(data stored in ACNUC7421 zone)

EMBL: FM252033

ID   FM252033; SV 1; circular; genomic DNA; STD; PRO; 24579 BP.
XX
AC   FM252033;
XX
PR   Project:PRJEA32237;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Streptococcus suis BM407 plasmid pBM407, strain BM407
XX
KW   .
XX
OS   Streptococcus suis BM407
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
OG   Plasmid pBM407
XX
RN   [1]
RP   1-24579
RA   Holden M.T.G.;
RT   ;
RL   Submitted (20-OCT-2008) to the INSDC.
RL   Holden M.T.G., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.pone.0006072.
RX   PUBMED; 19603075.
RA   Holden M.T.G., Hauser H., Sanders M., Ngo T.H., Cherevach I., Cronin A.,
RA   Goodhead I., Mungall K., Quail M.A., Price C., Rabbinowitsch E., Sharp S.,
RA   Croucher N.J., Chieu T.B., Mai N.T.H., Diep T.S., Chinh N.T., Kehoe M.,
RA   Leigh J.A., Ward P.N., Dowson C.G., Whatmore A.M., Chanter N., Iversen P.,
RA   Gottschalk M., Slater J.D., Smith H.E., Spratt B.G., Xu J., Ye C.,
RA   Bentley S.D., Barrell B.G., Schultsz C., Maskell D.J., Parkhill J.;
RT   "Rapid evolution of virulence and drug resistance in the emerging zoonotic
RT   pathogen Streptococcus suis";
RL   PLoS One 4(7):e6072-e6072(2009).
XX
DR   MD5; eec72713280df4099ca73243de3fbb9d.
DR   BioSample; SAMEA2272697.
DR   EnsemblGenomes-Gn; SSUBM407_p006.
DR   EnsemblGenomes-Gn; SSUBM407_p008.
DR   EnsemblGenomes-Gn; SSUBM407_p017.
DR   EnsemblGenomes-Tr; SSUBM407_p006.
DR   EnsemblGenomes-Tr; SSUBM407_p008.
DR   EnsemblGenomes-Tr; SSUBM407_p017.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC3227697; 22026465.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..24579
FT                   /organism="Streptococcus suis BM407"
FT                   /plasmid="pBM407"
FT                   /strain="BM407"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam:Ho Chi Minh City"
FT                   /isolation_source="human case of meningitis"
FT                   /collection_date="2004"
FT                   /db_xref="taxon:568814"
FT   CDS_pept        1..897
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p001"
FT                   /product="delta protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p001"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55651"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MUT2"
FT                   /protein_id="CAZ55651.1"
FT                   /translation="MIQYYYTKKEWGVVMEKEELKILEELRRILSNKNEAIVILNNYFK
FT                   GGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTFKVELPRVNFYEGLKNGN
FT                   LASSIVHLTDNLDLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTV
FT                   PTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLV
FT                   DTDSATIKSNLEELYKQHKEDNLVFQNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYKN
FT                   VFFEMLERIIQLENEKE"
FT   misc_feature    115..777
FT                   /locus_tag="SSUBM407_p001"
FT                   /note="HMMPfam hit to PF01656, CbiA, score 1.2e-36"
FT                   /inference="protein motif:HMMPfam:PF01656"
FT   CDS_pept        989..1204
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p002"
FT                   /product="omega protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p002"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55653"
FT                   /db_xref="GOA:A0A0H3N3R4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR011686"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N3R4"
FT                   /protein_id="CAZ55653.1"
FT                   /translation="MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETA
FT                   KNGGNVKEVMDQALEEYIRKYLPDKL"
FT   misc_feature    989..1201
FT                   /locus_tag="SSUBM407_p002"
FT                   /note="HMMPfam hit to PF07764, Omega_Repress, score
FT                   9.9e-54"
FT                   /inference="protein motif:HMMPfam:PF07764"
FT   CDS_pept        1221..1493
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p003"
FT                   /product="epsilon-antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p003"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55655"
FT                   /db_xref="GOA:A0A0H3MV38"
FT                   /db_xref="InterPro:IPR015090"
FT                   /db_xref="InterPro:IPR035569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MV38"
FT                   /protein_id="CAZ55655.1"
FT                   /translation="MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVN
FT                   LLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA"
FT   misc_feature    1224..1490
FT                   /locus_tag="SSUBM407_p003"
FT                   /note="HMMPfam hit to PF08998, Epsilon_antitox, score
FT                   7.3e-68"
FT                   /inference="protein motif:HMMPfam:PF08998"
FT   CDS_pept        1495..2358
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p004"
FT                   /product="toxin of epsilon-zeta postsegregational killing
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p004"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55657"
FT                   /db_xref="GOA:A0A0H3MZ42"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MZ42"
FT                   /protein_id="CAZ55657.1"
FT                   /translation="MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSG
FT                   KTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIIS
FT                   RLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMY
FT                   ADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISP
FT                   KETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKT
FT                   PKLPGI"
FT   misc_feature    1513..2175
FT                   /locus_tag="SSUBM407_p004"
FT                   /note="HMMPfam hit to PF06414, Zeta_toxin, score 1.8e-124"
FT                   /inference="protein motif:HMMPfam:PF06414"
FT   repeat_region   2609..2631
FT                   /note="inverted repeat"
FT   repeat_region   complement(2628..3394)
FT                   /note="IS1216 element"
FT   CDS_pept        complement(2663..3349)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p005"
FT                   /product="IS1216, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p005"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55659"
FT                   /db_xref="GOA:A0A0G2PMD9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMD9"
FT                   /protein_id="CAZ55659.1"
FT                   /translation="MTMNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVS
FT                   HTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDI
FT                   WLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKY
FT                   LNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKV
FT                   LLGIPA"
FT   misc_feature    complement(2696..3151)
