(data stored in ACNUC8465 zone)

EMBL: FM954973

ID   FM954973; SV 2; circular; genomic DNA; STD; PRO; 1675515 BP.
XX
AC   FM954973;
XX
PR   Project:PRJEA32815;
XX
DT   17-DEC-2008 (Rel. 98, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Vibrio splendidus LGP32 chromosome 2
XX
KW   .
XX
OS   Vibrio tasmaniensis LGP32
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RA   Mazel D., Le Roux F.;
RT   "Vibrio splendidus str. LGP32 complete genome";
RL   Unpublished.
XX
RN   [2]
RC   revised by [3]
RP   1-1675515
RA   Mazel D., Le Roux F.;
RT   ;
RL   Submitted (01-OCT-2008) to the INSDC.
RL   Unite Plasticite du Genome Bacterien - CNRS URA2171, Institut Pasteur, 25
RL   Rue du Docteur Roux, Paris 75724, FRANCE.
XX
RN   [3]
RP   1-1675515
RA   Mazel D., Le Roux F.;
RT   ;
RL   Submitted (10-FEB-2009) to the INSDC.
RL   Unite Plasticite du Genome Bacterien - CNRS URA2171, Institut Pasteur, 25
RL   Rue du Docteur Roux, Paris 75724, FRANCE.
XX
DR   MD5; 09d33bdcdcda4854e69594bcdb8b0f98.
DR   BioSample; SAMEA2271989.
DR   EnsemblGenomes-Gn; EBG00001025732.
DR   EnsemblGenomes-Gn; EBG00001025733.
DR   EnsemblGenomes-Gn; EBG00001025734.
DR   EnsemblGenomes-Gn; EBG00001025735.
DR   EnsemblGenomes-Gn; EBG00001025736.
DR   EnsemblGenomes-Gn; EBG00001025737.
DR   EnsemblGenomes-Gn; EBG00001025738.
DR   EnsemblGenomes-Gn; EBG00001025739.
DR   EnsemblGenomes-Gn; EBG00001025740.
DR   EnsemblGenomes-Gn; EBG00001025741.
DR   EnsemblGenomes-Gn; EBG00001025742.
DR   EnsemblGenomes-Gn; EBG00001025743.
DR   EnsemblGenomes-Gn; EBG00001025744.
DR   EnsemblGenomes-Gn; EBG00001025745.
DR   EnsemblGenomes-Gn; EBG00001025746.
DR   EnsemblGenomes-Gn; EBG00001025747.
DR   EnsemblGenomes-Gn; EBG00001025748.
DR   EnsemblGenomes-Gn; EBG00001025749.
DR   EnsemblGenomes-Gn; EBG00001025750.
DR   EnsemblGenomes-Gn; EBG00001025751.
DR   EnsemblGenomes-Gn; EBG00001025752.
DR   EnsemblGenomes-Gn; EBG00001025753.
DR   EnsemblGenomes-Gn; EBG00001025754.
DR   EnsemblGenomes-Gn; EBG00001025755.
DR   EnsemblGenomes-Gn; EBG00001025756.
DR   EnsemblGenomes-Gn; EBG00001025757.
DR   EnsemblGenomes-Gn; EBG00001025758.
DR   EnsemblGenomes-Gn; EBG00001025759.
DR   EnsemblGenomes-Gn; VS_II1025.
DR   EnsemblGenomes-Gn; VS_IIm0182.
DR   EnsemblGenomes-Gn; VS_IIm0322.
DR   EnsemblGenomes-Gn; VS_IIm0331.
DR   EnsemblGenomes-Gn; VS_IIm0780.
DR   EnsemblGenomes-Gn; VS_IIm1091.
DR   EnsemblGenomes-Gn; VS_IIm1262.
DR   EnsemblGenomes-Gn; VS_IIm1425.
DR   EnsemblGenomes-Gn; VS_IIr1232.
DR   EnsemblGenomes-Gn; VS_IIr1233.
DR   EnsemblGenomes-Gn; VS_IIr1234.
DR   EnsemblGenomes-Gn; VS_IIr1243.
DR   EnsemblGenomes-Gn; VS_IIt0521.
DR   EnsemblGenomes-Gn; VS_IIt0522.
DR   EnsemblGenomes-Gn; VS_IIt0642.
DR   EnsemblGenomes-Gn; VS_IIt0643.
DR   EnsemblGenomes-Gn; VS_IIt0644.
DR   EnsemblGenomes-Gn; VS_IIt0646.
DR   EnsemblGenomes-Gn; VS_IIt0648.
DR   EnsemblGenomes-Gn; VS_IIt0649.
DR   EnsemblGenomes-Gn; VS_IIt0650.
DR   EnsemblGenomes-Gn; VS_IIt0651.
DR   EnsemblGenomes-Gn; VS_IIt0652.
DR   EnsemblGenomes-Gn; VS_IIt1231.
DR   EnsemblGenomes-Gn; VS_IIt1238.
DR   EnsemblGenomes-Gn; VS_IIt1239.
DR   EnsemblGenomes-Gn; VS_IIt1240.
DR   EnsemblGenomes-Gn; VS_IIt1241.
DR   EnsemblGenomes-Gn; VS_IIt1242.
DR   EnsemblGenomes-Tr; EBT00001628943.
DR   EnsemblGenomes-Tr; EBT00001628944.
DR   EnsemblGenomes-Tr; EBT00001628945.
DR   EnsemblGenomes-Tr; EBT00001628946.
DR   EnsemblGenomes-Tr; EBT00001628947.
DR   EnsemblGenomes-Tr; EBT00001628948.
DR   EnsemblGenomes-Tr; EBT00001628949.
DR   EnsemblGenomes-Tr; EBT00001628950.
DR   EnsemblGenomes-Tr; EBT00001628951.
DR   EnsemblGenomes-Tr; EBT00001628952.
DR   EnsemblGenomes-Tr; EBT00001628953.
DR   EnsemblGenomes-Tr; EBT00001628954.
DR   EnsemblGenomes-Tr; EBT00001628955.
DR   EnsemblGenomes-Tr; EBT00001628956.
DR   EnsemblGenomes-Tr; EBT00001628957.
DR   EnsemblGenomes-Tr; EBT00001628958.
DR   EnsemblGenomes-Tr; EBT00001628959.
DR   EnsemblGenomes-Tr; EBT00001628960.
DR   EnsemblGenomes-Tr; EBT00001628961.
DR   EnsemblGenomes-Tr; EBT00001628962.
DR   EnsemblGenomes-Tr; EBT00001628963.
DR   EnsemblGenomes-Tr; EBT00001628964.
DR   EnsemblGenomes-Tr; EBT00001628965.
DR   EnsemblGenomes-Tr; EBT00001628966.
DR   EnsemblGenomes-Tr; EBT00001628967.
DR   EnsemblGenomes-Tr; EBT00001628968.
DR   EnsemblGenomes-Tr; EBT00001628969.
DR   EnsemblGenomes-Tr; EBT00001628970.
DR   EnsemblGenomes-Tr; VS_II1025.
DR   EnsemblGenomes-Tr; VS_IIm0182-1.
DR   EnsemblGenomes-Tr; VS_IIm0322-1.
DR   EnsemblGenomes-Tr; VS_IIm0331-1.
DR   EnsemblGenomes-Tr; VS_IIm0780-1.
DR   EnsemblGenomes-Tr; VS_IIm1091-1.
DR   EnsemblGenomes-Tr; VS_IIm1262-1.
DR   EnsemblGenomes-Tr; VS_IIm1425-1.
DR   EnsemblGenomes-Tr; VS_IIr1232-1.
DR   EnsemblGenomes-Tr; VS_IIr1233-1.
DR   EnsemblGenomes-Tr; VS_IIr1234-1.
DR   EnsemblGenomes-Tr; VS_IIr1243-1.
DR   EnsemblGenomes-Tr; VS_IIt0521-1.
DR   EnsemblGenomes-Tr; VS_IIt0522-1.
DR   EnsemblGenomes-Tr; VS_IIt0642-1.
DR   EnsemblGenomes-Tr; VS_IIt0643-1.
DR   EnsemblGenomes-Tr; VS_IIt0644-1.
DR   EnsemblGenomes-Tr; VS_IIt0646-1.
DR   EnsemblGenomes-Tr; VS_IIt0648-1.
DR   EnsemblGenomes-Tr; VS_IIt0649-1.
DR   EnsemblGenomes-Tr; VS_IIt0650-1.
DR   EnsemblGenomes-Tr; VS_IIt0651-1.
DR   EnsemblGenomes-Tr; VS_IIt0652-1.
DR   EnsemblGenomes-Tr; VS_IIt1231-1.
DR   EnsemblGenomes-Tr; VS_IIt1238-1.
DR   EnsemblGenomes-Tr; VS_IIt1239-1.
DR   EnsemblGenomes-Tr; VS_IIt1240-1.
DR   EnsemblGenomes-Tr; VS_IIt1241-1.
DR   EnsemblGenomes-Tr; VS_IIt1242-1.
DR   EuropePMC; PMC3360785; 22662170.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00378; Qrr.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01808; MicX.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FM954973.
DR   SILVA-SSU; FM954973.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1675515
FT                   /organism="Vibrio tasmaniensis LGP32"
FT                   /chromosome="2"
FT                   /strain="LGP32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:575788"
FT   gene            409..1626
FT                   /locus_tag="VS_II0001"
FT   CDS_pept        409..1626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0001"
FT                   /product="ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25166"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041250"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25166.1"
FT                   /translation="MKREQTIDKLYQLAEQTQQVQADRIEIILEERSDEHFPPMSKAMM
FT                   ETRSGLTRRKLDEAITKLEADGHQFTKNNANHYSISLTEAHMLMDAAEVPKFHQRKQHA
FT                   DNKPWIINVQNQKGGTGKSMTAVHLAACLSLNLDKRYRICLIDLDPQGSLRLFLNPQIS
FT                   GAEHDSIYSAVDIMLDNVPEEQDVDLEFLRKNVLLPTQYPNLKTISAFPEDAMFNAEAW
FT                   QSLSRDQSLDIVRLLKEKLIDKIADDFDVIMIDTGPHVDPLVWNAMYASNALLIPCAAK
FT                   RLDWASTVNFFQHLPTVYEMFPDDWKGLEFVRLMPTMFEDDNKKQVSVLTEMNYLLNDQ
FT                   VMMATIPRSRAFETCADTYSTVFDLTVSDFEGGKKTLAVAQDAVQKSALELERVLHSNW
FT                   PSLNQG"
FT   gene            1632..2606
FT                   /locus_tag="VS_II0002"
FT   CDS_pept        1632..2606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0002"
FT                   /product="ParB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25168"
FT                   /db_xref="GOA:B7VPX5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25168.1"
FT                   /translation="MAIKTSDLNAKLFGKANKRRVATPQEAQTAVKEQAQVIELSVAGE
FT                   DLVSFELVRIPAADVATRTVVFEENAREQSFLNEHALSDVLTTLKERGQQYPAVGRKNK
FT                   DGKIEVLDGSRRRMSCILADKEFLIYVAENINGEHAKFLSDVANAHKPLSLYEKGKEMQ
FT                   AKLDKGEAEDQKALAKMFQCSEALVSGALKAAALPLELLQAYPNVSDLGRPTIVKLHKQ
FT                   FSGLTSEQQQTLLTKCDASEGFVWQRSEAQGVTRLTKDVTETLEGWVLELAPAPAKKAS
FT                   PKVELIKGRASYSRKGSNLALNIKKVDDATMEEILAFVQSKLD"
FT   gene            2699..4831
FT                   /locus_tag="VS_II0003"
FT   CDS_pept        2699..4831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0003"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25170"
FT                   /db_xref="GOA:B7VPX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25170.1"
FT                   /translation="MTNPTNTFLHTLSNIAQHNGHRYGVVFDGDFDWQNSAVFTFLQNS
FT                   YTPSIFQIGGIPFEGVIHAPVKKGQQLLGRESQVLVCDFREQFDANGFSAALGSLIGGG
FT                   LLLVLPPKVDDSEDNESFGQRWLKENFNKLISVSQHNETDDVVQATKALPLKQDFENSL
FT                   DKFEQQNLAVELVKKVVSGHRKRPLVLTADRGRGKSSTLGIAAAQLLVERHGLNIIVTA
FT                   PSVKAIEPVFSHASQRLEDCEVVNATYICYQSGSLRFVAPDELLKSKPDCDLLLVDEAA
FT                   AVPIPMLKSMVGIYHRMVFSTTVHGYEGSGRGFGLKFESWLSEHRAGWKGFKLDQPIRW
FT                   NRNDPLERWLFDCFLLGNDASLSDSVIHELDSFSDLAINQLSLVELSKAECLANPEPLQ
FT                   QCFSLLVDAHYQTSPNDLMQFLNNPAIRLYAAWQKNECLGCMLVTEEGGLDSDLIAQIQ
FT                   LGKRRPQGHLAPVLLANQLGCTQAALSRCLRVMRIAVSTRHQGSGIGRWMLGQLSKQTN
FT                   QADYLATSFGATSELISFWRDNDFVPVHIGHQRDQASGCHSVLMVKSLNKSAQNWVYNL
FT                   ISHFERSFCFLTSGSLASLEVDMVRALLPRQAESMAESEIQLLRNYVDGGNSYDSIGFS
FT                   VLNLILQSNGHQAHITESDAIIDTGFVVPDLLIAKVVQQKEWGTCVEQFNLVGRKQAEL
FT                   QFRKDVGTLLLNLHCK"
FT   gene            5362..7032
FT                   /locus_tag="VS_II0004"
FT   CDS_pept        5362..7032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0004"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25172"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25172.1"
FT                   /translation="MWDSIVTLSEDRKQVMACLPSGFVVNASFDNKTLPTTLEALNASN
FT                   YFIFEEEILRFVTLAKEGKGEAYQGILIAEVRNSSVTVELSDDEMLASLVVTGAYNGQA
FT                   LRGSDIIHCLAQAHITKGINKLALRKVLMMSSKLKPGEKFTQPVAKGSPAVKGKDAKFS
FT                   ALVEDITHQVLKPRSKDAGKIDMRDLGETITVGQNDPLMKRTPATKGIAGFTVQGRIIP
FT                   PLPGQDSLIKPGKGTHISPDDPNLLLSSSSGLPIIKERSIEVDDALCVSNVDVSTGHVK
FT                   FKGNVFVSGNIEPGMIVKATGSITVGGFIESAEVQAQGDIKVAKGIIGHTTKEDEPKSC
FT                   KVLSKGSIAASYAQNTELQTGNDILLNLHSMSNDIRCGNNLIVMDTFKKHGTLSGGEAK
FT                   VGGKVECVFLGVEGDTATKVHGFARFEGYQKKIAQLKEIYKHAQEQTMDVIRQELEFKK
FT                   RPKAERSEEQALEIEQQREKNNQAIEKTKSQLDTLEAEFETNLAECTVEAHEKVYTRVS
FT                   VLFGDEMVTTKRTHGGSVFSFNQYEIQCSFKMEKEDISL"
FT   gene            complement(7180..9294)
FT                   /locus_tag="VS_II0005"
FT   CDS_pept        complement(7180..9294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0005"
FT                   /product="ABC transporter IM-ABC: Transmembrane and ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25174"
FT                   /db_xref="GOA:B7VPX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25174.1"
FT                   /translation="MQDPLLNSLIYVSRYYGLANSPEALINGLPLSDGKLTPFLFPRSA
FT                   ERAGLVAKENRSDLENIPHLILPAVLLLKQGEACVLNSIDIEKQEAEIITTESGMMPIV
FT                   IPIEELKEQFIGRYFLVKKQFRYDERSPEILKTREGHWFWSTIWQSKKIYRDVLIASIL
FT                   INLFAIAAPMFTRLVYDKVVPNLAFETLWVLASGIFVVFLFDLLLKLMRSYFIDVAGKK
FT                   SDILISSKLFSKVLGIRMEAKPASVGAFAKNLQEFESIREFFTSATIGSLIDLPFALMF
FT                   LALIWLMAGNLVFVPVVGVVILIIYALLIQGPLRRTIEEGSRLASQKYANLIESLAGLE
FT                   TVKLFSAQSQFQFRWEEAVAHMANWNIKSRRITDSIQNTAGFVQQSTNVGMIIFGVYLM
FT                   AEGTLTMGGLIAATMLSGRAIGPLVQLSLLSTRYNQAKSSMTLIEQVMSMPSEQEEGKR
FT                   YIHRPIIQGHIALDKVTFHYPDSPIASIRDLTLNISPGEKVAIIGRIGSGKSTLERLIM
FT                   GLYKPTEGHVRIDDTDMEQLHHVDVRRNIGCVPQDSNLFYGTVRDNITLGRPLVDDRDV
FT                   MDAANRAGVTAFTQQDPAGLERQVGEGGGLLSGGQRQSIAIARAFLGRPPVLLMDEPTS
FT                   AMDNRSEMHIKHQLSQLLPSETLILITHKTSMLDIVDRVIVMEKGSIIADGPKSQVLSD
FT                   LKQGKVKAAS"
FT   gene            complement(9312..11222)
FT                   /locus_tag="VS_II0006"
FT   CDS_pept        complement(9312..11222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0006"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25176"
FT                   /db_xref="GOA:B7VPX9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25176.1"
FT                   /translation="MTLYKQLVVGMVAVFILLMTSVFMIEFNTTRDYLEEQQRSEVNNT
FT                   INTVGLALAPYLEEKDQVAVESVINALFDGSSYSVVRLIFLDTGDDILRSYPVKPSGVP
FT                   QWFTNLDLFKPIHDRRVITSGWMQLAEVEIVSHPGPAYTQLWEAFTRLVTFFGAIFLLG
FT                   LISISWILQRALRPLSLIIKKMDQIAKNQFGEPLVRPKTKDLILVVDGINHMSTQVELA
FT                   FKSQAQEAQRLRERAYIDPVSQLGNRAYYMSQLTQWLEESSLGGLAVLKAEFISEEYDD
FT                   KGYQEGDALVHQLAEQLQASISSPDITIARISSDEFGFIMPNIDENELKLVASSIVNCI
FT                   QNLGSDPTGMANPHIALGVTYSKKRKTSTEIMSLVDNALSSAKANRELAYGYVTADDHG
FT                   AVMGKQQWRMLVEEAIINDLVTFRFQAANNSFGKTYHQEVFSAIEKEGVRYGANQYLYA
FT                   LEQLEMSHILDQYVIEKMIDKLNAKELTSPVAINISPSSISQPSFIRWIGKSLEKNASI
FT                   AHLLHFEIPENCFVNVPHYTALLCNTIRNADAVFGVDNYGRNFQSLDYINEYRPSYVKL
FT                   DYLFTHNLDDEKQKFTLTSISRTAHNLGVTTIASRIETQTQLDILSDNYVEVFQGFIVD
FT                   K"
FT   gene            complement(11228..11896)
FT                   /locus_tag="VS_II0007"
FT   CDS_pept        complement(11228..11896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0007"
