_tag="SSUBM407_0384"
FT                   /note="ScanRegExp hit to PS01231, TRMA_2, score NA"
FT                   /inference="protein motif:Prosite:PS01231"
FT   misc_feature    complement(431384..431479)
FT                   /locus_tag="SSUBM407_0384"
FT                   /note="ScanRegExp hit to PS01230, TRMA_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01230"
FT   misc_feature    complement(432440..432616)
FT                   /locus_tag="SSUBM407_0384"
FT                   /note="HMMPfam hit to PF01938, TRAM, score 4.4e-08"
FT                   /inference="protein motif:HMMPfam:PF01938"
FT   CDS_pept        432657..433433
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0385"
FT                   /product="RecX family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0397"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55217"
FT                   /db_xref="GOA:A0A0H3N2A2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2A2"
FT                   /protein_id="CAZ55217.1"
FT                   /translation="MRITKIEKKKRLYLLEVDGQDSLYITEDTIVRFMLSKGKEITEQE
FT                   FRELRDFAQFSYGKNLALYYLSFKQRTKKEVSNYLKKYEIEENNIVKIVTVLEEEKWLD
FT                   DGNYVDSYVRQNALNGDKGPAMIRQKLMQKGIPKTLIDKRLAEEDFSELAGKIGEKLVG
FT                   RYQRKLPLRALQDKVVQGLMGKGFSYEAAKQSLGQLELVADEENEDDLIAKELDKQYRK
FT                   YSRKYEGYELKQRLIQALARKGYDFDRIQAVLRDYL"
FT   misc_feature    432894..433274
FT                   /locus_tag="SSUBM407_0385"
FT                   /note="HMMPfam hit to PF02631, RecX, score 9.5e-09"
FT                   /inference="protein motif:HMMPfam:PF02631"
FT   CDS_pept        433509..434042
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0398"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55218"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTX7"
FT                   /protein_id="CAZ55218.1"
FT                   /translation="MKLPKEGDFITIQSYKHDGEIHRTWRDTMVLKTTENAIIGVNNHT
FT                   LVTENDGRRWVTREPAIVYFHKKYWFNIIAMIRENGVSYYCNLASPYVLDNEALKYIDY
FT                   DLDVKVFADGEKRLLDVDEYERHRKAMKYSDDIDFILKENVKILVDWINNQRGPFSPAY
FT                   VNIWYKRYLELRSR"
FT   misc_feature    433617..433910
FT                   /locus_tag="SSUBM407_0386"
FT                   /note="HMMPfam hit to PF04167, DUF402, score 6.8e-41"
FT                   /inference="protein motif:HMMPfam:PF04167"
FT   CDS_pept        434100..434417
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0399"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55219"
FT                   /db_xref="InterPro:IPR009303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTJ0"
FT                   /protein_id="CAZ55219.1"
FT                   /translation="MAFEQTNGRYASFGVVTSLPGEVIDSFWYVIDHYLKGVIPLKSVI
FT                   RFSIKNRRGKITLVFSQEGYKNVLAVDLSSRFDPFYPSTILVMDKQGKETITLPDEVTL
FT                   L"
FT   CDS_pept        434517..435248
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0388"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0400"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55220"
FT                   /db_xref="GOA:A0A0H3MXX2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXX2"
FT                   /protein_id="CAZ55220.1"
FT                   /translation="MVSQTVEKPLYLQLVDELEVAIRERMAPNDKLFSERELTQVYGVS
FT                   RITVRLALQELEKRGLVYKKHGKGTYVSEISDTAVDLSQAYSFTEQMKKIGKVPRTSIL
FT                   SFELVKASDYIAQHLQLSQGEEVFEVERLRLADEIPMMLERTYVPASVFPGLAAQRMKS
FT                   TPLYEIFSEDYHQVIRLAEEEFYASIALDNEAKILGIPSNSPVLHLVRKTYNDKNRIIE
FT                   FTFSIARADQFRYKITHQRGY"
FT   misc_feature    434544..434732
FT                   /locus_tag="SSUBM407_0388"
FT                   /note="HMMPfam hit to PF00392, GntR, score 7.5e-18"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    434613..434678
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1087.000, SD 2.89 at aa 33-54, sequence
FT                   FSERELTQVYGVSRITVRLALQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    434796..435218
FT                   /locus_tag="SSUBM407_0388"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 3.6e-51"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   repeat_region   complement(435253..435344)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(435388..436098)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0389"
FT                   /product="GntR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0401"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55221"
FT                   /db_xref="GOA:A0A0H3MTN4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN4"
FT                   /protein_id="CAZ55221.1"
FT                   /translation="MKVPKYQLIQNDLRQQIVSGKFENGDKFYTESELTKLFNVSSITV
FT                   IRAVNELVKDGYLVRQQGKGTFVSRSRKGRLVEFSDIEIFPMDKDKVTVLSCEKGNKPD
FT                   ILEKLNLDKNEFYYKIVRVRAAEDTPYIFHNSYIPQRYIQNPDAPLEHYQSIYQRFKLD
FT                   YNIHMSEEPFVETNEIVSPCPKEVATHLKLKATEPAVLQNKTTTNSTSGEVMEYTETYK
FT                   HWKYYKFEITANHR"
FT   misc_feature    complement(435415..435819)
FT                   /locus_tag="SSUBM407_0389"
FT                   /note="HMMPfam hit to PF07702, UTRA, score 6.7e-16"
FT                   /inference="protein motif:HMMPfam:PF07702"
FT   misc_feature    complement(435895..436086)
FT                   /locus_tag="SSUBM407_0389"
FT                   /note="HMMPfam hit to PF00392, GntR, score 2.2e-14"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(435943..435990)
FT                   /locus_tag="SSUBM407_0389"
FT                   /note="ScanRegExp hit to PS00012, PHOSPHOPANTETHEINE, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    complement(435949..436014)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1054.000, SD 2.78 at aa 29-50, sequence
FT                   YTESELTKLFNVSSITVIRAVN"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        436305..438077
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0390"
FT                   /product="putative beta-galactosidase precursor"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0402"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55222"
FT                   /db_xref="GOA:A0A0H3N2A7"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2A7"
FT                   /protein_id="CAZ55222.1"
FT                   /translation="MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKALG
FT                   FNTVETYVPWNMHEPRKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWGGL
FT                   PAWLMKEELRVRSSDSVYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSYGEE
FT                   KAYLRAVAGLMRKHGLTAPLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENFANMT
FT                   AFFNEHQKNWPLMCMEFWDGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYMFHGGT
FT                   NFGFMNGCSARGQIDLPQVTSYDYDAILDEAGNPTKKFYILQQRLKEVYPELEYAEPLV
FT                   KEAKAFSDVSLHDKVSLSATLENVSDCVKGFYPKNMEELDQSTGYILYRTELERDKTEA
FT                   ERFRVVDARDRIQIYADGKFVATQYQTEIGDDVELDFKDDKLTLDILVENMGRVNYGHK
FT                   LTAPTQSKGIGRGAMADLHFIGHWETYPLHLESVEDLDFSKGWEEGQAAFYRYQFELDE
FT                   LADTYLDMTGFGKGVVFVNNVNIGRFWEKGPILYLYIPKGYLKKGANEIVVFETEGKYR
FT                   EKIHFSQRPVIKDL"
FT   misc_feature    436329..437291
FT                   /locus_tag="SSUBM407_0390"
FT                   /note="HMMPfam hit to PF01301, Glyco_hydro_35, score
FT                   1.5e-177"
FT                   /inference="protein motif:HMMPfam:PF01301"
FT   CDS_pept        438131..438616
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0391"
FT                   /product="sugar phosphotransferase system (PTS), sorbose
FT                   subfamily, IIB component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0403"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55223"
FT                   /db_xref="GOA:A0A0H3MTY2"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTY2"
FT                   /protein_id="CAZ55223.1"
FT                   /translation="MAIIATRIDGRLIHGQVANLWTTKLNIGRIMVIDDAVAQNDIEKQ
FT                   GLKLACPPGVKLSILPIEKAANNIKEGKYDSQRLLIVARRPENFLRLVEYGVELAELNV
FT                   GNMSQTPETRSVTRSINVVDKDIADFDALAAKGVKLFAQMVPGDSPKDFMPLLDKVR"
FT   misc_feature    438134..438586
FT                   /locus_tag="SSUBM407_0391"
FT                   /note="HMMPfam hit to PF03830, PTSIIB_sorb, score 2.9e-74"
FT                   /inference="protein motif:HMMPfam:PF03830"
FT   CDS_pept        438658..439557
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0392"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   sorbose-specific family, IIC component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0404"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55224"
FT                   /db_xref="GOA:A0A0H3MTJ5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTJ5"
FT                   /protein_id="CAZ55224.1"
FT                   /translation="MQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGNME
FT                   VGLLIGASLQLVVLGVGTFGGASRIDATSGAVLATAFSISQGLDPEIAISTIGVPVAGL
FT                   LVYTDILGRFTTTFFAHRVDAAIERFDYAGIERNYLLGAIPWALSRALPVFLALAFGGG
FT                   LVETLVTTIELPEYKWIAAGLTLAARMLPGLGFAILLHYLPLKRNLHYLAVGFALTAML
FT                   TVLYGNVSALGGAVAGIVGTLPEDAGVSFVNNFKGLSMIGIAIVGAFLSVIHFKNSQKV
FT                   TVVAPSNSESGEIEDDEI"
FT   misc_feature    438658..439377
FT                   /locus_tag="SSUBM407_0392"
FT                   /note="HMMPfam hit to PF03609, EII-Sor, score 1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF03609"
FT   misc_feature    join(438715..438774,438793..438861,438931..438999,
FT                   439096..439164,439192..439260,439297..439365,
FT                   439408..439476)
FT                   /locus_tag="SSUBM407_0392"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SSUBM407_0392 by TMHMM2.0 at aa 20-39, 46-68, 92-114,
FT                   147-169, 179-201, 214-236 and 251-273"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        439544..440362
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0393"
FT                   /product="sugar phosphotransferase system (PTS),
FT                   mannose/fructose/sorbose family, IID component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0405"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55225"
FT                   /db_xref="GOA:A0A0H3MXX7"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXX7"
FT                   /protein_id="CAZ55225.1"
FT                   /translation="MTKSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQ
FT                   LRKMYGDGTPELKEMMKLHTQFFNTSPFFHTIITGIDLALEESDGVASKDAVNGVKTGL
FT                   MGPFAPIGDSIFGSLVPAIMGTVAATMGKEGSPVGIFLWVAVAIAYDIFRWKQLEVAYK
FT                   EGTKLITTMRDRLTALVDAASVMGVFMMGALIATMINFEVTWAPAIGEKVIDIQDILNT
FT                   IFPRLVPAIFTGFVFWLLGRRGMTSTKAILIIIVLALGFSAIGHFLFGMV"
FT   misc_feature    439559..440344
FT                   /locus_tag="SSUBM407_0393"
FT                   /note="HMMPfam hit to PF03613, EIID-AGA, score 5.1e-119"
FT                   /inference="protein motif:HMMPfam:PF03613"
FT   misc_feature    join(440072..440140,440198..440266,440285..440353)
FT                   /locus_tag="SSUBM407_0393"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0393 by TMHMM2.0 at aa 177-199, 219-241 and
FT                   248-270"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        440362..440763
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0394"
FT                   /product="sugar phosphotransferase system (PTS), fructose
FT                   family, IIA component"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0406"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55226"
FT                   /db_xref="GOA:A0A0H3MTN6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN6"
FT                   /protein_id="CAZ55226.1"
FT                   /translation="MVRSLVLVSHGIFCEELKKSTEMIMGPQEDIYTVALLPEEGPEDF
FT                   QKKFEETIAGLEDFVVFADLLGGTPANVVSRKLIEGGQFDLYAGMNMPMVIGFLNGVLL
FT                   GEAVDYVEFGTSNLVHVNSLLTSDEDDDE"
FT   misc_feature    440368..440697
FT                   /locus_tag="SSUBM407_0394"
FT                   /note="HMMPfam hit to PF03610, EIIA-man, score 1.2e-25"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   CDS_pept        440979..441980
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0395"
FT                   /product="putative aldose 1-epimerase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0407"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55227"
FT                   /db_xref="GOA:A0A0H3N2B2"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2B2"
FT                   /protein_id="CAZ55227.1"
FT                   /translation="MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGG
FT                   LRNVSLAAKSDDDYRKTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGV
FT                   DTANEQYWDVELDHERNQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSD
FT                   KDTIFNPTNHIYFNLTGDFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFR
FT                   DFAPFAQGFDSQYPQNVLVKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYT
FT                   YNFPVEALACYHGVFSLECQALPNACNVDGFGSILLEQGEEFLSKTTYRFTW"
FT   misc_feature    441012..441968
FT                   /locus_tag="SSUBM407_0395"
FT                   /note="HMMPfam hit to PF01263, Aldose_epim, score 2.2e-82"
FT                   /inference="protein motif:HMMPfam:PF01263"
FT   misc_feature    441483..441512
FT                   /locus_tag="SSUBM407_0395"
FT                   /note="ScanRegExp hit to PS00545, ALDOSE_1_EPIMERASE, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00545"
FT   CDS_pept        442090..442344
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0408"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55228"
FT                   /db_xref="InterPro:IPR015026"
FT                   /db_xref="InterPro:IPR038024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTY7"
FT                   /protein_id="CAZ55228.1"
FT                   /translation="MTKEQEFLKEFEAWVNTQVMVNEMAVEESRRVLEEDKDERAADAY
FT                   IRYESKLDAYRFIQGKFANYHAGKGFHDLPDELFGQRHY"
FT   misc_feature    442090..442341
FT                   /locus_tag="SSUBM407_0396"
FT                   /note="HMMPfam hit to PF08930, DUF1912, score 8.6e-61"
FT                   /inference="protein motif:HMMPfam:PF08930"
FT   CDS_pept        442359..442745
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0409"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55229"
FT                   /db_xref="GOA:A0A0H3MTJ8"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTJ8"
FT                   /protein_id="CAZ55229.1"
FT                   /translation="MAKKKVNRKKQLKKQLADLKRAGRVGLERAAEVVETVAHKAEAVV
FT                   ERTVEQVKEVVAEVTSSATSLEDFLALPELEGIAAARLETFYEAGIQSVADFANHTEKE
FT                   LLALKGIGPATIKQLKEKGIELKA"
FT   CDS_pept        442987..443376
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0398"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0410"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55230"
FT                   /db_xref="GOA:A0A0H3MXY3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXY3"
FT                   /protein_id="CAZ55230.1"
FT                   /translation="MLHHVEIYVSDLETSRAFYDFLLTKLGYSLYQEWDKGLSYKKAEQ
FT                   YLVFVQTPEDFLEVGYHRCRTGLNHLAFHAGTPDEIDQWRKEFLTRRVKLLYDDRYPHA
FT                   GGPDHYALYLEDPDGIKIELVGEGV"
FT   misc_feature    442987..443358
FT                   /locus_tag="SSUBM407_0398"
FT                   /note="HMMPfam hit to PF00903, Glyoxalase, score 0.00029"
FT                   /inference="protein motif:HMMPfam:PF00903"
FT   CDS_pept        443373..443948
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0411"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN9"
FT                   /protein_id="CAZ55231.1"
FT                   /translation="MNLIIIGAQASGKMTVGQEVAKLTGMTLFHNHDSIDFSLRFIPEF
FT                   SEDMFDLNTRITFAVYDVFARSGRPLIGTALINFKNLIEVQFLTTVQTIFHHHGQEILF
FT                   VELETALEERLRRNRTENRLTHKPLKRHIEVSEAEILSTADTCRYTSLGIPEGIQHYLK
FT                   INNTHLSANDVAQLIIQKMEELEQEQTK"
FT   CDS_pept        444063..446714
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SSUBM407_0400"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0412"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55232"
FT                   /db_xref="GOA:A0A0H3N2B7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2B7"
FT                   /protein_id="CAZ55232.1"
FT                   /translation="MSKELSPKYNPAEVEAGRYQTWLDQDVFKPSGDAEAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGVT
FT                   RYDLGREKFLDKVWEWKDEYAATIREQWGKLGLSLDYQRDRFTLDEGLSKAVRKVFVEL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKPIPIVADEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVAKLQELGALVEIENRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTADKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNESGEMYVGEEAPAGDGWVQDEDVLDTWFSSALWPFSTM
FT                   GWPDENAADFQRYFPTSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNALIHGLIRDEE
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNEGLTLDAARENVAKVAAGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVMTRSVLLYTLDQILRLLHPIMPFVT
FT                   EEIFAQYAEGSIVVAAYPVVNPAFENAEAHKGVESLKDLIRSVRNSRAEVNVAPSKPIT
FT                   ILIKTADSELETFFKANENYIRRFTNPEQLEISSSIAAPELAMSAVITGAEIFLPLADL
FT                   LNVEEELARLDKELVKWQKELDMVGKKLSNERFIANAKPEVVEKEKEKQADYQAKYDAT
FT                   VARIEEMKKLVK"
FT   misc_feature    444111..445742
FT                   /gene="valS"
FT                   /locus_tag="SSUBM407_0400"
FT                   /note="HMMPfam hit to PF00133, tRNA-synt_1, score 0"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    444198..444233
FT                   /gene="valS"
FT                   /locus_tag="SSUBM407_0400"
FT                   /note="ScanRegExp hit to PS00178, AA_TRNA_LIGASE_I, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    445890..446333
FT                   /gene="valS"
FT                   /locus_tag="SSUBM407_0400"
FT                   /note="HMMPfam hit to PF08264, Anticodon_1, score 3e-63"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   CDS_pept        446792..449575
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0401"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0413"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55233"
FT                   /db_xref="GOA:A0A0H3MTZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTZ4"
FT                   /protein_id="CAZ55233.1"
FT                   /translation="MMIILICLSLFIISRTMNGFRLFLDSTIIIGFICLFFYYCCFDLI
FT                   FISLTNLVLILILLVYSFSDILFGIRIIGLSIPFIRSIVLKYIDCKGFLQNKIRNHLVE
FT                   IREIILVTFLFLIFGVQVQLQLPYINFTNYSLIEILGFDIAIFSLYGIYVAFLQFLTEN
FT                   DKVYYLGVSKIRFMLDNSVWSQLTRAKLFHIILLVSVLIPLFSKSNIEFNYQLQNIEYL
FT                   WQTCYIISIVVYIFLLKLSISIVYGVFRLNLENVSKTVKKEDVKEKDSRHKEKIFNRFG
FT                   ITDKINISVQRSFKDEFWKIYKNQNQYRDDYIKVRLQERITLVEKADRDELIFTIFGRE
FT                   NWENYNLSESIFVFIENIDSDEGKQFFRFYKNFCIHKWNFLRDYQTDISPRTWVKLVEQ
FT                   DILIFDKLVKSDSTFNIFKIEFSDNAISRNLNLEKNKKIKEFLFELLLDKEGVNLDDVL
FT                   ISIKKEIQRFSQNKSDQFYRYTYDFLKFRLVTILDKYENDDVNINLPEYKSLSDAFQNG
FT                   QRNDYENSILYSKICFNYLDRGRIEDFSHTKVEADDSKEREKQKLKAQKIQGLILSMNE
FT                   EYRMAFMLYQLFYTDRTQWDENLAFYDNNIQSIMKHGKQYHGYLFDQVKNIILSETDID
FT                   HRITESFLDKIWETKNETIMDFSWFDQFGDQHQMSNFKILYVQWILSGATTSYLKSRIN
FT                   FERGFPIKVRNSLVGKIKGKENRKMSVKDLKWRIRRKEERIGHLCRDYLLLTDQLTTIF
FT                   TKVPSDKHNLQISVEYLLHSGKVNLSDVIDNISVTSLLRLEWLLRWNYYHYHRESNYTS
FT                   RTFFDEMTSNDRYYWSAGRGILEFFIAKIVDNFYRDLYQDKEFMAGFKYHLESQLNSLN
FT                   KTVEEYVELIAERVSGIDNLSILQKGQIISKLNYILFGQDNNIKIRQKENIAINKF"
FT   misc_feature    join(446849..446917,446921..446980,446990..447046,
FT                   447095..447163,447206..447274,447470..447538)
FT                   /locus_tag="SSUBM407_0401"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0401 by TMHMM2.0 at aa 20-42, 44-63, 67-85,
FT                   102-124, 139-161 and 227-249"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        449647..449721
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0402"
FT                   /product="putative valine-tRNA ligase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0414"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus pyogenes (serotype M3) putative
FT                   valine-tRNA ligase ValS UniProt:Q8K6M9 (EMBL:AE014161) (882
FT                   aa) fasta scores: E()=3.6e-05, 91.667% id in 24 aa"
FT   CDS_pept        449802..450608
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0403"
FT                   /product="Fic protein family"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0415"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55235"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK2"
FT                   /protein_id="CAZ55235.1"
FT                   /translation="MQPTYNIDNPNLSYEAKQELWETGFGLQKVDGLTPSVYMEELAER
FT                   QARGEYTYEQVYEEITKYHQSTDASTQEADIVSLRIVEMLSQNGFSLRPTTLLHIHKEL
FT                   FHDIFDSSIPVVEYRTVNITKNELVLKGDTVIYSDFPLIAATLDYDFQQERDFSYARLD
FT                   KKAIVAHIQSFISGVWQIHPFREGNTRTITVFLIKYLRSLGFEIDNEPFQKHAKYFRDA
FT                   LVLDNAKLVNKRSDFLTAFFENLLLNGQNDLSSERMYEELGLDEYQ"
FT   misc_feature    450090..450476
FT                   /locus_tag="SSUBM407_0403"
FT                   /note="HMMPfam hit to PF02661, Fic, score 3.3e-11"
FT                   /inference="protein motif:HMMPfam:PF02661"
FT   misc_feature    450408..450437
FT                   /locus_tag="SSUBM407_0403"
FT                   /note="ScanRegExp hit to PS00659, GLYCOSYL_HYDROL_F5, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00659"
FT   CDS_pept        450703..453411
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0404"
FT                   /product="DEAD/DEAH box family helicase"
FT                   /product="helicase, putative"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0416"
FT                   /note="C-terminal region is similar to Streptococcus
FT                   pneumoniae putative helicase UniProt:Q97S40 (EMBL:AE007367)
FT                   (548 aa) fasta scores: E()=1.3e-110, 55.657% id in 548 aa.