FT                   /locus_tag="SSUBM407_p005"
FT                   /note="HMMPfam hit to PF00665, rve, score 4.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(3077..3118)
FT                   /locus_tag="SSUBM407_p005"
FT                   /note="ScanRegExp hit to PS00213, LIPOCALIN, score NA"
FT                   /inference="protein motif:Prosite:PS00213"
FT   repeat_region   complement(3395..3417)
FT                   /note="inverted repeat"
FT   CDS_pept        complement(3418..4065)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p006"
FT                   /product="putative response regulator (fragment)"
FT   misc_feature    complement(3418..3618)
FT                   /locus_tag="SSUBM407_p006"
FT                   /note="HMMPfam hit to PF04397, LytTR, score 3.4e-15"
FT                   /inference="protein motif:HMMPfam:PF04397"
FT   misc_feature    complement(3694..4062)
FT                   /locus_tag="SSUBM407_p006"
FT                   /note="HMMPfam hit to PF00072, Response_reg, score 5e-07"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   CDS_pept        complement(4069..4401)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p007"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p007"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55662"
FT                   /db_xref="GOA:A0A0H3MUT6"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MUT6"
FT                   /protein_id="CAZ55662.1"
FT                   /translation="MNFLIVNKDDISMKLFLEDIFYISSDTTKPHMLKAVTESGVFEFY
FT                   GTLKDLEDKLKLNFFRCHRKFLVNIDKIQGLNLSERLIVFTNDGVGTISFSRYKQKELN
FT                   KLWRRG"
FT   misc_feature    complement(4078..4374)
FT                   /locus_tag="SSUBM407_p007"
FT                   /note="HMMPfam hit to PF04397, LytTR, score 3.7e-23"
FT                   /inference="protein motif:HMMPfam:PF04397"
FT   CDS_pept        4591..4959
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p008"
FT                   /product="putative response regulator (fragment)"
FT                   /db_xref="PSEUDO:CAZ55664.1"
FT   CDS_pept        complement(4988..5578)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p009"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p009"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55666"
FT                   /db_xref="GOA:A0A0H3MUS8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MUS8"
FT                   /protein_id="CAZ55666.1"
FT                   /translation="MSRIGYIRISSKDQNLDRQVENLSDVFKVFSDKLSGKDKNRPGLE
FT                   ELLSFIREGDIVVVSELDRLGRNNKELTEVISMIHSKGATLEILSFPSLIGIKDDNLRR
FT                   LLNNLIIEIYKYQAEAERVRLLERQRQGIEIAKRKGKYKGRKPLFTSASPQLQHAFELF
FT                   KSGCSDRDIEDLVGINARTFRRYREKFGIKRTT"
FT   misc_feature    complement(5153..5572)
FT                   /locus_tag="SSUBM407_p009"
FT                   /note="HMMPfam hit to PF00239, Resolvase, score 7.4e-42"
FT                   /inference="protein motif:HMMPfam:PF00239"
FT   misc_feature    complement(5381..5419)
FT                   /locus_tag="SSUBM407_p009"
FT                   /note="ScanRegExp hit to PS00398, RECOMBINASES_2, score
FT                   8e-5"
FT                   /inference="protein motif:Prosite:PS00398"
FT   CDS_pept        complement(5724..7214)
FT                   /transl_table=11
FT                   /gene="repR"
FT                   /locus_tag="SSUBM407_p010"
FT                   /product="protein RepR"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p010"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55669"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3N3S5"
FT                   /protein_id="CAZ55669.1"
FT                   /translation="MNINIEKIHQMILKDGLRQFKFKNSKHENTPFEEQKGAIFGYRSK
FT                   KNMTAGRGIVLTSLEAVEDNQTVFTHWTPNVYRYGTYSQKNPRITKGHSENNLRQINAF
FT                   YIDFDLKNQSDNINFSDILVSSLDLGFMPTLILKTENGYQAYFILKDAAYVTAATEFKV
FT                   VNVAKMISQNIRNHFIKDLPVDMTCNHFGIARIPREDNIEYFDQNNVYTFAEWFNWSMQ
FT                   QDDLTYSKKPNLLVLSGTEGQKQIDEPWYRLLKNTSKIRGEKAIMGRNNVIFTLALANY
FT                   ASGVAYSDCMEELSDYNAELEVPLKKNELKKTIASAYSGRYEAANRDFIKILCQTWISS
FT                   DLTTKDLFIRQGWYKFKKSRDQRQRSHFSEWREDFWNYIKQKTNSDSPYLRVKKKEITA
FT                   TIGIPERSLDYVLKTLQSEGKILYSFKRGRQGGIILASISNIALSLISMNKKAREAYYI
FT                   ALSRILGVSKGILIKLLKRAIIGLTTPQTSSLFELDTG"
FT   misc_feature    complement(6246..6446)
FT                   /gene="repR"
FT                   /locus_tag="SSUBM407_p010"
FT                   /note="HMMPfam hit to PF08708, PriCT_1, score 6.7e-14"
FT                   /inference="protein motif:HMMPfam:PF08708"
FT   CDS_pept        complement(9930..10271)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p011"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MV48"
FT                   /protein_id="CAZ55670.1"
FT                   /translation="MYYIFLTTNKTRARDLYDIFKTLTNINQVELRSEVLSEDNFYILE
FT                   NIFRVKEVPLELMTKLGTKKDDLAADYERKVLPQIPNKDQEEFEYIFDYNQRLFNELFE
FT                   RYQKYNESR"
FT   CDS_pept        complement(11869..12765)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p012"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55672"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MZ52"
FT                   /protein_id="CAZ55672.1"
FT                   /translation="MTPDEIRNTILKAIYSDTELVENLVLKGGNALKLHRIVDRESQDL
FT                   DFSIKETIRFTKENEGVKLQQLITDAFRQKGFFVNSFEFVPKPKNRHRDLPPFWGGYKI
FT                   SFALLDQEKYQDKINSQDSRQMKELNKYALSIEGGVKKIEIDLSYDEYTEHKEAYDLDG
FT                   TTIYLYSPLMIVYEKIRASCQQLEEYPLTTNKTRARDLYDIFKTLTNINQVELRSEVLS
FT                   EDNFYILENIFRVKEVPLELMTKLDTKKDDLAADYERKVLPQISNKDREEFEYIFDYNQ
FT                   RLFNELFEKYQKYNESR"
FT   misc_feature    complement(11974..12759)
FT                   /locus_tag="SSUBM407_p012"
FT                   /note="HMMPfam hit to PF08843, DUF1814, score 3.2e-07"
FT                   /inference="protein motif:HMMPfam:PF08843"
FT   CDS_pept        12966..13949
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p013"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MV54"
FT                   /protein_id="CAZ55675.1"
FT                   /translation="MVLSDEKIQNILLEKKITKDASNLVKYSDEIVIQARKEFGNILNR
FT                   TSIIKILNDFKQSNKLKKSASVSKFIDIIIDKLGLFEPIKILNEYKGETVTRYIATDVQ
FT                   ISPYEIALSLLSKSFLSHYSALFVNDLTINNPKDIYINKEQSKKDFYSNNEQNISQGRI
FT                   DYAFSKKMRRTNMIYSFTYDETSYKVHVLNSKNTNNTGVVLKNVVGFSKPVRTTNIERT
FT                   LIDATVRPGYSGGALEILEAFLRAKNELNSKQLWSYLKKFNYSYPYHKAIAFYLKYSDY
FT                   SYKNELVDFCNNDNQNSLTFYLDYQMVSPQKDDELGIYFPKMIPLK"
FT   repeat_region   13968..13990
FT                   /note="inverted repeat"
FT   repeat_region   complement(13991..14753)
FT                   /note="IS1216 element"
FT   CDS_pept        complement(14022..14708)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p014"