FT                   /product="Predicted periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25179"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25179.1"
FT                   /translation="MKSRFSLLLLFLTSFTSGALNKSDQRWIDAVSVTYGERAGKRVST
FT                   WRSNMTSYAGLSEKEKLDSVNRFFNQMYFVDDSILWGKNDYWATPLEFLGSNAGDCEDF
FT                   TIAKYFSLLELGVPDKKLRLVYVKALELNQFHMVLAYYSTPSAEPLILDNLNPEIKRGS
FT                   KRRDLRPIYSFNGKNLWLIKSAAGSGKLSGKSSRLSLWNDLRSRERSLKLNKPIINYDE
FT                   "
FT   gene            complement(11956..13347)
FT                   /locus_tag="VS_II0008"
FT   CDS_pept        complement(11956..13347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0008"
FT                   /product="Secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25182"
FT                   /db_xref="GOA:B7VPY1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25182.1"
FT                   /translation="MSQKNFSKLNETELEYVDDKTAALLLNTPTSARIMLWVIVLFFVA
FT                   AIGWSAWAEIDKVTVGQGKVIPSSQIQVVQNLEGGLVKEILVKEGQRVQKGQQLLLIDD
FT                   TRFRSDFREREQQVANLTANVLMLSASLTSVVINEEFSVKEWKKSVLLDYGKLAFPPLF
FT                   YDLHPKLVNRQKAEYRQDLNNLKNQLSVFDQQVGQKQQDLVEIKARVQNLRQSYNFARQ
FT                   ELDITKPLADEGVVPKIELLKLQRQVNDTRREMTSSELKIPLLRSAIKEAMLSRIDAAL
FT                   NFRSEQQEKLNQAQDKLSAMTESAVGLEDRVNRTVVVSPVTGTVKTLGINTVGGVIQPG
FT                   MDIVEIVPTEDSLLVEAKIAPQDIAFLRPELSAVVKFSAYDFTKYGGLVGVLEHISADT
FT                   TQDEEGNSFYIVRVRTEKYSFGANEELPIIPGMTASVDIITGKRTVLEYMLKPILSAQN
FT                   NALKE"
FT   gene            complement(13460..14773)
FT                   /locus_tag="VS_II0009"
FT   CDS_pept        complement(13460..14773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0009"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25185"
FT                   /db_xref="GOA:B7VPY2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25185.1"
FT                   /translation="MHPLPKLYFVDDEPAIRDSVEQAMLIEGIDIACFPNAIEALKRID
FT                   VTQAGIVITDIHMPVMDGIQLTQKLLNQNPHFQIIVLTGHGDVQTAVSAMKAGAYDFLE
FT                   KPFVVDALLTAVKKASDKLALVEENNLLRKELAVQNQVGPKLIGQSPSMQTLRRELISL
FT                   DTKTNPLLLFVGDLGTGKRVTAQYTHDLHSHQAAELCPVAAFNLPRSDEATFHQFVLQL
FT                   FLKHQGGTLYIHETEALTQDQWQWLANLKPTLLRENSCKTSATCIILATTILPTTMVSE
FT                   FRRFDLLPLAQRTEDIGSLFKHFARGAASRYQLPPPVITEKEVQRLIATHWSENIRQLR
FT                   QHAELRVLTKPKLASLESEPNHNQEQSDKDHIDLKTEEQQLSLSQRTDSFEQILLIEAL
FT                   HRHQGRLKEVQQELQVSRKTLYDKLRKHQLDKTDFKKQ"
FT   gene            complement(14865..16787)
FT                   /locus_tag="VS_II0010"
FT   CDS_pept        complement(14865..16787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0010"
FT                   /product="Signal transduction histidine kinase regulating
FT                   C4-dicarboxylate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25188"
FT                   /db_xref="GOA:B7VPY3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25188.1"
FT                   /translation="MTKILLNIMTPFVLFSLLLGAIGLSATHFLAVQFQEKVVTQKLNE
FT                   AANKANLQIDSELDKFKQIPDLLSHDPRLLSYFDSSPQTDKISAAQLNQLLFEWSNQSQ
FT                   ADTIYIHDPSGTVVASSNYQKLGTFVGENFSFRPYFASAIEGNSTHYVALGARSNVRGY
FT                   FLSSPLYIENDIVGVITVKVSLENLENILTSDDFEIVVLDSNQVVFLSSQTQWLYHSLL
FT                   PLSQKQQTDIALQRQYGQSEISIIEAFRSSNYQPQVNDANQPNNIQPNRVQKELTANRL
FT                   FKLGPFNLYPATFSNNQYQVVALKKAEAELIKVLQIDVIFVVIYSLVMLIAWSWRQTYV
FT                   AKVALTRLNQNLEQTVDKRTHYLKKSNQQLQQTIFQYQASQLKLKQTEQELTQTAKLAV
FT                   LGELSASINHEINQPLAALRTYSENSLKLLEMDRTDLVKSNLEKMIGLNNTITDIIARL
FT                   KVFTRKVTKQEHHVANLHQSVNNATSILSALMIKQGITLRLSTVPNHINIAIHPTELEQ
FT                   VLVNLIHNATQALQQQVLEQKILQEQQNLENVDQPASPQIGIEWQLHHNSCQLIIWDNG
FT                   IGMPDDKLEQLFNPFFTTKPEGLGLGLSISKRIIEAYHGTISANRLEPSGMVFSLSIPL
FT                   YNDKG"
FT   gene            16954..17589
FT                   /locus_tag="VS_II0011"
FT   CDS_pept        16954..17589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0011"
FT                   /product="Pyridoxamine-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25190"
FT                   /db_xref="GOA:B7VPY4"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VPY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25190.1"
FT                   /translation="MELTDIRREYAKGGLRRKDLAADPIEQFNLWLEQAIEAKLTDPTA
FT                   MTVATVDENGQPFQRIVLLKNVDKDGFVFYTNLGSRKAHQLEHNSKISLHFPWHPLERQ
FT                   VHITGTAEKLTAMENMKYFSSRPKESQLAAIASKQSSRISARGILEGKYLELKQKFAKG
FT                   EIPVPSFWGGFRVRVDSIEFWQGGEHRLHDRFLFSRQDSRWDIDRLAP"
FT   gene            complement(17694..18476)
FT                   /locus_tag="VS_II0012"
FT   CDS_pept        complement(17694..18476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0012"
FT                   /product="Transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25193"
FT                   /db_xref="GOA:B7VPY5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25193.1"
FT                   /translation="MSLQLYKKLISLQYSLLRDKTLPDPLNSIHRSLFEQLPGCWGCKD
FT                   TDSVFVYANLAYNQLIGLKPNETCTGLTDFDMPSQTTECAQDFRAQDKHVMDTRSTLKI
FT                   LDIHPYPDGRWHAHIFTKTPWLDGNGEVQGTIFYGQELTDTAILEVGHWVCQATCEKDN
FT                   QVSIAGSKPRISKLKKRLTSRESEVLFLLLFGKKPQYIASTLNISIKTVEGHVARLKQK
FT                   FDARSKSQLIEYALDSGLGSMIPETLLKKQISVVLHSD"
FT   gene            complement(18853..20682)
FT                   /locus_tag="VS_II0014"
FT   CDS_pept        complement(18853..20682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0014"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25195"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25195.1"
FT                   /translation="MRQGFPTLLFALAPCLMTPAVFAEATSPAITSSVIDIESSLFEEH
FT                   ASLTAIEKKMADKQNQVDNQAEQMARQAKLLAQSEQKLATAKTSLEQDYTRMIDEPDFD
FT                   ISPAQNRFQDAWKSVKEHKLTISDSEQKLQSLVMELEAIKAEKSAVEMSIAHLNQDKLR
FT                   ARAERLRSEVTQTQEHTVSFTNRCSSDMTLAQCSDQTVALTLQKAVKQFQNSLVSNATE
FT                   SKIVKEHLASASLNIHVLQHSVKSSGFSEDNRYRAVVAANLETRPDKNTPCRLLGIKSS
FT                   NCFDQSDLQADDQQKEVAWVNLVVRSNQYNDKVSINGVNYGSTPVEVMLPTGQHMVTIE
FT                   KEGYLSFHQELKIARDHNLRAVLQAKQNSLNVGTKFADPMGNGAQSPEMIVVGSGTYLL
FT                   GENNAEQVTIKQPFALAATPTRVQDFKAFVKNTGYQTDAELMNTCDTFVNAEITTVSDN
FT                   DWKAPGFKQVDNSPVVCVSQSDAKAYTRWLSKKTGFTYRLPTQQEWEAAARAGQDTSFW
FT                   WGNKFRSGRANTGWSGTQWSNVSTSPVKSFLPTPTGFYDMVGNVWEWTATQKGIAKGGA
FT                   WSFSPEEAKVFAELYVSPSTAANYLGFRVLREL"
FT   gene            complement(20840..21961)
FT                   /locus_tag="VS_II0016"
FT   CDS_pept        complement(20840..21961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0016"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25198"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25198.1"
FT                   /translation="MQGPMTNFRISALLLALSPLWVSASLSAEELNQVDPVSAIDAKLT
FT                   EKNSDIERISATKVSATETLKQLQNQNSKLLREGEELKAKRNRAKSVLDKQYSRLLDDP
FT                   ETDLVSFQKGYQDAWAAVKENQSSQLDNQQAMNENEIYLSQIKQKQARLNNELANLKES
FT                   KVEARVKRIATELRESAVLETSYTTTCSSTMTLGECIAQGKHLTKQKAVQNFKSKLLEQ
FT                   LTESTLAKQNLQGVQLNIHVQDSQAIKSGFSGNNSYFVQMQAQLQAKPEAIAACNLLNV
FT                   STRYCLTDSDVKVTKKSDKQWANVMVRSDQYNDSVTINGIKYGSTPLEVSLPSGRHQVT
FT                   ISKEGYESYNRTVTINGSDTIWVKLLPSKENEI"
FT   gene            complement(22321..22524)
FT                   /locus_tag="VS_II0017"
FT   CDS_pept        complement(22321..22524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25201"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25201.1"
FT                   /translation="MISAGRGPVSPSGDKSRFGKGKGFGMTAKYLGRHDKNNTLKSAED
FT                   EFVNDHERCFLFFKERSLLITT"
FT   gene            22448..23272
FT                   /locus_tag="VS_II0018"
FT   CDS_pept        22448..23272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0018"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25204"
FT                   /db_xref="GOA:B7VPY9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25204.1"
FT                   /translation="MPKPLPFPNLDLSPLGLTGPRPAEIITLPSHMDCHDHHYSQVVIG
FT                   LKGQAEFEVSGKGNLVGPGQGCVVTASSDHAFGGVVGQSDILVLNMPVPTDDDPLMLEK
FT                   INQLESSNVYFQLDAQIQKLIHMLVQEMQASPNDLLLSRACNDTVIALMQRHISAFETS
FT                   IKDSRFDLEALDRYIEQHLANKISVAQLAGSVFLGESQFHMLFKDQMGITPHQYVLGKR
FT                   IDRSRRLIEQGNLSLGQVAELAGFSGQSSFTHTFSRLQGMSPSQYKKKISVK"
FT   gene            23454..26609
FT                   /locus_tag="VS_II0019"
FT   CDS_pept        23454..26609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0019"
FT                   /product="Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25207"
FT                   /db_xref="GOA:B7VPZ0"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25207.1"
FT                   /translation="MFTATDVLKPEFNEQSLADLWSLISPLYMVDETQWLEQLLPLATP
FT                   SESEKQQITDKTTSLIEAIRADKTSIQMIDALLLEYSLDTQEGILLMCLAEALMRIPDS
FT                   ATADALIRDKLSVADWKSHLKNSDSVFVNASTWGLMLTGKVVGLSSKEQSAGQAVNRLV
FT                   NKLSEPVIRKAMHQAMKVMGHQFVLGRSIAEAQKNGKSMRDKGFTYSYDMLGEAALTTA
FT                   DANKYFKDYLMAIEAVGRDNYVSPQSKVSSKSSPAPSVSIKLSALHPRYEVANEERVLT
FT                   ELCDTLEQLLRRAVELDVAITIDAEEADRLELSLKLFEKLYRTDLVKGWGKFGLVIQAY
FT                   SKRALPVLVWLNRLAKEQGDLIPLRLVKGAYWDSEIKWSQQAGFTDYPVYTRKEATDVA
FT                   YLACARYLLSPSVRGNIFPQFASHNAHTVSAIAVMTDHKDFEFQRLHGMGDSLYNHAME
FT                   AYQQSVRIYAPVGSHKDLLPYLVRRLLENGANSSFVHRLVDARCPVAELTQHPVDMLLA
FT                   FDTLHNTKIPLPPAVFPERKNSYGVNIDIESEAHQFEEQVKGFLNNQWTAGPVINGESL
FT                   AESMIKADQNVEQVTAPYDRRINVGQVAFANLDHVSAAITGADAAFADWNATSVETKAA
FT                   ALDKLADLMEDNLAELVAICHQEAGKTIHDSVDEVREAVDFCRYYAKQADNLQGFELKG
FT                   FDGQTRIASRQGRGVFVCISPWNFPLAIFLGQITAALVAGNTVVAKPAEQTSLIAARAV
FT                   ELMNEAGFPAGTIQLLPGRGAEIGSALTSHDAIAGVAFTGSTPTAQRINVSLATRNAKP
FT                   VPFIAETGGQNAMIVDSTALPEQVVRDVIRSAFASAGQRCSALRVLYIQEDIADRVVGL
FT                   IHGAMDELSVGIPHLHKTDVGPVIDQNAKQKLMAHLENMTNTQKKVAQLSLGSDCEHGD
FT                   FVPPSAFEIDDISCLKEEQFGPVLHIVRFKASELAQVVDQINQTGFGLTMGIHSRNETT
FT                   YRWIEKHVRVGNCYINRDQVGAVVGVQPFGGQGLSGTGPKAGGPHYLYRFTDVHFSQSQ
FT                   DKA"
FT   gene            26621..27325
FT                   /locus_tag="VS_II0020"
FT   CDS_pept        26621..27325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0020"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25209"
FT                   /db_xref="GOA:B7VPZ1"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25209.1"
FT                   /translation="MVHQVTGFSDALLAWEQWNLTDFDYKSAQVLALKSEIESQSAPLA
FT                   TVATYHLEQASALLSEHHLMAGPTGETNELYAAGRGVALVIVDDCEEKVPALQTAMALI
FT                   TAALLAGNSVQLCSDDVQFNTLVADAAKSANLPTNLVQVASYDAAQQLLSCDVRSVGYV
FT                   GYSQTAQAINLQLAKRDGAIVGLVAETDLATMNVANDPHLSLRFITERTRTINITAVGG
FT                   NATLLELGSEAH"
FT   gene            27509..29002
FT                   /locus_tag="VS_II0021"
FT   CDS_pept        27509..29002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0021"
FT                   /product="Sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25211"
FT                   /db_xref="GOA:B7VPZ2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25211.1"
FT                   /translation="MIENSFAITTTFIAYLIMMLAIGVIAYKRTSNSTDYFLGGRSLGP
FT                   WPAALSAGASDMSGWLLLGLPGYAYAAGFEAFWLAGGLLVGTWANWLISAKRLRTYSIT
FT                   TESLTLPEFLSRRFNDNSKLIQTISAFFILLFFLFYTSSGLVAGGKLFETVFGLDYTTA
FT                   VIIGTVCVVSYTLFGGFLAVSWTDLVQGLLMSAALLIVPIAAMNGGLGQLSSDLHNINP
FT                   ELLTLWNDAKGEPLSAIAIISLAAWGLGYFGQPHILARFKATRSNKDLTTARRIAVIWT
FT                   ALSMIGAMLVGLVGLIYVTNSGAPKLDDGEKIFMLLVNAMFHPVIAGILLAAILAAIMS
FT                   TADSQLLVSSSAMAEDLYKQVLKKDATSEEIVRVGRFAVILISLVALVLAMTPDSSVLG
FT                   LVSYAWAGFGAAFGPAIVLSLYWSRMNRNGALAGIVVGGVTIVLWKQFTGGWFDVYEIV
FT                   PGIILSTLSIVIVSLMTGEPEDEVKKQHAEFEKNLVELD"
FT   gene            29390..29614
FT                   /locus_tag="VS_II0022"
FT   CDS_pept        29390..29614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0022"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25213"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25213.1"
FT                   /translation="MPDLYCKGCKKTTLHKSIMKRCESEPETTSGRMMQWTSKLFSGNL
FT                   YYDMETQHFCRTCNCRCETGTAVPQVGLA"
FT   gene            complement(29677..29847)
FT                   /locus_tag="VS_II0023"
FT   CDS_pept        complement(29677..29847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0023"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25215"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25215.1"
FT                   /translation="MKTQELAYKPYGIGSWTHVTVSKDVAQALASEYSNYGWEVKIDGN