FT                   Full length CDS is similar to Bacteroides fragilis probable
FT                   helicase UniProt:Q64S40 (EMBL:AP006841) (970 aa) fasta
FT                   scores: E()=4.9e-64, 36.773% id in 911 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55236"
FT                   /db_xref="GOA:A0A0H3MXY4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXY4"
FT                   /protein_id="CAZ55236.1"
FT                   /translation="MSYYYEKLTGKVAKHLARFPYYATDKILNLMQFQDNNQQFLISDK
FT                   HLYDYFEEQKHQLSTDEKLSILFNLFKGRIDVYAKSYIDENGKINYFPSYNYGWKKRPV
FT                   EKRTCQPLTKQVLLAHLRGEISIGIFPMSLSDTCSFLAIDFDKNNWREEVSILRDTAEQ
FT                   HGFEGHIEISRSGNGAHLWFFFEEEIACQQARNVGKRLLELAMQESKDIRFSSFDRMFP
FT                   NQDILPKGGFGNLIALPLQGEAFKKGRTVFVDKHFQPFSEQWTYLQQVQKIGQKKILDF
FT                   LGQEFSDTVDDTVLDCSLSNVIRVEKRAISSKTNYLLRKLASFPNPEFYLKQATRQPTY
FT                   QTPERIYLFEETNEALHLPRGILAKLQEIFETVTIRDNRNSLSPIQISFKGRLRFEQEL
FT                   ALADLLASENGLLCAETGFGKTVLGAALIAQRKCRTIILVHNRQLLEQWLERLGEFLEI
FT                   EEEEAVRYTPSGRVKVIGHIGQYGASKKWRSKLVDVVMIQSLFQLDVISDFLSDYDMMI
FT                   VDECHHVTALQFEKVVAQFASQYLYGLTATPECKNGHQPIVFQRIGPILHTAQSGQYDF
FT                   KKRLLLHLTSFGKLDLEQSNSTNFASLNDWLAKDLHRNTLIVQDIFKLYQEKRNILVLV
FT                   NRREHIELLEKLLIEKEMPNIFCLSGASKRRDTKELLKRISELDENSPFVLISTGKFIG
FT                   EGFDMPKLDTLILAAPLSWKNNLIQYAGRLHRPYQGKTEVRIVDYLDIHVPYLERMYQK
FT                   RQIAYRKMAYQVGEKEQTQVLFSGRDYEEKFREDLRNTRSTVYLQLHSFTSSRIQELLG
FT                   LLRGKQVVIHVSKNHKLSEWLMGLNSDNVKVKLVPERIGTTAVILDSNLVWYGNLSPFT
FT                   YQSDDQASLLRLESQSIATELLEKFENSNIK"
FT   misc_feature    451123..451467
FT                   /locus_tag="SSUBM407_0404"
FT                   /note="HMMPfam hit to PF01896, DNA_primase_S, score
FT                   8.5e-06"
FT                   /inference="protein motif:HMMPfam:PF01896"
FT   misc_feature    451870..452352
FT                   /locus_tag="SSUBM407_0404"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 7e-30"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   CDS_pept        453527..454249
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0417"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP2"
FT                   /protein_id="CAZ55237.1"
FT                   /translation="MEKEVFTPDQSQSIVDAILKGYKSYLDERIEKRRTMHVSAGYVWT
FT                   KANHIDGALATANLNFIDKFELKHASQSWEFLEFNSENQLLGRVCFVLKGLTRLRQVFP
FT                   TAVKSGKGYLFDYAQINTSYLENLSRHTDESTLFPVQMELFDDNLFELLNRSEQSINNF
FT                   FFITYQADELHHLTNIQVIMPDSRTGKLIEIQNLSTFISTSNVDFNDEKYQELQGLSEI
FT                   DDVADFEIIPRLASEKEA"
FT   CDS_pept        454262..455416
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0406"
FT                   /product="putative DNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0418"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55238"
FT                   /db_xref="GOA:A0A0H3N2C3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2C3"
FT                   /protein_id="CAZ55238.1"
FT                   /translation="MFNGSRLEELRLLNGLTRADLARELEVTEQAIWQFETGVTLPKMK
FT                   NKIAMARFFQVEVDYFDAVDKNGSFSLSRIAFRNADLEAKKNIHIQMVYLEKMNQMIDY
FT                   LENFVSIPNQIIYQLVDSIEQKLQQHESLEFIADHVREVLAVSVDNANLLYSLEKSGIY
FT                   ISERLINGNADAYSAWSRNGRPFIVLGLGKSAVRHNFDLAHELGHLLLHNQVDFEELSK
FT                   EELEEKEKEANQFASYFLLPRKQFLMDFVNIVGKRVSNPDQYILLKKRFGVSIQALEYR
FT                   AYKLGLLTPQQNSYFYRQISKKGYKAVEPLDLEIPLKKPSKIRSILDVILSNNLLTLSD
FT                   IERNQRVSKNFISQLFSFDVKFFDKYLLQLDTFDNVIPLFSRKQ"
FT   misc_feature    454280..454444
FT                   /locus_tag="SSUBM407_0406"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 3e-10"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    454307..454372
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1677.000, SD 4.90 at aa 16-37, sequence
FT                   LTRADLARELEVTEQAIWQFET"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    454730..455110
FT                   /locus_tag="SSUBM407_0406"
FT                   /note="HMMPfam hit to PF06114, DUF955, score 1.1e-23"
FT                   /inference="protein motif:HMMPfam:PF06114"
FT   misc_feature    455267..455332
FT                   /note="Predicted helix-turn-helix motif with score 995.000,
FT                   SD 2.58 at aa 336-357, sequence LTLSDIERNQRVSKNFISQLFS"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        455431..456489
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0419"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55239"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU05"
FT                   /protein_id="CAZ55239.1"
FT                   /translation="MNKINSYKIHLPSLLPFGFLFANNCYTYREVFMEGQFEAVVEVDE
FT                   AGQLSSYVWDCEMEEVYTAHLVTAPSGAFVGQVRESYQSILDRVEEACCIALPFTKDQS
FT                   NRIAQLIKEQWGDLPDYPFAKLPTYGAFRHPNNNKWYALVSQIPRDKLDGSGSQEEVEI
FT                   VNLKVAGREIAELLSRSGIFPAYHMSKKTWVSVLLDDTVEDQTVFALLEKSRYLVGPKS
FT                   YKATQGPDYWVIPANPKVYDIDTEFAENKVVYWPQKSTIQVGDIVAIYVTAPVQAIRYV
FT                   CRVLGENLENHGESDIPTEKKLMQVELLAQFSDDVLPRARMMDLGVKAVRGPRRLTKEL
FT                   IDVLTSEVINIY"
FT   misc_feature    455761..456087
FT                   /locus_tag="SSUBM407_0407"
FT                   /note="HMMPfam hit to PF04237, DUF419, score 1.5e-32"
FT                   /inference="protein motif:HMMPfam:PF04237"
FT   CDS_pept        456573..457565
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="SSUBM407_0408"
FT                   /product="aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0420"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55240"
FT                   /db_xref="GOA:A0A0H3MTK7"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTK7"
FT                   /protein_id="CAZ55240.1"
FT                   /translation="MKKSFIHQQEEISFVKNTFTQYLKDKLEIVEVQGPILSRVGDGMQ
FT                   DNLSGVENAVTVNVKLIPDATYEVVHSLAKWKRHTLARFGFHEGEGLFVHMKALRPDED
FT                   SLDPIHSVYVDQWDWEKVIPDGRRNLAYLKETVEQIYKAIRLTELAVEARYDIESVLPK
FT                   KITFIHTEDLVKNFPDLTPKERENVVAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWT
FT                   SPSEAGYKGLNGDILVWNEALGSAFELSSMGIRVDEEALKRQVAITGDEDRLEFDWHRA
FT                   LLNGLFPLSIGGGIGQSRLAMFLLRKKHIGEVQSSVWPQEVRDNFENIL"
FT   misc_feature    456579..457310
FT                   /gene="asnA"
FT                   /locus_tag="SSUBM407_0408"
FT                   /note="HMMPfam hit to PF03590, AsnA, score 3.4e-181"
FT                   /inference="protein motif:HMMPfam:PF03590"
FT   misc_feature    457413..457460
FT                   /gene="asnA"
FT                   /locus_tag="SSUBM407_0408"
FT                   /note="ScanRegExp hit to PS00879, ODR_DC_2_2, score NA"
FT                   /inference="protein motif:Prosite:PS00879"
FT   CDS_pept        457698..459545
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0409"
FT                   /product="BipA family GTPase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0421"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55241"
FT                   /db_xref="GOA:A0A0H3MXZ0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXZ0"
FT                   /protein_id="CAZ55241.1"
FT                   /translation="MTKLREDIRNVAIIAHVDHGKTTLVDELLKQSQTLDERTQLDERA
FT                   MDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVVDA
FT                   YEGTMPQTRFVLKKALEQNLTPIVVVNKIDKPSARPEEVVDEVLELFIELGADDDQLEF
FT                   PVVYASAINGTSSLSDNPADQEETMAPIFDTIIEHIPAPVDNSDEPLQFQVSLLDYNDF
FT                   VGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERKEIQEAKAGDLIAV
FT                   SGMEDIFVGETVTPTDAVEALPVLRIDEPTLQMTFLVNNSPFAGREGKWVTSRKIEERL
FT                   LAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEVIIKEIDG
FT                   VKMEPFERVQIDTPEEYQGSVIQSLSERKGDMLDMVATGNGQTRLVFLVPARGLIGYST
FT                   EFLSMTRGYGIMNHTFDQYLPVVQGEIGGRHRGALVSIDQGKATTYSIMCIEERGTIFV
FT                   NPGTEVYEGMIIGENSRENDLTVNITTAKQMTNVRSATKDQTSVIKTPRILTLEESLEF
FT                   LNDDEYMEVTPESIRLRKQILNKAERDKAAKKKKLATEE"
FT   misc_feature    457713..458306
FT                   /locus_tag="SSUBM407_0409"
FT                   /note="HMMPfam hit to PF00009, GTP_EFTU, score 2.9e-67"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    457836..457883
FT                   /locus_tag="SSUBM407_0409"
FT                   /note="ScanRegExp hit to PS00301, EFACTOR_GTP, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    458367..458579
FT                   /locus_tag="SSUBM407_0409"
FT                   /note="HMMPfam hit to PF03144, GTP_EFTU_D2, score 6.8e-17"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    458895..459152
FT                   /locus_tag="SSUBM407_0409"
FT                   /note="HMMPfam hit to PF00679, EFG_C, score 1.2e-27"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   CDS_pept        459563..459811
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0410"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0422"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55242"
FT                   /db_xref="GOA:A0A0H3MTP5"
FT                   /db_xref="InterPro:IPR021506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP5"
FT                   /protein_id="CAZ55242.1"
FT                   /translation="MFYLILAIMLVLFYIFIAPSNIKGTMNLIAAVFLLVALAIALVLG
FT                   FLRIMQFPKEIWVGLLMILIGFWAMRDIYQLNDDTKF"
FT   misc_feature    join(459566..459616,459644..459712,459731..459784)
FT                   /locus_tag="SSUBM407_0410"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0410 by TMHMM2.0 at aa 2-18, 28-50 and 57-74"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        460518..460778
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0411"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0423"
FT                   /note="Possible gene remnant. Weakly similar to the
FT                   N-terminal region of Clostridium tetani DNA replication
FT                   protein DnaC UniProt:Q899P7 (EMBL:AE015936) (329 aa) fasta
FT                   scores: E()=7.2, 36.111% id in 72 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55243"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2C8"
FT                   /protein_id="CAZ55243.1"
FT                   /translation="MDVKNLRKLKRIELYEIMLAQSEEIDCLRNQLEKIKTELADRRIM
FT                   ISQSGSIAEASMKLTNIFEEAQKAADLYLYNVKNKIGDVHE"
FT   CDS_pept        460771..461361
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0412"
FT                   /product="putative signal peptidase I 2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0424"
FT                   /note="Similar to SSU0450, 52.308% identity (52.308%
FT                   ungapped) in 195 aa overlap (4-198:8-202)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55244"
FT                   /db_xref="GOA:A0A0H3MU09"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU09"
FT                   /protein_id="CAZ55244.1"
FT                   /translation="MNSSNLKGKELPKTSELKELYQHERYRHTFWRTVKSTVFMLVVVA
FT                   AFAILIAVLFLPILRIYGDSMKGTLNSGDIVVSVKSNDFESSDVVAFYYNNNILVKRVI
FT                   AEAGDWVDMDKQGNVYVNNQRLDEPYLANRDYGHTDIEFPYQVPENRIFVMGDNRKESI
FT                   DSRNNAIGTVSNEQIVGKLVFKIWPLSELGWIE"
FT   sig_peptide     460771..460959
FT                   /locus_tag="SSUBM407_0412"
FT                   /note="Signal peptide predicted for SSUBM407_0412 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.630) with
FT                   cleavage site probability 0.630 between residues 63 and 64"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    460879..460947
FT                   /locus_tag="SSUBM407_0412"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0412 by TMHMM2.0 at aa 37-59"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    460948..461142
FT                   /locus_tag="SSUBM407_0412"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score
FT                   2.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    461224..461265
FT                   /locus_tag="SSUBM407_0412"
FT                   /note="ScanRegExp hit to PS00761, SPASE_I_3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00761"
FT   CDS_pept        join(461393..461539,461543..466369)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0413"
FT                   /product="accessory pilus subunit (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0425"
FT                   /note="CDS contains a nonsense mutation (ochre) after codon
FT                   49. Internal region is similar to the N-terminal region of
FT                   Listeria monocytogenes internalin A precursorinla InlA
FT                   UniProt:P25146 (EMBL:LMO012346) (800 aa) blastp scores:
FT                   E()=4e-09"
FT                   /db_xref="PSEUDO:CAZ55245.1"
FT   sig_peptide     461393..461536
FT                   /locus_tag="SSUBM407_0413"
FT                   /note="Signal peptide predicted for SSUBM407_0413 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.657) with
FT                   cleavage site probability 0.539 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(461450..461518,466295..466354)
FT                   /locus_tag="SSUBM407_0413"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0413 by TMHMM2.0 at aa 20-42 and 1634-1653"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        466476..467918
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0414"
FT                   /product="major pilus subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0427"
FT                   /note="Similar to protein mediating epithelial cell
FT                   invasion by virulent serotype III group B Streptococcus
FT                   agalactiae, Spb1 UniProt:Q84A41 (EMBL:AF485279) (502 aa)
FT                   fasta scores: E()=1.9e-05, 32.961% id in 537 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55246"
FT                   /db_xref="GOA:A0A0H3MTL3"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTL3"
FT                   /protein_id="CAZ55246.1"
FT                   /translation="MKKLQQFFTSLVAVLTVFAFGSTALAQTVDSGKSGAGTITVSNAS
FT                   QGQTYTAYKLFDATVTTDGSGISYKLPAGKTATNFGGDTWFEVDSKGNITAKEGATVSS
FT                   EAFAAWAKNFGTEVTSATANDNSLVFTHLTFGYYFVTSSLGAVLTVDSTTPNATVIDKN
FT                   TTNPTIPDSNNGGGKKILSNGATTSETTAKIGDTINFQIKFNATNYVTKDRQTKQIVSY
FT                   TIEDSPTALAIDQNSVNVKVDGVDITAKISKTFDATGKMNLVITWADAAASNKTIYNSP
FT                   AEVIITYSAVVTKDAKEGEATNSATIGYNTIDNPTTPPTPVDPDKPTETTKVTTHRFTL
FT                   KKTNNVGETLTGAEFKLYDAANNGTEIKVVKESDGVYRVAQADEQGVVIEAGEVVIKGL
FT                   KHSTTYYLEEMKAPNGYNILTERQSIEVKENNTAQANIVNKKGGVLPSTGAIGTTLFYL
FT                   VGSILLLVALVYTISKRRMNNI"
FT   sig_peptide     466476..466553
FT                   /locus_tag="SSUBM407_0414"
FT                   /note="Signal peptide predicted for SSUBM407_0414 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.986 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(466494..466562,467823..467891)
FT                   /locus_tag="SSUBM407_0414"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0414 by TMHMM2.0 at aa 7-29 and 450-472"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    467523..467789
FT                   /locus_tag="SSUBM407_0414"
FT                   /note="HMMPfam hit to PF05738, Cna_B, score 7.4e-11"
FT                   /inference="protein motif:HMMPfam:PF05738"
FT   misc_feature    467784..467900
FT                   /locus_tag="SSUBM407_0414"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        468032..468901
FT                   /transl_table=11
FT                   /gene="srtC1"
FT                   /locus_tag="SSUBM407_0415"
FT                   /product="sortase srtC1"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0428"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55247"
FT                   /db_xref="GOA:A0A0H3MXZ2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXZ2"
FT                   /protein_id="CAZ55247.1"
FT                   /translation="MIKWLKKKGPSFIMPLIFILGIGLLAYPSVSDYWNSFHQSEAIMS
FT                   YSDTVSDMTADQYKEIIDSARQYNQEKPLNWNVTASDIEAYNQELNFNKDGIMGYIEIP
FT                   KIDVKLSIFHGTDETVLETSIGHLEGTSLPVGGLGTHSVLSGHRGLPSARLFSDLDKLR
FT                   EGDIFTIHVLNETLTYKVDQIRVVEPSDLSALTMEPQKDLLTLVTCTPYGINTHRLLVR
FT                   GYRIENVNGSALVTSDAIQIKAIFIAPFIATPILFVILIYIFITTSKTFRSRNRNQVLD
FT                   DFLVPKKF"
FT   sig_peptide     468032..468109
FT                   /gene="srtC1"
FT                   /locus_tag="SSUBM407_0415"
FT                   /note="Signal peptide predicted for SSUBM407_0415 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.820) with
FT                   cleavage site probability 0.737 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(468065..468133,468761..468829)