FT                   /product="IS1216, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p014"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55677"
FT                   /db_xref="GOA:A0A0G2PMD9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2PMD9"
FT                   /protein_id="CAZ55677.1"
FT                   /translation="MTMNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVS
FT                   HTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDI
FT                   WLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKY
FT                   LNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKV
FT                   LLGIPA"
FT   misc_feature    complement(14055..14510)
FT                   /locus_tag="SSUBM407_p014"
FT                   /note="HMMPfam hit to PF00665, rve, score 4.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(14436..14477)
FT                   /locus_tag="SSUBM407_p014"
FT                   /note="ScanRegExp hit to PS00213, LIPOCALIN, score NA"
FT                   /inference="protein motif:Prosite:PS00213"
FT   repeat_region   complement(14754..14776)
FT                   /note="inverted repeat"
FT   CDS_pept        complement(14890..18573)
FT                   /transl_table=11
FT                   /gene="rexA"
FT                   /locus_tag="SSUBM407_p015"
FT                   /product="exonuclease RexA"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p015"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55679"
FT                   /db_xref="GOA:A0A0H3MUV2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MUV2"
FT                   /protein_id="CAZ55679.1"
FT                   /translation="MDGTNERRSGLMAFEQFLSAEEIKAVQLAEAHSDKQQKRTAEQIE
FT                   AIYTHGQNVLVSASAGSGKTFVMVQRILDKLKRGIGIDQLFISTFTVKAAGELKERIEK
FT                   KLNETIAETTDMELRRHLSAQLADLTKADIGTMDSFTQKLVTTYGYSLGISPQFRILQD
FT                   ETEKASLKKEVFDQLFADYLEEDENGAFRKLVRNFSGNRKDNSGFRQVVYQVHDFSQST
FT                   SSPTKWLKEQAVQADLYSQERIEQMLEQGFKEKVLDKLYQAADFFRYHVEWGRNDFGSA
FT                   KYFANVEEVLDLLTGLDSLDQKDLMERVERILLINNQSRGKGLTNANRPKDEHLIAFKE
FT                   EYNAGKSQIISELRDLGQEVYELTLLKDYQVQALPLLILLRDFVLDFSQAYLDVKIKEA
FT                   AFEFGDIGHFAIRILEENADIRQFFQEKYHEVMVDEYQDNNHSQERMLDLLSNGHNRFM
FT                   VGDIKQSIYRFRQADPMIFQEKFELYQANPQSGKLILLKENFRSQIEVLEATNAIFTRL
FT                   MDRQVGEIKYDDTHSLVAGSPGQKIAQPKNEMEYLIYDQQDSANSSTDAEEETPLTAGE
FT                   IEVVAKEIIRLHNEEGADFKDITLLVQKRTHNDLIMSIFEKHGIPIVADGGAASYLQSL
FT                   EVMIMLDTLRVINNPLNDYALVALLKSPMFRFDEDELTRISLQAGTGFFYQKMEIAQQA
FT                   SGQHPELMSEKLKKKITDFLSILENWRAYAKLHSIYDMIWKMFNEKFYYDYVGALPNGS
FT                   KRQANLYALGLRANQFEKTGYKGLSRFIAMIDRALANDKDLADVQEFLPQNAVQLMTIH
FT                   KSKGLEFKYVFLMNIDKRFNLEDHYQSVIISRKNGLGIQYLADMKDKVNSPLPQVRVLM
FT                   NTLPYQNNLQELKIANLSEQMRLLYVALTRAEKKLYLVGKGNADKLAEKYDGKKENGVL
FT                   AQSTRESMATFQDWILAIDEAFSGEDLHFKKVFVTDEDLTEEKIGKLTLKSKLEDASLK
FT                   DIRQSEDIAQALDQLSSVQELNERYKAAIELPSLRTPSQIKKLYEPILEQEGMEVMEKY
FT                   QPKRTFNLPDFSKKPKITGAQVGSAVHELMQRLDLSWLVTEDTVRAALEAVHAEQAIKD
FT                   KINVQMILDFFDTDLGREILANTDKLHREAPFASLQTDSVSQENFVLRGIIDGYLLYDD
FT                   HIVLFDYKTDKYDQPIQLSQRYQAQMQLYAEALKKAYKIDRVDCHLILLGGERIEVVEV
FT                   NI"
FT   misc_feature    complement(16348..18459)
FT                   /gene="rexA"
FT                   /locus_tag="SSUBM407_p015"
FT                   /note="HMMPfam hit to PF00580, UvrD-helicase, score
FT                   4.5e-81"
FT                   /inference="protein motif:HMMPfam:PF00580"
FT   CDS_pept        complement(18540..21806)
FT                   /transl_table=11
FT                   /gene="rexB"
FT                   /locus_tag="SSUBM407_p016"
FT                   /product="exonuclease RexB"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p016"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55681"
FT                   /db_xref="GOA:A0A0H3MV79"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MV79"
FT                   /protein_id="CAZ55681.1"
FT                   /translation="MKLVYTDIRNPLTQYLTEQTATFAEQGKRVFYIAPNSLSFEMERK
FT                   VLEYLPEQATFDIIVTRFGQLARYLMIDRKEAGQPLDDVGLAMIFFRVLSQFEDGDLKV
FT                   YGRLQTDFGFINQLVALYKELQRANMSILDLEAMDSPDKQADLVKIFLAVTDILSKEGF
FT                   EHQSKLAQLTGLVETGQLDEQLKNIVLVVDGFSRFSAEEEALVSALNERVSEILIGVYA
FT                   SKKAVQATYAEGNVYQANVDFLRQLSAQFQTKATYIGQEPVLDSIGKFSKNMEAYYDYS
FT                   GTMIDLTPADQEKIQLWEVVNQKEEVEQVATAIRQHVHQGARYKDILLLLGDVDSYKLQ
FT                   IGKIFDKYDIPYYFGKAEEMSHHPLVHFVESLERLRRYRFRAEDLLNLLKSGLYASISQ
FT                   KELDLFESYILFADMKGQAAFSRAFSVNGRADYDAEVIKEKRLVYDLTVLEPLRAKIME
FT                   PLNQLFKAGPQSGTALLEKFMAFLEAIDLPKNMEKMSRNLSEVEQEKEEQVWKSFTHLL
FT                   ENFHQIFGKEKLKMDDFLAILQAGMQASHYRTVPATVDVVNVKSYDLIEPHTAKYVYAI
FT                   GMGQSNFPKVAKNTSLLTEEEMEKVNLVSASSSRFDLVSRENIKKNHAAMMSLLNSATE
FT                   QLVISTPQIYNEGEDSLSPYIKILQKMGLKSEERGRIKTLSPQDIGHYKSLLSRLIESE
FT                   RPSLETEEWEGQRAFWTVLVRHLKKKLESQSIEIPTITGDIASKQLSDETLAALYPEDK
FT                   PLNLSASSLTNFYNNQYLYFVRNVLRLREQESIHPTAFQHGLFLHRIFERVVMDQSELD
FT                   FDQKVDKAILCTRDEAEFAMFYNQDADARYTEEVLDKIARSSATILRDNDLVEIDGQEK
FT                   SFRQDKALVFDLQNGKSVHVNGTIDRLDTLQINQAVGVVDYKSSDQSFSVGDFYNGLKP
FT                   QLVTYLAALQELDETKDKPVFGAMYLHLQDPIIKLKDTKNLEQLEGAANTSLVYKGLFL
FT                   KEESLGLNHFYQTRNQLYTEDEFAVLLNHNQELYKQAAMDILAGRFAINPYTKDGRSVA
FT                   GEQLKAITGFEADRHMGMARRLVKEAKRQDWMERMKGGQD"
FT   misc_feature    complement(19173..19205)
FT                   /gene="rexB"
FT                   /locus_tag="SSUBM407_p016"
FT                   /note="ScanRegExp hit to PS00515, SVP_II, score NA"
FT                   /inference="protein motif:Prosite:PS00515"
FT   CDS_pept        complement(22097..23560)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="SSUBM407_p017"
FT                   /product="muramidase-released protein precursor (fragment)"
FT                   /note="Probable gene remnant. CDS is truncated by the
FT                   insertion of the downstream IS element and subsequent
FT                   recombination events"
FT   misc_feature    complement(22112..22225)
FT                   /gene="mrp"
FT                   /locus_tag="SSUBM407_p017"
FT                   /note="HMMPfam hit to PF00746, Gram_pos_anchor, score
FT                   6.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00746"
FT   repeat_region   23539..23561
FT                   /note="inverted repeat"
FT   repeat_region   complement(23562..24324)
FT                   /note="IS1216 element"
FT   CDS_pept        complement(23593..>24297)
FT                   /transl_table=11