FT                   VVEAEPSLKAA"
FT   gene            30127..30615
FT                   /locus_tag="VS_II0024"
FT   CDS_pept        30127..30615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0024"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25216"
FT                   /db_xref="GOA:B7VPZ5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25216.1"
FT                   /translation="MSQHQLDRIDKEILRILHMKGRLPVVELAKQVNLTTSPCSDRLKR
FT                   LEKVGYITGYHAELCSEKLGLDVQVFIHIRLDQTSFSIFDKFAQAVETMPEVEECYSLS
FT                   GDFDTMIKVRVKDMKAYQAFMATKLGTLPGVIQTRSEVVIEEHKKGFGVNPELLATIK"
FT   gene            complement(30726..31430)
FT                   /locus_tag="VS_II0025"
FT   CDS_pept        complement(30726..31430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25218"
FT                   /db_xref="GOA:B7VPZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25218.1"
FT                   /translation="MNKSVLTNVIALALLAGGYATANQYLLYAGLFAFSGAITNWLAIH
FT                   MLFEKVPGLYGSGVIPARFEEFKAAIKQLMMEQFFTESNIDRFLSSEMTGKSLNLEPVI
FT                   KKIDFNPAFESLAHVIENSQFGGMLAMVGGTEALQPMKAPFVEKMQESVIEISKSDSVK
FT                   NAIKDELESPAMMDEIKENIEAIIDQRLNELTPKLVKEMVQTMIKKHLGWLVVWGGVFG
FT                   GVIGLISAAITL"
FT   gene            complement(31728..33578)
FT                   /locus_tag="VS_II0026"
FT   CDS_pept        complement(31728..33578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0026"
FT                   /product="ABC transporters: Transmembrane and ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25220"
FT                   /db_xref="GOA:B7VPZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25220.1"
FT                   /translation="MYKKFEGFTEAFPKGEPIQPPTGILAFCRHYTRGFEKPLILLGLM
FT                   SMTIAIIEVALFGYMGQLVDWLSTSNPDTFLADNESTLMGLGVLLLVVMPILISVYSLL
FT                   LHQTLLGNYPMSIRWLAHRYLLKQSLSFYQDDFAGRVATKVMQTSLAVRETVTKMVDVF
FT                   VYVTVYFTAMLFMLAESDWRLMAPMLIWLFIYVGIQLHFVPKLKDVSSEQADARSLMTG
FT                   RIVDSYTNIATVKLFSHSKRETEYAEEGMEGFLDTVHRQMRLVTGFNICVEFANYLLVF
FT                   SIAGISIYLWLDNAITVGAIAIAVSLALRINGMSKWIMWEIGGLFENLGTVIDGIKTLS
FT                   KPIVIEDKKDAKPLDVPQGGINFDNVSFNYGENKGVINNLNLNIKPGEKVGLVGRSGAG
FT                   KSTLVNLLLRFHDVESGRILIDDQEISSVTQDSLRSNIGMVTQDTSLLHRSIKDNILYG
FT                   RPEATDEEVYAATKQAHAHEFIETLTDPFGNVGYDAQVGERGVKLSGGQRQRVAISRVL
FT                   LKNAPLLVLDEATSALDSEVEAAIQESLIELMEGKTVIAIAHRLSTIAAMDRLIVLDQG
FT                   NIVEEGTHQELIHQNGIYAQLWNHQTGGFIGDDLEQTTSA"
FT   gene            34145..35119
FT                   /locus_tag="VS_II0027"
FT   CDS_pept        34145..35119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0027"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25222"
FT                   /db_xref="InterPro:IPR014541"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25222.1"
FT                   /translation="MLNLHKKSLHITNVQNANCVVMVPPKEFKFNEETARDNEFQHRVD
FT                   LTEAEVKLETMAEFKAMVVSLRKEGVQVVEFDYPELGVETPDAVFPNNWFSTCSDGSLF
FT                   TFPMACENRQNEVKPNALIEALEASGRIVNHSESMESYVAQGSYLESTGVMVIDHINKT
FT                   IYAALSQRCDREVLEDYAKRIGYSRVVSFQTALPSGQPIYHTNVMMAIGDNFCVICDEV
FT                   IPEFERRFVVKSLAKDKQVISISIDQMNRFCGNILQLETVNGDKVIAMSQSAYDAFSPA
FT                   QLAQLSTHGKLLPFNVKTIEDIGGGSVRCMLGEVFLPTRVNRL"
FT   gene            complement(35271..35903)
FT                   /locus_tag="VS_II0028"
FT   CDS_pept        complement(35271..35903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0028"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25224"
FT                   /db_xref="GOA:B7VPZ9"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25224.1"
FT                   /translation="MNNKNKHIVLIHGLYMPALIMQYLDRNFKKRGFTTHKFAYNSLRF
FT                   PSAAKRLNRFVNARFNEYDEVYFFGHSLGGLLIRHYFKFYQPHFADTCIITAGTPHNGA
FT                   TIAKTLSNHGLGFIFGSSKMILSDGLGDYDIDVPIGVITGTYDAGVGRIVLGRNPGDGT
FT                   VTLEDANLRGATDTYALKLNHTALVYSKEVVTLSAQFIEHRAFKDAS"
FT   gene            complement(36019..36858)
FT                   /locus_tag="VS_II0029"
FT   CDS_pept        complement(36019..36858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0029"
FT                   /product="Transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25226"
FT                   /db_xref="GOA:B7VQ00"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25226.1"
FT                   /translation="MINWLQSPKSPEVAQFIDCYWLIEKTPDAQTHQFPKLNPDPSAHL
FT                   ILSPSDQPYHYTIEQQVDQGIGCHLLLPHHKAIELDHSKPFIHLGIKFHVGALYSLNIP
FT                   DCPHPSLDHVNPIELANLLGNSNTEAMSLIKLAQTDFKACCERLDSLLLPWLSAGKTDR
FT                   HSELTRKVLQVLSTTPIAELGDKLFCSQRTLERSFNKVTGLTLKQCQSMNKLEAMLEYL
FT                   YKRNFDDIDWIDVAYQFGFSDQPHLIRYLKKTIGLTPNTYAKQGGLTIDVYGGVRSD"
FT   gene            complement(37057..37881)
FT                   /locus_tag="VS_II0030"
FT   CDS_pept        complement(37057..37881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0030"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25228"
FT                   /db_xref="GOA:B7VQ01"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR040579"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25228.1"
FT                   /translation="MNAMLDIKKISSLSDVSELKTAYFTESTAPLDGMWHFGFVPMSDH
FT                   FAFYENSKLVGYCVLNGEGYLLQFFLAATANANITDLFTLIIENNRSVIGEVKGAFVST
FT                   AEPQYLSLCLDNTESFKVNALMFRQRPTAVANNIENIEMTLATEEQLEQLVEFASSAIG
FT                   APKEWLTGYYGNLIARQELWGYWESDSILATGECRKFDEHQTQFADLGMIVAPQERGKG
FT                   LATRVLNFLTQHATSQGLEAMCSTESSNIGAQKAIIRAGLSSKNRILQFDFS"
FT   gene            complement(38102..39724)
FT                   /locus_tag="VS_II0031"
FT   CDS_pept        complement(38102..39724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0031"
FT                   /product="Predicted membrane-associated, metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25230"
FT                   /db_xref="GOA:B7VQ02"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25230.1"
FT                   /translation="MNLPSLNMSINKLPFVLAVYYLLVINIPLSLELFSIVQASKSESV
FT                   AFLVSIPFFFLAAFNFIFQVFNWPIFSKPFFILLLITSTLVSYSMFNYGIFVDYGMIEN
FT                   VFETNSGEAASYVSTHSILWLLAMGGIPSIILLFTKLEKESWKDFFVWKSIGLLSSLIV
FT                   IAIIAGIFYKDYVSIGRNHSHIKKMIIPTEYVSSTVKYINNTYIKQPIPYQELGLDAKQ
FT                   TAQAKAATKPTLLVFVLGETARVYNYQYHGYERETNAHTKPYNPIFFSDVQSCGTATAV
FT                   SVPCMFSNMNRSNYDRDKAYNQDNVVDIMNRAGIHSIWREHDGGDKAVAHRIKEMTLVA
FT                   KDSDPLCNKYVCYDTAMLENFEQDTQDLKQDSIIFYHISGSHGPTYFERYPEEHKKFTP
FT                   DCARADIENCTKEEVVNTYDNTILYTDFFLSQTIQKLEKLTDKYNVALMYISDHGESLG
FT                   ENGVYLHGMPYSLAPKEQTHVPMILWMSDGFAAQKGISETCLRKAGKEQSFSHDNLFDS
FT                   LLGLMDVQTKEYRASQDIFAPCR"
FT   gene            complement(39954..40544)
FT                   /locus_tag="VS_II0032"
FT   CDS_pept        complement(39954..40544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0032"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25231"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25231.1"
FT                   /translation="MSKQGIIMKKSVLALGLIGLVSLPTFAASTDGGAYVGGGLSVYQD
FT                   SDTDGHGNLDSDGMGYNLYGGYQFNRIVGVELGYNDYADYKNGAEKLSPTSISASANIG
FT                   YTFDNTIRPFVLAGLSSVDLHANQAANYGDDSGTGFHFGVGVEYTPIEHLTLRLISQAD
FT                   AVSVDDYSYQGSLKNDDHTLAFNSVSFGGSYNF"
FT   gene            40887..41426
FT                   /locus_tag="VS_II0033"
FT   CDS_pept        40887..41426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0033"
FT                   /product="Amidase related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25233"
FT                   /db_xref="GOA:B7VQ04"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25233.1"
FT                   /translation="MLNRANTGLVVVDVQGKLARLVDESDTLIANCGKLAQGAQVLGLP
FT                   IIRLEQNPEKLGATVDELNDLLNDAKPIPKFTFNACDEPKFVEAVQDKGVETWLVCGIE
FT                   AHICVYQTAMGLLDLGYKVQVVGDCISSRTALNKNLAICRLMDAGIEITGLEMSLYELV
FT                   KDCRAREFKLILSLIR"
FT   gene            complement(41423..42286)
FT                   /locus_tag="VS_II0034"
FT   CDS_pept        complement(41423..42286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0034"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25236"
FT                   /db_xref="GOA:B7VQ05"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25236.1"
FT                   /translation="MSLEVDIISQITERFPALRDAEKKVAKLIMDDIDFAANASITELA
FT                   EGAQVSEATITRFAKAIGCSNVRDMKIKLAQTLTVGQRFILEPVDQTGYQGIYESIKQS
FT                   LDINRTLFKEQDVETAVSWLHNARQIIAIGMGGGSTIASQELQHRLFRLGYPVVSYNDG
FT                   LMSRMVAATADANDVMVMISATGFTPVITETAELAKQYGLKIIAITPQDTPLAKIADIL
FT                   LPIKHMETDFIYKPSASRYAMLALVDVLSMGMAVNHKNRSRDKLRRLKVALDSYRGGGD
FT                   RQPLGD"
FT   gene            complement(42404..43678)
FT                   /locus_tag="VS_II0035"
FT   CDS_pept        complement(42404..43678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0035"
FT                   /product="Predicted amino acid aldolase or racemase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25237"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25237.1"
FT                   /translation="MKHNPAQKDVIKYQKDSFALTEKGQKGRAVSQSENGIYRLVDEDI
FT                   SLPIAVIKQSALTNNLNWMQSFADHHQVKLSPHGKTSMTPDFFRQQLENGAWGITVATP
FT                   AQAEIAAMAGAKRIIMANQLVGKTNMAIVEQLISEFDVDFYCCVDSSINVQQLSQYFAN
FT                   TQQTLKVLIEFGVPGGRCGCRSPQEVLELAQTIQDTPALSLAGIEVYEGVIHGDNAEQD
FT                   IRTFLNHALTSVESLASDGLIAGQPIITGAGSAWYDVVAECLANLTDYLAIIRPGCYAI
FT                   HDTGIYLDAQSKVLQRAQVNQGYACELGGDLESALEVWAYVISRPEPTKLVVGLGKRDV
FT                   AFDAGLPIAERGYRNGEAISVKGLTATAVMDQHTFVEIDGSSEIEVGDMIAFSTSHPCL
FT                   TFDKWRYIAISDDDHQVRHWVETCF"
FT   gene            43855..45288
FT                   /locus_tag="VS_II0036"
FT   CDS_pept        43855..45288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0036"
FT                   /product="N-acyl-D-aspartate/D-glutamate deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25239"
FT                   /db_xref="GOA:B7VQ07"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25239.1"
FT                   /translation="MLFDTIIKNVEVFDGTGEQSFCADVAILDGKIAEIGQIDHEDCGQ
FT                   LVEGAGLALAPGFIDVHTHDDTNVIRYPDCLPKISQGVTTVIVGNCGISASPTVLAGDP
FT                   PDPMNLLGAQADFKYPTFAAYAQAVEQAQPAVNVAALVGHTTLRNQVMDDLQRTASEDE
FT                   IAVMQTNLDLAMAQGALGLSSGLAYASAKQANANEVMQLAKVLSSHGGIYTTHMRTEFE
FT                   EILSAMEEAFETGQYAKVPVVISHLKCAGAGNWGRTVEVLDLMDKVSEHQDVSCDCYPY
FT                   SASSSTLDLKQVTDDFDIFITWSEAKPEHAGKTLKQIADEMNLPLMDAAKALQPAGAVY
FT                   HCMDENDVKRVLKYKLTMVGSDGLPNDPHPHPRLWGTFPKVLGHYCRDEKLFSLPEAIH
FT                   KMTGMSAQRYNLAGRGEVRCGAFADLVLFDPKNIKDTATFENPISVAEGIESVFVNGEL
FT                   TYQQGKVRNNHSGVFIYRK"
FT   gene            45409..45801
FT                   /locus_tag="VS_II0037"
FT   CDS_pept        45409..45801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0037"
FT                   /product="putative translation initiationinhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25241"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25241.1"
FT                   /translation="MTIKRYGVEGGTGTGGQHLPFARATEAGGFLYVSGQTPMTDGEVV
FT                   EGGIVDQSRLAIQNCVDIMTEAGYGLEDVMHVKVVLTDSRYFQSFNKVFKEFFGANPPA
FT                   RICMVCDLVVDVKVEVDVTCYRADRG"
FT   gene            46007..47521
FT                   /locus_tag="VS_II0038"
FT   CDS_pept        46007..47521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0038"
FT                   /product="putative Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25242"
FT                   /db_xref="GOA:B7VQ09"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25242.1"
FT                   /translation="MNSTLFLTGFGVYVLFLIWLGWFVSRNQKSGEDFLLGGRGLPMFL
FT                   VLGTTVATMVGTGSSMGAVGFGYANGWAGALYGIGGAIGILLLALWFAPVRKLNFMTMS
FT                   EELAYYVGANRIVKNVVGVLIFVASIGWLGAHILGGGMYLAWIADIDLNLAKIIIAAAF
FT                   TIYVVIGGYTAVVWTDTIQAIILFAGFILMAVMSVDYIGGMDNLYAAMDPAATSFLAID
FT                   KLGLLPAVSLAVVIGVGVLATPSFRQRIYSGKDVSTVRRSFVASGVLYLFFSIIPAIIG
FT                   MAAHAIDPSLDNANYSFPYVAATVLPVGVGMIVLIAGLSATMSSASSDAIAGVSILLRD
FT                   VYVMFTGRVPNKESMMNYSRLALIVVIGFALLFALTSNDIIGYITKMISTVMSGMFVCG
FT                   MLGRFWKRYNWQGALATLVGASVASFVVMLNADYTAFWGNPVIPSCLVALTAGVLVSLC
FT                   TPANQVTPEMAKAILDDERALMEMELSDSGVLEEDASSQHPANQTS"
FT   gene            47652..48593
FT                   /locus_tag="VS_II0039"
FT   CDS_pept        47652..48593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0039"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25244"
FT                   /db_xref="GOA:B7VQ10"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25244.1"
FT                   /translation="MPASSNFNIAFFGECMVEISGSPLTKKFGGDTLNTALYLSRLTQH