FT                   /gene="srtC1"
FT                   /locus_tag="SSUBM407_0415"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0415 by TMHMM2.0 at aa 12-34 and 244-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    468332..468709
FT                   /gene="srtC1"
FT                   /locus_tag="SSUBM407_0415"
FT                   /note="HMMPfam hit to PF04203, Sortase, score 8.2e-62"
FT                   /inference="protein motif:HMMPfam:PF04203"
FT   CDS_pept        complement(469012..469347)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0416"
FT                   /product="transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0429"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Streptococcus mutans transposase UniProt:Q93UN9
FT                   (EMBL:AF068251) (297 aa) fasta scores: E()=2e-19, 55.000%
FT                   id in 100 aa"
FT                   /db_xref="PSEUDO:CAZ55248.1"
FT   CDS_pept        469473..470822
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SSUBM407_0417"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0430"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55249"
FT                   /db_xref="GOA:A0A0H3MTP8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP8"
FT                   /protein_id="CAZ55249.1"
FT                   /translation="MKMIDIVKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFEE
FT                   NPTAQSLLEDGIRVICGSHPLELLDEDFALMVKNPGIRYDNPMVEKAIGKGIPVWTEVE
FT                   LAYLVSDVPIVGITGSNGKTTTTTMIAEVLNAGKKPAKLCGNIGYPASSVAQTATAEDT
FT                   LVMELSSFQLMGTESFHPHIAVVTNLIASHIDYHGTFEDYVAAKWMIQRQMTAEDFVVI
FT                   NFNQKEAKELAGQTKATVVPFSTQEVVDGAYLADGKLYFKGEYIMDADQIGVPGSHNVE
FT                   NALATIVVAKLLGVDQQAIQESLSAFGGVKHRLQFVGEINGVSFYNDSKSTNILATQKA
FT                   LSGFDNSKVILIAGGLDRGNEFDELVPDLVGLKKMVILGQSAPRVQRAADKAEVETIEA
FT                   LDIADATRKAFAIAEKGDIVLLSPANASWDMYANFEVRGDVFLQTFEELK"
FT   misc_feature    469815..470342
FT                   /gene="murD"
FT                   /locus_tag="SSUBM407_0417"
FT                   /note="HMMPfam hit to PF08245, Mur_ligase_M, score 8.5e-62"
FT                   /inference="protein motif:HMMPfam:PF08245"
FT   misc_feature    470400..470627
FT                   /gene="murD"
FT                   /locus_tag="SSUBM407_0417"
FT                   /note="HMMPfam hit to PF02875, Mur_ligase_C, score 1.3e-19"
FT                   /inference="protein motif:HMMPfam:PF02875"
FT   CDS_pept        470825..471889
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SSUBM407_0418"
FT                   /product="putative
FT                   UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)pyr
FT                   ophosphoryl-undecaprenol N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0431"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55250"
FT                   /db_xref="GOA:A0A0H3N2D3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2D3"
FT                   /protein_id="CAZ55250.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLIPRFLEEGWEVHYIGDGNGIEHEQ
FT                   VVKSGLDVHFHSIATGKLRRYFSFQNMLDVFKVGFGVLQSLTIIAKIRPQALFSKGGFV
FT                   SVPPVIAANLLRVPVFIHESDLTMGLANKIAYKFATTMYSTFEQPASLTKVKHVGAVTK
FT                   VGQTNDKVTPIQLPEILSHFDKSLPTLLFVGGSGGAKVFNDLISQNSAALTERFNIINL
FT                   TGDSSLNKLDKNLYRVDYVTELYQPLMDLADVVITRGGSNTLFELIAMQQLHLIVPLGR
FT                   QASRGDQIENALYAEKKGYSKQIDESQLTFASLLVEVDELLKHKEFYVQNMANSNEIQS
FT                   VDSFYNLLREDMGR"
FT   misc_feature    470834..471256
FT                   /gene="murG"
FT                   /locus_tag="SSUBM407_0418"
FT                   /note="HMMPfam hit to PF03033, Glyco_transf_28, score
FT                   1.2e-39"
FT                   /inference="protein motif:HMMPfam:PF03033"
FT   misc_feature    471389..471859
FT                   /gene="murG"
FT                   /locus_tag="SSUBM407_0418"
FT                   /note="HMMPfam hit to PF04101, Glyco_tran_28_C, score
FT                   3.5e-27"
FT                   /inference="protein motif:HMMPfam:PF04101"
FT   CDS_pept        471895..472977
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0419"
FT                   /product="putative cell division protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0432"
FT                   /note="CDS is truncated at the C-terminus in comparison to
FT                   some orthologues, for example, similar to Streptococcus
FT                   pneumoniae cell division protein DivIB UniProt:Q9ZHA8
FT                   (EMBL:AF068902) (399 aa) fasta scores: E()=1.7e-28, 35.457%
FT                   id in 361 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55251"
FT                   /db_xref="GOA:A0A0H3MU13"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026580"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU13"
FT                   /protein_id="CAZ55251.1"
FT                   /translation="MTEKDSNVEESVLEVEQASQVELDSEQISPAEKESVLAEEKEFST
FT                   DVDIPEMTAPDDEKSAFFEQWKARHQAYLAHKDEADIQAVDEGQTEQEIPEAKKSKRVL
FT                   FQGIERKTESLKSKKETGEKVQTLKVDIPSKVVWKAIPVLVTSLLLAALALYFISPTSK
FT                   KKQIEVVGNERLTAEQVENYSLISPDDYNVTIALHADAYAKNIKKNSSSVETATIKFQF
FT                   PATFTIHIKEYAIIGYIQQQSQWYPVLSSGEIGGEPISQDSLPEDYTTINLSDKELIKE
FT                   LAIELGKIDAGIRSAIQTINLTPSKVTADLLTFNMRDGNTVLVPLSEISQKVSYYTKIA
FT                   AEVTVPTTIDMEVGIYRYAS"
FT   misc_feature    472300..472368
FT                   /locus_tag="SSUBM407_0419"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0419 by TMHMM2.0 at aa 136-158"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    472378..472593
FT                   /locus_tag="SSUBM407_0419"
FT                   /note="HMMPfam hit to PF08478, POTRA_1, score 7.4e-15"
FT                   /inference="protein motif:HMMPfam:PF08478"
FT   misc_feature    472600..472971
FT                   /locus_tag="SSUBM407_0419"
FT                   /note="HMMPfam hit to PF03799, FtsQ, score 7.8e-12"
FT                   /inference="protein motif:HMMPfam:PF03799"
FT   CDS_pept        473130..474509
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SSUBM407_0420"
FT                   /product="putative cell division protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0433"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55252"
FT                   /db_xref="GOA:A0A0H3MTL7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="InterPro:IPR021873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTL7"
FT                   /protein_id="CAZ55252.1"
FT                   /translation="MARNGFFTGLDIGTSSVKVLVAEYIDNEMNVIGVSNVKSAGVKDG
FT                   IIVNIEVAAGAIKKAIEQAEEKSGIRIEKVNVGLPANLLQIEPTQGMIPVTTDSQEITD
FT                   LDVENVVKSALTKSMTPEREVISFIPEEFTVDGFQGIKDPRGMMGIRLEMRGMLYTGPR
FT                   TILHNLRKTVERAGVQVENIVISPLALTRSVLNEGEREFGATVIDLGGGQTTVAVMRGQ
FT                   ELQYTNIYQEGGDYITNDISKVLTTSKSIAENLKYNYGIAYPQDASDKEKFTVEVIGEN
FT                   APVEVTERYLSEVIAARLRQIFDRVKQDLERTRALDLPGGIVLVGGGAILPGIIELAQE
FT                   VFGVNTKLFVPNQIGIRNPAFASVISFVEYVGELEDVENIAQHAVNGETTLRHKPVEIP
FT                   VARPRISQPIQREIVNELNTVDQVEEQVAPTYHDEEEEVRPAAKGNITDRIRGLFGSMF
FT                   E"
FT   misc_feature    473148..473711
FT                   /gene="ftsA"
FT                   /locus_tag="SSUBM407_0420"
FT                   /note="HMMPfam hit to PF02491, FtsA, score 5.9e-64"
FT                   /inference="protein motif:HMMPfam:PF02491"
FT   misc_feature    473739..474230
FT                   /gene="ftsA"
FT                   /locus_tag="SSUBM407_0420"
FT                   /note="HMMPfam hit to PF02491, FtsA, score 2e-50"
FT                   /inference="protein motif:HMMPfam:PF02491"
FT   CDS_pept        474535..475764
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUBM407_0421"
FT                   /product="cell division protein FtsZ"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0434"
FT                   /note="CDS lacks internal amino acids around residue 360 in
FT                   comparison to some orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55253"
FT                   /db_xref="GOA:A0A0H3MXZ7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MXZ7"
FT                   /protein_id="CAZ55253.1"
FT                   /translation="MAFSFEAAASHGAVIKVIGVGGGGGNAINRMIEEGVAGVEFIAAN
FT                   TDVQALSSSKAETVIQLGPKLTRGLGAGGQPEVGRKAAEESEEALTNVLTGADMVFITA
FT                   GMGGGSGTGAAPVIARIAKNLGALTVAVVTRPFGFEGNKRGNFAIEGIEGLREQVDTLL
FT                   IISNNNLLEIVDKKTPLLEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTVMENK
FT                   GNALMGIGIGTGEDRVIEAARKAIYSPLLETTIDGAEDVIVNVTGGYDMTLTEAEDASE
FT                   IVNQAAGQGVNIWLGTSIDETMKDEIRVTVVATGVRQDTADKPARHRTEAVSPRPSHRF
FT                   DHSVASAPTRGAAQQTEAPKASAFGEWDLRRENLIRPTDTEPTSTVSVEKFTMDQDEDE
FT                   LDTPPFFRNR"
FT   misc_feature    474571..475152
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUBM407_0421"
FT                   /note="HMMPfam hit to PF00091, Tubulin, score 1.2e-95"
FT                   /inference="protein motif:HMMPfam:PF00091"
FT   misc_feature    474667..474771
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUBM407_0421"
FT                   /note="ScanRegExp hit to PS01134, FTSZ_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01134"
FT   misc_feature    475156..475521
FT                   /gene="ftsZ"
FT                   /locus_tag="SSUBM407_0421"
FT                   /note="HMMPfam hit to PF03953, Tubulin_C, score 3.3e-25"
FT                   /inference="protein motif:HMMPfam:PF03953"
FT   CDS_pept        475771..476442
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0435"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55254"
FT                   /db_xref="GOA:A0A0H3MTQ2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTQ2"
FT                   /protein_id="CAZ55254.1"
FT                   /translation="MNFQKNKDAIFSAVAKAAEKAGRPSESVKVIAVTKYVDSSIANQL
FT                   VNTGITHIGENRVDQFLEKYNALADKQLTWHLIGTLQRRKVKDIIPFVDYFHALDSVKL
FT                   AQEIDKRATKIVKCFLQVNVSGEESKHGFAVSEIDAALAEISLLENIELVGLMTMAPID
FT                   ATDDELDEIFSKMQEIQEELATRNLPRMPFTELSMGMSGDFERAIAHGATYVRIGSAFF
FT                   E"
FT   misc_feature    475786..476439
FT                   /locus_tag="SSUBM407_0422"
FT                   /note="HMMPfam hit to PF01168, Ala_racemase_N, score
FT                   1.1e-07"
FT                   /inference="protein motif:HMMPfam:PF01168"
FT   CDS_pept        476459..477022
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0436"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55255"
FT                   /db_xref="GOA:A0A0H3N2D9"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2D9"
FT                   /protein_id="CAZ55255.1"
FT                   /translation="MALKDTFKNLFNYFEVDEVNEVEEQADAYSMPNDRPKMRVANTTV
FT                   APVREQQPKVETRREARSESQLQRLHERQQELMTNNNEKEIVKTTIDIKFPKRYEDAPE
FT                   MVNLLLDNASILIDFQYMSEQQARRCLDYLDGARSVLSGNLKKVSNTMWLLTPVNVTVN
FT                   IEELRNAGTTTGVADSNFEFDIKR"
FT   misc_feature    476714..476953
FT                   /locus_tag="SSUBM407_0423"
FT                   /note="HMMPfam hit to PF04472, DUF552, score 8.6e-28"
FT                   /inference="protein motif:HMMPfam:PF04472"
FT   CDS_pept        477027..477290
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0424"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0437"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55256"
FT                   /db_xref="GOA:A0A0H3MU17"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU17"
FT                   /protein_id="CAZ55256.1"
FT                   /translation="MQILIFLLLKIVEIYSYLLLAYALLSWFPSLYTSSIGRLIQWLVA
FT                   PILKPFRRLNLQFMGLDWTVMAAMIALNMGTRFLVQLLLLLA"
FT   misc_feature    477027..477272
FT                   /locus_tag="SSUBM407_0424"
FT                   /note="HMMPfam hit to PF02325, YGGT, score 7.9e-20"
FT                   /inference="protein motif:HMMPfam:PF02325"
FT   misc_feature    join(477039..477107,477216..477284)
FT                   /locus_tag="SSUBM407_0424"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0424 by TMHMM2.0 at aa 5-27 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        477293..478084
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0425"
FT                   /product="putative RNA-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0438"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55257"
FT                   /db_xref="GOA:A0A0H3MTM1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR040591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTM1"
FT                   /protein_id="CAZ55257.1"
FT                   /translation="MKNDKNLLQHFSREEREFVEKIMDMCQQVEDTYSYRLTHFLHPRQ
FT                   DEIVCKIANYYQLQTFSSRDLVSTEHSRVIIAPTYYELDIKDFELTALHLSYARKFHTL
FT                   SHSQVLGTFLNQLGIKREYLGDILIDDERLIVFIDQKFGQIALQSITKVARVPVKGKEE
FT                   EWTTVRLPIGQEWRSKDVLVSSMRLDKLISVAFNLSRATANKLIEAGHVKLDYVLTEQT
FT                   SKLVEIGQLISVRRYGRVRLNEFLGFSKQGKIKLKLDIVKT"
FT   misc_feature    477848..477988
FT                   /locus_tag="SSUBM407_0425"
FT                   /note="HMMPfam hit to PF01479, S4, score 9.8e-08"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS_pept        478093..478782
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0426"
FT                   /product="putative cell-division protein DivIVA"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0439"
FT                   /note="In comparison to orthologues, CDS lacks similarity
FT                   in the C-terminal region, for example, similar to
FT                   Streptococcus pneumoniae cell division protein DivIVA
FT                   UniProt:Q9ZHB4 (EMBL:AF068901) (262 aa) fasta scores:
FT                   E()=6.8e-42, 66.038% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55258"
FT                   /db_xref="GOA:A0A0H3MY01"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY01"
FT                   /protein_id="CAZ55258.1"
FT                   /translation="MALTALELKDKTFATKFRGYDADEVDDFLDIVTRDYEDLIRKNHD
FT                   QELELKNLRERLAYFDEMKESLSKSVLLAQDTAEKVKVAAEDQAANIIKQADYDAATLL
FT                   HEAKDKANEILRNATDNAKKVVIETEELKNQTRIFHQRLKSTVESQLSLVNSSEWEEIL
FT                   RPTASYIQTSDEAFRDVLHKALDEELPVEEESLDYTRQLTPEEIAELTRQAAAFESGES
FT                   VVLSIEE"
FT   misc_feature    478093..478779
FT                   /locus_tag="SSUBM407_0426"
FT                   /note="HMMPfam hit to PF05103, DivIVA, score 7.1e-66"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        478797..479017
FT                   /locus_tag="SSUBM407_m0003"
FT                   /note="T-box leader (RF00230) as predicted by Rfam, score
FT                   60.74"
FT   CDS_pept        479012..479455
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0427"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0440"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55259"
FT                   /db_xref="GOA:A0A0H3MTQ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTQ9"
FT                   /protein_id="CAZ55259.1"
FT                   /translation="MIRLELVNKDNFEVVLQVQLASEDQRRVASVEYSLAQAWLYKDSG
FT                   MILPYAVVSGRKVVGFAMLSIEPKDNSYYLWRLLIDKDFQNRGCGKEAIQQIIGKAKAD
FT                   PLCHKISINYVIGNHKMRYILEKIGFQSVGLEGQEMKMELIIK"
FT   misc_feature    479159..479404
FT                   /locus_tag="SSUBM407_0427"
FT                   /note="HMMPfam hit to PF00583, Acetyltransf_1, score
FT                   4.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS_pept        479466..482255
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SSUBM407_0428"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0441"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55260"
FT                   /db_xref="GOA:A0A0H3N2E3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2E3"
FT                   /protein_id="CAZ55260.1"
FT                   /translation="MKLKETLNLGKTAFPMRAGLPTREPEWQKAWDEANLYARRQELNE
FT                   GKPAFHLHDGPPYANGNIHVGHALNKISKDIIVRSKSMSGFRAPFVPGWDTHGLPIEQV
FT                   LAKQGVKRKEMDLVEYLEMCRDYAFSQVDKQRDDFKRLGVSADWENPYITLTKDYEAAQ
FT                   IRVFGAMADKGYIYRGAKPVYWSWSSESALAEAEIEYHDIDSTSLYYANKVKDGKGLLD
FT                   TDSYIVVWTTTPFTVTASRGLTMGADIDYVLVQPAGSDRKYVLAEALVDSLAAKFGWES
FT                   FEVISKHKGAEFEYIVTEHPWDREVDELVILGDHVTTDSGTGIVHTAPGFGEDDYNVGV
FT                   KYDLEVAVTVNERGLMNEAAGPDFEGQFYDKVVPTVKEKLGDLLLASEVINHSYPFDWR
FT                   TKKPIIWRAVPQWFASVSKFRQEILDQIEATTFNPSWGKTRLYNMIRDRGDWVISRQRA
FT                   WGVPLPIFYAEDGTAIMTKEVTDHVAALFEEHGSIIWWKSDAKDLLPAGFTHPGSPNGE
FT                   FTKETDIMDVWFDSGSSWNGVMNARENLAYPADLYLEGSDQYRGWFNSSLITSVAVNGH