FT                   /locus_tag="SSUBM407_p018"
FT                   /product="IS1216, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SSUBM407_p018"
FT                   /db_xref="EnsemblGenomes-Tr:CAZ55684"
FT                   /db_xref="GOA:A0A0H3MZ62"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3MZ62"
FT                   /protein_id="CAZ55684.1"
FT                   /translation="KKIAGGMTMNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYD
FT                   RGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDAD
FT                   GLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTE
FT                   HRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSV
FT                   CTEIKVLLGIPA"
FT   misc_feature    complement(23626..24081)
FT                   /locus_tag="SSUBM407_p018"
FT                   /note="HMMPfam hit to PF00665, rve, score 4.8e-19"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(24007..24048)
FT                   /locus_tag="SSUBM407_p018"
FT                   /note="ScanRegExp hit to PS00213, LIPOCALIN, score NA"
FT                   /inference="protein motif:Prosite:PS00213"
FT   repeat_region   complement(24325..24347)
FT                   /note="inverted repeat"
XX
SQ   Sequence 24579 BP; 7582 A; 4984 C; 3971 G; 8042 T; 0 other;
     atgatacaat attactatac aaaaaaagaa tggggcgtag ttatggagaa ggaagaactc        60
     aaaatacttg aagaattaag acgtatttta agcaataaaa atgaagcaat tgttattttg       120
     aataattact ttaaaggtgg tgttggaaag tcaaaattat caactatgtt tgcttacttg       180
     acagacaaat tgaatttaaa agttttaatg atcgataagg acttacaagc aacattgaca       240
     aaagacttag caaaaacttt taaggtagaa ttgccacgtg ttaattttta tgaaggcttg       300
     aaaaatggaa acttggcttc ttctattgtt catttgactg ataatttaga cttgatccct       360
     ggcacgtttg atttgatgtt actgccaaaa ttaactcgtt catggacgtt tgaaaatgaa       420
     agtagattgc ttgctactct tttagcacct ttaaaaagtg actatgatct cattattatt       480
     gatactgtac caacgccaag cgtttataca aataatgcaa tcgtggcgag tgattacgtt       540
     atgatccctt tacaagcaga agaagaaagt acaaacaaca ttcaaaacta tatttcctat       600
     ttgattgatt tacaagaaca atttaaccct ggactagata tgatcggttt tgttccttat       660
     ttagttgata cggacagcgc aacgataaaa tcaaacctgg aagaactgta taagcaacat       720
     aaagaagata acttggtttt ccaaaatatt atcaagcgaa gtaataaagt aagtacctgg       780
     tctaaaaacg gcattacaga gcataaaggc tatgacaaaa aagttttatc catgtataag       840
     aacgtatttt ttgaaatgct tgagcgaatt attcaattag aaaacgaaaa agaatagaat       900
     cacaaatcac aagtgattaa tcacaaatca cttgtgattt gtgattgttg atgataaaat       960
     aagagtaaga agaaatagaa agaagtgagt gattgtggga aatttaggcg cacaaaaagc      1020
     aaaacgaaat gatacaccaa tcagtgcaaa aaaagatata atgggagata agacggttcg      1080
     tgttcgtgct gacttgcacc atatcataaa aatcgaaaca gcaaagaatg gcggaaacgt      1140
     aaaagaagtt atggatcaag ccttagaaga atatatacgg aaatatttac ctgacaaact      1200
     ttaaaaggag tgaaaatgaa atggcagtta cgtatgaaaa aacatttgaa atagagatca      1260
     ttaacgaatt atcggcaagc gtttataatc gagtattaaa ctatgttttg aaccatgaat      1320
     taaataaaaa tgactctcaa ttattggaag tcaatttatt aaaccaatta aagcttgcaa      1380
     aacgtgtaaa tctttttgat tattctttag aagaattaca agccgttcat gagtattggc      1440
     ggtcaatgaa tcgttactca aaacaagttt tgaataaaga gaaagtggct taatatggca      1500
     aatatagtca attttactga caaacaattt gagaatcgct taaatgataa tttagaagaa      1560
     ttgattcaag gaaaaaaagc ggttgaatcg ccaaccgctt ttttacttgg tgggcaacca      1620
     gggtcaggga aaaccagttt gcgatcagca atttttgaag aaacacaagg gaatgttatt      1680
     gtcattgata atgatacctt taaacaacag caccctaatt ttgatgaact agtgaaactt      1740
     tatgaaaaag acgtagtaaa acacgttacc ccttattcta atcgcatgac agaagcgatc      1800
     ataagccgtt tgagcgatca agggtataat ttggtgatcg aaggtacagg acgaacaaca      1860
     gacgttccta ttcaaaccgc aacaatgctt caagccaaag gttatgaaac aaaaatgtat      1920
     gtcatggcag tacctaaaat caactcatat ttaggaacaa ttgaacgata tgaaaccatg      1980
     tatgcagatg atccaatgac agccagggca acaccaaaac aagcgcatga tattgttgtc      2040
     aaaaacttac cgaccaattt agaaaccctt cataaaacgg gcttatttag cgatataagg      2100
     ctatataaca gagaaggagt aaaactctat tcaagtttgg aaacaccttc tattagtcca      2160
     aaagaaacct tagaaaaaga attgaatcgt aaagtatcag ggaaagaaat tcaaccgact      2220
     ttagaacgaa tagagcaaaa aatggttcta aataaacacc aagagacacc tgaatttaaa      2280
     gcaattcaac aaaaattgga aagcttgcag ccacctacac caccaatacc caaaacacct      2340
     aaacttccag gtatttaaac cttaaaaaag gaaaagagta gttaccaaaa aacggtaact      2400
     actctttttt tataaaaaca tttcctcatg ttggggtccc gagcgcctac gaggaatttg      2460
     tatcgataag aaatagattt aaaaatttcg ctgttttttt ctaatttcat tttgaggtga      2520
     attaattggt agttattaga ggtgccctat acctaataat ttatctacat tccctttagt      2580
     aacgtgtaac tttccaaatt tacaaaaggg ttctgttgca aagttttaaa taaagaataa      2640
     aatcccttac ggtatctatg atttaagctg ggattcccaa taataccttg atttcagtac      2700
     agaccgaaaa cccgaagaga gtgccttctt ttcgggtttt cttatataat cctcgaatgg      2760
     cttccatgcc tttaatcgtg gtagaggcag tgcgtaaact tcgatagaat ttattgcgtc      2820
     tctttactgg acgatggtct tgttcaatca aattattcag gtatttaatg gtacgatgtt      2880
     ctgtcccttg ataaaagccg tattctttta gtttcttaaa ggcacttgta atagaggggg      2940
     ctttatctgt gactacaacc ttcggttcat caaactgctt cactaaccgc ttaagaaaag      3000
     cataggctgc ttgtgtgtcc cgttttttac gtaaccaaat atccaaggtt aaaccatctg      3060
     catcgatggc tcgatacaaa taatgccatt ttcctttaat tttgatgtac gtttcatcca      3120
     ttttccatga ataaaaggat tttttatttt tctttttcca aatttgatag agtagtttgc      3180
     catattcttg cacccaacga taaatcgtcg tatgagaaac gttaatgcca cgatcatata      3240
     agatttcttg aacttcacga tagctaaggt tataacgaag atagtagccc acggctacaa      3300
     taatcacatc ctgctgaaat tgctttcctt taaaatgatt catcgtcatt cctcctgcta      3360
     tctttttcta ttattctacc ttatttgata gtagatttaa aactttgcaa cagaacccgt      3420
     tctgtccaat ctggttatat ttaatggatt cactacacaa gaacgatgtg cctggtaaag      3480
     tcgttcatct gctttcgcta tatcggatac tttcccgtaa aactcagtct gacctgtttt      3540
     ggtttttaaa ataactttat gtattgttga tgatgtttca aaataaagga tgtcactaaa      3600
     agggacttga atatgagcag tttcagtttt gtatataaaa gaattttcag ctatagtatg      3660
     atcaatattt tcaaaagcat gcactaacac atctgatact gccttttgaa agtcactatc      3720
     ctccaggcct ttatctataa aatctaaagc agaaacccga taacgatacg ttaccggcat      3780
     aaattctgag tgagttgtta caaagacaat aacagcataa ggatctcgag cacggatttc      3840
     tttagcgatt tccattcctt tcttttcttc gcctttaatt tcaatatcta aaaagaaaaa      3900
     ttggtgattg cctgcttcct caattgattc caataactga tttggtttac caaaaacttc      3960
     taggaattta tatcttactg acgtttcttc aacacactgc ctaatagcat tttctagcct      4020
     gctctgctga aaaaaatcat cttctaatac aaaaatatta agcatagatt aacctcttct      4080
     ccatagttta tttaattcct tctgtttgta tcttgaaaaa gaaatagtcc caacaccatc      4140