FT                   QNLSVHYATGLGSDELSQNMIDSWQLEGIQTNFVERIPNKLPGLYMVETDETGERHFHY
FT                   WRNDTAVKSYFHANDLNKLEIALTEKQVDAVYISGISIAILDDASRERLFKAISVFSNQ
FT                   GGKVIFDNNYRPQLWSTEQARHWYAKLLPLVDIALITEDDDLLVWGNSESVQQRCLRLG
FT                   CQEIVIKRGCEPCKIVQAEQGNIVENYVSATRVSNVVDTCAAGDSFAAGYLAARLTGES
FT                   ATDAAELGHQLASIVIQYSGAIIPVSAMSQLI"
FT   gene            48619..49254
FT                   /locus_tag="VS_II0040"
FT   CDS_pept        48619..49254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0040"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-deydro-3-deoxyphosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25246"
FT                   /db_xref="GOA:B7VQ11"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25246.1"
FT                   /translation="MSQEMINKLKQFKVIPVIQINKVEHAIPLAKVLIENGLPVAEVTF
FT                   RTEAAADAIRAMRDAYPEMCIGAGTVLTPAQIDLAKESGSEFIVAPGLNPNTVKRCQEI
FT                   GMPIVPGVNNPSQVEQALELGLNFLKFFPAEASGGINMVKSLLAPYVDVSLMPTGGIGK
FT                   HNVNDYLAVDRVVCCGGTWMVSPKMIENEQWNEIAVLVREAVALVNEQ"
FT   gene            49412..51862
FT                   /locus_tag="VS_II0041"
FT   CDS_pept        49412..51862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0041"
FT                   /product="N-acetyl-beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25247"
FT                   /db_xref="GOA:B7VQ12"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25247.1"
FT                   /translation="MKKTILSLLISGSVVSPMALAMAPNTDLNLMPYPQTVELQTGQVK
FT                   VDGNFKVYIKGFNSDRVEYTAKRFIDRLERQTGVPILNWQVDSADQANLIIDIDAAPKS
FT                   EVQNIDSVESYKITTQGEQITLSSPSPYGTIHGIETLLQLVETTATGYHIPAVTIVDEP
FT                   RFRWRGVSYDTSRHFIEFDVLIRQLDAMASAKMNVFHWHFWDDQGIRIQTESWPRLWSE
FT                   TADGNYYTKDQVRYLVEYARNLGIRVIPEVSLPGHSSAVAHAYPRLMSGGEGQNYEQER
FT                   GWGVFEPLMDPLNPEVYEMLGDVFDEVTELFPDEYFHIGGDEPNYAQWKNSEKHQQFIE
FT                   ENNIDGERGLQSYLNVKVEKMLEERGKKMTGWDEIWHKDLPTSIVIQSWQGHDSIGRAA
FT                   KEGYPGILSTGYYLDQPQPTSYHYRNDPMPTGITVDDKLHSGEKFVTYQWQKPRSKGGP
FT                   RKGTLTIIEGKDGTFRAFSDYNGKSREEIYILDYVPGKTFVGHFDNFMSYTEFNLNLNP
FT                   KGFTEGSYQLVGNVRWPTTGEVIASSDVEGSVIPEPNGGYPAELTDKEKELILGGEITM
FT                   WLENKDSLTVENYLWPRSYAIAERFWSDAELTDERSMYKRMKAMDTWSEVSVGLRHHAD
FT                   ADMLLKRIAKGQDIHDLRVLAKYTEPAQYYARNWEKWNSTEPKGTLYSQYERLNRFVDA
FT                   LPVESYAVYEMQDLVSEVATGNQQALEQLAQHYQQAKAAALAAKTVFAGNVSSVETVVV
FT                   AEKTAEVADLALTLIAKAQAGEKVRASDANAYQAILFESAKIYDESIIAIVRPTELLLK
FT                   QLAE"
FT   gene            complement(52087..52383)
FT                   /locus_tag="VS_II0042"
FT   CDS_pept        complement(52087..52383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0042"
FT                   /product="putative Bor protein precursor of bacteriophage"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25249"
FT                   /db_xref="InterPro:IPR010438"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25249.1"
FT                   /translation="MKKLMIIAALSLVATGCAQQTFVMAPQESEATAPTTEKSHHFFIN
FT                   GLAQKKQIDAAKVCSGIDNVAKVEVQETFVNGLLAAVTFGIYTPREARVYCKA"
FT   gene            complement(52507..53826)
FT                   /locus_tag="VS_II0043"
FT   CDS_pept        complement(52507..53826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0043"
FT                   /product="Sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25251"
FT                   /db_xref="GOA:B7VQ14"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25251.1"
FT                   /translation="MRRIYLESLLGLLTCFIVGLLAYEICVYQLNTDYEYILQDYEATA
FT                   HQQLLENIANNQGLEAAHQAINQFVDTSRNTLVTFKSNDEVPTPVSEFFTANPNVFIFH
FT                   DDYRELWFRLANSENIYHYQPNDDTLVRQKIELEDDLIWVFFIASFIVYGLGHLLIIFR
FT                   RVKKLENATLRFSEGDLSSRAETSGGSAIGTLNKSFNLMADRIHSLIESNRSLTNAVAH
FT                   ELRTPIFRIQWQAEMLKDTLLNKEQQDTIESIVEDTEEMEKMVDELLYYAKLDSCDLDN
FT                   LLQPLEIRDFLDHAMSRWNKETEFSIDLSLPEQPHLILADDTLLNRALDNLVRNAMKFA
FT                   RSQISIEASVHHDMLQIAVHDDGDGVAKEHRSRLFEPFYVGDKARNKAKSGHGLGLSIV
FT                   KKICVQHGATVQVAQSNTLKGAVFTIAFPLCNDSTDKPIQ"
FT   gene            complement(53863..54567)
FT                   /locus_tag="VS_II0044"
FT   CDS_pept        complement(53863..54567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0044"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25253"
FT                   /db_xref="GOA:B7VQ15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25253.1"
FT                   /translation="MTKPKMIIVEDDLKLQQMLKDYFVAQDFEVTALDDGSDAVQTILD
FT                   DQPDIVLLDLMLPVTDGLTICRQTRTLFKGKILMLTASDDDFDHVAGLETGADDYVTKP
FT                   IKPRVLLARVRSLLRRQETNTPLVDDSSSLQFGQLTLKNTYKKCELSDVVLSLTDSEFD
FT                   LLWLLASNPDTPLSRDYLTQTLRGIEYDGIDRTIDNKVVRLRKILGDDKTPAEKIQTIR
FT                   GKGYLFVSTAWH"
FT   gene            complement(54927..57122)
FT                   /locus_tag="VS_II0045"
FT   CDS_pept        complement(54927..57122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0045"
FT                   /product="Conserved hypothetical protein with GGDEF and EAL
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25255"
FT                   /db_xref="GOA:B7VQ16"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25255.1"
FT                   /translation="MKRSLSWTIIYPIIGIALACILLFSLISTVILEDFVQKVSVENAK
FT                   NYVTTFHSIRNYYSSNVVQKVVDSQELVATAQHQSLENSIPVPATFLIEMLDKSDKDLT
FT                   ITTSFTSPYPFKNRQGRLFDEFQQRAWVAINKKPDEFYVEFVQEQDRTRVRVARADRLY
FT                   DQTCVNCHNSHPDSPKHDWELNDVRGILEVNTVVDEWLKYGKMINQSLMSISIISFMTV
FT                   MFINFAIARRVSTPLKNITRSLSLLAQGKEESASLPPAKYYEITELQSAFSSLYDKEQQ
FT                   RRALTKEIETLAYYDSLTKLPNRLGFLRSLDELLNKHKEKNERITVLIIDIKRFRDINN
FT                   TLGYKAGDTILLHLANRLSACTTMVDFNLARLDENKFCIAVPAKEHNGDQGSDAFFAML
FT                   IDVVSNEIIIDENKIKLVANLGATCSSNGAQSSSEMLIQANIALYVSKEKGDDITVKHQ
FT                   PELSNAALRRITLIKEINNAIENREFIPYYQPQFCLKTNRIIGAEALMRWKKPNGDLVR
FT                   PDLFIELAEQSHLIIPMGAHIFEQATTDCQQWQNHKALAGVKVAVNISSIQFSEQNILD
FT                   LTQLTLEKTGLSPSLLELEITESAMLGDVSKVVAVLNDLKKLNIEIALDDFGTGYSSLS
FT                   YLKLLPIDRLKIDREFVKDLLSNTDDQAILSMICKLATELSLNVLAEGIEEKEQLEFLG
FT                   RAGCHEVQGFYFAKPMPLDDFVLFAKNHNSELINTHA"
FT   gene            complement(57025..57177)
FT                   /locus_tag="VS_II0046"
FT   CDS_pept        complement(57025..57177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25256"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25256.1"
FT                   /translation="MESHFSSVRQLKISIKVDNEAFTILDHYLSNHRNSTCLYFTILFN
FT                   IDRYP"
FT   gene            57403..58506
FT                   /locus_tag="VS_II0047"
FT   CDS_pept        57403..58506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0047"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25258"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25258.1"
FT                   /translation="MKYYRNTLLALPLALLAGCNSSSNAGQSTTILQKEPKADYVFSSA
FT                   KLGELYQERQELQEEAMKLSYDGILYEKIQFAEDISDKQKVIRLLDGLGQSVDLYFPEA
FT                   GFDSCGIYTESKGLDLFDCDAAQRFTSSDTTSIKAMTKDKKVSVNLEYQNELLQYVTSL
FT                   GSTILSKSKNGNKVTITTSFAFNAFYRDVLNETGAVERITSTLGASTYSQLFDIVKLYR
FT                   GSEMTLKFTNHIGGSADDEINMYTGRMINNNKMTTVVTPTGSVFSGGTDLFAAGTPRIL
FT                   QRADTTKAIELNKQVGVHSWANGDKTAKEFPYTNESHRQQATYFKKAMGEKGIDFYIFT
FT                   LDSAPASGEHWMTKADSDKYGFITRIE"
FT   gene            58866..60065
FT                   /locus_tag="VS_II0048"
FT   CDS_pept        58866..60065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0048"
FT                   /product="Diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25260"
FT                   /db_xref="GOA:B7VQ19"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25260.1"
FT                   /translation="MQLLAGTLTHYANPQARPELEYSSEQRDILSVANSQQAIKDISQW
FT                   PGYSVTPLHELNAISAEIGVNKFWYKDESQRFSLKSFKALGGAYAVARQLQIEIANRYG
FT                   KNPTISELLNGEWKSEVAEIVVSCATDGNHGRSVAWGAQMFGCGCVIYIHRDVSEGRKQ
FT                   AMEAFGAEVVRITGNYDESVRLADSEAKAQNRVIVSDTSYEGYMEIPKDVALGYTVMLA
FT                   EIVEQLDGEIPTHVFVQGGVGGLASAVCGYFWDLWGADRPRFVIVEPEQANCLQKSAQA
FT                   GKPIVVTGDLETLMAGLACGEVSSLAWTILQNGADDFMTLSEEAIPQAMRMLASGEKTE
FT                   LAIEGGESAVPGFAAAIIAKQDPQYAEKLNLTQDSRVLVIGTEGATDPDLYQQIIDNKI
FT                   "
FT   gene            complement(60250..60756)
FT                   /locus_tag="VS_II0049"
FT   CDS_pept        complement(60250..60756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0049"
FT                   /product="Hypothetical transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25262"
FT                   /db_xref="GOA:B7VQ20"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25262.1"
FT                   /translation="MGSMGMTQQPALVVDSFDKKILNIVQDSNRATSDKIAEKVGLSPA
FT                   AVQRRLKRMRAQGVIQADVSVINPKAVGHGMTFIVQVTLERERVDLMHNFKKEMSSNRS
FT                   VQQCYYVTGSSDFIMIVTAADMEGYDNFTREAFFDNANIKSFQTNVVMDNVKVGLTIPI
FT                   DEQRD"
FT   gene            61052..61846
FT                   /locus_tag="VS_II0050"
FT   CDS_pept        61052..61846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0050"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25264"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25264.1"
FT                   /translation="MKSATATLQFELEKLAPAGRVGVIALATDFNIERDLNALYPNDVQ
FT                   SFTSRLRNYNPLTIENLRKMEPGIAACADTILPGTELDVVIYACTSGTVAIGSERITQL
FT                   IHQSRPNAAVTNPVTAALAAFDSFKAKRISVLTPYTEAVNKGVAAFFESQGIEVLSIAG
FT                   FGFEDDTAMTFISPMDIKHAALQVCDPDADLLFISCTALRAASVVESIEAQLDKPVVSS
FT                   NQVLAWHSLQLMNYPIPIKGFGALLAHHLQPSSDNCQRSQSL"
FT   gene            61948..63159
FT                   /locus_tag="VS_II0051"
FT   CDS_pept        61948..63159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0051"
FT                   /product="Amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25266"
FT                   /db_xref="GOA:B7VQ22"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25266.1"
FT                   /translation="MPSTFSIKPDQLSSQLIQNMTEWRQHLHRFPECGFDVNLTSDFIA
FT                   SKLESFGIEVVRNIGKTGLVGILRSGSSDASIGLRADMDALHIHEQNSFSHCSQHDGKM
FT                   HACGHDGHSAMLLGAASYLAENLLSGNSTFDGTVYFIFQPDEEHGCGAQAMIDDGLFER
FT                   FSIDEVYGVHNFPGLAEGELMVRPGSLMASESSFEITINGVGGHAALPHQGVDPLVVGS
FT                   QVILGLQTIVSRNLSAIHDTAVVSATEFITDGTVNVIPTQVVIKGDCRCFTEASLDRIK
FT                   QSMERIVAGICQAAGTTYDFEFINTFYPTINSEQQTQYSVTAAQKVLGVENVNDACDPL
FT                   TISEDFSSMLRVKPGCYVLLGNGTESVGGCALHNPKYDFNDGILKLGASYWIQLVNDRL
FT                   ARSI"
FT   gene            63377..64420
FT                   /locus_tag="VS_II0052"
FT   CDS_pept        63377..64420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0052"
FT                   /product="putative C4-dicarboxylate-binding periplasmic
FT                   protein DctP"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25267"
FT                   /db_xref="GOA:B7VQ23"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25267.1"
FT                   /translation="MKRLGAALLSLSMVFGVHAETWKFASEEDKTDVQDIYAQKFAEVI
FT                   KKESDGDIRVRIYYYGQLGTENDIVELAAKGTIQFVSVGAGHLGSYVPEVQAVSLPYVL
FT                   GTNEAITHKVLTESPTIYNKLAPKFESVNLKLLSMMSEGEMVWGGNKPIRTPEDFANQK
FT                   IRTFTSTIPVETYKAFGATPTPLSWGEVYGSLQLKTIDSMVNPIYFIYNAKWHEVQDYL
FT                   MFPGQQPYVSTVSTNSKWYNGLSEEKQAMVDKAITAADQAAYDYQIRINKENMDKILKE
FT                   RPNMQVVVLTEEERERFKVLSQKLHTTYYDVVANAYPSGEQSEAREGAKTILEEILDEV
FT                   KAASATQ"
FT   gene            64541..65083
FT                   /locus_tag="VS_II0053"
FT   CDS_pept        64541..65083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0053"
FT                   /product="C4-dicarboxylate transporter family protein, DctQ
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25269"
FT                   /db_xref="GOA:B7VQ24"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25269.1"
FT                   /translation="MKELLHKISVATEKLERFLIMTAILAMMINSTANAIGRYAFNKSL
FT                   FFSEELNQFLIVSVTFIGFAYAVRQGRNIRMTAVYDSLSAKAQKVLTTIIALLTAMLMF
FT                   YLTYHAFFYVKELKDINRLSPALQFPVYWVYAIIPIGFFIAGLQYSMSFLMNLLHKEIY
FT                   VSFDVIENRNTKVGEFE"
FT   gene            65080..66423
FT                   /locus_tag="VS_II0054"
FT   CDS_pept        65080..66423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0054"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   large permease component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25271"
FT                   /db_xref="GOA:B7VQ25"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25271.1"
FT                   /translation="MSDVAQFFSDIIAGELDIYVITFTLVSVMVILLFLSFPMIVPLAV