FT                   APYKAILSQGFVLDGNGMKMSKSLGNTILPSDVEKQFGAEILRLWVTSVDTSNDVRVSM
FT                   DILGQVSETYRKIRNTLRFLIANTSDFNPASDAVAYEELRSVDQYLLVKFNKLVVQIRE
FT                   AYDNYDFMGIYKSVVNFVTLDLSAFYLDFAKDVVYIDGAKSLSRRQMQTVFYDILVKIT
FT                   KLLTPILPHTAEEIWSYLEHEAEEFVQLAEMPEVETFANEAQLLADWENFMVFRTQAQK
FT                   ALEEARNAKVIGKSLEAHLTAYVSAETKSFLESLNADLAQLLIVSNLTVTTETAPSTAL
FT                   VVDEVAFAVERAAGEVCDRCRRIDTSVAERSYGATICDHCASVVEENFAEAVAQGFEA"
FT   misc_feature    479541..481367
FT                   /gene="ileS"
FT                   /locus_tag="SSUBM407_0428"
FT                   /note="HMMPfam hit to PF00133, tRNA-synt_1, score 5.5e-273"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    479634..479669
FT                   /gene="ileS"
FT                   /locus_tag="SSUBM407_0428"
FT                   /note="ScanRegExp hit to PS00178, AA_TRNA_LIGASE_I, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    481497..481967
FT                   /gene="ileS"
FT                   /locus_tag="SSUBM407_0428"
FT                   /note="HMMPfam hit to PF08264, Anticodon_1, score 1.8e-52"
FT                   /inference="protein motif:HMMPfam:PF08264"
FT   misc_feature    482118..482207
FT                   /gene="ileS"
FT                   /locus_tag="SSUBM407_0428"
FT                   /note="HMMPfam hit to PF06827, zf-FPG_IleRS, score 8.4e-09"
FT                   /inference="protein motif:HMMPfam:PF06827"
FT   repeat_region   complement(482306..482412)
FT                   /rpt_family="RepSU1"
FT                   /note="Imperfect repeat RepSU1"
FT   CDS_pept        complement(482634..482942)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0442"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55261"
FT                   /db_xref="InterPro:IPR014959"
FT                   /db_xref="InterPro:IPR038226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU22"
FT                   /protein_id="CAZ55261.1"
FT                   /translation="MKIINTTNSHPNLVQSQLANTDAFLVETYSAGNTDVIFTQAPRHY
FT                   ELLISNKYRAVQQNEIEQIRDFFLHRKIDERTINKAAIQTIHTDRLIEMSIPIIAEV"
FT   misc_feature    complement(482649..482942)
FT                   /locus_tag="SSUBM407_0429"
FT                   /note="HMMPfam hit to PF08860, DUF1827, score 6.3e-58"
FT                   /inference="protein motif:HMMPfam:PF08860"
FT   CDS_pept        complement(482997..483464)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0430"
FT                   /product="MutT/NUDIX hydrolase family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0443"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55262"
FT                   /db_xref="GOA:A0A0H3MTM5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTM5"
FT                   /protein_id="CAZ55262.1"
FT                   /translation="MPMEKIAVFGEKKAGVSYQSRFGVYAVIPDEKKEQIILVQAPNGA
FT                   WFLPGGEIEKGENHLIALERELMEELGFTAEIGKYFGQADEYFYSSHRDTHFYNPAYIY
FT                   EVTSYHQIGQPLEDFNHIAWFPVNEAIDKLKRGSHKWGIEQWKLQENSFNN"
FT   misc_feature    complement(483018..483407)
FT                   /locus_tag="SSUBM407_0430"
FT                   /note="HMMPfam hit to PF00293, NUDIX, score 1.7e-19"
FT                   /inference="protein motif:HMMPfam:PF00293"
FT   misc_feature    complement(483249..483314)
FT                   /locus_tag="SSUBM407_0430"
FT                   /note="ScanRegExp hit to PS00893, NUDIX, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS_pept        complement(483644..485872)
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="SSUBM407_0431"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0444"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55263"
FT                   /db_xref="GOA:A0A0H3MY03"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY03"
FT                   /protein_id="CAZ55263.1"
FT                   /translation="MLCKNCNINDATIHLYTNLNGKQQQVDLCHNCYQIMKTDPHNAIL
FT                   RGLGDLTNPNNMDPFSEFFNHLGGYPGNTPAGKNREQTPPTQAGGHNGRGGQTPPPQQP
FT                   QQPNGLLEEFGINVTEIARRGDIDPVIGRDQEITRVIEILNRRTKNNPVLIGEPGVGKT
FT                   AVVEGLAQKIIDGDVPQKLRDKEVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRNRREI
FT                   ILFIDEIHEIVGAGSAGDGNMDAGNILKPALARGEMQLVGATTLNEYRIIEKDAALERR
FT                   MQPVKVEEPSVEETITILKGIQNKYQDYHHVKYSDAAIEAAAVLSNRYIQDRFLPDKAI
FT                   DLLDEAGSKMNLTLNFIDPKEIDQRLIDSENRKAQATRDEDYEKAAYFRDQIAKYKEMQ
FT                   KATISEEDIPLITEKEIEAIVEQKTNIPVGDLKEKEQSQLVSLASDLKAHVIGQDEAVD
FT                   KIAKAIRRNRVGLGAPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADSMIRFDMSEY
FT                   MEKHAVAKLVGAPPGYVGYEEAGQLTEKVRRNPYSLILLDEVEKAHPDVMHMFLQVLDD
FT                   GRLTDGQGRTVSFKDTIIIMTSNAGTGKVEASVGFGAAMEGRTQSVLGQLSNFFTPEFM
FT                   NRFDGIIEFQPLSKENLLEIVSLMLDDVNKRLSHNGISLHVTDKVKEKLVDLGYNPKMG
FT                   ARPLRRTIQDQIEDAITDFYLEHPAEKDLRAVMSSKGTIQIKAQTKTK"
FT   misc_feature    complement(483950..484447)
FT                   /gene="clpE"
FT                   /locus_tag="SSUBM407_0431"
FT                   /note="HMMPfam hit to PF07724, AAA_2, score 6.3e-98"
FT                   /inference="protein motif:HMMPfam:PF07724"
FT   misc_feature    complement(484286..484342)
FT                   /gene="clpE"
FT                   /locus_tag="SSUBM407_0431"
FT                   /note="ScanRegExp hit to PS00871, CLPAB_2, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00871"
FT   misc_feature    complement(484679..484786)
FT                   /gene="clpE"
FT                   /locus_tag="SSUBM407_0431"
FT                   /note="HMMPfam hit to PF02151, UVR, score 0.0014"
FT                   /inference="protein motif:HMMPfam:PF02151"
FT   misc_feature    complement(485105..485143)
FT                   /gene="clpE"
FT                   /locus_tag="SSUBM407_0431"
FT                   /note="ScanRegExp hit to PS00870, CLPAB_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00870"
FT   misc_feature    complement(485138..485422)
FT                   /gene="clpE"
FT                   /locus_tag="SSUBM407_0431"
FT                   /note="HMMPfam hit to PF00004, AAA, score 5.8e-11"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   CDS_pept        486096..486326
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0445"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55264"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTR3"
FT                   /protein_id="CAZ55264.1"
FT                   /translation="MESHLVRIINRLEAMANDGGTLKRNFERDGIVVAEVAYSYDEENG
FT                   SVFTLRDVAARETYAFDSIDLIAMEIYELLY"
FT   misc_feature    486117..486320
FT                   /locus_tag="SSUBM407_0432"
FT                   /note="HMMPfam hit to PF08796, DUF1797, score 1.7e-33"
FT                   /inference="protein motif:HMMPfam:PF08796"
FT   CDS_pept        486452..487141
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0433"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0446"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55265"
FT                   /db_xref="GOA:A0A0H3N2E9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2E9"
FT                   /protein_id="CAZ55265.1"
FT                   /translation="MNFSFLPEYWAYFNYGAIVTLIIAFFSVFFGSILGVLLAFAQRSK
FT                   YKVLAWTANIYVWIFRGTPMIVQIMIAFAMTHFVAPTFQLGILTVDLTRLIPGIIVISM
FT                   NSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKQAMRYVIMPQAIKNILPALGNEFVTI
FT                   VKDSSLLSTIGVMELWNGAQTVQSTSYIPLTPLVFAASYYLIMTTVLTVIIQSFEKKLN
FT                   KGGQFHV"
FT   misc_feature    486488..487120
FT                   /locus_tag="SSUBM407_0433"
FT                   /note="HMMPfam hit to PF00528, BPD_transp_1, score 8.2e-32"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    join(486494..486562,486620..486688,487022..487090)
FT                   /locus_tag="SSUBM407_0433"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0433 by TMHMM2.0 at aa 15-37, 57-79 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        487134..487868
FT                   /transl_table=11
FT                   /gene="glnQ3"
FT                   /locus_tag="SSUBM407_0434"
FT                   /product="putative glutamine transporter, ATP-binding
FT                   protein 3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0447"
FT                   /note="Similar to SSU0884, 65.984% identity (65.984%
FT                   ungapped) in 244 aa overlap (1-244:1-244); SSU1676, 58.436%
FT                   identity (58.678% ungapped) in 243 aa overlap
FT                   (3-244:4-246); SSU1192, 55.556% identity (56.017% ungapped)
FT                   in 243 aa overlap (4-244:2-244); and SSU1851, 54.545%
FT                   identity (55.230% ungapped) in 242 aa overlap
FT                   (5-243:1-242)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55266"
FT                   /db_xref="GOA:A0A0H3MU26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU26"
FT                   /protein_id="CAZ55266.1"
FT                   /translation="MSNAIISIKDLHKYFGKNEVLKGIDLDIQQGQVVVIIGPSGSGKS
FT                   TFLRTMNLLEVPTKGTVTFEGVDITDKSNDIFKMREKMGMVFQQFNLFPNMTVLDNITL
FT                   SPIKTKGIAKDEAEKKAKELLEKVGLPDKANAYPQSLSGGQQQRIAIARGLAMDPDVLL
FT                   FDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMDGGVIVEDG
FT                   TPEEVFEHTKEERTKDFLSKVL"
FT   misc_feature    487224..487781
FT                   /gene="glnQ3"
FT                   /locus_tag="SSUBM407_0434"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 1.5e-68"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    487554..487598
FT                   /gene="glnQ3"
FT                   /locus_tag="SSUBM407_0434"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        487998..488846
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SSUBM407_0435"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase]"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0448"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55267"
FT                   /db_xref="GOA:A0A0H3MTN0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN0"
FT                   /protein_id="CAZ55267.1"
FT                   /translation="MTVIDGKALGVKLQAALAEKTARLKEEKGLVPGLVVILVGENPAS
FT                   QVYVRNKERSALAAGFKSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAHIS
FT                   EEKVLLAIDPDKDVDGFHPTNMGKFWSGHPVMIPSTPAGIMEMFKEYQIELEGKSALVI
FT                   GRSNIVGKPMAQLLLDADATVTIAHSRTKNLPDLARQADILVVAIGRGHFVTKEFVKLG
FT                   AVVIDVGMNRDENGKLIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEACVRSA
FT                   K"
FT   misc_feature    488001..488354
FT                   /gene="folD"
FT                   /locus_tag="SSUBM407_0435"
FT                   /note="HMMPfam hit to PF00763, THF_DHG_CYH, score 2.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00763"
FT   misc_feature    488217..488294
FT                   /gene="folD"
FT                   /locus_tag="SSUBM407_0435"
FT                   /note="ScanRegExp hit to PS00766, THF_DHG_CYH_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00766"
FT   misc_feature    488361..488840
FT                   /gene="folD"
FT                   /locus_tag="SSUBM407_0435"
FT                   /note="HMMPfam hit to PF02882, THF_DHG_CYH_C, score
FT                   2.2e-106"
FT                   /inference="protein motif:HMMPfam:PF02882"
FT   misc_feature    488769..488795
FT                   /gene="folD"
FT                   /locus_tag="SSUBM407_0435"
FT                   /note="ScanRegExp hit to PS00767, THF_DHG_CYH_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00767"
FT   CDS_pept        490295..490588
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0436"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0449"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY07"
FT                   /protein_id="CAZ55268.1"
FT                   /translation="MQKTLEKLKRSELFELLVEQAKEIESYQAKLVDLEKRIEYREAVL
FT                   GEIGSIAEASLAVTRIFEEAQLAANIYLEQVQKVTHKQSDNCEIGRTDEDGD"
FT   CDS_pept        490638..491180
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0437"
FT                   /product="putative signal peptidase I 3"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0450"
FT                   /note="Similar to SSU0424, 52.308% identity (52.308%
FT                   ungapped) in 195 aa overlap (8-202:4-198)"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55269"
FT                   /db_xref="GOA:A0A0H3MTR8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTR8"
FT                   /protein_id="CAZ55269.1"
FT                   /translation="MSEELDKIRYKERYLETLKNTIFTLVTVVALAVLIAMLWLPVLHI
FT                   YGSSMSPTLKAGDMVATVKTNTLSTGDMVAFYYNNKVLVKRVVATSGQWVNIDEQGNVY
FT                   ANGKTLDEPYVKDKAYGQTDIKLPYQVPEGQYFVMGDHRSVSIDSRNTAIGSIGEEQLV
FT                   GKLTFRIWPFHKMGVIK"
FT   misc_feature    490698..490766
FT                   /locus_tag="SSUBM407_0437"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0437 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    490767..490961
FT                   /locus_tag="SSUBM407_0437"
FT                   /note="HMMPfam hit to PF00717, Peptidase_S24, score
FT                   1.3e-13"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    491043..491084
FT                   /locus_tag="SSUBM407_0437"
FT                   /note="ScanRegExp hit to PS00761, SPASE_I_3, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00761"
FT   CDS_pept        491199..491585
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0438"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0451"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55270"
FT                   /db_xref="GOA:A0A0H3N2F4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2F4"
FT                   /protein_id="CAZ55270.1"
FT                   /translation="MKILWERLFKFVQQYFREKKTAKITMVLSIIMAFGISYLLILPAI
FT                   TLETDSQESVLQSVYNQPTTVEQPVQEEQAESQLAQVQSAGSLFAEHENITVQVNYEEH
FT                   TFEQPVRLQVLPSEDSTKYIGLVR"
FT   sig_peptide     491199..491345
FT                   /locus_tag="SSUBM407_0438"
FT                   /note="Signal peptide predicted for SSUBM407_0438 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.671) with
FT                   cleavage site probability 0.466 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    491268..491336
FT                   /locus_tag="SSUBM407_0438"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0438 by TMHMM2.0 at aa 24-46"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(491586..491957)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0439"
FT                   /product="putative transposase (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0452"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Lactobacillus helveticus ISl2 mobile genetic
FT                   element protein UniProt:Q48559 (EMBL:LHISL2) (268 aa) fasta
FT                   scores: E()=1.2e-13, 44.167% id in 120 aa"
FT   misc_feature    complement(491592..491957)
FT                   /locus_tag="SSUBM407_0439"
FT                   /note="HMMPfam hit to PF01609, Transposase_11, score
FT                   0.0035"
FT                   /inference="protein motif:HMMPfam:PF01609"
FT   CDS_pept        491943..492770
FT                   /transl_table=11
FT                   /gene="srtC2"
FT                   /locus_tag="SSUBM407_0440"
FT                   /product="sortase SrtC2"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0453"
FT                   /note="Previously sequenced as Streptococcus suis
FT                   sortase-like protein SrtE UniProt:Q8VUN6 (EMBL:AB066355)
FT                   (275 aa) fasta scores: E()=8.4e-98, 100.000% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55272"
FT                   /db_xref="GOA:A0A0H3MU30"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU30"
FT                   /protein_id="CAZ55272.1"
FT                   /translation="MASQIRHDLSLLVFFLITGLLLLLYPTVSDYWNSHYQSEAVATYS
FT                   EKLLDISKEEKQKILENVSAYNNTLEKGTILNLNIDSVALKKYDSILNITDTGIMGYVE
FT                   IPKLQTTLPIYHGTDDAVLQVAVGHLAGTSLPIGGQGSHAAISGHRGLPSAKLFSDLDQ
FT                   LVIGDTFMIQVLDNTLTYEIDKIITVTPDDVSPLMIDPNEDFVTLVTCTPYGVNSHRLL
FT                   VRGHRIENQLLARQVVSEGSIVKPILVSPFIALCLLGLLWSLFFIKKEVNLFM"
FT   misc_feature    join(491967..492026,492681..492740)
FT                   /gene="srtC2"
FT                   /locus_tag="SSUBM407_0440"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0440 by TMHMM2.0 at aa 9-28 and 247-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492249..492626
FT                   /gene="srtC2"
FT                   /locus_tag="SSUBM407_0440"
FT                   /note="HMMPfam hit to PF04203, Sortase, score 3.6e-58"
FT                   /inference="protein motif:HMMPfam:PF04203"
FT   CDS_pept        492900..493064