     atttgtaaat actattagac gttctgataa atttagtcct tgaattttat caatattgac      4200
     aaggaattta cgatgacacc taaaaaagtt caattttaac ttatcttcta aatctttcaa      4260
     ggtaccataa aattcaaaaa caccagactc tgtaacagcc tttaacatat gcggcttggt      4320
     tgtatctgaa ctaatataaa atatatcctc aagaaacagt ttcattgaaa tatcatcttt      4380
     attaacaatt aaaaaattca taagattacc tcctctttta gaagtatctt atcaaaaatc      4440
     aactcttaat ttcccaaaaa atcatgaact gtacattatc tgtcatcaat gaccatttat      4500
     tgccactcat tatataatat aaacttttca ttatcttaat aaaatttatc ctcactaact      4560
     gatataataa aaataaagaa aggaggaatt atgttttata ttattgaaca acaaaacaaa      4620
     aatttacaaa ttaccaaaat catcagtgac tatctgaaaa atagatatcc gaaaatagcc      4680
     ttcaaaatat tacaaagttt caaagctcct ccaactcatc aatctaacac atattttatc      4740
     ataaatgaag acatatgttt aaatgaacaa gagctagaag tagcaaaaaa tattagaaaa      4800
     aatgatcgat tcggtcacat tatcctcatt tctaaaaata tcaactacct acaactattc      4860
     cgctcacaca ttaacttcct ggaaatcatt gactgtaaca ataatctcaa agaagacatt      4920
     tataattgca ttgactttct aaacaaaaac atctcttaaa caacataata tgatacattg      4980
     cattatatta tgttgttctt tttattccaa atttttctct atatcttctg aatgttctcg      5040
     cattaattcc cactaaatct tctatatccc tatcagaaca gcctgattta aataattcaa      5100
     atgcatgctg caattgagga cttgcactag taaacaaagg ttttctccct ttatacttgc      5160
     ctttcctttt tgcaatctca atcccctgac gttgtctctc caaaagccta accctctcag      5220
     cttctgcttg atatttataa atctcaataa ttaaattatt caataacctt cttagattat      5280
     catctttaat tccaatcaaa gaaggaaaac ttaaaatctc aagagtagcc ccttttgaat      5340
     gaatcataga tattacttct gttaactctt tattatttct ccctaatcga tctaactcag      5400
     aaacaacaac aatatctcct tctctaataa aagacaataa ttcttctaat ccaggtctat      5460
     tcttatcctt tccactaagc ttatcagaaa ataccttaaa tacatcagaa agattttcta      5520
     cttgtctatc taaattctga tccttactac taattctaat ataaccaatc ctactcatat      5580
     ttatgcctaa ccctactgtc ctaaaaataa ccatactaaa tagaactaac cattaatgac      5640
     atttaaacta taccctattg tccctctctc tccaggacaa ctatcataga tataatgtaa      5700
     tggcagtttg cgtgttttat ttattaaccc gtatcaagtt caaatagcga gcttgtctga      5760
     ggcgttgtga gccctataat cgctcgtttt aatagtttaa ttagaatacc cttacttaca      5820
     cctagaatac gtgatagagc gatataatac gcttctcttg ctttcttatt catactaatc      5880
     aaggagagag cgatattcga aatcgaagca aggataatcc ctccttggcg accacgttta      5940
     aaagaatata aaatctttcc ttcggactgc agtgtcttta aaacataatc tagagaacgt      6000
     tctggaatac caattgtagc tgtaatttct ttctttttca ctctcagata tggactatct      6060
     gagtttgttt tttgcttgat atagttccaa aaatcttctc tccattctga aaagtgacta      6120
     cgttgacgtt gatcacgtga cttcttgaac ttataccatc cttgacgaat gaataaatct      6180
     tttgttgtca aatcagagct aatccaagtt tgacataaaa ttttgataaa atctctgtta      6240
     gcagcttcgt atcttccaga ataagcactt gcgattgtct ttttgagttc atttttcttc      6300
     aaaggcactt ctaactcagc attataatca ctgagttctt ccatacagtc actataagca      6360
     actcctgaag cgtagttggc caaagctaac gtaaaaataa cgttattgcg acccataata      6420
     gccttttccc cacgaatttt cgaggtattc ttaagaagac gataccaggg ctcgtcaatt      6480
     tgtttctgac cttcagttcc tgatagtaca agaagattag gtttcttaga gtacgttaaa      6540
     tcatcttgtt gcatagacca gttgaaccat tcagcaaagg tatagacatt attttgatca      6600
     aagtactcta tgttatcttc acgaggaata cgtgcgatac caaagtgatt gcacgtcata      6660
     tcaacgggca aatccttgat aaagtggttt ctgatattct gagaaatcat ctttgcaaca      6720
     tttacaactt tgaattcagt agcagctgtt acataagcag catcctttaa gatgaaatag      6780
     gcttgataac cattctctgt ttttaaaatt aaagttggca tgaagcctaa atctaaagat      6840
     gatactagaa tgtcactgaa attgatatta tctgactgat tttttaagtc aaaatcaata      6900
     tagaaagcgt taatttggcg aagattattc tcactatgcc cctttgtaat acgagggttc      6960
     ttttgcgaat atgtcccgta tcgatagaca ttcggtgtcc aatgagtaaa aacagtttga      7020
     ttatcctcaa cagcctccag agaagtgaga acaatccctc ttccggcagt catattcttt      7080
     ttactacgat acccaaaaat agctcccttt tgttcctcga aaggagtatt ttcatgctta      7140
     ctatttttaa atttgaattg tcttagtcca tcttttaaaa tcatttgatg aatcttttca      7200
     atattgatat tcatctctcc tcctttctta gaaaaatata aaaaggtatc aacttttcgt      7260
     cgataccttc cacttatttt actcaactac ttgatttttt tgagaaatct tagtacactt      7320
     tactaagtca tttcatttta cacaattttg tggtataatg aaatcaaata agaaattgta      7380
     ctagaagtag tttcgcttga taggtttcgg ctatcaacga ggctcctgga aaatgtcgcc      7440
     aaacattttt cgggctagtc ttttttattt tctttgattt taactaaaat cattatacaa      7500
     cgatttcgat tttttcgcaa attgtatttt gatatgatac agttttagaa atccaataaa      7560
     ctacattact agatcaaatc attattcaga aagtaaaaat atcatctaca caaacttcta      7620
     atattttagc aatttttaaa gctatcaaaa cagacggaac catttttcct ctctcaattg      7680
     aacttattaa ttgtcgagag caattgactt tggatgccaa ttgttcctga gtaaaagctt      7740
     ttcttacacg aaatctcttc acattgtttt ttaattcagc catgtaactc tctctccgat      7800
     acacctaata taatttttac aaattataaa tgtttataat agttagcaat agcatttaaa      7860
     cagaaaataa taaaaaatag acaatttgtc tattttttta ttattaacca aaagttcgtg      7920
     ctaaaccata tccaaccaat cctgagccac cagcagccaa taacgaccaa ccgataaccg      7980
     ccaaaacacc tacaccacct tcaacacttg taagttcttc ggttgaaact tcttcaaatt      8040
     ttttaatatt ttccattttt tttacctctt cttattattt atcttaaagc acttagtcct      8100
     agagcaactc caatgagtaa tccaataaac gatgatgctg aaataattac tgctgcaata      8160
     ctatttgaaa tttcattttt catagttact tcctctattt gcgaccatta cgcgaaatcc      8220
     caatagtcac acctgcactt aagcctgcaa aagctgcact agcaactata cccgctgcta      8280
     ctgcaacagg gataattccg ccttccatat ccatcaattc ccgatctgaa agtgccacaa      8340
     agtctacatt cattttatcc attgtttcaa atttagtcat atattttctc ctttaattta      8400
     ttattctaca tttagattgt tattttttat gataagattt aaaatttaaa aatcttccat      8460
     agccacgggt atactccagt aacaacgaac atatatttct cctttctctt atattgtgtg      8520
     ttgttttgtt tacatgtaca gtatacaaaa tatattatta aattttttgt tattgtcatg      8580
     aaatgccctt atttagtaat gaacgaccat tttttaccat taaagaaaaa aagctgacaa      8640
     tcagcttttt tatttttggg gttttggggc gaagtcacca cattttctta tcatcagttg      8700
     ataaacctgt aaggttgagg aacagctggt gattagattt taggtttttg tggacacaat      8760
     aactgagctc gcaaaagcct aaaagaaaag cgttgaagct tttaggaagc acccgtatcc      8820
     catacggtat cggggctgac ccgataaaga tactaatatg acaaatgaca gacctctgcc      8880
     taattataga acggtattga gaattttctt tcatccgtaa cttcaagcat ttctctgtaa      8940
     tcgaataata aaaaagcagc atcaccctat atagaaaaat gctaatactt gctgctacag      9000
     ctagagtaat acttccttcc tccatcaatt cctgtgccta ctgttgaagc tgctattttc      9060
     ttcgttggcg atttgccaaa tctttcccaa aagcatatcc tccactcgca gcagctaaaa      9120
     ataatgttcc taagcctata gtcactgtga acggatctaa tcccccttca atcataacga      9180
     gttcgtcatc acacaatgta ttaaatttat tcatatccta tccttctttc cagtctttgt      9240
     ataatacaag catcaataat gctaacaata taataaaagg cacatacggc gccgtcaata      9300