FT                   GALIGLIHFSQVEPGVLIQQMVTGISPNALIAVPMFILAADIMTRGHTAYNLLGLIQAF
FT                   VGHLRGGLPITTCISCTLFGSVSGSTQATVVSVGQIMRPKLLQAGYKDSFVMALIINAS
FT                   DIAFLIPPSIGLILYGTLANASVGELFIAGIGPGLVLASLFSLYSYAYSVKHSDTITLV
FT                   EKANTAERIEAIKKAILPLGFPALIIGGIYSGIVTPTEAASFAVLYAIIVECIFYRKLG
FT                   VKDICDAALNTGLITAVVFVLVGVGQAFSWYISYEQIPQELLAPLNLEDASPEFILFVI
FT                   ALTFFVGCMFVDSLVVLLILTPIFMPIVDAAGIDPILVGVMVTLQMAIGSATPPFGCDI
FT                   FTAIAIFERPYMEVIRGTLPFFLILILMSALLIFFPSIALLPRDILFN"
FT   gene            66461..67642
FT                   /locus_tag="VS_II0055"
FT   CDS_pept        66461..67642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0055"
FT                   /product="Metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25273"
FT                   /db_xref="GOA:B7VQ26"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25273.1"
FT                   /translation="MSILPLTPPQRGFESAELEQRTVELQQHLRAQNIDAAFFTTEPEF
FT                   RYFSGFKSQFWESPTRPWFLVVPAVGKPIAVVPEIGVAGFDETWIDDVRSWPSPRPEDD
FT                   GISLLASTLSEVSKGSRRIGSMIGPETHLRMPATNYALLQQKLSQHSVVDVSLMVRDLR
FT                   CVKSQAEIDKVRFACQVTAAGFEYLRHHLAIGMTERQACKAMHLEMLRLGADACPYLIS
FT                   ASGQGGYDNIIMGPTDRVLSEGDILIIDTGANFDGYFSDFDRNYAFGHAQPDTIAAYDA
FT                   VYQSTEAGLAIAEPGRTTGDVWQAMWSVLEKNGALGNDVGRMGHGLGMQLTEWPSHVPN
FT                   GDVVLKPGMVLTLEPGMAFAKNRMMVHEENIVITESGCEMLHQRAWQSMPIIG"
FT   gene            68078..68680
FT                   /locus_tag="VS_II0056"
FT   CDS_pept        68078..68680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0056"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25275"
FT                   /db_xref="GOA:B7VQ27"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQ27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25275.1"
FT                   /translation="MPKVGMPDIRKPQLVQATMTVIDRVGLHAASIALISKEAGVSTGI
FT                   INHYFGGKHGLLEETMREILRQLSNTVTTELKALPADAHQQRINAIINGNFEGYQAENK
FT                   VSKTWLAFWSYSMHDAQLKRLQRVNEKRLISHLLIELKSIFQPDQAELIAHGIASLIDG
FT                   IWLRGTLNPEGINADKARAIINDYLDKQLTFYSCQRD"
FT   gene            68797..70257
FT                   /locus_tag="VS_II0057"
FT   CDS_pept        68797..70257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0057"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25277"
FT                   /db_xref="GOA:B7VQ28"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQ28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25277.1"
FT                   /translation="MEMNSLYIDGKAVDATSGETFVSINPANGEPIATLGQASSADVEN
FT                   AIESAKRGFAVWSAMTAVERSRILLKAVEILRARNNDLANLEVVDTGKPLQEAIEVDVA
FT                   SGADVIEYFAGLAPTLQGDQQPLSDTQFFYTRREPLGICAGIGAWNYPIQIAMWKSAPA
FT                   LAAGNAMIFKPSEETPLTALKLAEIFTEAGLPDGVFNVVQGDYRVGQMLTAHPDIAKVS
FT                   FTGETGTGKAVMSDSAKTLKSVTMELGGKSPMIIFDDAKLDDAVSASMVANFYTQGEVC
FT                   TNGTRVYVHESIYNDFIDQLKTRTEKLIIGNPMDMETQIGALISKEHLSKVLEAIELAK
FT                   QSGATLLTGGYQVTDNGLANGNFVIPTVFTDCHDDMPHVQQEIFGPVMSVLKFTDEDDV
FT                   IRRANDTQYGLAAGVFTQNLSRAHRVIHQMQAGICWVNTWGDSPAEMPVGGYKLSGVGR
FT                   ENGPETLLHYTQTKSILIELGDYASPYA"
FT   gene            70330..72042
FT                   /locus_tag="VS_II0058"
FT   CDS_pept        70330..72042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0058"
FT                   /product="Choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25279"
FT                   /db_xref="GOA:B7VQ29"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25279.1"
FT                   /translation="MEQRYDYIIVGAGSAGCVLADRLTESGEHSVLLLEAGGTDKSIFI
FT                   QMPTALSYPMNTEKYAWQFETEKEPGLDGRELHCPRGKVLGGSSSINGMVYVRGHACDF
FT                   DQWEEEGAAGWNYQACLPYFRRAESWNKGGDEYRGDNGPVGTCNGNDMELNPLYQAFID
FT                   AGKDAGYPETNDYNGYQQEGFGTMHMTVDKGVRASTSNAYLRRALKRSNLTLKKGIVAR
FT                   RFLLEAQDSNGQSGLKAVGVEFEKSGNTQVAVANKEVISSAGSIGSVQLLQLSGIGPKA
FT                   VLEKAGVELKHELIGVGENLQDHLEVYFQYHCNEPITLNSKLGLVSKGMIGAEWILTRK
FT                   GLGATNHFESCAFIRSRKGLKWPNIQYHFLPAAMRYDGQAAFDGHGFQVHVGPNKPESR
FT                   GTVAITSADPHAKPEIIFNYISTEQDRQDWRDCIRLTREILSQPAMDVYRGEEIQPGLS
FT                   VTSDEAIDEWVKQNVESAYHPSCGCKMGADDDPMAVLDEECRVRGIDNLRVVDSSVFPV
FT                   IPNGNLNAPTIMVAERASDLILGKPVLKEQNVPVWIAPEWEETQRINKPVREA"
FT   gene            72186..73157
FT                   /locus_tag="VS_II0059"
FT   CDS_pept        72186..73157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0059"
FT                   /product="Substrate binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25281"
FT                   /db_xref="GOA:B7VQ30"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25281.1"
FT                   /translation="MTTPNIQNVTTKTLTALAISSFAFGANASVEPQQCENVRFADVGW
FT                   TDITATTAVTSELLKGLGYKTKTDLLSVPVTYSSMANGDIDVFLGNWMPTMEGDIAKYR
FT                   EAGTVETVRANLEGAKYTLAVPKYVYDSGVKSFADLAKHADKFKDRIYGIEPGNDGNRL
FT                   IQSMIDADAFGLKDFSLVESSEAGMVSQVSRAARRSQWIVYLGWAPHPMNSNVEMEYLS
FT                   GGDDFFGPNYGGANVYTNVRSNYLSECANVGQLLQNLEFTLEMENQLMEEILNQKVKPE
FT                   KAAQQWLNNNPQQVEAWLDNVKTHKGESATQAVTEYLKQVKA"
FT   gene            73265..74107
FT                   /locus_tag="VS_II0060"
FT   CDS_pept        73265..74107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0060"
FT                   /product="ABC transporter: transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25283"
FT                   /db_xref="GOA:B7VQ31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25283.1"
FT                   /translation="MNFITENKIPVGQWMEAGVDWLTINAAGFFDAISIFLETVIMFLV
FT                   DVFKWMPPALPIVITAAIAWYLHRKPSLVIFVVAALLTILNLGYWQEMLETFVLVFAAT
FT                   TISVLIGVPVGIMAAHRPWLYTVLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTI
FT                   IFAIAAPIRLTYLGVTKVPEELIEAGKAFGASRMKLLMKVELPAALPSIMAGVTQCIML
FT                   SLSMVVIAALVGADGLGKPVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKEA"
FT   gene            74137..75324
FT                   /locus_tag="VS_II0061"
FT   CDS_pept        74137..75324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0061"
FT                   /product="ABC transporter: ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25284"
FT                   /db_xref="GOA:B7VQ32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25284.1"
FT                   /translation="MDAITIKNLDVVFGNKANQALELLDQGKTRQEIIDETGQVVGVDN
FT                   VSLTVEEGEICVLMGLSGSGKSSLLRAVNGLNEISRGSLAIKDGDKLVDLGEQCDEATL
FT                   RHLRTHRVSMVFQKFALMPWLNVLDNVAFGLEMQGVAKGVRRAKAREQLEMVGLAEWET
FT                   KYPHELSGGMQQRVGLARAFAMDTDILLMDEPFSALDPLIRAQLQDELILLQNKLNKTI
FT                   LFVSHDLDEALKIGNNIAIMESGKLIQHGKPEEIVLTPKTEYVKDFVAHTNPLNVLKGR
FT                   SLMQPLDSLKQEDESWKICDSKDLWIEQSEGTLSVKGESTLALVEWNESDDLTAISASS
FT                   VVVASPEIGMRDAIKLKQLSNHPILLVEDNKLVGILDNSEFYNALTGNFQMNAAA"
FT   gene            75688..76170
FT                   /locus_tag="VS_II0062"
FT   CDS_pept        75688..76170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0062"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25286"
FT                   /db_xref="GOA:B7VQ33"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25286.1"
FT                   /translation="MDKHDEILVAIRQIIRAIDLHSKKLSKEYGLTGPQLILMRAIQEM
FT                   GNVTIKELSNQTNVSQATTTTIIDRLELNGYVQRVRSSSDRRKVHANLTEKGQELLNNA
FT                   PPPLQDNFVKKFQNLEAWEQSLLLSSMQRVSAMMNAEDIDAAPVLQLEGIANVVKS"
FT   gene            76628..77284
FT                   /gene="qnrVS2"
FT                   /locus_tag="VS_II0063"
FT   CDS_pept        76628..77284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qnrVS2"
FT                   /locus_tag="VS_II0063"
FT                   /product="quinolone resistance determinant (experimentally
FT                   demonstrated)"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17452482; Product type f
FT                   : factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25288"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25288.1"
FT                   /translation="MDTNNSTYHQHSFAQQDLSELTFTACTFIRCDFRRSNLRDATFIN
FT                   CKFIEQGDIEGCHFDIADLRDASFQNCQLAMANFSNANCYGIELRECDLKGANFTRANF
FT                   ANQVSNRMYFCSAYITGCNLSYANLEQACLEKCELFENRWIGTYLGGASLKESDLSRGV
FT                   FSEDVWGQFSMQGANLCHAELEGLDPRKVDTTGIKIVAWQQEQLLETMGIVVMPD"
FT   gene            complement(77461..77685)
FT                   /locus_tag="VS_II0064"
FT   CDS_pept        complement(77461..77685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0064"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25290"
FT                   /db_xref="GOA:B7VQ35"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25290.1"
FT                   /translation="MLKMRYRWASFCHKNPIIGRIVHVFVMLVAVASIVLPLMSKDATT
FT                   ILVSLCVALVCFVLFVFFALADKMRSGMH"
FT   gene            78060..78320
FT                   /locus_tag="VS_II0065"
FT   CDS_pept        78060..78320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0065"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25292"
FT                   /db_xref="InterPro:IPR032036"
FT                   /db_xref="InterPro:IPR038316"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25292.1"
FT                   /translation="MSKTAKIINEDKLLKKALEVGSKMAKLQGFDLPHSSQPIKVKAVY
FT                   LFLVGVNQITPLPESKLDGANIKKRLALWIHKALPDNDPLK"
FT   gene            78790..79323
FT                   /locus_tag="VS_II0066"
FT   CDS_pept        78790..79323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0066"
FT                   /product="L-2,4-diaminobutyric acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25293"
FT                   /db_xref="GOA:B7VQ37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25293.1"
FT                   /translation="MITSAPWILYPEVVEKMIEKWNFREPEVSDGNNIYQLISECPPLD
FT                   TNSSYCNFLQSTHFSKTCILVEHEGDLAGFISSYQKPSEPNVLFIWQVAVAPKFRGNAL
FT                   AYKMLNTLLKREGLKSIEAIETTITKSNQASWALFKKLDEKNGNTGKVTTFLDENLHFN
FT                   GQHDTEYLYRILLK"
FT   gene            79359..80624
FT                   /locus_tag="VS_II0067"
FT   CDS_pept        79359..80624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0067"
FT                   /product="Diaminobutyrate-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25295"
FT                   /db_xref="GOA:B7VQ38"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25295.1"
FT                   /translation="MDIFKKQESNVRSYSNSFPVTFSKSKGCWLETKQGDRYIDFLAGA
FT                   GSLNYGHNNPILKQALLDYIEMDGITHGLDMHSEAKAEFLEALTRLILEPRDLNYKVQF
FT                   TGPTGTNAVEAAIKLAKKVKGRSSIVAFTNGFHGCTAGALAATGNQHHRQGAGSNLNNV
FT                   TRLPFEGYAGIDGLKLFETMLADNSAGMDKPAAVLLETVQGEGGLNVASNEWLQRLSKI
FT                   CKAHDILVIVDDIQAGCGRTGTFFSFEPSGIKPDIVTLSKSISGYGLPMAVVLLKPELD
FT                   KWQPGEHNGTFRGNNHAFVTATKALEMYWSNDDFENHIQRSSSMVDDVIQRNIKRFPEL
FT                   FVQRKGRGMMIGIECKDGNTADEIAKTCFENGMVIETAGPNDEIVKFFCPLTISESELM
FT                   QGLTIFEDSVEIVATKYFKKVS"
FT   gene            80638..81024
FT                   /locus_tag="VS_II0068"
FT   CDS_pept        80638..81024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0068"
FT                   /product="Ectoine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25297"
FT                   /db_xref="GOA:B7VQ39"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQ39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25297.1"
FT                   /translation="MIVRTLDECRNSERRIVSDNWESTRMLLKDDNMGFSFHITTIYEA
FT                   TETHIHYQNHLESVYCMSGEGEIEVVGGETYPIKPGTLYILDKHDEHYLRAYKYKEMVM
FT                   ACVFNPPITGAEVHDENGVYPLVD"
FT   gene            81104..82528
FT                   /locus_tag="VS_II0069"
FT   CDS_pept        81104..82528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0069"
FT                   /product="Aspartokinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25299"
FT                   /db_xref="GOA:B7VQ40"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25299.1"
FT                   /translation="MTFTVEKIGGTSMTAFDAVLDNIILRPKNPYNRIFVVSAYSGMTD
FT                   ALLECKKTGKPGVYQLIAMRDDSWEEALSYIESRMLLINEHIFADPMNRARADKFIRSR
FT                   ISEAKNCITNILETCQYGQFSLRHYLPQIREFLSSIGESHSAYNTALKLKNIGINSTFV
FT                   DLSGWDNKTPQSLDDTIRDAFSDINVAEELPIVTGYAYCKEGLMHTYDRGYSEMTFSRI
FT                   ATMTKASLAIIHKEYHFSSADPKVVGVSSVKPIGATNYDVADQLANLGMEAIHSNAAAG
FT                   LRESGIELQIKNTFEPEHEGTLISSDYRPDTNQIEIIAGKQKVYALHVFDQGMVGKADN
FT                   VSYELMEIIADARVNLIGKEMNANSITYYLGGSSESLNKVFYKAEKRYPKASISGRMVA
FT                   IISAIGSQIDTNKTLANGVLALMSNSVTPIALHSSMRNVNVQFVVSDDKYQEAICALHE
FT                   EFFEQKQKVTSSVNAA"
FT   gene            82754..83377
FT                   /locus_tag="VS_II0070"