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0441"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0454"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Enterococcus faecalis (Streptococcus faecalis)
FT                   hypothetical protein UniProt:Q835N7 (EMBL:AE016951) (153
FT                   aa) fasta scores: E()=4.6e-11, 66.667% id in 57 aa"
FT   CDS_pept        493153..493563
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0442"
FT                   /product="MerR family regulatory protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0455"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55274"
FT                   /db_xref="GOA:A0A0H3MTN3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN3"
FT                   /protein_id="CAZ55274.1"
FT                   /translation="MNIKEVSDVTGLSADTIRYYERVGLIPKIARKSSGVRDFVENDVA
FT                   VLDFVRCFRSAGMSIERLIEYMGLVQAGDSTVEARIDLLKEEREVLQSRLSKIQQALER
FT                   LDYKIENYQTILRGAENQLFTDGSGSCKKDRE"
FT   misc_feature    493153..493218
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1649.000, SD 4.80 at aa 3-24, sequence
FT                   MNIKEVSDVTGLSADTIRYYER"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   misc_feature    493156..493269
FT                   /locus_tag="SSUBM407_0442"
FT                   /note="HMMPfam hit to PF00376, MerR, score 3.7e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   CDS_pept        complement(493589..493900)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0443"
FT                   /product="putative membrane protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0456"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55275"
FT                   /db_xref="GOA:A0A0H3MY11"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY11"
FT                   /protein_id="CAZ55275.1"
FT                   /translation="MPLRHYQSHEYQYEEYIPKEKKANFQTYQAKNANKERLKELLFFV
FT                   NIAFFSLITVIASYVYLSVGIPVFIAIILASATGFLGLRLVQIGLKKKFKPKQVIRKN"
FT   misc_feature    complement(join(493643..493711,493721..493780))
FT                   /locus_tag="SSUBM407_0443"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0443 by TMHMM2.0 at aa 41-60 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        494061..494990
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0444"
FT                   /product="putative peptidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0457"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55276"
FT                   /db_xref="GOA:A0A0H3MTS3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTS3"
FT                   /protein_id="CAZ55276.1"
FT                   /translation="MEKIIITATAESIEQVKELLVAGVDRIYVGEADHALRIPTNFTYD
FT                   ELREIAELVHSAGKELTVAANALMHQDMMDNIKPFMELMREIKVDYLVVGDTGIFYINK
FT                   RDGYNFKLIYDTSVFVTSSRQINFWKDHGAVEAVLAREIPSEELFDIAKNLEMPAEILV
FT                   YGASVIHHSKRTLLQNYYNFTKADETDLSRGRGLFLAEPSDPDSHYSIFEDKHGTHIFI
FT                   NNDIDMMTKLSELDEHGYHNWKLDGIYCPGQNFVEIVKLFVQARDLIEKGDFTYDQAFL
FT                   LDEQVRKLHPAERGLDTGFYEFDRNKVK"
FT   misc_feature    494280..494981
FT                   /locus_tag="SSUBM407_0444"
FT                   /note="HMMPfam hit to PF01136, Peptidase_U32, score
FT                   9.7e-74"
FT                   /inference="protein motif:HMMPfam:PF01136"
FT   CDS_pept        495285..496574
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0445"
FT                   /product="putative peptidase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0458"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55277"
FT                   /db_xref="GOA:A0A0H3N2F9"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2F9"
FT                   /protein_id="CAZ55277.1"
FT                   /translation="MMSKTLKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRA
FT                   GNFTMDEMREGIEYAHARGAKVYVAANMVTHEGNEEGAGAWFRELRDMGLDAVIVSDPA
FT                   LIVICATEAPGLEIHLSTQASSTNYETFEFWKELGLTRVVLAREVTMEEVAEIRKRTDV
FT                   EIEAFVHGAMCISYSGRCVLSNHMSKRDANRGGCSQSCRWKYNLYDLPFGEERRSIKGE
FT                   IPEEFSMSAVDMCMIDHIPDMIENGVDSLKIEGRMKSVHYVSTVTNCYKAAVDAYLESP
FT                   ERFEAIKQDLIDEMWKVAQRELATGFYYSPPSENEQLFGARRKIPEYKFIAEVVAFDKE
FT                   TMTATIRQRNVINEGDQVEFYGPGFRHFETTIQDLHDSNGEKIDRANKPMELLTIKLDR
FT                   EIYPGDMIRACKSGLINLYQEDGQSLTIRA"
FT   misc_feature    495522..496226
FT                   /locus_tag="SSUBM407_0445"
FT                   /note="HMMPfam hit to PF01136, Peptidase_U32, score
FT                   6.8e-128"
FT                   /inference="protein motif:HMMPfam:PF01136"
FT   misc_feature    495780..495836
FT                   /locus_tag="SSUBM407_0445"
FT                   /note="ScanRegExp hit to PS01276, PEPTIDASE_U32, score NA"
FT                   /inference="protein motif:Prosite:PS01276"
FT   CDS_pept        496700..496816
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0446"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0459"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU35"
FT                   /protein_id="CAZ55278.1"
FT                   /translation="MLRKCYLQPPKVPQTFGASTKSKLKDYKKAEISASERR"
FT   CDS_pept        complement(496990..497313)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0460"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTN7"
FT                   /protein_id="CAZ55279.1"
FT                   /translation="MKRFLEVIFEQFTIFLEHGKAPKSIEPDSKEEIKNNLELALYKKA
FT                   AVHVIYGDRSFTGDIVKYDTDRQRIIMKNFKRQVTSIIKIEDIKKVTLVPDSIKTSQQQ
FT                   TKG"
FT   CDS_pept        497405..497620
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0461"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55280"
FT                   /db_xref="GOA:A0A0H3MY16"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY16"
FT                   /protein_id="CAZ55280.1"
FT                   /translation="MAEFTFEIEEKLLVLSENDKGWTKELNRVSFNGAPAKYDIRTWSP
FT                   DHTKMGKGITLSNEEFQVLLDAFANK"
FT   CDS_pept        complement(497632..498171)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0449"
FT                   /product="BioY family protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0462"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55281"
FT                   /db_xref="GOA:A0A0H3MTS6"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTS6"
FT                   /protein_id="CAZ55281.1"
FT                   /translation="MKTTSIKSLVYIAIGTALISTLSQISLSIGPVPFTLQTLAIGLVA
FT                   CLYKPKEAITSVSLYLVLGAIGLPVFAGFSGGFAALTGPTSGFLWGFLLYTIITSALTK
FT                   SDSSPVTIFLACLLGTSICFLLGCCVFKLVSGASWTDTIGWTVLPFILPDLAKITLVMI
FT                   CHRLLQPVIKKEAYFA"
FT   misc_feature    complement(497656..498099)
FT                   /locus_tag="SSUBM407_0449"
FT                   /note="HMMPfam hit to PF02632, BioY, score 4.1e-27"
FT                   /inference="protein motif:HMMPfam:PF02632"
FT   misc_feature    complement(join(497779..497847,497875..497943,
FT                   497947..498015,498085..498153))
FT                   /locus_tag="SSUBM407_0449"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0449 by TMHMM2.0 at aa 7-29, 53-75, 77-99 and
FT                   109-131"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(498052..498171)
FT                   /locus_tag="SSUBM407_0449"
FT                   /note="Signal peptide predicted for SSUBM407_0449 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.905) with
FT                   cleavage site probability 0.434 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        498376..499113
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0450"
FT                   /product="putative cyclase"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0463"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55282"
FT                   /db_xref="GOA:A0A0H3N2G3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2G3"
FT                   /protein_id="CAZ55282.1"
FT                   /translation="MTELLDIYRTLKSKTWVDLTHQINEKSPHFPALPALEKKALFTHK
FT                   DGFFVEQFTVVGQYGTHIDPPIHFVEGARYLDEIDLKDLLLPLYVIDKSAAVIENNDYE
FT                   ITKQDILDFEAEYGPIAPKSFVAFRSDLSKRWPSQDAIRNLDEDGVQRTPGWSHEALEY
FT                   LIEERQVKAVGHETLDTDSGVSAAKHGGSLSEEYYLLSKDIYQLEVLANLDQVPPTGAL
FT                   ISIAFPHWEKASGSPVRAIAILP"
FT   misc_feature    498421..499065
FT                   /locus_tag="SSUBM407_0450"
FT                   /note="HMMPfam hit to PF04199, Cyclase, score 1.3e-52"
FT                   /inference="protein motif:HMMPfam:PF04199"
FT   CDS_pept        complement(499163..500512)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SSUBM407_0451"
FT                   /product="glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0464"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55283"
FT                   /db_xref="GOA:A0A0H3MU40"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU40"
FT                   /protein_id="CAZ55283.1"
FT                   /translation="MKVFDIIAIGGGSGGIATMNRAAMYGAKAAVIEGSYLGGTCVNLG
FT                   CVPKKIMWYGSQVAEAIQHYGPEYGFTSQEVTFDFATLRKNREAYIERSRASYGNTFNN
FT                   NEVEVIQGFARFVDNQTVEVNGELIRAKHIVIATGAKPVVPAIPGSELGIVSDDVFAWE
FT                   ELPSSVAVIGAGYIAVEMAGLLHGLGVQTDLFVRGNRPLRSFDTYIVDALMEEMQRTNL
FT                   PLHTGKTPVSLEKTDDGQIQINFADGSNHIAQKVLWAIGRKPNIDKLNLKATSVQLTSS
FT                   GHISVNEYQETAVPGIYALGDVTGEKELTPVAIKAGRLLAERLFNNKPTAKMDYTTIPT
FT                   VVFSHPAIGTVGLTEDEAITQYGQDNVKVYTSAFTSMYTALENNRQMAKFKLVTVGENE
FT                   KVVGLHGIGYGVDEMIQGFSVAIKMGATKEEFDAVVAIHPTGSEEFVTMR"
FT   misc_feature    complement(499166..499501)
FT                   /gene="gor"
FT                   /locus_tag="SSUBM407_0451"
FT                   /note="HMMPfam hit to PF02852, Pyr_redox_dim, score
FT                   1.5e-47"
FT                   /inference="protein motif:HMMPfam:PF02852"
FT   misc_feature    complement(499592..500500)
FT                   /gene="gor"
FT                   /locus_tag="SSUBM407_0451"
FT                   /note="HMMPfam hit to PF07992, Pyr_redox_2, score 8.4e-61"
FT                   /inference="protein motif:HMMPfam:PF07992"
FT   misc_feature    complement(499730..500011)
FT                   /gene="gor"
FT                   /locus_tag="SSUBM407_0451"
FT                   /note="HMMPfam hit to PF00070, Pyr_redox, score 1.8e-27"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   misc_feature    complement(500369..500401)
FT                   /gene="gor"
FT                   /locus_tag="SSUBM407_0451"
FT                   /note="ScanRegExp hit to PS00076, PYRIDINE_REDOX_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00076"
FT   CDS_pept        500726..501883
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0452"
FT                   /product="putative exported protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0465"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55284"
FT                   /db_xref="GOA:A0A0H3MTP0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP0"
FT                   /protein_id="CAZ55284.1"
FT                   /translation="MLKTKKAKIALFGGLGVVAVALVGGALIFSNMLTSPSSSEDVAMS
FT                   MTYTVAKEGSIASSTLLTGTITAADEQYVYYDPSKGDLSEVLVAPGAKVEVGTPLIRYD
FT                   ATELQSALDTAVRGRDKIGRQIADLRTNGQTVQTTGDAETDAAATATAQRSVDMQLADL
FT                   NDSYADAQAAVDKAYTALTEATVTSTVAGTVVEVNKAVSKNSTSSQTVVHIVNQGSLQV
FT                   TGSLTEYDLANIAVDQEVKLTSKVYPDKTWTGKITYISNYPSSNQAGAATTGTSGSGAK
FT                   YPFKAALTSELGELKQGFSVNIEVVNTSKNILIPVSAVVPEEDKNYVWTLVDGKAKKVE
FT                   VTLGNADALNQEVTAGIAAGDKVITIPTPNLEDGKEVEANEEPAY"
FT   sig_peptide     500726..500842
FT                   /locus_tag="SSUBM407_0452"
FT                   /note="Signal peptide predicted for SSUBM407_0452 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.797 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    500744..500812
FT                   /locus_tag="SSUBM407_0452"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0452 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        501864..502559
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0453"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0466"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55285"
FT                   /db_xref="GOA:A0A0H3MY21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY21"
FT                   /protein_id="CAZ55285.1"
FT                   /translation="MKNQLIRLTSINKSYKNGDQELRVLKNIDLEVEEGEFLAIMGPSG
FT                   SGKSTLMNIIGLLDRFSSGNYWLEGEEVSQLSEKKLAQVRNDQIGFVFQQFFLLSKLNA
FT                   LQNVELPLIYAGVPSSKRKELAKQYLEKVELAERMTHLPSELSGGQKQRVAIARALVNT
FT                   PAIILADEPTGALDTKTGEQIMQLLTELNNEGKTIIMVTHEPEIAAYAKRKIVLRDGVI
FT                   TEDSRREGV"
FT   misc_feature    501966..502523
FT                   /locus_tag="SSUBM407_0453"
FT                   /note="HMMPfam hit to PF00005, ABC_tran, score 4.3e-57"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    502299..502343
FT                   /locus_tag="SSUBM407_0453"
FT                   /note="ScanRegExp hit to PS00211, ABC_TRANSPORTER_1, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS_pept        502560..503807
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0454"
FT                   /product="putative permease"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0467"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55286"
FT                   /db_xref="GOA:A0A0H3MTT2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTT2"
FT                   /protein_id="CAZ55286.1"
FT                   /translation="MENWKFALKSIMAHKMRSLLTMLGIIIGVAAVVIIVAMGTGVAKS
FT                   IEKSLAGDQNNVQVYFTAFSSSGTAFGPFGTASTEEPILEEEPDLTDSTLKGLLEIDGV
FT                   SNYYSSISNIAEVRSGNKKAENVTITGVSQNFFAVKEYEILAGRQFTANDYSRFSRMIM
FT                   LDTALAEKLFGSIENSLNQTISVNSNAYLVIGVYKDPKAGTAIYGMNSGGNAVMTNTQL
FT                   AAETGMKENSQIFVHVEDVTRATEVGKAAADYLTKATGLKEARYEIYDMSAMLEEFKSQ
FT                   MSGVTLFIGAVAGISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRGNILIQFLIEA
FT                   MVLTTLGGAIGLAIAQTIVFLLNVSKALGERIAAEISIPVVLGSLAFSAVVGIVFGVLP
FT                   ANKASKLDPIEALRYE"
FT   sig_peptide     502560..502694
FT                   /locus_tag="SSUBM407_0454"
FT                   /note="Signal peptide predicted for SSUBM407_0454 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.999) with
FT                   cleavage site probability 0.625 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    join(502617..502685,503421..503489,503547..503642,
FT                   503685..503753)
FT                   /locus_tag="SSUBM407_0454"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SSUBM407_0454 by TMHMM2.0 at aa 20-42, 288-310, 330-361 and
FT                   376-398"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    503250..503783
FT                   /locus_tag="SSUBM407_0454"
FT                   /note="HMMPfam hit to PF02687, FtsX, score 3.8e-49"
FT                   /inference="protein motif:HMMPfam:PF02687"
FT   CDS_pept        join(503933..504475,580445..580966)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0455"
FT                   /product="luciferase-like monooxygenase (pseudogene)"
FT                   /note="Orthologue of S. suis P17 (AM946016) SSU0468"
FT                   /note="CDS is disrupted by the insertion of an intergrative
FT                   conjugative element (ICE) after codon 181. Similar to
FT                   Streptococcus sanguinis (strain SK36) flavin monoxygenase,
FT                   putative UniProt:A3CQL9 (EMBL:CP000387) (349 aa) fasta
FT                   scores: E()=1.6e-105, 70.605% id in 347 aa"
FT                   /db_xref="PSEUDO:CAZ55287.1"
FT   misc_feature    join(503936..504475,580445..580921)
FT                   /locus_tag="SSUBM407_0455"
FT                   /note="HMMPfam hit to PF00296, Bac_luciferase, score
FT                   5.8e-21"
FT                   /inference="protein motif:HMMPfam:PF00296"
FT   misc_feature    504474..580443
FT                   /note="ICESsuBM4071"
FT   CDS_pept        504649..504822
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2H0"
FT                   /protein_id="CAZ55288.1"
FT                   /translation="MKKKEQSSRQIVMCHLVAILGVDIEKATQLIDEMEQVGLIRFDEF
FT                   GNVGILVLEGQS"
FT   CDS_pept        504819..505637
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0457"
FT                   /product="replication initiator protein A protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55289"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU45"
FT                   /protein_id="CAZ55289.1"
FT                   /translation="MKRITANQYQTSERYYELPKVLFESERYKDMKLEVKVAYAVLKDR
FT                   LELSLSKGWIDEDGAIYLIYSNSNLMALLGCSKSKLLSIKKILREYGLIDEVQQSSSER