     cactaggtag ttttattcct aaaacatcac tgacaaccag tgaagtaaaa tgtaataaag      9360
     cggcactaaa tattacaact tcaggtaaat acttcataat tcaatacacc tttaaggacg      9420
     atttgcaaaa taacctgcag cagctccaat tgctacacct cctgcaataa ctcctgcagt      9480
     aaccccagca gctactttcc agccaaccac aactccacct acaacaacag gtaatagacc      9540
     tccatcaaca ttcatcaatt cttcttctgt tagtgccaca aagtctacat tcattttatc      9600
     cattgtttca aatttagtca tatcttttct cctttaattt attattctac atttagattg      9660
     ttatttttta tggtaagatt taaaatccaa agaacttcca taaccacggg tatactccag      9720
     taacaacgaa catatatttc tcctttctct gatattgtgt gttgttttgt ttacatgtac      9780
     agtatacaaa atatattatt aaatttttgt tattgtcatg aaatgccctt atttagtaat      9840
     gaacgaccat tttttaccat taaagaaaaa aagaaaccga aaatggcttc ttcgtaaaaa      9900
     tttatcattc aaaaatcaat cataatatgc tatctactct cgttatattt ttgatacctc      9960
     tcaaatagtt cattaaacag tctctggttg tagtcaaaaa tatattcaaa ttcctcttga     10020
     tctttattcg gaatttgagg caatacctta cgttcatagt cggcagcaag atcatctttc     10080
     tttgtgccca atttcgtcat taattccaag ggaacttctt tcacacgaaa gatattctct     10140
     aaaatataaa aattatcttc actcagtacc tctgaacgca actccacttg atttatatta     10200
     gttaatgttt tgaaaatatc atataaatct ctagctctgg tcttattggt cgttaagaat     10260
     atatagtaca ctccataata taaaaagcta cctatccatt taatattata attgaggtag     10320
     gtagtttctt tagttatgtt gtttttctct ttaaaaattc catataatac tttaattatt     10380
     tatttttacc aatcatatat ccgatgcagt acactgcaac cgtaccaata gcgattccta     10440
     acccagttgc aaaaccacct tctgtttcca tcatttctac ttcagaaagt gctacaaaat     10500
     tagtcttgtc aattacttca aaattagtca tactatacct ctttacttgc tatttttaat     10560
     tgcttgacca atcgcatacc ctagagcgaa tgaagcgcta gccaatttta cacctgtata     10620
     aatcattgtt cctgtgacta caaagccacc ttctgtttcc atcatttctg cttcagaaag     10680
     tgccataaaa ttagtgttgt caattacttt aaaattagtc atattcatct tctcctttgc     10740
     ttttttgtgc tttgctattt aaaaaatcct gtcaaccatt tggcaatttt gggagtaaaa     10800
     attactggac caagaatgat tcctccattg gtattcttta agtcagtttt acttagctct     10860
     tgaaattttt tcattgtttt ttctactttc tacataactt ctaattttgg tttcacggga     10920
     ccagggaggt aaatgcgtgg cgatctaaga gtctgcccct ttccgatgag accgataatg     10980
     cttcctcctg tcgttttaac caattctttt tgagttagtg tcttcatgta taagtttctc     11040
     cttttagaac cttgatttaa tattccacgg catctgtatt ttgagaaaat ttacaaaaaa     11100
     tccctctaaa aataagttcc taatcattag tgacagaata cttcttatac cctatccaat     11160
     aaatgtaata ctcctgcaac agctccagat aacatcacaa atgtcaatgg attatcaaac     11220
     gatttccctg ataaataagc ccctaaaaaa tacatgaaac tacaacttag gctagagaac     11280
     attaaaatgt ccattaattt agtcatatca atgtctatta atttagtcat accatacctc     11340
     tttacttgct atttttaatt gcttgaccaa tcgcataccc tagagcgaat gaagcgctag     11400
     ccaattttac acctgtataa atcattgttc ctgtgactac aaagccaccg ttaatatttt     11460
     ctagttcttc ttgcttcata tctacgaaat tattcatctt aagcctccta ttttgatccc     11520
     aggtacaaac caagtccacc aaatccaact acaataagtc caccaactat tgctggtcca     11580
     gtaattacaa gtccaccatc tgtttccatc atttctgatt cagaaagtgc tacaaagttc     11640
     atattgtcta gtgtatcaaa tttagtcata tattttctcc tttctcttat attgtgtgtt     11700
     gttttgttta catgtacagt atacaaaata tattattaaa ttttttgtta ttgtcatgaa     11760
     atgcccttat ttagtaatga acgaccattt tttaccatta aagaaaaaaa agaaaccgaa     11820
     aatggcttct tcgtaaaaat ttatcattca aaaatcaatc ataatatgct acctactctc     11880
     gttatatttt tgatacttct caaatagttc attaaacagt ctctggttgt agtcaaaaat     11940
     atattcaaat tcctctcgat ctttgttcga aatttgaggc aataccttac gttcatagtc     12000
     ggcagcaaga tcatctttct ttgtgtccaa tttcgtcatt aattccaagg gaacttcttt     12060
     cacacgaaag atattctcta aaatataaaa gttatcttca ctcaatacct ctgaacgcaa     12120
     ctccacttga tttatattgg ttaatgtttt aaaaatatca tataaatctc tagctcgggt     12180
     cttgttggtc gttaatggat attcttccaa ttgctgacag gaggctctaa ttttttcata     12240
     gacaatcatt aggggactgt acaagtagat tgttgtccca tctaaatcgt atgcttcttt     12300
     atgctctgta tactcatcgt agcttaaatc aatctcaatt ttttttacac caccctcgat     12360
     agatagagcg tatttattca actctttcat ttgtctagaa tcttgagagt ttattttatc     12420
     ctggtacttt tcttggtcaa gtaaagcaaa tgatatttta tatcctcccc aaaacggtgg     12480
     caaatctcga tgtctattct ttggcttcgg aacaaattcg aacgaattga caaagaaacc     12540
     tttctgtctg aatgcatctg taattagttg ctgaagtttt actccttcat tttcttttgt     12600
     aaaccttatc gtttctttga ttgaaaaatc aagatcttga gattccctat caactattct     12660
     atgtagtttt aatgcatttc ctccctttaa aactaaattt tctactagtt cagtatctga     12720
     gtaaatcgcc tttaaaatgg tattgcgtat ttcatctggg gtcatattat tgctcctttt     12780
     atatcttata tctattctat cattgatttg ctattaaaca aattatttct caactataag     12840
     ctatggtata tataccatag cttatagaat gacttttttt attttttttg ttaaagtata     12900
     atctaagcta tggtatatat accatagctt aaggttcttg ttttttaaaa tatggaggtt     12960
     taaaattggt actgtcagat gaaaaaatac aaaatatcct tttagaaaaa aagattacca     13020
     aagatgcttc taacttagta aaatactctg atgaaatagt aatacaagct cgaaaagaat     13080
     ttggtaatat tctgaatcga acatcaatca taaaaatttt aaatgatttt aaacaatcaa     13140
     ataaacttaa aaaatctgct tcagtaagta aatttatcga tatcattatc gataaattag     13200
     gtttatttga accgataaaa attctaaatg aatataaagg tgagactgtt actcgttata     13260
     ttgctactga cgttcaaatt tctccttacg aaatagctct ttcattatta tctaaatctt     13320
     tcctttccca ctacagtgca ctttttgtta acgacttaac catcaacaat cctaaagata     13380
     tatatattaa caaagaacaa tcaaaaaaag atttttattc taacaatgag caaaatatct     13440
     ctcaaggaag aatagattat gctttttcta aaaaaatgag acgtacaaat atgatctatt     13500
     catttaccta tgatgaaact tcctacaaag ttcatgttct aaactctaaa aacacgaata     13560
     atactggtgt tgttctcaaa aacgtagtag gcttttccaa acctgtaaga actacaaata     13620
     ttgaacgtac tttgattgat gcaactgtta gaccaggata cagcggtggt gctttagaaa     13680
     ttttagaagc atttttgcga gcaaaaaatg agttaaactc taaacaacta tggagttacc     13740
     ttaaaaaatt taactactct tatccatacc ataaagcgat tgctttctat ctaaaatatt     13800
     ccgattacag ttataaaaac gagctagtag acttctgtaa taatgacaac caaaattctc     13860
     taacatttta cctagactat caaatggttt ctcctcaaaa agatgacgag cttggcatat     13920
     actttccaaa aatgataccc ctaaaatgat ggtttgatac actgaccggt tctgttgcaa     13980
     agttttaaat aaagaataaa atcccttacg gtatctatga tttaagctgg gattcccaat     14040
     aataccttga tttcagtaca gaccgaaaac ccgaagagag tgccttcttt tcgggttttc     14100
     ttatataatc ctcgaatggc ttccatgcct ttaatcgtgg tagaggcagt gcgtaaactt     14160
     cgatagaatt tattgcgtct ctttactgga cgatggtctt gttcaatcaa attattcagg     14220
     tatttaatgg tacgatgttc tgtcccttga taaaagccgt attcttttag tttcttaaag     14280
     gcacttgtaa tagagggggc tttatctgtg actacaacct tcggttcatc aaactgcttc     14340
     actaaccgct taagaaaagc ataggctgct tgtgtgtccc gttttttacg taaccaaata     14400