FT   CDS_pept        82754..83377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0070"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25300"
FT                   /db_xref="GOA:B7VQ41"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25300.1"
FT                   /translation="MSTHQIKNVVFDVGNVIVRWSPLEITRLTFGELDDLETQARSIFQ
FT                   STIWLDLNKGFLTENEAKLRYQQELDLSSLECDRLFYYVKQTQILLYGSVDLIKQVKRA
FT                   GYAVYALTDNVVEIVEYLKSTYQFWPLFDGAAVSAELGMLKPQPEIYQALLSNNGLEAS
FT                   ETVFIDDMPYNVEGAKAVGITGIQFSDVSQCERELLALGIDLNR"
FT   gene            83458..84273
FT                   /locus_tag="VS_II0071"
FT   CDS_pept        83458..84273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25302"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25302.1"
FT                   /translation="MITFLVLALSGLVLIVAAMLQMQGEEPCHNCYESDKGQFKYVLYD
FT                   GTSPSIIPSIHNELLLKQAPLMKSFGLDSIPVITVRVWRNQKAYLDEQERSIGYRYAFS
FT                   TGYIDPKSNEIRLLYFGGEIHKTALHEFVHLLTLQVNPNFANNPRWLWEAIAIYKSEDY
FT                   WFHVNNRTAISRRFDGLVQDLYHKPNSSSAVYELGYTVGEFIERSWGEEAFVDLIKSNG
FT                   DPSQLTEQPIESLFSDWEQFVKTTYLSGPKSEYEKAMERNPFDRRDTAN"
FT   gene            complement(84373..84948)
FT                   /locus_tag="VS_II0072"
FT   CDS_pept        complement(84373..84948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0072"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25304"
FT                   /db_xref="GOA:B7VQ43"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25304.1"
FT                   /translation="MSNTNDKTELEKMLSGQVYDGADQEIDTMRFNARKSLMAFNHHQD
FT                   PNQQHILQEQLFGKVGSSSLIQPPFHCEFGKTIEIGDDTFINMNAVMLDGANIKIGNNV
FT                   LIGPSAQFYTPSHSLDYRSRRKWETFCLPITIEDDVWIGGNSVINQGVTIGARSVIAAN
FT                   SVVNSDVPPDCLYGGTPAKLIRHLNTEQ"
FT   gene            complement(85279..86277)
FT                   /locus_tag="VS_II0073"
FT   CDS_pept        complement(85279..86277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0073"
FT                   /product="Adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25306"
FT                   /db_xref="GOA:B7VQ44"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQ44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25306.1"
FT                   /translation="MDFLALPKIDLHCHLDGSVRPDTIIDLAKQYNIELPEDRDAVVQS
FT                   LTVPEDCKNLDEYLACFSLPLQVMQTEEAIERISFELYEDAALENVKYLEVRFAPILHV
FT                   NKGLSLDTIIASAVKGMKRAEEKYDIKGNYIMSVLRMFPKDSIKDVIDAGQPYLGKGVV
FT                   AFDIAGGEKPGFCAEFPEYTQYALEKGYRITVHAGEQWHGQNVYDAVTMLDAERIGHGV
FT                   HIQGNEDAYNIVKEKQVALETCPTSNVQTKCIHQFSDHPIAEFKKDGIVVTINTDNRTV
FT                   SNTTMTNEVKRVCETFGLTKEDYVEIYKYSVESAFASDEVKQHLMGFVEQI"
FT   gene            86398..87333
FT                   /locus_tag="VS_II0074"
FT   CDS_pept        86398..87333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0074"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25308"
FT                   /db_xref="GOA:B7VQ45"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25308.1"
FT                   /translation="MVDVKSLLKCDMNLLLCLHVLIEERSVSKTAERLFLSQSAVSKQL
FT                   TKLRALFDDPLFERESKGLFPTPKALALAPKIHQILLQIEKLTVPEVFDPKDSERTFTI
FT                   DLVETAYTAIYPHFMPTALADAPHITINSSTWSSDSFKRLLKREVDFGIGIFELDERAS
FT                   THVQCIPDELDYVELCLDYSVCLMRNDHPALQEEWNLGTFLKYRHIQLVTGGAGDWLLM
FT                   EVLNSKQLEINKAANVSDITSAIKLCKQSDLLMCYPYNSVRDYIDSGELVMKPVPVDLV
FT                   PGGLFLLWHKYFDSEPSHKWLRDLIIEQTR"
FT   gene            87470..88921
FT                   /locus_tag="VS_II0075"
FT   CDS_pept        87470..88921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0075"
FT                   /product="Glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25310"
FT                   /db_xref="GOA:B7VQ46"
FT                   /db_xref="InterPro:IPR004887"
FT                   /db_xref="InterPro:IPR005615"
FT                   /db_xref="InterPro:IPR014042"
FT                   /db_xref="InterPro:IPR014049"
FT                   /db_xref="InterPro:IPR014709"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR037013"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25310.1"
FT                   /translation="MTIPRLPQQIIEDVCEWAIMHGVAFRQSDNTARHCPFSIAPMTME
FT                   REVYEHLLKVTPLITKLISNVSEDHEFLQSSLSDMAKADPFFGRLMELHQQAHGSADER
FT                   LNPARQSLLLMRTDFMDDRQHGAKVIEFNGIAAGMAPFGQKATDFHDYMHNQWPETYQS
FT                   WLEDKSATPAENQGLTQLAYGIATSARKVRADFNDSDKPTFLMVVQKNEDNVYDQHLLE
FT                   IELQKQGVRTVRRTFEQLSCQLSSGDKQRLLLQDVGAVDVVYLRAGYQYSDYWAPELNE
FT                   SVCCHTLSQTRVFMEQHHVAMNATISQQLATSKTMQMRLTMMPASEYARWGLTLEEAEL
FT                   VKSVLADMKPITSESIEWFNTQANKQEWVLKNQGEGGGHCVFGDDISEQLSQLKPEEYD
FT                   AWALMQRLYPHERDVPTIAVRDTQQMLVTDLVSEVGLFTAYYQGKPVTELDGYAGYLIR
FT                   SKPASENEGGIHSGKGILDSLVLID"
FT   gene            complement(88922..90430)
FT                   /locus_tag="VS_II0076"
FT   CDS_pept        complement(88922..90430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0076"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25311"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25311.1"
FT                   /translation="MGNLKRKLELYEKIFQAFGPGVSYCQVNQLATLLHVSERHVQTLI
FT                   KAMTAQGWIEWQASSGRSKKAQLTCLVEPIEACYQYTQTQADAGNIEQVFSTLSFNGRN
FT                   AGAELQAFLSNTNPSAQNIAYIPFHRELEALHPQRVLRRTERFLVMQVCQRLTSVKHGK
FT                   LSGDLAYHWQPNEDATQWHFQIRNGVRFHNGRTLEPQDIARNLNSLCQSKIWRRCYQHI
FT                   DEVSVSAGNVVVVKLNQPDWHLPRLLARAEASVFEHSSPTDRLIGSGAFSLDIFSSNML
FT                   RLSRNSAYSHSTPILNRVELWVYPEWAQSKACAQNQVCVKLPEKTTTVRGDDHYSKPEF
FT                   GSTFFKIQNPALSKTEREFTVEDTSECQTLFDQLSVSGDHKTNVEYGHYLTTKDVALCS
FT                   IIDENDTFSSWLSFFSRFPFESLSLPTEMLNTIEQGLASIRSQPNFELAMNALLALKHW
FT                   LNHSGVVIELKQEVFNLEISEKIHSAQVNGFGWCELDQLWINHL"
FT   gene            complement(90441..91505)
FT                   /locus_tag="VS_II0078"
FT   CDS_pept        complement(90441..91505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0078"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25313"
FT                   /db_xref="GOA:B7VQ48"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25313.1"
FT                   /translation="MYVASLSTLIQNNDLEQLMSDTQRKIKWGIAGLGNIANRFATAVI
FT                   EHCLHGELYAVAARDHSRAATFANKFGCDKAYGSYEKMAQDPDVEAVYIATVHPYHKPL
FT                   AELFLSHKKHVLVEKPAFTNLGDWLEMKALANQNGVMLLEAMKTVVFPAYREIQSFLVD
FT                   NNIQIDSIEASFGNHHDYEPGLFIFNPDLSGGATLDVGVYGLWFFYDLCRTLGVTPSEP
FT                   QVEMSCLYEGANVDTDACFTFSGDMNGKISASTVQNLPRTAHLTGPDTKITIHEKWWNP
FT                   AFIEIEHQGQKSTINCRVTGNGFEFEIDHFSGLVLQDKTESDILSSEITSRVLDTMEKA
FT                   LIDSGYPHLTQPRR"
FT   gene            complement(91565..92470)
FT                   /locus_tag="VS_II0079"
FT   CDS_pept        complement(91565..92470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0079"
FT                   /product="Homocysteine S-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25315"
FT                   /db_xref="GOA:B7VQ49"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25315.1"
FT                   /translation="MNMKTLTILDGGMGRELKEIGAPFSQPLWSAQALIEAPDFVSQAH
FT                   QNFVDAGAEILITNSYACVPFHLGEELFEQRGFELAALSGELAKAVADNASHTIKVAGA
FT                   IPPPFGSYRPDLFKVEEAAPIIQTLYDAQDPNIDLWIAETICSLQEFESIHAVLKQSNK
FT                   PCYYAFSLEDTKGDSANIRSGESVTDSIKLACQSNAKGIMFNCSVPEVMDQAIIDAKKV
FT                   IGELGSDLEIGVYANNFAPISSEHEANDMLQEIRELDGQGYLVYAKRWHALGANIIGGC
FT                   CGIGPKHIQALADWKRHTQS"
FT   gene            complement(92598..92825)
FT                   /locus_tag="VS_II0080"
FT   CDS_pept        complement(92598..92825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0080"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25317"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25317.1"
FT                   /translation="MVLKCIGGTMSDYSYSCGIDLAKNHFSLHAVDQNGKIILHKPVTR
FT                   SKLLTTIANIPLMRIGVEACGGAHYRERVI"
FT   gene            92897..93433
FT                   /locus_tag="VS_II0081"
FT   CDS_pept        92897..93433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25319"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25319.1"
FT                   /translation="MFNRMMDLLFRSNSSKRAARFEAEQAINLTIELCIEAYGKDNPRL
FT                   LELIELNMNVLCRGYIGANLQKQSVFHGQFEFNPISTNQVFSYGGHVEWNQHGNLVLNI
FT                   INHLGEHHKSPEPNKSEGSTGSHEIDIVIVRKLKGSSNIDFTTKFSSCDICKASSTGQM
FT                   IERYYVCSRCKDEHL"
FT   gene            complement(93618..93836)
FT                   /locus_tag="VS_II0082"
FT   CDS_pept        complement(93618..93836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0082"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25320"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25320.1"
FT                   /translation="MVLKCTGGTMSDYSYFCGIDLAKNHFSLHAVDQNGKVILHKLVTR
FT                   SKLLTTTASVPLAHIDVEAYSEKQLTA"
FT   gene            93893..94486
FT                   /locus_tag="VS_II0083"
FT   CDS_pept        93893..94486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0083"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25322"
FT                   /db_xref="GOA:B7VQ53"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25322.1"
FT                   /translation="MKFPIFVSILLSMMAAGSSVWIIQEDFKPQDTATLIIYIITALGG
FT                   LISAVFVVYGYFVNLSVFKESQKPKLLLQVHNERRNLIGTGENVHQTVLHYANLSQNEC
FT                   RGLTLCLSLVGEGENIEIPRLFNPKMNVGPNDSRTRDFPTLIYLRENGIPEAVIRNLGK
FT                   YKLRASYSYSIMNEKVKSHYDYAWDHGNEWWSIV"
FT   gene            94865..96601
FT                   /locus_tag="VS_II0084"
FT   CDS_pept        94865..96601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0084"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25324"
FT                   /db_xref="GOA:B7VQ54"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25324.1"
FT                   /translation="MTTKNSIFPPNSMAHDSPNRTQPLGIEDARYQEATKDSFFPKWSI
FT                   AYDAEARSGKGVTPAITDAAVTRQNAIAAETEAANPQTANTNSLASSDATSNIMKTVSE
FT                   LFSSSSKKCFASSIIPDVDKTQSIPLREYGEVAVLTSGKSTDFKKRFSKMTPEQELKIL
FT                   SGTSLVDMTLSDLGAWRITHNNEEVLPAWCLLFCASSMKAEHLINREEFNQLSDVNTEL
FT                   KLRLQNDESGKEDLIAFHRYGEKLPVIQAEPNPESGSKAFQATLPSGVVIEWNGVSKQG
FT                   PLFHNGAKRRFGSLRQEKVLPNDGKTQDIEGVPDDAVEEVIIAFPKQKFLEPLYLVLPK
FT                   FKEESKIAINPKNMYWPPYNPLAKDGEKEINIEYTQDVVKFAVLEPAEWTVFFDTFDKS
FT                   KTVKDTVTGLYNARETAKSLGGLGVTILVKNIDGVDYVILKNYDKWSQTLLHGGVFKAN
FT                   NAQVIKLGLGALDSVKGMARFVKVSAPMEILVGSGINVLQFIVNDEYTLKKLGVDQAKI
FT                   FVNILAVSGLAVGAVYFFPILGATALYSGVTLVISSTVVWTVDKLTDFESKFIEKVLEL
FT                   SE"
FT   gene            96598..96993
FT                   /locus_tag="VS_II0085"
FT   CDS_pept        96598..96993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0085"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25326"
FT                   /db_xref="GOA:B7VQ55"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25326.1"
FT                   /translation="MMYRVVWFIFAPAIILLYGWVCANFLSPFIFNVTKVLYEPIGYIS
FT                   GILFAGFFTILIVFGYRFVEVAFLKEVKPTSRKLKASFIIGLVFGFFMNYATYALIIEP
FT                   KGLMECPAELGYKNNLMSEYVTDLKEC"
FT   gene            97330..97608
FT                   /locus_tag="VS_II0086"
FT   CDS_pept        97330..97608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0086"
FT                   /product="putative antitoxin of toxin-antitoxin stability
FT                   system"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25328"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25328.1"
FT                   /translation="MSRIHLDQDIQPLSEFRAGVTSFIKQINETRRPLVITQRGKGVAV
FT                   VLDVAEYEAMQEKIELLEEMRAAETQLASGLGVSNEDARAQVLGRIK"
FT   gene            97608..97895
FT                   /locus_tag="VS_II0087"
FT   CDS_pept        97608..97895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0087"
FT                   /product="putative addiction module"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25330"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25330.1"
FT                   /translation="MEVVWSPLALEKLGDAAEFIALDNPVAAKNWINEAFDKTELLGTM
FT                   PEIGRMVPEMPHTHYREVLFGHYRIIYSLGIEIRILTVRNCRQTLTESDV"
FT   gene            98040..98777
FT                   /locus_tag="VS_II0088"
FT   CDS_pept        98040..98777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0088"
FT                   /product="Lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25332"
FT                   /db_xref="GOA:B7VQ58"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25332.1"
FT                   /translation="MVGHHNLQRKSALKLTNKLVRYPHIDVDRAFEKEDELLQQIQAGE
FT                   IGQALMLWQAKTPTLVLPAGKKWPVTLESREQLAAQGWQLTSRKTGGAPVPQLPGIINL
FT                   SHIYHWPRDEAYNIQKAYRHLCDILTLFFKELGIDVEVHATPGSYCDGDYNLNINKQKI