FT                   GRMANKIYLGELEHEPTPVLHTDGASVKKTLGGSQRKTGPVLYSAPSETEGSETEYSET
FT                   EGSDFLIEDEEERQLVDEKQEENFTSKVDGVTKYDRDYIWGLVHDQLRQTGLSQSASDY
FT                   AMLYFSDRYQYALEHMRFARSAEVIAEYVFNGVLSEWTKQLRRQEVKGGD"
FT   misc_feature    504855..505082
FT                   /locus_tag="SSUBM407_0457"
FT                   /note="HMMPfam hit to PF06970, RepA_N, score 8.9e-43"
FT                   /inference="protein motif:HMMPfam:PF06970"
FT   CDS_pept        505786..507141
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0458"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55290"
FT                   /db_xref="GOA:A0A0H3MTP3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP3"
FT                   /protein_id="CAZ55290.1"
FT                   /translation="MKFLDLFAGIGGFRLGMESQGHKCLGFCEIDKFARTSYKAMFNTE
FT                   GEIEYHDIKEVTDHDFRQFRGQVDIICGGFPCQAFSLAGRRLGFEDTRGTLFFEIARAA
FT                   KQIQPRFLFLENVKGLLNHDEGRTFATILSTMDELGYDVEWQVLNSKDFQVPQNRERVF
FT                   IIGHSRRYRSRFIFPLRGENSPAHLERLGNINPSKRGLNGEVYLTSGLAPTLTRGKGEG
FT                   AKIAIPVLTPDRLEKRQHGRRFKDNQDPMFTLTSQDRHGVVVAGNLPTSFDQTGRVFDI
FT                   SGLSPTLTTMQGGDKVPKILLREELPFLKIKEATKTGYAKATLGDSVNLAYPDSTKRRG
FT                   RVGKGISNTLTTSDNMGVVVAAMEYRQAKWYEVTGIVLEGKLYRLRIRRLTPRECFRLQ
FT                   GFPDWAYERAESVSSKSQLYKQAGNSVTVTVIEAIAREFRRTEEEEKHEPTT"
FT   misc_feature    505786..506286
FT                   /locus_tag="SSUBM407_0458"
FT                   /note="HMMPfam hit to PF00145, DNA_methylase, score
FT                   3.6e-79"
FT                   /inference="protein motif:HMMPfam:PF00145"
FT   misc_feature    505990..506028
FT                   /locus_tag="SSUBM407_0458"
FT                   /note="ScanRegExp hit to PS00094, C5_MTASE_1, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00094"
FT   misc_feature    506941..507105
FT                   /locus_tag="SSUBM407_0458"
FT                   /note="HMMPfam hit to PF00145, DNA_methylase, score 2e-19"
FT                   /inference="protein motif:HMMPfam:PF00145"
FT   CDS_pept        507125..507553
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PME7"
FT                   /protein_id="CAZ55291.1"
FT                   /translation="MNLLHKKSILDCTELEEHIHQVETNQLLQKILSLPNFDCDFEVTF
FT                   EDDYHKEMNDPLFYESNLHRISDFMETRDIKNGVDTLLTKDNHLAFRAFGENYSARGKD
FT                   GILTTLVTVKCFGEGRMPIDMSRYFSTPEPTVENSLTL"
FT   CDS_pept        507564..507947
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY25"
FT                   /protein_id="CAZ55292.1"
FT                   /translation="MLEVYLGNNANTNQDLLAILTTYGVTYRCIKACDVNREILLSLFA
FT                   KTTDCFELLSPRFLRFKRQYSISLNEMIQLILQKPDQNLRLPLIVCQNHVYPAIGLDEV
FT                   RTFLPRQVKEELFQTSLMKQVTG"
FT   CDS_pept        507950..508189
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTT8"
FT                   /protein_id="CAZ55293.1"
FT                   /translation="MKMNERFWDNLEIILAEKDLTWAELARKVFKGQYVYPSEFNRLYQ
FT                   KLRHYKSNRLMPQTRWVERIVLVLEIDYEDLFKR"
FT   CDS_pept        508192..508776
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0462"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55294"
FT                   /db_xref="GOA:A0A0H3N2H4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2H4"
FT                   /protein_id="CAZ55294.1"
FT                   /translation="MIRIVVFYLAIQLNGLLVSLYLKEYLTIEGIVLLQLVLLSVTCLE
FT                   IARHKTVQAKNITLRNRLRWFLLGFVAMVAFAVFISFLFPGQTRNQAVLVQVGKQVPPI
FT                   IFLLFLVNASILEEIVYRQLLWEKLTFPFVQIGVTSFLFVLSHGPNQLGSWLMYSCLGL
FT                   TLAAVRLKTDCMTAIILHLLWNSLAYVVTFL"
FT   misc_feature    join(508204..508257,508267..508323,508384..508443,
FT                   508471..508539,508576..508635,508711..508770)
FT                   /locus_tag="SSUBM407_0462"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0462 by TMHMM2.0 at aa 5-22, 26-44, 65-84, 94-116,
FT                   129-148 and 174-193"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    508501..508767
FT                   /locus_tag="SSUBM407_0462"
FT                   /note="HMMPfam hit to PF02517, Abi, score 1.7e-10"
FT                   /inference="protein motif:HMMPfam:PF02517"
FT   CDS_pept        508854..509342
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU49"
FT                   /protein_id="CAZ55295.1"
FT                   /translation="MSSEQQERQAMQYVERSSLLTVRTLLKLLEWSARQALAQDSAYKI
FT                   GVQKLEELLQSPYAIEAIDVSKDILDKPIDVEKFKELMESEKLPIAISWQKDYLYFYAK
FT                   DKTLLDHHLDELLKKLMSNPEKLEGLTFDKTLDQEIELAKEKIRVTEPSAVKTKEVTL"
FT   CDS_pept        509342..511159
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0464"
FT                   /product="putative conjugal transfer protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55296"
FT                   /db_xref="GOA:A0A0H3MTP6"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP6"
FT                   /protein_id="CAZ55296.1"
FT                   /translation="MYSRQKAFVFGLLGLAFGYFCHRLTLLYDSLTNAPPMERIAYLLG
FT                   EGLNQVFNPLWLFSFTQKSFLAFILGVLTMTLVYLYVSTGQKVYREGEEYGSARFGTSK
FT                   EKRNFYSKNPFNDTILARDVRLTLLEKKKPQFDRNKNLIVIGGSGAGKTFRFVKPNLIQ
FT                   LNCSNIVVDPKDHLAEKTGKLFLENGYQVKVLDLVNMTNSDGFNPFRYVETENDLNRML
FT                   TVYFNNTKGNGSRSDPFWDEASMTLVRAIASYLVDFYNPPGSSKQEQEARRKRGRYPAF
FT                   SEIGKLIKLLSKGDNQDKSVLEVLFEDYAKKYGHENFTMRNWADFQNYKDKTLDSVIAV
FT                   TTAKFALFNIQSVIDLTQRDTMDLKTWGTQKTMVYLVIPDNDTTFRFLSALFFSTVFST
FT                   LTRQADVDFKGQLPIHVRSYLDEFANVGEIPDFAEQTSTVRSRNMSLVPILQNIAQLQG
FT                   LYKEKEAWKTILGNCDSLLYLGGNDEETFKFMSGLLGKQTIDVRSTSRSFGQTGSSSTS
FT                   HQKIARDLMTADEVGNMKRDECLVRIAGVPVFRTKKYFPLKHKNWKWLADKESDERWWH
FT                   YHINPLTAEEEVDLSGHKIRDLSTEKTLH"
FT   misc_feature    join(509360..509419,509462..509521,509534..509587)
FT                   /locus_tag="SSUBM407_0464"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0464 by TMHMM2.0 at aa 7-26, 41-60 and 65-82"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    509690..511108
FT                   /locus_tag="SSUBM407_0464"
FT                   /note="HMMPfam hit to PF02534, TraG, score 3.8e-33"
FT                   /inference="protein motif:HMMPfam:PF02534"
FT   CDS_pept        511177..511419
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0465"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55297"
FT                   /db_xref="GOA:A0A0G2PMF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMF8"
FT                   /protein_id="CAZ55297.1"
FT                   /translation="MNQKLTGFVYGVDASSMFSQAMSLLQKGLIAVGAFLVVMGIINLS
FT                   TNIKDGGPGVRNAILEIVGGVMVGAAGAFVTQITI"
FT   misc_feature    join(511261..511320,511348..511401)
FT                   /locus_tag="SSUBM407_0465"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0465 by TMHMM2.0 at aa 33-52 and 62-79"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        511438..512292
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0466"
FT                   /product="putative TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55298"
FT                   /db_xref="GOA:A0A0H3MY29"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY29"
FT                   /protein_id="CAZ55298.1"
FT                   /translation="MIMNFTSPFVFLASEKVSSDSLFEGFQVDLESTANLVKSLADFNP
FT                   TVWSYMTAITKGIMQPLGVAILAVVLVLEFSKMAKKIANSGGAMTFEAMAPMIVSYIMV
FT                   AVVITNTTVIVEAIIALASYVIEQVASLVTNGGANYDTISGIKGSGIVGKMIIGFFAIL
FT                   IWLVRMASIMVVNILITIRFIQLYLMIPFAPVTIPTFLSDDWRSVGIGYLKNIMVYAVQ
FT                   GILIFLIVSLVPLFESAGKIAVSNGAGVMESLAIMFGGLVQAILLIIALVGSQRTARSI
FT                   LGM"
FT   misc_feature    join(511588..511656,511729..511797,511870..511938,
FT                   511972..512040,512083..512151,512185..512253)
FT                   /locus_tag="SSUBM407_0466"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SSUBM407_0466 by TMHMM2.0 at aa 51-73, 98-120, 145-167,
FT                   179-201, 216-238 and 250-272"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        512354..512707
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0467"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55299"
FT                   /db_xref="GOA:A0A0H3MTU1"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTU1"
FT                   /protein_id="CAZ55299.1"
FT                   /translation="MNTRVFKDISKVQHRAWLGFTTRQVIFVFPAIVLTILVLGLNLFY
FT                   WQFGDWFVYGFVFIFTIPLMLFGVYRPNDLPFETYLRYRFHYELTVPDRTFTGRKGDQR
FT                   EKIKTLNEIKDLF"
FT   misc_feature    join(512423..512491,512504..512563)
FT                   /locus_tag="SSUBM407_0467"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0467 by TMHMM2.0 at aa 43-65 and 70-89"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        512685..515015
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55300"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2H9"
FT                   /protein_id="CAZ55300.1"
FT                   /translation="MKSKTSSNDKKQKTKTQKQEIRPSTVNTLAYQGLFQNGLMQVSPS
FT                   YFSQTYLLGDVNYQTVGLDDKGAIVEKYSDLINSLDDQTNFQLTIFNQKVNLEKFRKSI
FT                   LYPLQEDGFDAYRDELNRMMDANLEAGENNFSAVKFLSFGKSDQTPKLAFRSLSQIGEY
FT                   FKSGFSEIDVSLGLLGGEERVNVLADMLRGENHSSFSYKDLTLSGQSTKHFIAPTYLSF
FT                   KHKNHIELDERLLQIVYVRDYGMELGDKFIRDLMQSDLEVMISLHAKGSTKSETMTKLR
FT                   TKKTLMESQKIGEQQKMARTGIYLEKVGHVLENNIDEAEALLQTMTQTGDKLFDTVFLI
FT                   GVLADTEDQLKQSLDIIKQVAGSNDMIIDNLTYMQEAAFNSLLPFGKNYLEGVSRSLLT
FT                   SNIAVNAPWTSVDIQDKGGKFYGINQISSNIISIDRGKLNTPSGLILGTSGAGKGMATK
FT                   HEIISTKLKEADSDTEIIIVDPENEYSIIGQAFGGESIDIAPDSTTFLNVLDLSDENMD
FT                   EDPVKVKSEFLLSWIGKLLDRKMDGREKSLIDRVTRLTYKHFDTPSLVEWVFVLAQQPE
FT                   QEAKDLALDMELYVEGSLDIFSHRTNIKTDSHFLIYNVKKLGDELKQIALMVIFDQIWN
FT                   RVVKNQKLGKKTWIYFDEMQLLLLDKYASDFFFKLWSRVRKYGAIPTGITQNVETLLLD
FT                   ANGRRIIANSEFMILLKQAKSDREELVHMLGLSKELEKYLVNPEKGAGLIKAGSTVVPF
FT                   KNKIPQHTKLFDIMSTDPEKMRT"
FT   CDS_pept        515017..517818
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55301"
FT                   /db_xref="GOA:A0A0H3MU53"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU53"
FT                   /protein_id="CAZ55301.1"
FT                   /translation="MKEDKKLVKQARQNFRSNLKSARMHYRKEVSSLKQTVPKKGRFRK
FT                   SAKNSLFQEKKTELKGNLLSSQKEAEEKFLKEITYVSPRLLRGKEIKNYRLSQAQERLR
FT                   TARKHLSEVKLREKSKSVNPKFTFQKENSSLKSRFQFHQEKSFDRLSAEKDVSSAKREV
FT                   KQLKKVRKSKKSSTKVKAGLALAASESLDLIAQEDDLDGLRTMKDTSLKARRYGRFTFQ
FT                   AGKVAVKSGQTGVRFTKTKFSHGKERFQNFKKGKGFTRQKPLKPRRRYQTFLKLARKQS
FT                   VAGFKGIVQAIKGSMTFFSVLAGNPLTWIVSGILLILLLMMSFFMSVSGSSVIQQDEIE
FT                   LSKSYTHMTLEDAEHTRNNEKGITFYTKIDEVMVYMNHQYQDYKLDDFMEAGGVTYKAF
FT                   LSQVWTDLNGGDSIKSMSDLYKEPTYKLSDEDQEELKELTEGGNYLALQELDNPFQGQT
FT                   DEDSLSMTYRYGYEVIDEKPTLHHHIILEAKEGQVIVAPMDGKVSLDGENVVLTSGKGV
FT                   NKTKLTLFGIHSGRVSENQQVLAGDIIGQTKDGTGLKVTYQKVDDDTDKLVYVNPAFYF
FT                   PKVIQVQTTILPTIGQFGGDEFERAKAIYDYLKSKGATNQAIAAILGNWSVESSINPKR
FT                   AEGDYLSPPIGATDGSWDDEGWLSLNGPTIYNGRYPNILKRGLGLGQWTDTADGSRRHT
FT                   LLLEYAKGKHQKWYDLGLQLDFMLHGDSPYYTNWLKDFFKNSGSPASLAQLFLIYWEGN
FT                   SGDKLLERQTRASEWYYQIEKGFSQPNGGTAQSDPKALEAVRGDLFENSVPGGGDGMGY
FT                   AYGQCTWGVAARINQLGLKLKGKNGEKIPIISTMGNGQDWVRTAASLGGETGTSPQAGA
FT                   ILSFAGGGHGTPTEYGHVAFVEKVYPDGSFLISETNYNGNPNYTFRKLSGVDSSLSFAY
FT                   TTK"
FT   misc_feature    515908..515976
FT                   /locus_tag="SSUBM407_0469"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0469 by TMHMM2.0 at aa 298-320"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    516451..516732
FT                   /locus_tag="SSUBM407_0469"
FT                   /note="HMMPfam hit to PF01551, Peptidase_M23, score
FT                   0.00043"
FT                   /inference="protein motif:HMMPfam:PF01551"
FT   misc_feature    517405..517806
FT                   /locus_tag="SSUBM407_0469"
FT                   /note="HMMPfam hit to PF05257, CHAP, score 1.7e-41"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS_pept        518157..518792
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTP9"
FT                   /protein_id="CAZ55302.1"
FT                   /translation="MTYTLEWLETFDGEIDILNVDMSCLANTIEKYVSQYKYVYQTNME
FT                   NYPEIVLSVPNSSIPHLLGLSRDHHVNLPTNNAGSIFEGLKDDWTLQRLNKADNGWFNE
FT                   NKFKIVGTLLLYQMLHVMECKFYTTDGILNRKVGKRFRRDNIYFVVFKLSNGISYTVEL
FT                   SHEQGNQYFPRSLKINDTLITNCREIELKLVDKKRFKTAKVRKVNWPS"
FT   CDS_pept        518952..523847
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0471"
FT                   /product="putative glucan-binding surface-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55303"
FT                   /db_xref="GOA:A0A0H3MY34"
FT                   /db_xref="InterPro:IPR013574"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021197"
FT                   /db_xref="InterPro:IPR026345"
FT                   /db_xref="InterPro:IPR032300"
FT                   /db_xref="InterPro:IPR036234"
FT                   /db_xref="InterPro:IPR041324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY34"
FT                   /protein_id="CAZ55303.1"
FT                   /translation="MTKTCNHHFLVNQEKGEKHVFRKSKKYRTLCSVALGTMVTAVVAW
FT                   GGTVAHADEVTSSVDTAIQRTENPATNLPEAQPTPVSEQTESLGSTGQSNGAIAVTVPH
FT                   DTVAQAVEQAKVEGVSTVEDSPMDLGNTTSAAETNQQISKAEEDAQNQVEAINEVTKTY
FT                   KADKAAYVDEKVRIEQENKVLSQAYEGANQTGKETNAWVDSKVNDLKTRYADADVTVKE
FT                   QVISSGNGTSVLDYTNYGKAVETIQSTNEQAVADYLTKKTKADDIVAKNQAIQKENEAG
FT                   LAKAKADNEAIEKRNQAGQAAVDAENRAGQAAVDQANQEKQQFVSDRAAEIEAITKRNQ
FT                   EKEATARKENEAIDADNAKELERYQRDLAEISKGEEGYISEALAQALNLNNGEPQAQHG
FT                   AITRNPDQIISTGDALLGGYSRILDSTGFFVYDSFKTGETLSFNYQNLQNARFDGKKIS
FT                   RVTYEITNLVSPAGTDAVKLVVPNDPTEGFIAYRNDGNGDWRTDKMEFRVVAKYFLEDG
FT                   SQVTFSKEKPGVFTHSSLNHNDIGLEYVKDTSGKFVPINGSTVQVTNEGLARSLGSNRA
FT                   SDLNLAEEWDTTSSRYAYKGAIVSTVTSGNTYTVTFGQGDMPQDVGLSYWFALNTLPVA
FT                   RTVTPYSPKPHVTVELEPIPEPITVTPDVFTPKTFTPEKPVTFTPKPLEEVVQPSLTLT
FT                   KVTLPVKPIPKELPTPPQVPTVHYHAYRLTTTPEIMKEVVNSDQANLHEKTVAKDSTVI
FT                   YPLTVDALSPNRAQTTSLIFEDYLPTGYLFDKETTQKENGNYVLSFDETKNFVTLTAKE
FT                   NLLQEVNKDLTKVYQLNAPKLYGSVQNDGATYSNSYKLLLNKGTTNTYTVTSNVVTVRT
FT                   PGDGETTTLITPDKNNENADGVLINDTVVALGTTNHYRLIWDLDQYKGDRSAKETIARG
FT                   FFFVDDYPEEVLDVVENGTAVTTLDGQKVSGITVKNYTSLNEAPKDLQDKLARAKITPT
FT                   GAFQVFLPDDNQAFYDQYVQTGTSLALLTKMTVKDSLYGQTKTYTNKAYQVDFGNGYET
FT                   KEVTNTLVSPEPKKQNLNKDKVDINGKPMLVGTQNHYTLSWDLDQYRGIKADNSQIAQG
FT                   FYFVDDYPEEALLPDEAAIQFVTSDGKTVSGITVKAYSQLSEAPKTLQEALSKQKIQPQ
FT                   GAFQVFMPEDPQAFFESYVTKGENITIVTPMTVLETMLNSGKSYENVAYQVDFGQAYET
FT                   NTVTNFVPKVTPHKSNTNQEGISIDGKTVLPNTVNYYKIVLDYSQYKDMVVTDDVLAKG
FT                   FYMVDDYPEEALTLNPDGIQVLDKDGNRVSGISVSTYTSLSEAPKVVQDAMAKRQFTPK
FT                   GAIQVLSSDDPKAFYDTYVKTGQTLVVTLPMTVKNELTKTGGQYENTAYQIDFGLAYVT
FT                   ETVVNNVPKLDPQKDVVIDLSHKDVSLDGKEVALNQTFNYRLVGAMIPSNRATDLFEYG
FT                   FEDNYDEKHDEYNGVYRSYLMTDVTLKDGSVLKEGTEVTKYTLQQVDTENGLVSISFDK
FT                   SFLETISDDSAFQADVYLQMKRIATGQVENTYLHTVNGYVISSNTVVTHTPQPEEPSPN
FT                   QPSPPQPPIESLEPPVPASVLPNTGEQESILGLIGAGILLGTAYGLKKKEEK"
FT   sig_peptide     518952..519107
FT                   /locus_tag="SSUBM407_0471"
FT                   /note="Signal peptide predicted for SSUBM407_0471 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 1.000 between residues 52 and 53"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    519039..519107
FT                   /locus_tag="SSUBM407_0471"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0471 by TMHMM2.0 at aa 30-52"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    520059..520841
FT                   /locus_tag="SSUBM407_0471"
FT                   /note="HMMPfam hit to PF08363, GbpC, score 1.2e-119"
FT                   /inference="protein motif:HMMPfam:PF08363"
FT   misc_feature    523725..523838
FT                   /locus_tag="SSUBM407_0471"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   0.0003"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   CDS_pept        523848..524039
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0471a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0471a"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55304"
FT                   /db_xref="GOA:A0A0H3MTU6"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTU6"