     tccaaggtta aaccatctgc atcgatggct cgatacaaat aatgccattt tcctttaatt     14460
     ttgatgtacg tttcatccat tttccatgaa taaaaggatt ttttattttt ctttttccaa     14520
     atttgataga gtagtttgcc atattcttgc acccaacgat aaatcgtcgt atgagaaacg     14580
     ttaatgccac gatcatataa gatttcttga acttcacgat agctaaggtt ataacgaaga     14640
     tagtagccca cggctacaat aatcacatcc tgctgaaatt gctttccttt aaaatgattc     14700
     atcgtcattc ctcctgctat ctttttctat tattctacct tatttgatag tagatttaaa     14760
     actttgcaac agaacctttt aatttattta tagtctttta gtttactttt agtactaggc     14820
     aacgagctgc agacagtact ggagtacggc aaagcgagtt aacgaagtaa taaaagaaaa     14880
     actaaatgac tatatgttga cttcgaccac ttctattctc tccccaccaa gcaaaatcaa     14940
     atggcagtct acacgatcta tcttgtaggc ttttttcaat gcctccgcat agagttgcat     15000
     ttgagcttgg taacgttggc tgagttggat tggttggtca tatttgtctg tcttgtaatc     15060
     aaagaggaca atatgatcat catacagtag gtagccatcg ataatcccac gaaggacaaa     15120
     gttttcctga gatacagaat ctgtctgcaa acttgcaaat ggagcttctc ggtggagttt     15180
     gtccgtattg gctagaattt ctcttcctaa gtctgtatca aagaaatcca aaatcatctg     15240
     aacattgatt ttatctttaa tcgcttgctc agcatgaaca gcttctaggg ctgctcttac     15300
     cgtatcttct gtcaccaacc aagacagatc caagcgttgc atgagttcat gcactgctga     15360
     accgacttgg gctccagtga tttttggttt cttggagaaa tctggcaagt tgaaggtccg     15420
     tttgggctgg tatttttcca taacttccat gccttcttgt tccaaaatag gctcatagag     15480
     cttcttgatt tgacttggag tccgtaaact tggcaattct atagcagcct tatagcgttc     15540
     gttcaactct tggacagaag acaactggtc caaggcctgg gcgatgtctt ctgattgacg     15600
     aatatcttta aggctggcgt cttctagctt actcttcaat gtaagtttac caatcttctc     15660
     ctctgtcaaa tcctcatccg tcacaaagac tttcttgaag tgcaagtctt ctcctgagaa     15720
     ggcctcatca atggctagaa tccagtcttg gaaggtcgcc atactttcac gagttgattg     15780
     ggctagtacg ccattttcct ttttgccatc gtatttttca gctaacttgt cagcattacc     15840
     ctttccaacc agatacagct tcttctcagc acgcgttagt gcaacataaa gcaaccgcat     15900
     ttgttccgaa agattggcaa tttttagctc ttggagatta ttttgataag ggagggtgtt     15960
     cattaagact cgcacctgag gtaatgggct atttacctta tctttcatat ctgctaaata     16020
     ttggatacct agaccatttt tccggctgat gatgactgat tggtaatggt cttccaagtt     16080
     aaatcgctta tcgatgttca tgaggaagac atacttgaac tccaaacctt ttgacttgtg     16140
     aatagtcata agctgtacag cattttgcgg tagaaactct tgtacatctg ccaagtcctt     16200
     gtcatttgct aaggcacgat caatcatggc gatgaagcga gacaatccct tgtagcctgt     16260
     tttttcaaac tggttggcac gcagaccaag tgcgtataga ttggcctgac gcttgctgcc     16320
     atttggaagc gcaccgacat agtcatagta gaatttttca ttgaacatct tccaaatcat     16380
     gtcataaata gaatgcagtt tggcataggc acgccaattt tccaaaatag acaagaaatc     16440
     cgtgattttc ttcttcaact tttctgacat cagttcagga tgttgcccac ttgcttgctg     16500
     ggctatttcc attttctggt aaaagaaacc tgtcccggcc tgcaaggaaa tccgtgtcag     16560
     ttcatcttca tcgaatcgga acataggtga tttaagcagg gcaaccaagg catagtcatt     16620
     gagtggatta ttgataaccc gcaaggtatc cagcatgatc atgacttcta aagattgcag     16680
     ataggaggct gctccgccat ctgccacaat tggaatccca tgtttttcaa aaatggacat     16740
     aatgaggtca ttgtgcgtcc gcttttgtac caagagagtg atgtccttga agtctgctcc     16800
     ttcttcattg tgaagacgaa taatctcttt tgcaacgacc tcaatttcac cagcagtcag     16860
     aggtgtttct tcctcagcat ctgttgaaga gtttgcgcta tcctgctgat cgtaaatcaa     16920
     gtattccatc tcattcttgg gctgggcaat tttttgacca ggactaccag ccactagact     16980
     gtgggtgtcg tcatacttga tttcccctac ttgacggtcc atcaggcgcg tgaaaatagc     17040
     atttgttgcc tccaagactt caatctgact acggaaattt tccttgagca aaatcaattt     17100
     cccagactga ggatttgcct gatacagttc aaatttctct tggaaaatca tcggatccgc     17160
     ctgacggaat cgatagatgg actgcttaat atcacccacc ataaagcggt tgtgaccgtt     17220
     agacagcagg tccagcattc gctcttggct atggttgtta tcctggtact cgtccaccat     17280
     gacttcgtga tatttctctt ggaaaaactg gcgaatgtcc gcattttctt ctaaaatacg     17340
     aatagcgaaa tgcccaatgt cgccaaattc aaaggctgct tccttgattt tgacatccag     17400
     ataagcctgc gaaaaatcca agacaaagtc acgtaataat atcagtagtg gcaaagcttg     17460
     aacctgatag tctttcagca gggtcaattc ataaacttcc tgacccaaat ctcgtagttc     17520
     tgagataatc tggctcttac cagcattgta ttcttcttta aaggctatca aatgctcatc     17580
     ttttggtcga ttggcattgg tcaggccctt gcctctggac tgattattga tgagaagaat     17640
     tctttcaacc cgttccatca agtccttctg gtccagacta tctaaacctg tcaacaaatc     17700
     caagacttct tccacatttg caaaatattt agcagaacca aagtcatttc tgccccattc     17760
     cacatggtag cggaagaaat ctgcagcttg atagagcttg tctaacactt tttccttaaa     17820
     gccttgctct agcatctgct ctatacgctc ttgactgtac aaatcagctt gaacagcctg     17880
     ttctttcagc catttagttg gactgctcgt cgattggcta aaatcatgca cctgataaac     17940
     aacctgacgg aaaccactat tatccttgcg gttgcccgaa aaattgcgaa ccagtttgcg     18000
     gaatgcacca ttttcatcct cttcaagata atctgcaaag agctggtcaa aaacctcttt     18060
     tttcagactc gctttttcag tctcatcctg taaaatccga aactgcggag aaataccaag     18120
     gctataacca taggtggtca ccaatttctg cgtaaaggag tccatggtcc caatatccgc     18180
     cttagtcaaa tctgccaact gggccgacaa atgccgacgc aattccatat cggtcgtctc     18240
     cgcaatagtt tcattgagct ttttctcaat ccgctccttc aattcaccag ccgccttgac     18300
     tgtaaaggtc gagataaaga gctggtcaat ccctatacca cgcttcaact tatccaaaat     18360
     ccgttgaacc atgacgaaag tctttcctga cccagccgat gcagagacca gaacattctg     18420
     accgtgcgtg tagatagctt caatctgctc agctgtgcgt ttttgctgct tatcagaatg     18480
     ggcttccgcc agctgcacag ccttgatttc ttccgcactt aaaaattgtt caaaagccat     18540
     tagtcctgac ctcctttcat tcgttccatc caatcttgac gcttggcctc tttgaccaac     18600
     cgccgtgcca tgcccatgtg ccgatccgcc tcaaaaccag tgattgcctt cagctgctca     18660
     cctgccaccg aacgcccatc tttggtataa gggttaatag caaagcgacc agccagaatg     18720
     tccatggcag cttgtttgta tagttcttgg ttgtggttca ataaaaccgc aaactcatct     18780
     tccgtgtaga gttggttacg agtctgataa aaatgattga gccccagact ttcctccttc     18840
     aagaaaagcc ccttgtaaac caagctagta ttggcagctc cttctagctg ttctaaattc     18900
     ttcgtgtctt ttaatttgat aatcggatcc tgcaaatgca aatacatagc cccaaaaaca     18960
     ggtttatcct tggtttcatc cagctcttgt aaggctgcca agtaggtcac caactgaggt     19020
     ttgagaccat tataaaaatc cccaactgaa aaagattggt cgctggactt gtaatccaca     19080
     acaccgacag cctgattgat ttgtaaggta tccaagcggt caatggtacc atttacatgc     19140
     acactcttgc cattttgaag gtcaaaaacc agcgccttat cctgacggaa actcttttcc     19200
     tggccatcaa tttcaaccaa atcattatcc cgcaaaatag tcgcactgga acgagcaatc     19260
     ttatccagca cctcctccgt ataacgagca tccgcatcct ggttataaaa catagcaaat     19320
     tctgcctcgt cacgcgtaca cagaattgcc ttgtccactt tttgatcaaa atctagctca     19380
     gattggtcca tgaccactcg ttcaaaaatc cgatgcaaga acaaaccatg ctgaaaggca     19440
     gtcggatgga tggattcctg ttcccgcagg cgaagaacat tacggacaaa gtaaagatat     19500