FT                   VGTAQRVLLKQGGGQIVLSQACILLDADLENIVAPVNFYNQICDNPTVVDAQVHTLLSA
FT                   HLMSLPNVDSLFQRLSQAFIKYA"
FT   gene            complement(98945..99784)
FT                   /locus_tag="VS_II0089"
FT   CDS_pept        complement(98945..99784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0089"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25334"
FT                   /db_xref="GOA:B7VQ59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25334.1"
FT                   /translation="MSGLFIQGRKMRKKIMITGATDGIGLETAKMLAQQGHHILIHGRN
FT                   PTKLSKVETGLSRLSKDAIIESYVADLSSLSEVEALANQIKSKHEQLDVLINNAGVYKV
FT                   SEITTKDNLDVRFSVNTIAPYLLTQKLLPLFDANGRIVNLSSAAQSSVDLEALVSPNPD
FT                   ALDGPIYAQSKLALTMWSIHLAHQLRDQGPLIIPVNPASFLGSKLVKDAYGLEGNDLGI
FT                   GADILCRAALSEEFSNASGKYFDNDSGLFKAPHADALNTGKNQKLMTTLDQLLTELL"
FT   gene            complement(99962..100768)
FT                   /locus_tag="VS_II0090"
FT   CDS_pept        complement(99962..100768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0090"
FT                   /product="Transposase (orfB) of insertion sequence ISVisp4
FT                   ; IS3 family subgroup IS3"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25336"
FT                   /db_xref="GOA:B7VGV3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7VGV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25336.1"
FT                   /translation="MTVTKACHFIGITRQAFYKRCVAEIHQTKKDESVLGFVKEQRMMH
FT                   PRIGARKIKYLLAQNDIEIGRDRLFSLLRVNRLLVQNRRAYHRTTNSNHRFYCHPNRIK
FT                   EGLIPEGPEQLWVADITYLATRRGSTYLSLVTDAYSRKIVGYHISDDMKAHTVKQAFLN
FT                   ALKGRKNTGELVHHSDRGVQYCSVEYQELHRQYGVSCSMTDGYDCYQNALAERVNGILK
FT                   MEYLLNKPNDLDEAKKMVAESVKIYNEYRPHTALKYKTPDEVHRAF"
FT   gene            complement(100765..101184)
FT                   /locus_tag="VS_II0091"
FT   CDS_pept        complement(100765..101184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0091"
FT                   /product="Transposase (orfA) of insertion sequence ISVisp4
FT                   ; IS3 family subgroup IS3"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25337"
FT                   /db_xref="GOA:B7VIP3"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B7VIP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25337.1"
FT                   /translation="MKLESVMKTTSRRTQRDYSLAFKLAVVSQVEKGEMTYKQAQERYG
FT                   IQGRSTVLVWLRKHGQLDWSKGIEQSRALGAAMSNSSSTQTPEQRIKELEQQLEETQLK
FT                   AEFFEAVVKVMDRDFGVRISKKRRAELLRKKRSES"
FT   gene            complement(101330..103402)
FT                   /locus_tag="VS_II0092"
FT   CDS_pept        complement(101330..103402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0092"
FT                   /product="putative hydrolase, metallo-beta-lactamase
FT                   superfamily"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25339"
FT                   /db_xref="GOA:B7VQ62"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25339.1"
FT                   /translation="MTPSRTFKNASLFLAISLAFPAIAANHDHAHFSDIGDQGGKDATE
FT                   MTTKANQEFAKTLNFEDTRAFDNNNKGLIASFDQETGDIIRNSFNFIDPSVNNADQAPD
FT                   SVNPSLWRQAVLNQAAEGLYEVVPGKVYQVRGADLASISFIRSDNGWIAYDVLLTKESA
FT                   AKSLKFFKNNVPDGGDLPVVAMIYSHSHADHFGGARAIKEAYPDVKVYGSKNITKEIVD
FT                   ENVLAGNAMSRRTAYQYGATLNRHEHGIVDAALAKGLSTGTITYVLPDYELNHNEEIET
FT                   LVIDGLEMQFMDASGTEAASEMVTYIPSMKALWTGELTYQGMHNLYTLRGAKVRDGLKW
FT                   SKKINEMLVTWGEDTEVLFASHSSPIWGEQEISDYLKMQRDAYGFTHNQTLRLANNGVV
FT                   LQDIGDEIYKVMPDSIQQSWHTNGYHGTYSHNARAVYNMYLGYFDMNPANLNPLQIHPE
FT                   SVKFVEYMGGSDAVIEKAQQDFQEGEYRFVATALNKVVQAEPENKKARGLLADTYEQLG
FT                   YQSEGAGWRNIYLTGAQELRIGTQPGAPKTASPDVLANMTIENLLDYLAVKVDSLKAQE
FT                   TPFTLNIQLPDLQEFYYVEMSNGNLNNIQVNELQDADTTLIINKSDVSDIVLKKTSLGK
FT                   LLEDGQAGVKGDKTSLNKLLSSLTEADTSFEIVPRPNKGEEVDAELYQDSHEHAH"
FT   gene            103591..104505
FT                   /locus_tag="VS_II0093"
FT   CDS_pept        103591..104505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0093"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25341"
FT                   /db_xref="GOA:B7VQ63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25341.1"
FT                   /translation="MSDMEKLDLNLLSVFLEVYRLKSITLASESLGMTQPGVSGALKRL
FT                   QAQLGTDLFIREGRGITPTNAAMQLALRVEPALDGITSAVSTLKQFDNQQHHVFRILVN
FT                   EIGLTKLQPLVEKDDTLGNISIEFNMVPSNEEDLLQSLSMQQADLAIDIHYPQVNGYMN
FT                   QQVIEDELVLIAKKGHPRIDGSVTEAQYYHEKHITFRMRRSHLYTADYFTKNPIQQRKV
FT                   SSECDSLMTMCVLVSGSDCVGSTSRGFANQFAERFQLQVLEQPFEVLPMKQYMIWHKRT
FT                   DLNTAHQWLRTKIQQHMTSSQSC"
FT   gene            complement(104593..105597)
FT                   /locus_tag="VS_II0094"
FT   CDS_pept        complement(104593..105597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0094"
FT                   /product="Transporter, drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25342"
FT                   /db_xref="GOA:B7VQ64"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25342.1"
FT                   /translation="MVSSVIKIPTISCTVLTSKFVQYIALIHSRCFTQSEIQTVSFLKL
FT                   ILLAAIWGGSFLFMRMAANPLGPAVLIEARVLFAALTLLLVSFYLKKKLSFHDHAKHFF
FT                   ILGLFNTTLPFLLFAYAAQTLNASTLAILNSTAPIWAAIIGAIWTKTALEAKVLLGLGI
FT                   GVTGVGVLVGWDAMNIGREAMLPIFAAVMAAFSYGIASNYTKQAPKVEAFNNAHGSMWA
FT                   AVLLVLPFVFFIPMRETPDVTITTSVILLGAVCTGLAYLLYFNLVSELGAPSALSVTFI
FT                   IPVFGILWGNLFLDEAIGINTIVGSILVITGTMLVTGMSPMKMLKAARQKRAQ"
FT   gene            105690..106079
FT                   /locus_tag="VS_II0095"
FT   CDS_pept        105690..106079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0095"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25344"
FT                   /db_xref="GOA:B7VQ65"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25344.1"
FT                   /translation="MKIEHIAIWTKQLEVLKRFYEDYFGATSNQKYHNPSKGFSSYFLS
FT                   FESGSRLEIMEMFSVPESKDDIYDQFTGFIHMAISLGSEQAVDQLTQRLVEDGYERLDG
FT                   PRRTGDGYYESCVLDPDGNRLELTV"
FT   gene            106131..106655
FT                   /locus_tag="VS_II0096"
FT   CDS_pept        106131..106655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0096"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25346"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25346.1"
FT                   /translation="MMKLAVTFLFSLGLMGCATSEPMYEQETDSKPEPSQPIGYLGFKA
FT                   HQEWAIQFNDCTVYDLTGAQPYQWFDRTSASVSCYTFKPNDAIKTLLVYSDADFNSNKL
FT                   TPIDRFQELQVSESGWGIFPAVYETNGTNWLKVKEGWIHLTLADQTLVQFYPGTQDQSS
FT                   KHTHDQYFEEH"
FT   gene            106826..108265
FT                   /locus_tag="VS_II0097"
FT   CDS_pept        106826..108265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0097"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25348"
FT                   /db_xref="GOA:B7VQ67"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25348.1"
FT                   /translation="MNNEFPNDFLWGGAVAAHQLEGGWDANGKGVSVVDVLTAGAHGVQ
FT                   RRITDGVIDGENYPNQVAVDFYHRYKEDIKLFAEMGFKCFRTSIAWTRIFPNGDDAEPC
FT                   EAGLAFYDDLFDELLKYDIQPVVTLSHFEMPYHLANEYGGWMNRKVIDFFVKYSTTVMD
FT                   RYQHKVKYWMTFNEINNQMNTSADIFGWLCSGVKFPQCEKPQEAMYQAVHHQFVASALV
FT                   VKKGHEINPELQIGAMCAMVPFYPRSSKPEDIMVAQQAMRDRYFFSDVMVRGHYPNYAK
FT                   RDWAIKGFNIEMQPEDEQILKEGKADYLGFSYYMSNTLDSSSHQSTEEAMDGGHENSVD
FT                   NPFIQSSDWGWPIDPTGLRFCLASLYERYEVPLFIVENGFGAVDTIEEDGSINDDYRIA
FT                   YLGDHIKEMKKAVAIDGVDLMGYTPWGCIDLVSFTTGEMKKRYGFIYVDKHNDQSGSLE
FT                   RKRKKSFEWYKGVIASNGATI"
FT   gene            108366..109364
FT                   /locus_tag="VS_II0098"
FT   CDS_pept        108366..109364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0098"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25349"
FT                   /db_xref="GOA:B7VQ68"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25349.1"
FT                   /translation="MVTMLDVANRAGVSKSTVSRVLNGKNIVRPDVVKKVFDAIQETGY
FT                   RPNLLAQQLATKKTNFIGFVITNELFNGPYFSSLMYHAASYSEKSNHQLVITDGKHSAE
FT                   DERKAINFLLDMKCAGIIIYPQCLTESEIAKIIESTDTPILVLNREMPSKPNHAITTDH
FT                   YQSACLMVEHIIEQGHTDIAVIRGKAGSSTDELRYQAYQDVLTKQGIALDESKVVQGDW
FT                   TMESGYHAAQALVKSKATFTAILSENDDMAIGAIKALTELGYSLPQDVSIVGFDNSKVG
FT                   AFLTPSLTSVSVPLEQMTQKAILQIVGETEQATTINTTGSLVLRDSIAKLN"
FT   gene            109568..110131
FT                   /locus_tag="VS_II0099"
FT   CDS_pept        109568..110131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0099"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25351"
FT                   /db_xref="GOA:B7VQ69"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25351.1"
FT                   /translation="MKTEKQKMLAGEPYQAWDKELYAARIECRKVLQKLNNSIPDTPEW
FT                   EAATQELIPGCENAHLEPPFRCDYGSNIKLGKNFYANFNCVILDVAEVTIGDNVLLGPN
FT                   VQILTAGHPLDVKGRVEEGVEFGTPINVGDNVWLGGGVIICPGVTIGENSVIGAGSVVT
FT                   KDIPANVVAVGNPCKVLKSIDNGQ"
FT   gene            complement(110231..111424)
FT                   /locus_tag="VS_II0100"
FT   CDS_pept        complement(110231..111424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0100"
FT                   /product="putative transmembrane efflux transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25353"
FT                   /db_xref="GOA:B7VQ70"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25353.1"
FT                   /translation="MIMPLALLALTLSAFAIGTTEFVIVGLIPTMASDLNVSLPSAGLL
FT                   VSLYALGVAIGAPVLTALTGKWNRKAVLLTVMALFVIGNLLAWQAPGYNTLIAARILTG
FT                   LAHGVFFSIGSTIATGLVSKDKAASAIAIMFTGLTVALVTGVPLGTYIGQTFGWQATFL
FT                   IVALLGLIALIGSAILVPSNLKQPPAAKISAQLKVLTQPRLLLVYAITALGYGGTFTAF
FT                   TFLAPILENVSGFDSSSISLIMLVYGVSVAVGNIWGGKMADKMGPIKALTVIFSGLAAV
FT                   LVVFNFTAVNPYAAVATILVWGAFAFGNVPGLQVYVVKLAEKYTPDAVDVASGLNIAAF
FT                   NVGIALGSWGGGLIVAKSGLMNTPWVGAVIVLIALVLTRFSGALDKKQAQQAVPSSI"
FT   gene            111700..112581
FT                   /locus_tag="VS_II0101"
FT   CDS_pept        111700..112581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0101"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25355"
FT                   /db_xref="GOA:B7VQ71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25355.1"
FT                   /translation="MLTRSDDLEMVLTVVDAGGFSAAAETLDVQVAKVSRSVSKVESQL
FT                   GVSIFNRTTRRVELTEEGRQFVDSVRVGLQMIQSAEEEIVSRGELPKGRLRVDAASPFV
FT                   FHQLVPLVQSFKEAYPDIELELTSNEGFVDLLEKRTDVAIRIGKLSDSTLHARPLGKSL
FT                   LHIVASPDYLAKRGLPTKPEDLSSHQIVGFAGNKVLNHWPLPNQSDVAPTVTASNGETV
FT                   RQLVLAGNGIACLSGFMVQEDMAAGRLIPILEQDKLANTDRERVNAVYYKSSSVSKRIS
FT                   AFIDFIQPRLKL"
FT   gene            complement(112703..113062)
FT                   /locus_tag="VS_II0102"
FT   CDS_pept        complement(112703..113062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0102"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25356"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25356.1"
FT                   /translation="MNKEWRCIHRQITISVKNNIGTNMTQLTIVANIVANEDKIELVKA
FT                   ELLKLIDITRAEEGCINYDLHQDNENPAHFTFYENWTSRELWQKHMGNTHLAEYMAATE
FT                   GSVTSFTLNEMTKIA"
FT   gene            complement(113200..113697)
FT                   /locus_tag="VS_II0103"
FT   CDS_pept        complement(113200..113697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0103"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25358"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25358.1"
FT                   /translation="MKLLVDRTGEQFLEILQESGDTLTVQFITNEGSRKGKPFQDNLSG
FT                   LFLTGWKPRTTSTAIGLERFKQGKLEDPKVSFALHQLYPLGRDVKLPSGDIATIASYAN
FT                   THADGYYMFVRLNDELTRLKITPDWELQPSVQRLALPYYPEPRSQQELDNIDDFDAWAG
FT                   GF"
FT   gene            complement(113921..114712)
FT                   /locus_tag="VS_II0104"
FT   CDS_pept        complement(113921..114712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0104"
FT                   /product="putative plasmid-related protein"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25360"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25360.1"
FT                   /translation="MNFPSTLPAPHKALLIKVIDVLSQDPRICGIAASGSFGSDSMDKY
FT                   SDLDFVIAVNPADYNSVMQERFGILDQIGGKVAAFTGEHVGEPRLIVSIFGPEPVHVDF
FT                   KFVSLPDAAARVDNNHVLWERDSLLTDVFCTAEPDYPQPNPQWIEDRFWIWTHYAATKI
FT                   ARGEYFETIEFLSFLRQNVLSPLALKQAGLTPSGVRKIEARLPEFAQELAKTVSMPERD
FT                   ALIPALNQAVKLYLELRSNEQVSVDEHAQSFCLQYVQDELS"
FT   gene            complement(114873..115439)
FT                   /locus_tag="VS_II0105"