FT                   /protein_id="CAZ55304.1"
FT                   /translation="MNPKTIYEKDSDQDGLTDAQELALGTNPQSVDTDGDGQADLEELQ
FT                   SGHSPLVPQKELCDGLEL"
FT   CDS_pept        524023..524574
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2I4"
FT                   /protein_id="CAZ55305.1"
FT                   /translation="MAWNFDTMKEALSEMEKVDYQEFIKAFLSLELSISNRTILNQVYQ
FT                   DYMDEDDLSLISDELRDKVDSYQDELQADMTDILEKLYRTGEGSSFIMDLMSSNSLSDT
FT                   LEQYEVLDSDDYSPLSLETLQAIIQQELAISSQDYFGDLVHLALQKDLLDQKSNFLQHY
FT                   VATVMEGIPQERDQRALVLD"
FT   CDS_pept        524624..531469
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55306"
FT                   /db_xref="GOA:A0A0H3MU58"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU58"
FT                   /protein_id="CAZ55306.1"
FT                   /translation="MNQEVLLQMMRATIPRDRALLEAFLYYQAEHFDEEWDSLIRQFLT
FT                   NRKEIKKSVQVLHFETDVSAFVQASPYDTAHDLLTYTQVFGQSGLQKLDKLSPTEKNLV
FT                   IEVALFNLATRFQLLDSNGHYQTISPDSLLQKSRGANLVNVYRVANNLADRISRDIEQF
FT                   LLTYESELETGVDETVLENEATVDEHKTSVHQAISFREDGSLIIASLDVDLSQLDVQTG
FT                   KTSHLPAYEELSLRRKFEILTYFDQIRNERSKVPSFKRGDFDTEMEMTPIFEGEELLTY
FT                   LEADGSPYELKRTLTTVEEKELEKIGRAIRIENQEKLTQLGIELSQFESDQVGILLDAA
FT                   GRFRLKNADLALLGGYPKASVTQLALATELLQMGLSHEKVEFFFGSQLSIEELRQVAYA
FT                   FLHQELSREDAEQFEKDKGNQPDLTLRDWKNKLEKAEGKEVVDEAFEVNPLVQMVLDNY
FT                   PLGTLVSYKGQDFEVTSVSDARLNGLIRIELVNDFSDIIEQNPVLYLRTWEEISQVIHI
FT                   PKPEPKVELDEPDQELNLFSFLEEETSQSVNEAVQNIGVLDPDGSEKGHNDTDLEDTDN
FT                   QIPEEEVVEIIPDSPVTDFHFPEDLTVFYPKTARDKVETNIAAIRLVKILEAERRKASP
FT                   SEQELLAKYVGWGGLANEFFDDYNPKFSKEREELKNLVSDKEYSDMKQSSLTAYYTDPA
FT                   LIRQMWDKLERDGFTGGKILDPSMGTGNFFAAMPKHLREKSELYGVELDTITGAIAKHL
FT                   HPTSHIEIKGFETVAFNDNSFDLVISNVPFANIRIADNRYNKPYMIHDYFVKKSLDLVH
FT                   DGGQVAIISSTGTMDKRTENILQDIRETTEFLGGVRLPDSAFKAIAGTSVTTDMLFFQK
FT                   HLDKGYVTDDLAFLGSVRYDKDSRIWLNPYFDGKYNSQVLGTYEVRNFNGGTLSVKGTS
FT                   DNLIASVQTALNHVKAPREIDRNDIIINPNVLTEQVMDTSIPAEIRENLGQYSFGYQGS
FT                   TVYYRDNKGIRVGTKTEEISYYVDEEGNFKAWDTKHSQKQIDRFNALEVTDNTALDVYV
FT                   TDDAAKRGQFKGYYKKTVFYEAPLSDKEVARIKGMVDIRNAYQEVIAIQRHYDYDKKTF
FT                   SHLLGKLNRTYDSFVKRYGYLNSAVNRNLFDSDDKYSLLASLEDESLDPSGKSVIYTKS
FT                   LAFEKALVRPEKEVKKVHTALDALNSSLADGRGVDFAYMMSIYQVESKMTLIEELGDLI
FT                   MPDPEKYLNGELSYVSRQDFLSGDVVTKLEVVDLFVKQDDQDFNWPHYAGLLETVKPAR
FT                   ITLADIDYRIGSRWIPLSVYGKFAQETFMGKAFDLSDQEVVTVLEVSPIDGVITYQSKF
FT                   AYTYSNATDRSLGVPASRYDSGRKIFENLLNSNQPTITKQVVEGDKKKNVTDVEKTTVL
FT                   RAKETHLQELFQDFVAKYPEVQQIIEDTYNRLYNRTVSKTYDGSHLTIDGLAQNISLRP
FT                   HQKNAIQRIVEEKRALLAHEVGSGKTLTMLGAGFKLKELGMVHKPLYVVPSSLTAQFGQ
FT                   EIMKFFPTKKVYVTTKKDFAKAKRKQFVSRIITGDYDAIVIGDSQFEKIPMSREKQVTY
FT                   INDKLEQLREIKLGSDSDYTVKEAERSIKGLEHQLEELQKLERDTFIEFENLGIDFLFV
FT                   DEAHHFKNIRPITGLGNVAGITNTTSKKNVDMEMKVRQVQAEHGDRNVVFATGTPVSNS
FT                   ISELFTMMNYIQPDVLERYQVSNFDSWVGAFGNIENSMELAPTGDKYQPKKRFKKFVNL
FT                   PELMRIYKETADIQTSDMLDLPVPEAKIIAVESELTQAQKYYLEELVERSDAIKSGSVD
FT                   PSRDNMLKITGEARKLAIDMRLIDPAYSLSDNQKILQVVDNVERIYREGAGDKATQMIF
FT                   SDIGTPKSKEDGFDVYNELKDLLVDRGIPKEEIAFVHDANTDEKKNSLSRKVNSGEVRI
FT                   LMASTEKGGTGLNVQSRMKAVHHLDVPWRPSDIVQRNGRLIRQGNMHQEVDIYHYITKG
FT                   SFDNYLWQTQENKLKYITQIMTSKDPVRSAEDIDEQTMTASDFKALATGNPYLKLKMEL
FT                   ENELTVLENQKRAFNRSKDEYRHTISYSEKNLPIMEKRLSQYDKDIAQSLTTKSQDFVM
FT                   RFDNQSMDNRSEAGDYLRKLITYNRSETKEVRTLASFRGFDLKMTTRGLSEPLPETISL
FT                   MIVGDNQYTVALDLKSDVGTIQRISNAIDHIIDDQEKTEGLVKDLKDKLRVAKVEVEKV
FT                   FPKEEDYQLVKAKYDVLAPLVEKEEEIEVIDAALAKFSEETTAQMKQQIALEI"
FT   misc_feature    526625..527479
FT                   /locus_tag="SSUBM407_0473"
FT                   /note="HMMPfam hit to PF02384, N6_Mtase, score 4.5e-05"
FT                   /inference="protein motif:HMMPfam:PF02384"
FT   misc_feature    528989..529096
FT                   /locus_tag="SSUBM407_0473"
FT                   /note="HMMPfam hit to PF04851, ResIII, score 9.5e-10"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    530318..530554
FT                   /locus_tag="SSUBM407_0473"
FT                   /note="HMMPfam hit to PF00271, Helicase_C, score 0.00097"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS_pept        531540..531839
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTQ3"
FT                   /protein_id="CAZ55307.1"
FT                   /translation="MTQTLEEMRYQLEEWLAQGYTSPEDRANYQNLKEQYEDETLDYSF
FT                   SRREITGQLELIITSRENDFPNLDEVTKAEYLDLVAQLDDLDKRQADYYRKQLA"
FT   CDS_pept        531853..532152
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0475"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55308"
FT                   /db_xref="GOA:A0A0H3MY39"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY39"
FT                   /protein_id="CAZ55308.1"
FT                   /translation="MLEQILQSLLIIAAIGLMLLVLYQIVKVSGALFLIGLISGLVFIE
FT                   IYGIYLFFTERYLYSEDLATNGIWSFTGFFIIFNILLVLGLMTNLVKSRITEYK"
FT   misc_feature    join(531862..531930,531943..532011,532054..532122)
FT                   /locus_tag="SSUBM407_0475"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0475 by TMHMM2.0 at aa 4-26, 31-53 and 68-90"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(532197..533084)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0476"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55309"
FT                   /db_xref="GOA:A0A0H3MTU9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTU9"
FT                   /protein_id="CAZ55309.1"
FT                   /translation="MDYTIISNYLDYCKAHKRLSTHTLRAYKNDLMQFYNSNNECVISY
FT                   IEGLTHSNLKTSTLRRKIASLKVFYGYLQLKNVITDNPFNQLRFQFRAEKTLPKTISHD
FT                   SLKILYTYLQKKMISAKTIYQKQKAERNLLIVSLLLSTGIRISELCHIQIKDINLTEQT
FT                   LQILGKGKKERMIFIGDERTFQLLKAYITCYCNHTDDYLFPGKSLQKPLTEQSVRLLLK
FT                   TAKTQTRLTTTITPHMFRHSFATMLLDNDVDIRYIQQILGHSSISITQIYTHVSQSRQK
FT                   EILSSYNPISSIYT"
FT   misc_feature    complement(532239..532718)
FT                   /locus_tag="SSUBM407_0476"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   2.4e-38"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   misc_feature    complement(532854..533069)
FT                   /locus_tag="SSUBM407_0476"
FT                   /note="HMMPfam hit to PF02899, Phage_integr_N, score
FT                   1.7e-06"
FT                   /inference="protein motif:HMMPfam:PF02899"
FT   CDS_pept        533176..534126
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0477"
FT                   /product="putative D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55310"
FT                   /db_xref="GOA:A0A0H3N2I9"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2I9"
FT                   /protein_id="CAZ55310.1"
FT                   /translation="MKLVVILNVNPDPNVHEKISDNREYTRRELKNILKENFSKFVKEV
FT                   TFYDNFEHFKINVQKHHNDFVLNFDFGYKSRTRNMNVPAFCENYNIKYFNPDPYVQVLC
FT                   QDKFMTEKFAENFGVTVPNSLLVFKHSYQKNLLKDLNYPLIIKPNYESESIGITQDSIV
FT                   ENPGDADTIIGKLFKEFDGILVEEYIEGKEVAITIWDNGEEIFFEEVELIFPRLEEIKY
FT                   QAYTSEIKQKIGIEIKKSCYLSDKDIINLKQLYKNLSPNKLIRIDGRIKNSKFYLIEIN
FT                   ANPGLYPKSVVPKTFLINGYDYETMLKKLFSVHLN"
FT   CDS_pept        complement(534107..535402)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0478"
FT                   /product="hypothetical protein"
FT                   /note="Possible gene remnant. CDS is possibly disrupted by
FT                   the insertion of a Tn916 element"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU63"
FT                   /protein_id="CAZ55311.1"
FT                   /translation="MFLIEKNLLEQVENFVFLPNSVSEIVRQESYFRTEKAFVGSSLIR
FT                   FLNLKISKTNKFEYLDTLVDYYIDSKNLLQIKPIIPQIRERLLNFDSQQGRREYFEKFF
FT                   LNRQRFIEKDNSFALSFTKIAYDANLYHEALEFINLSSKVTDDVIFAKSLILNRCELFI
FT                   ESIAYIQKNITSLSEQSSQFFKLSLIKLMNLIQLERRDEAKTIFESIKSQVDNPYYPFL
FT                   IRISNVFESSFSERLRMVEEISDRIYNQGNAEFSGLNAIYLSYLYAVNGKIMNAEEHLD
FT                   KARYFFGEKLIYNHMILHNEATIKFHNNDIDESIPELLNNAKLTAYDQYDLLAIYNNLL
FT                   VYYILSERVADINCQMLVLELEELLNETGFKRFVDKIYYNLYHYYNKMYNVDKAEVYNN
FT                   KLTHHQIKNFKEYNVRLMYETSWKLPLSLDGH"
FT   misc_feature    535397..553430
FT                   /note="Tn916"
FT   CDS_pept        complement(535571..536788)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0479"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55312"
FT                   /db_xref="GOA:A0A0G2PMF9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004191"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMF9"
FT                   /protein_id="CAZ55312.1"
FT                   /translation="MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLV
FT                   ATDRVPAGKRDCISLREKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTET
FT                   GRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAI
FT                   QDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKT
FT                   GLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQA
FT                   FKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHI
FT                   TPHSLRHTFCTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQ
FT                   QERLVA"
FT   misc_feature    complement(535622..536194)
FT                   /locus_tag="SSUBM407_0479"
FT                   /note="HMMPfam hit to PF00589, Phage_integrase, score
FT                   1.9e-62"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   misc_feature    complement(536582..536782)
FT                   /locus_tag="SSUBM407_0479"
FT                   /note="HMMPfam hit to PF02920, Integrase_DNA, score
FT                   5.4e-43"
FT                   /inference="protein motif:HMMPfam:PF02920"
FT   CDS_pept        complement(536870..537073)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0479a"
FT                   /product="excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0479a"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55313"
FT                   /db_xref="GOA:A0A0G2PMG9"
FT                   /db_xref="InterPro:IPR015122"
FT                   /db_xref="InterPro:IPR038148"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMG9"
FT                   /protein_id="CAZ55313.1"
FT                   /translation="MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIM
FT                   NGNRIQIKRKQFEKIIDTLDAI"
FT   CDS_pept        complement(537534..537764)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55314"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PME9"
FT                   /protein_id="CAZ55314.1"
FT                   /translation="MKTQYPMIPFPLIVKATDGDTEAINQILHHYRGYITKRSLRLMKD
FT                   EYGNQSMVVDEVLRGRMETRLITKILSFEIK"
FT   CDS_pept        complement(537761..538183)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0481"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55315"
FT                   /db_xref="GOA:A0A0G2PME2"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PME2"
FT                   /protein_id="CAZ55315.1"
FT                   /translation="MKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVSFSD
FT                   VGDYLVSQFATTDNYSTDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYFMDM
FT                   SDSEIADLLKLNRSTVYRHRTSGLALIKKFMEEFEE"
FT   misc_feature    complement(537791..537952)
FT                   /locus_tag="SSUBM407_0481"
FT                   /note="HMMPfam hit to PF08281, Sigma70_r4_2, score 3.1e-10"
FT                   /inference="protein motif:HMMPfam:PF08281"
FT   CDS_pept        538688..539041
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0482"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55316"
FT                   /db_xref="GOA:A0A0H3MTQ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041511"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTQ8"
FT                   /protein_id="CAZ55316.1"
FT                   /translation="MRKKEDKYDFRAFGLAIKEARLKRGLTREQVGALIEIDPRYLTNI
FT                   ENKGQHPSIQVLYDLVSLLHVSVDEFFLPANNLVKSTRRLQIEKYMDSFTDKELSLMES
FT                   LASGINEARNIED"
FT   misc_feature    538736..538900
FT                   /locus_tag="SSUBM407_0482"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 5e-14"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        complement(539387..541306)
FT                   /transl_table=11
FT                   /gene="tetM1"
FT                   /locus_tag="SSUBM407_0483"
FT                   /product="tetracycline resistance protein TetM 1"
FT                   /note="Similar to SSUBM4070983, 94.8% identity (98.7%
FT                   similar) in 639 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55317"
FT                   /db_xref="GOA:A0A0H3MY43"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035650"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY43"
FT                   /protein_id="CAZ55317.1"
FT                   /translation="MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDN
FT                   TLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDG
FT                   VQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPN
FT                   MCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAK
FT                   SNIGIDNLIEVITNKFYSSTHRGQSELCGNVFKIEYTKKRQRLAYIRLYSGVLHLRDSV
FT                   RVSEKEKIKVTEMYTSINGELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLPQRKKIE
FT                   NPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKVQMEVI
FT                   SALLQEKYHVEIELKEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLPLGSGM
FT                   QYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFR
FT                   MLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVI
FT                   LSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMF
FT                   NKIT"
FT   misc_feature    complement(539444..539707)
FT                   /gene="tetM1"
FT                   /locus_tag="SSUBM407_0483"
FT                   /note="HMMPfam hit to PF00679, EFG_C, score 2.1e-21"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   misc_feature    complement(539711..540061)
FT                   /gene="tetM1"
FT                   /locus_tag="SSUBM407_0483"
FT                   /note="HMMPfam hit to PF03764, EFG_IV, score 1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    complement(540323..540520)
FT                   /gene="tetM1"
FT                   /locus_tag="SSUBM407_0483"
FT                   /note="HMMPfam hit to PF03144, GTP_EFTU_D2, score 3e-08"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    complement(540581..541306)
FT                   /gene="tetM1"
FT                   /locus_tag="SSUBM407_0483"
FT                   /note="HMMPfam hit to PF00009, GTP_EFTU, score 2.8e-84"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    complement(541130..541177)
FT                   /gene="tetM1"
FT                   /locus_tag="SSUBM407_0483"
FT                   /note="ScanRegExp hit to PS00301, EFACTOR_GTP, score 8e-5"
FT                   /inference="protein motif:Prosite:PS00301"
FT   CDS_pept        complement(541683..542615)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0484"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55318"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTV2"
FT                   /protein_id="CAZ55318.1"
FT                   /translation="MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVLL
FT                   GLSFSFAIFKHFTAIDTHTIHETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDN
FT                   RMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLITE
FT                   GENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNEI
FT                   NEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVE
FT                   YIDQQTKATQVSQFDLVLEKNGSNWKIIE"
FT   misc_feature    complement(542454..542507)
FT                   /locus_tag="SSUBM407_0484"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0484 by TMHMM2.0 at aa 37-54"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(542460..542615)
FT                   /locus_tag="SSUBM407_0484"
FT                   /note="Signal peptide predicted for SSUBM407_0484 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.898) with
FT                   cleavage site probability 0.833 between residues 52 and 53"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(542612..543613)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0485"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55319"