     tggttattgt agaaattggt caagctggat gcagaaagat tgagcggctt atcctctgga     19560
     tataaagcag ccaaggtttc atctgaaagt tgtttagaag caatatcacc agtaatggtc     19620
     ggaatttcaa tgctttgcga ctccaatttc ttcttcaaat ggcgaaccaa gactgtccag     19680
     aaggccctct gcccttccca ctcctctgtt tcaaggcttg gtctttccga ctcaatcaaa     19740
     cgggataaga gactcttgta gtgaccgatg tcttgtggac taagtgtttt aatccgacca     19800
     cgttcttcgg atttcaaccc cattttttgg agaatcttga tatatgggga gagactatct     19860
     tcgccttcgt tataaatctg aggagtagaa atgactaact gttccgtcgc agaattaagc     19920
     agagacatca tagcagcatg gttcttcttg atattctctc ggctgaccaa atcgaaacgt     19980
     gaggaactag ccgagacaag attgactttt tccatctctt cttctgtcaa tagactggta     20040
     ttcttggcaa cttttggaaa atttgactga cccattccga tagcataaac atactttgca     20100
     gtgtgcggct cgatcaaatc ataggatttg acattgacca catcaactgt tgcaggaacg     20160
     gtacgatagt ggctggcctg cattccagcc tgtaaaatag ccagaaaatc atccattttc     20220
     aacttttctt ttccgaaaat ctgatgaaaa ttctcaagaa gatgggtaaa acttttccag     20280
     acctgctctt ctttttcttg ctctacttca ctcaaatttc gagacatttt ttccatattt     20340
     ttaggaagat caattgcctc caaaaatgcc ataaatttct caagcaaggc agttccagat     20400
     tgtggtccag ccttaaacag ctggttcaaa ggttccataa tcttagcacg taggggttcc     20460
     aagacagtca aatcatagac aagccttttc tccttgatga cttcagcatc atagtctgct     20520
     ctgccattga ccgaaaaagc cctcgaaaaa gcagcctgcc ccttcatatc cgcaaaaagg     20580
     atgtaagact caaataggtc cagctccttt tgggaaatgc tggcgtacaa accagatttg     20640
     aggagattga gcaggtcttc cgcacgaaaa cgatagcgac gcaagcgctc caaggactcc     20700
     acaaaatgga ccaacggatg atgactcatc tcctctgcct taccgaaata gtaaggaatg     20760
     tcatacttgt caaaaatctt gccaatctgc aacttgtagc tatccacgtc acccaagagc     20820
     aacaagatgt ctttatagcg agcaccttga tgcacatgct gacgaattgc agtcgcaact     20880
     tgctccactt cttctttttg gttaacaacc tcccagagtt ggattttttc ttggtctgct     20940
     ggagtcaagt ctatcatggt cccgctgtag tcataatagg cttccatatt ctttgaaaat     21000
     ttaccgatac tgtccaagac cggctcttga ccaatataag ttgccttagt ctggaactgc     21060
     gctgataact gacgtaaaaa gtcaacgttg gcttgataga cgttgccttc cgcataggtg     21120
     gcttgcacag ctttcttgct ggcatataca ccaatcagga tttccgacac ccgttcattt     21180
     aaagcactta ctaaagcttc ttcttctgcc gaaaaacgag aaaatccgtc taccaccagc     21240
     acaatgttct tcaactgctc atccaactga ccagtttcta ccaagccagt caactgtgct     21300
     aacttagact gatgctcaaa gccttctttg gacaaaatgt ctgttacagc cagaaaaatc     21360
     tttaccaaat cagcctgctt atctggtgag tccatggctt ccaagtccaa aatagacata     21420
     tttgcccgtt gcaattcttt gtataaagca actagctggt taatgaaacc aaaatctgtc     21480
     tgtaaacgac catagacttt caagtcgcca tcttcaaatt gcgatagaac acgaaagaaa     21540
     atcattgcca gaccaacatc atccagcggt tgacctgctt ctttcctatc aatcatcaaa     21600
     tagcgggcca attgcccaaa acgggtcacg ataatatcaa aagttgcctg ttcaggcagg     21660
     tattccaaga ccttgcgttc catctcaaag gatagagagt ttggagcaat ataaaaaaca     21720
     cgtttgccct gctcggcaaa tgttgctgtc tgttctgtca aatactgcgt cagaggattg     21780
     cgaatatctg tatagactaa tttcatatca aattctcatg ctttcgttga atatactata     21840
     tctagtatat caaaataaga caaaaaaatg ggagcgagaa agaactcgac cgaataaaaa     21900
     aagagctcgt ctcccacccc cacacagctc caacagtcag agtagtgact gttggaggtt     21960
     ggaaatggag cgaactctaa gatgtaactc tggacttttt gcccagcctc attttttcgg     22020
     aaaggcaatc ctgcatgtta cgtacaattc ttatactttc tatgtggggg aataaagtct     22080
     gtataaagaa ttttgactaa tcttcgttac gacgacgttt tcttgcaaac gcaagtgttg     22140
     cgacaagcat tgctgtacca agcgcacctg ccacagatga agcctcacca gtatttggca     22200
     attgagcttt acctgaagcg gttttacctg cttgaggttt tgcaggagtt tccttctcag     22260
     gtgttgttgg tttattagaa agtttgcgat aaatatgtgt cgtgttacct tcttcatcaa     22320
     ctacagtacg cacatactcg taacctgaaa tttgacgttt tggtgttgtc ccatcctctt     22380
     gtggagcaat agggttacct tcttcatcaa cgtggttagt cacaactttc ttagcaggtg     22440
     ttttcttgta gatgtgagtt gtgttgccat cttcgtcagt aacagtttta cctgtaaatt     22500
     cgtaacctgg gattgatttg tttggttttg ttccctcttc ttgcggcgca acagggttac     22560
     cctcttcatc aacgtggtta gttacaactt tcttagcagg tgtttcgact ttacggtaaa     22620
     cgtaagtcac aactgtttca ccttctacaa ctttaccgtt ttctgtaccg tcaacacgaa     22680
     ccaattcata ctcttcacct ttgaaagtga ttgtcttagg tttgttgtct gtagtgtcgt     22740
     atggtgtgcc ttctggagaa gttggtgtat ctgttacagg ttccttgata actgtgccat     22800
     cttctgttac atagttaaca acaactgtac cattcttaac ttctggtgtt ttcttgtaga     22860
     tgtgagttgt gttgccatct tcgtcagtaa cagttttacc tgtgaactcg taacctggga     22920
     ttgatttgtt tggttttgtt ccctcttctt gcggtgcaat agggttaccc tcttcatcaa     22980
     cgtggttagt tacgactttt ttaactggaa cataaggaat tggtgtatca acacctggat     23040
     tttctggtgt tggtggtaca taacccttac ctggatcatt tggatcaatt ggtttcaacg     23100
     gcgtgttatc cttaggatca accggtgtat atcctggaac gtaaggaata tttggaacct     23160
     cgccatttgt tcctggtgtc gttggatcga ttggctcgtc tggctctgtt gggtcaaatg     23220
     ggtaaggtac ttttggacgg tctgtttctg gtacatttgg aatctctgga atccagtttg     23280
     caactttctg gtaaacataa gttactgtga ttgttccttc gataacttta ccattttcct     23340
     caccatctgt cttagatgga acaagaacat agcgtgatcc atcttttgtg atgatttcgt     23400
     ttggtttctt gtcagttgta gtataagcat ctccaaccgg tgcatcagac acatccgttt     23460
     ctggatcttt aatcacatta ccttctgtat ctttgtaatt tacaactaca gaacctgtca     23520
     ctgctctata gacatagggg ttctgttgca aagttttaaa taaagaataa aatcccttac     23580
     ggtatctatg atttaagctg ggattcccaa taataccttg atttcagtac agaccgaaaa     23640
     cccgaagaga gtgccttctt ttcgggtttt cttatataat cctcgaatgg cttccatgcc     23700
     tttaatcgtg gtagaggcag tgcgtaaact tcgatagaat ttattgcgtc tctttactgg     23760
     acgatggtct tgttcaatca aattattcag gtatttaatg gtacgatgtt ctgtcccttg     23820
     ataaaagccg tattctttta gtttcttaaa ggcacttgta atagaggggg ctttatctgt     23880
     gactacaacc ttcggttcat caaactgctt cactaaccgc ttaagaaaag cataggctgc     23940
     ttgtgtgtcc cgttttttac gtaaccaaat atccaaggtt aaaccatctg catcgatggc     24000
     tcgatacaaa taatgccatt ttcctttaat tttgatgtac gtttcatcca ttttccatga     24060
     ataaaaggat tttttatttt tctttttcca aatttgatag agtagtttgc catattcttg     24120
     cacccaacga taaatcgtcg tatgagaaac gttaatgcca cgatcatata agatttcttg     24180
     aacttcacga tagctaaggt tataacgaag atagtagccc acggctacaa taatcacatc     24240
     ctgctgaaat tgctttcctt taaaatgatt catcgtcatt cctcctgcta tctttttcta     24300
     ttattctacc ttatttgata gtagatttaa aactttgcaa cagaacctgt aaaagaatta     24360
     ctggagggaa aagaaaccct ggtaaaagga atcaaaaata aagagaaaaa gtcctacaat     24420
     gccgttgtaa aaatcgggga aaagggatat attgatttta tttcattctc aaaataagca     24480
     taaaagccct ttaaataggg cttttatata ttaatcacaa atcacttatc acaaatcact     24540
     tatcacaaat cacaaatcac ttgtgatttg tgattttta                            24579
//

If you have problems or comments...

PBIL Back to PBIL home page