FT                   /db_xref="GOA:A0A0G2PME6"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PME6"
FT                   /protein_id="CAZ55319.1"
FT                   /translation="MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVN
FT                   VSAEVLAHKPMVEKYAKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLST
FT                   EESIKQGVKYFSELLASSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSK
FT                   EYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKY
FT                   EGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVF
FT                   FHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ"
FT   misc_feature    complement(542624..542944)
FT                   /locus_tag="SSUBM407_0485"
FT                   /note="HMMPfam hit to PF00877, NLPC_P60, score 1.1e-54"
FT                   /inference="protein motif:HMMPfam:PF00877"
FT   sig_peptide     complement(543527..543613)
FT                   /locus_tag="SSUBM407_0485"
FT                   /note="Signal peptide predicted for SSUBM407_0485 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 0.998 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(543527..543595)
FT                   /locus_tag="SSUBM407_0485"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0485 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(543610..545787)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0486"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55320"
FT                   /db_xref="GOA:A0A0H3N2J5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2J5"
FT                   /protein_id="CAZ55320.1"
FT                   /translation="MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQA
FT                   AGLVDDTVNVANEYSRYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIW
FT                   TISLYVSNATGYLVQEAYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLI
FT                   LVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNAS
FT                   LSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLS
FT                   TSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGI
FT                   MIFSQVLFIIYAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSIS
FT                   TMLYTLSAGYPFFLIAFLQIVTFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLM
FT                   HAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRI
FT                   GQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKA
FT                   DRASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNI
FT                   QTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKE
FT                   RPSTVQRVPLQNTRSRPPIKTATIKKVGKKP"
FT   misc_feature    complement(join(544498..544566,544576..544644,
FT                   544681..544749,544762..544830,545179..545232,
FT                   545260..545328,545449..545517,545659..545727))
FT                   /locus_tag="SSUBM407_0486"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SSUBM407_0486 by TMHMM2.0 at aa 21-43, 91-113, 154-176,
FT                   186-203, 320-342, 347-369, 382-404 and 408-430"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(545653..545787)
FT                   /locus_tag="SSUBM407_0486"
FT                   /note="Signal peptide predicted for SSUBM407_0486 by
FT                   SignalP 2.0 HMM (Signal peptide probability 1.000) with
FT                   cleavage site probability 1.000 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(545790..548237)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55321"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMD6"
FT                   /protein_id="CAZ55321.1"
FT                   /translation="MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDS
FT                   FRQLIAQNRDGKIHALQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIG
FT                   ENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILR
FT                   FQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLI
FT                   KYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFT
FT                   FPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETN
FT                   LDQSKESMYKLSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLP
FT                   ASKRYMNDYIQYVTSDFLAGLGFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVK
FT                   GSVTNALASAFVGSLGGGKSFANNLIVYYAVLYGAQAVIVDPKAERGRWKETLPEISHE
FT                   INIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGISSRDGERFPILRKAIRA
FT                   VTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQL
FT                   NIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWS
FT                   FLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIK
FT                   KTLAFFGVDPEDENNQKRLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVR
FT                   KEV"
FT   CDS_pept        complement(548221..548727)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0488"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55322"
FT                   /db_xref="GOA:A0A0G2PMG1"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMG1"
FT                   /protein_id="CAZ55322.1"
FT                   /translation="MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSY
FT                   TSIWSVEKVLYSINDFRLPFPITFTQMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGI
FT                   PVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVRSEF
FT                   YGISN"
FT   misc_feature    complement(join(548389..548442,548461..548529,
FT                   548632..548700))
FT                   /locus_tag="SSUBM407_0488"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SSUBM407_0488 by TMHMM2.0 at aa 7-29, 64-86 and 93-110"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(548647..548727)
FT                   /locus_tag="SSUBM407_0488"
FT                   /note="Signal peptide predicted for SSUBM407_0488 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.896) with
FT                   cleavage site probability 0.895 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS_pept        complement(548702..549199)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0489"
FT                   /product="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55323"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="InterPro:IPR041893"
FT                   /db_xref="InterPro:IPR041895"
FT                   /db_xref="InterPro:IPR041896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMH0"
FT                   /protein_id="CAZ55323.1"
FT                   /translation="MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEE
FT                   YAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDI
FT                   IIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEI
FT                   VY"
FT   misc_feature    complement(548705..549187)
FT                   /locus_tag="SSUBM407_0489"
FT                   /note="HMMPfam hit to PF07275, ArdA, score 3.1e-81"
FT                   /inference="protein motif:HMMPfam:PF07275"
FT   CDS_pept        complement(549316..549537)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0490"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55324"
FT                   /db_xref="GOA:A0A0G2PMD5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMD5"
FT                   /protein_id="CAZ55324.1"
FT                   /translation="MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLII
FT                   AIIAVGLVFNAAGVKDILLELFNRIIGA"
FT   misc_feature    complement(join(549364..549423,549442..549510))
FT                   /locus_tag="SSUBM407_0490"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0490 by TMHMM2.0 at aa 10-32 and 39-58"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(549580..550785)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0491"
FT                   /product="replication initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55325"
FT                   /db_xref="GOA:A0A0G2PME8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PME8"
FT                   /protein_id="CAZ55325.1"
FT                   /translation="MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIET
FT                   GKVKPSEDLQQSLWEALERFNPDAPLEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLH
FT                   EDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEFFMDV
FT                   LVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGELVRKEEKECM
FT                   GNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLV
FT                   YDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQ
FT                   RTLNWLSHQVAPTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITT
FT                   KK"
FT   misc_feature    complement(549610..550284)
FT                   /locus_tag="SSUBM407_0491"
FT                   /note="HMMPfam hit to PF02486, Rep_trans, score 4.7e-96"
FT                   /inference="protein motif:HMMPfam:PF02486"
FT   misc_feature    complement(550627..550728)
FT                   /locus_tag="SSUBM407_0491"
FT                   /note="HMMPfam hit to PF01381, HTH_3, score 2.9e-06"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS_pept        complement(550963..552348)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0492"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55326"
FT                   /db_xref="GOA:A0A0H3MU68"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU68"
FT                   /protein_id="CAZ55326.1"
FT                   /translation="MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINW
FT                   QDFNLSQADKIDIPYLIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENK
FT                   WYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEK
FT                   KLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLP
FT                   HMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLS
FT                   CIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVM
FT                   NKLKQIVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDV
FT                   QKDFFLKRIKGRGYVDVGTSVISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVA
FT                   GVD"
FT   misc_feature    complement(551251..551799)
FT                   /locus_tag="SSUBM407_0492"
FT                   /note="HMMPfam hit to PF01580, FtsK_SpoIIIE, score 1.3e-57"
FT                   /inference="protein motif:HMMPfam:PF01580"
FT   misc_feature    complement(join(552112..552177,552238..552306))
FT                   /locus_tag="SSUBM407_0492"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SSUBM407_0492 by TMHMM2.0 at aa 15-37 and 58-79"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(552377..552763)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55327"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMG2"
FT                   /protein_id="CAZ55327.1"
FT                   /translation="MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERT
FT                   YDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADD
FT                   IVLTKDSSSFKAQPQAKKEPTQDK"
FT   misc_feature    complement(552443..552757)
FT                   /locus_tag="SSUBM407_0493"
FT                   /note="HMMPfam hit to PF06125, DUF961, score 6.1e-69"
FT                   /inference="protein motif:HMMPfam:PF06125"
FT   CDS_pept        complement(552779..553093)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55328"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTR4"
FT                   /protein_id="CAZ55328.1"
FT                   /translation="MELKFVIPNMEKTFGNLEFAGEDKVVQRRINGRLTVLSRSYNLYS
FT                   DVQRADDIVVVLPAEAGEKHFGFEERVKLVNPRITAEGYKIGTRGFTNYLLHADDMIKE
FT                   "
FT   misc_feature    complement(552785..553090)
FT                   /locus_tag="SSUBM407_0494"
FT                   /note="HMMPfam hit to PF06125, DUF961, score 1.6e-66"
FT                   /inference="protein motif:HMMPfam:PF06125"
FT   CDS_pept        complement(553409..554452)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0495"
FT                   /product="hypothetical protein"
FT                   /note="gene remnant. CDS is possibly disrupted by the
FT                   insertion of a Tn916 element"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55329"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY47"
FT                   /protein_id="CAZ55329.1"
FT                   /translation="MEFINRKHLLQELKNEYKQHLKTGNSHIYIIRASSGIGKSEFIKE
FT                   ITKGFSKIPIEILHLEDTEEFSTFRRFVIELDKLSYSNKYLDFKSFYQRKINSSKAMQL
FT                   LLKISSFFGQAVLVKKAQENGLEFLASEFNLPSLVVEHREYETFILKAQTENLFEYAKY
FT                   VLDHSNLYFNFPNASKIEQESLDLLNKLIIKSKGSIFIFECADEKIENSFKNSCNITLK
FT                   TYQLEKLSEEHIKLYINLLSEQLGLQIEQVDFMVLQDSIRKGDLSEISIILKDFSERLK
FT                   EDNASQLQSIYQIIENISRTQLVFLILTLYTKGKLQLKELKEIMLETDKTFSSDDVDFL
FT                   FKNSIKI"
FT   CDS_pept        554587..555225
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0496"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55330"
FT                   /db_xref="GOA:A0A0H3MTV7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTV7"
FT                   /protein_id="CAZ55330.1"
FT                   /translation="MLNKVKARFLIGVGGLIAVSFMVMIGYTIGSQTISKQTENQIRAE
FT                   ANKLVSKKKQEERATVLSDELVKEFLTQYFTKVQLGENNARIKPYMTDSAFSEEEARQN
FT                   KAINQVYKDYMLDYRFESASIYVNTESHVALAEVSYQVTYVSDLSEQQQRTTQTETKTV
FT                   MLSYSKVSDKLLVNQLTIWNGKLEDMKEATDGANSSIPTIQGTTTSENN"
FT   sig_peptide     554587..554679
FT                   /locus_tag="SSUBM407_0496"
FT                   /note="Signal peptide predicted for SSUBM407_0496 by
FT                   SignalP 2.0 HMM (Signal peptide probability 0.977) with
FT                   cleavage site probability 0.586 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    554605..554673
FT                   /locus_tag="SSUBM407_0496"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SSUBM407_0496 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        555264..556340
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0497"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55331"
FT                   /db_xref="GOA:A0A0H3N2K1"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N2K1"
FT                   /protein_id="CAZ55331.1"
FT                   /translation="MTRIKAVKQKAILDVAESLGYSFRRLSGQIYEHPDHDSFRIFADT
FT                   NTFKWFSRDIQGDVIDFVQLVAGVTFKEAVSYLETGDFEQAKLVEETYQPFQYYLHEEP
FT                   FQQARIYLKDIRGLSDQTINTFGRQGLLAQATYQSEPVLVLKSYDHNGTLQAASLQGLV
FT                   KNEEKHDRGYLKKIMKGSHGYVGISFDIGNPKRLIFCESVIDMMSYYQLYKKQLSDVRL
FT                   ISMEGLKLSVIAYQTLRLAAEEQGKLAFLDTVKPSRLSHYLQAIQETTTFFQTHSNVIT
FT                   MAVDNDEAGREFCQKLSDKGLPITKDLPPLQRLETKSDWNDIVKQQSELSLSDFIQTAQ
FT                   AQVNKNHPPPKWKHALEL"
FT   misc_feature    555555..555644
FT                   /locus_tag="SSUBM407_0497"
FT                   /note="HMMPfam hit to PF08275, Toprim_N, score 0.00058"
FT                   /inference="protein motif:HMMPfam:PF08275"
FT   misc_feature    555990..556055
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1065.000, SD 2.81 at aa 243-264, sequence
FT                   EEQGKLAFLDTVKPSRLSHYLQ"
FT                   /inference="protein motif:helixturnhelix:EMBOSS"
FT   CDS_pept        556394..556621
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MU73"
FT                   /protein_id="CAZ55332.1"
FT                   /translation="MSVIERLAEKVARQEEKVSRETEKLEHYRDQLQTAMYSTFIKRQQ
FT                   SSQLSFHEALEQAFGKETTLHSNYRNEDTE"
FT   CDS_pept        556618..557007
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTR9"
FT                   /protein_id="CAZ55333.1"
FT                   /translation="MSKTWNFDQPLDDVKSTSSHEERAKIAALFHKQDEKPIEEVDYVA
FT                   AFEQQQKESKYKDDQTLASTVKQSQPKKVNITSDYKQHLADTIAQNNKDISACQKQIEE
FT                   LHQLIDEKKIQNKKLQAISVAIDDL"
FT   CDS_pept        556997..557353
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MY52"
FT                   /protein_id="CAZ55334.1"
FT                   /translation="MIYKSGSPMRATFLQLKEKIMKFFQKKKQNQDQFKRLIHRLSEMS
FT                   DTELTKVEQLLDVVFDTNFKPDRNVELSQSVINDEEQSLDKSIQEAKNKLNMEQFEKNI
FT                   ERFRQGRRESNNNK"
FT   CDS_pept        complement(557362..557670)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MTW0"
FT                   /protein_id="CAZ55335.1"
FT                   /translation="MNQLDFNKNQLQMDYFSDSYRKFEADFYRYSALDTPLTFLTDDIM
FT                   LAMAKSQKSYFKLNKENAKDYQDHYFMFNVEPSRDNNLVRLYCYDSTMTHISKNRPK"
FT   CDS_pept        complement(557657..558007)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_0502"
FT