FT   CDS_pept        complement(114873..115439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0105"
FT                   /product="putative dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25362"
FT                   /db_xref="GOA:B7VQ75"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25362.1"
FT                   /translation="MPSFSSISELKMSNIVFIATSLDGYIADKQGGLDWLQAIPNPDGD
FT                   DMGYNAHTDRIDALVMGRNTMDMVLSFGIDWPYSKPVYVLSNTLNEVPQELEGKVFLIK
FT                   GELKQIVADLNNKGLKNLYIDGGITIQNFLKEDLIDELIISTIPVVLGGGSPLFGDLVS
FT                   PVDFTLKGVTTYLDEIVQTHYLRKR"
FT   gene            115500..116063
FT                   /locus_tag="VS_II0106"
FT   CDS_pept        115500..116063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0106"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25364"
FT                   /db_xref="GOA:B7VQ76"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25364.1"
FT                   /translation="MTVKDQKRGRPKSGSSQLSAERILTIAKSMMRESGKVPSIRGLAT
FT                   ELGVDAMAIYHYFKNKNDLLEAITVSLIEEVAQPELNQDWQDNLYRLSVSYLSMLNEYR
FT                   GLLETLLTMKSLGPMEVFSERFEAVLNPLALTEEQTKNALDLLVDYLHGYALALNCNPD
FT                   RTELTIEMVEKPLSLYCLALTQLK"
FT   gene            116223..117755
FT                   /locus_tag="VS_II0107"
FT   CDS_pept        116223..117755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0107"
FT                   /product="putative phospholipase D"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25365"
FT                   /db_xref="GOA:B7VQ77"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25365.1"
FT                   /translation="MPVLQRISLTLILIAILGGCSSLPEGIDHPTEPPTSPAPSSLSVL
FT                   TNEFQPEALEQGNTAVRLQESGWDALAQRLALVESAEHTIDIQYYIWNSDESGSYLASR
FT                   LLAAAERGVKVRVMLDDINLNEREGLLSALDAHPNVEIRIFNPTPTRRGFSKWLSFVGD
FT                   FSRLNRRMHNKSFTVDGTLSVVGGRNIGDEYFDLSDEINFRDRDVLVMGSVVNTIQTSF
FT                   VEYWNSRWSYPVDMLGDDEQPDLSKIDNIVVPHYQNYPELPLDRKAADSLLKEVIGEMT
FT                   WVNARFVYDQPVPDDSDNTDEPKATAILLGKLASESKQEILLESAYLVFDDGQLEEWQV
FT                   LNNKGVEIKALTNSMASNDLVTNHSAYAGRRYDMLEHGIDLFELKPESKLCEASTKDVS
FT                   KCAPETAYGLHAKSVVFDRSIASIGSFNFNLRSTYLNTESVLIIENKEIAETLAKTIEQ
FT                   AMSEDNSWRLELEDGDVYWYSGEQSWDSEPETGKWERMQSGFLQLLPIEKYL"
FT   gene            complement(117879..118601)
FT                   /locus_tag="VS_II0108"
FT   CDS_pept        complement(117879..118601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0108"
FT                   /product="NADPH-flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25367"
FT                   /db_xref="GOA:B7VQ78"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25367.1"
FT                   /translation="MNSTIETILGHRSIRQYTNQPIEKAQLDVIIQAGLAASSSSLLQA
FT                   VSIVRVTDKEKRKLLAEYAGNQAYVENAAEFLVFCIDYQRHAQINPEVKTDFTELTLIG
FT                   AVDSGIMAQNCMLAAESLGLGGVYIGGLRNSAQQVDELLELPQHTAVLFGMCLGHPAQQ
FT                   PEVKPRLPAHVVMHENQYQPLSLDEIASYDDSMQSYYASRSSNQKQSSWSQQITQKLSG
FT                   ESRPHILPYLNSKQLTKR"
FT   gene            118880..120124
FT                   /locus_tag="VS_II0109"
FT   CDS_pept        118880..120124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0109"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25368"
FT                   /db_xref="GOA:B7VQ79"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25368.1"
FT                   /translation="MNPICLNDPFSLPNGQVIKNRLFKSAMSEQLGDKHHNPKQGLVTL
FT                   YQRWAQGGIGLSMTGNVMVDRGALGEPKNVVLDEQSDLSVFREWAKAGTQNGSQIWMQL
FT                   NHPGKQIPKFLCDSPVAPSAISLERGLEKGFNTPRALNETEIIAIIDKFALSAKLSKQA
FT                   GFTGVQIHGAHGYLVSQFLSSRHNQRQDKWGGSLENRLRFVLEVYRAIRKEVGEDFPVG
FT                   IKLNSADFMKGGFTEEESMQVVQTLSDNGIDLIEISGGTYESPSMMGSKSKAEPIKAST
FT                   VKREAYFMDYMVKARKLVSTPLVVTGGFRTAQAMNEALNTSATDFIGIARTMAVDPDFP
FT                   NKLIEDPSHGMPLTVPTTGKPALDKMAMVGLVWYEHQMWRIASGKNADPKLSALGVVLK
FT                   TIFSAGWHAFKKRRA"
FT   gene            120342..121256
FT                   /locus_tag="VS_II0110"
FT   CDS_pept        120342..121256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0110"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25370"
FT                   /db_xref="GOA:B7VQ80"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25370.1"
FT                   /translation="MKQLDLNLIRVFLVLLETQNTRIAGNKLALSQPAVSKALGRLREY
FT                   FDDELFTRVHSGLKPTPRALELGERLPMIMESLDDVILETPSFDPAEYQGNITIAINGF
FT                   ISNWLGARLCLGLIQEAPNAQVNIVNWGSQTLKKLLDGEIQAAINFSPIDTNKQFTHQI
FT                   IGEDDFVGLVKTGHPLAGKVISQQEIDEAEYASLVIPGWNDIQPYIAKHLSTEQLKVKA
FT                   RSSYLHTLLEVIKQSDMILPCSKQLALYLNEEFDYLSFPDYAPEELKKIVLVESHNKRM
FT                   HPMNQWLKRKIITTSQTIIKEKQ"
FT   gene            complement(121363..122403)
FT                   /locus_tag="VS_II0111"
FT   CDS_pept        complement(121363..122403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25372"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25372.1"
FT                   /translation="MSSPNDDLKVNDMKKTILATLITITSMQTMAAVEVTDENFARAES
FT                   DLYFTQQLEHQPVNVFEHNRENVTVENQMIIRSNTDLLYSTAVVDVSEGATFKLAKGDA
FT                   YQIMHIFNNNHDNHMAIYGGEEIYIDSEIAGSDYIYILMRTATSAGADEAHRLQDAAVI
FT                   NAKSAKPFEPASDWDDASRDNVRAKWEKLVNDIKTEEAFTPNITATSDNKQFMIGTAVG
FT                   WAGMPAEHAVYTSRAGTGKTECANITFEAPSLRYDEGGYWSITAYSSQGWLMTDNNSAD
FT                   STTSTPNKDGSYTIHFAPKGQTCDAANNVIEVNDDGWNFAVRAYRPSDEAVASGEMHNF
FT                   PQVTAQ"
FT   gene            123070..123306
FT                   /locus_tag="VS_II0112"
FT   CDS_pept        123070..123306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0112"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25373"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25373.1"
FT                   /translation="MLGENHSLVHEFPEMKDKIAELAKTDDGFAADMKTYDNLDKEIRK
FT                   LELKDSPIDDGSMHQLKHDRSELKDSLHARLIA"
FT   gene            complement(123588..125222)
FT                   /locus_tag="VS_II0113"
FT   CDS_pept        complement(123588..125222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0113"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25375"
FT                   /db_xref="GOA:B7VQ83"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25375.1"
FT                   /translation="MTANESSYRIQLCSKMLVRSEEVKTMSAQQNNSNNSTSSTLDLIV
FT                   IGGGINGAGIAADASGRGLNVGLYEANDFASATSSASSKLIHGGLRYLEHYEFRLVSEA
FT                   LAEREVLLRKAPHVAQPMRFRLPHRPFLRPAWMIRCGLFLYDNLGKRTTLPGSKTVNLA
FT                   KSGLLKPEMKTGFEYSDCWVDDARMVLLNVLAAKENNAEVRNYCRVEKAHREGGVWHVT
FT                   ILDVMTNQRFERKAKALVNAAGPWVKQFFDDGLEQASPRNIRLIKGSHIVVPRIHDEPK
FT                   AYILQNKDNRIVFMIPYLDKFSIIGTTDLEYKGDPRNVAIDDVEVDYLIDIVNQHFVKQ
FT                   LGREDVVWTYSGVRPLCDDESDSPQAITRDYTLELDAELDQAPLLSIFGGKLTTYRKLG
FT                   EAALKKLEPHLTNMGAPWTANDTLPGGNFSCSREQLAKMIHTKYPWASEALLLRYVTQF
FT                   GTYTWKLLEGADSEADLGIQFSSEAHGVYQVEIDYLINEEMAMTDEDILWRRTKLGLYM
FT                   IESEQQAVTDYLKEKLQSKVVSFSQVG"
FT   gene            complement(125434..126219)
FT                   /locus_tag="VS_II0114"
FT   CDS_pept        complement(125434..126219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0114"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25377"
FT                   /db_xref="GOA:B7VQ84"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25377.1"
FT                   /translation="MKQIPRHQQIVDLVKTQGYVSTEELVEKFDVSPQTIRRDLNELAD
FT                   SNKIRRYHGGATIPLSSENTSYNTRKALNFNEKDVIADELVKHIPDGATLFVDIGTTPE
FT                   SVARALNKNHKQLRVVTNNINVASILLPNPEIKVILAGGEVRNRDGGIVGEATLDFVKQ
FT                   FRLDFGILGISGIDFDGSLLDFDYHEVRVKQAIIENSRSIFLAVDHTKFGRNAMVKLGN
FT                   ISQAHMVFTNKQPPEEILNILKDSAIPLEVIDTARPVSE"
FT   gene            complement(126512..128035)
FT                   /locus_tag="VS_II0115"
FT   CDS_pept        complement(126512..128035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0115"
FT                   /product="Glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25379"
FT                   /db_xref="GOA:B7VQ85"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQ85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25379.1"
FT                   /translation="MTEQKYIVALDQGTTSSRAVILDHDANIVSSSQREFTQIYPKAGW
FT                   VEHDPMEIWATQSSTLVEALAKAGIRSDELAGIGITNQRETTIVWNKETGKPVYNAIVW
FT                   QCRRTADICEDLKARGLEDYVRDNTGLVLDPYFSGTKVKWILDNVEGAREDAEAGKLLF
FT                   GTVDTWLVWKMTQGRVHVTDYTNASRTMLFNINDLCWDQKLLDEMGIPSSMMPEVKRSS
FT                   EVYGQTNLGGKGGTRIPIAGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNTGQEKV
FT                   TSKNGLLTTLACGPKGEPAYALEGAVFMGGASIQWLRDEMKLLAGAEDSEYFATKVDSS
FT                   NGVYVVPAFTGLGAPYWDAYARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQAD
FT                   SGIKLANLRVDGGAVANNFLMQFQSDVLDTEVHRPEVTEVTALGAAYLAGLAVGFWDSI
FT                   DELQDKAVLNRTFMPHHDEEKRNRRYKGWKRAIKCAQVWSELHDDDDEE"
FT   gene            complement(128095..128949)
FT                   /locus_tag="VS_II0116"
FT   CDS_pept        complement(128095..128949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0116"
FT                   /product="Glycerol uptake facilitator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25380"
FT                   /db_xref="GOA:B7VQ86"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25380.1"
FT                   /translation="MTTNKHPSLFGQCLAEFIGTGLLIFFGVGCVAALVLTGATFGQWE
FT                   ISIIWGFGVAIAIYCTAGVSGAHINPAVTIALAMFHGFDKAKVLPYIISQLLGAFCSAA
FT                   LVYSLYSNLFTDYEIAHNFVRSSQDALSTAGIFSTYPHASLSFFGAFAVEFVITAVLMF
FT                   AILALGDENNGASRGAMNPLLIGILIAVIGGSLGPLTGFAMNPARDFGPKLFAYFAGWD
FT                   FALTGARDIPYFIVPILAPIAGACFGGWLYPRVIGAYLPVEGQGCTIPNQCETEQEAEQ
FT                   AQA"
FT   gene            complement(129398..129829)
FT                   /locus_tag="VS_II0117"
FT   CDS_pept        complement(129398..129829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0117"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25382"
FT                   /db_xref="GOA:B7VQ87"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25382.1"
FT                   /translation="MSHKERMLHMVLFELVALVLMAGLATYITGNGAGEMAGLALAISL
FT                   IAMAWNYVYNYGYDKIYGADRSKRTKKTRVLHGLGFELGLMTVTLPVLMWVLQLDFLTV
FT                   LIMDIGLVIFFVLYAIAFNWAYDSIRAQLVSKGKVAALV"
FT   gene            129984..130850
FT                   /locus_tag="VS_II0118"
FT   CDS_pept        129984..130850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0118"
FT                   /product="Hypothetical transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25384"
FT                   /db_xref="GOA:B7VQ88"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25384.1"
FT                   /translation="MFVYAVELGSFSASARHLGKVQSAVSQGISNLEIDFNVELFDRST
FT                   RKPSLTKAGEQLFKQVKAIVLQVEDLNVTVSAMGSGEEGLIKIALDDSLLVPNLSKILS
FT                   QFSQQFPATEVELVACTTTEVNPLIIEERADIGLMFTNLAFDVGSEPCFIGHLPFIAVC
FT                   HPSHSLAKTGVAKLSDLLPHRQLMLRGDKGKVMDQFPLIAGKVWWSNSFIVIKEMVLGS
FT                   DIGWAYLPKHLVEEELNKQRLVEINVSFDHKTWSPPVDLVLSKTRSKGPALLWLEQALK
FT                   GLLDETE"
FT   gene            complement(130935..131990)
FT                   /locus_tag="VS_II0119"
FT   CDS_pept        complement(130935..131990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0119"
FT                   /product="putative heavy metal membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25386"
FT                   /db_xref="GOA:B7VQ89"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25386.1"
FT                   /translation="MKPKLGFLDRYLTLWIFIAMGLGVLLGTLFPQIEQWNESMSVGTT
FT                   NIPLAIGLILMMYPPLAKVNYNLLGTVVKDKKAIKLSLIMNWLVGPILMFVLALTFLGD
FT                   HPGYMVGVILIGLARCVAMVLVWNDIGGGNKEYGAALVALNSAFQVVSYSFMAWLFISV
FT                   LPPVFGYEGMMVDISMIDIAHSVLIYLGIPFLAGFLSRKILVSMKGEQWYNDVFIPRIS
FT                   PITLIALLATIVLMFSLKGEMIVELPMDVLLIAVPLTIYFTAMFFISFFIAKKMGIEYD
FT                   KNASIAFTATGNNFELAIAVAISVFGINSDQAFAGVIGPLIEVPVLIYLVNVALKMKDK
FT                   YYNGQTVKPSV"
FT   gene            complement(132096..132437)
FT                   /locus_tag="VS_II0120"
FT   CDS_pept        complement(132096..132437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0120"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25388"
FT                   /db_xref="GOA:B7VQ90"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25388.1"
FT                   /translation="MNEICPTTGGCALPIGHGDTEAETQMAALAKALAHPARVRILSIL
FT                   STLEKSGGCLNSDLVSELGLAQSTVSEHLRILKTSGFITAESIPPKMCYRINRDNIQQF
FT                   ETLIDTILK"
FT   gene            132757..133554
FT                   /locus_tag="VS_II0121"
FT   CDS_pept        132757..133554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0121"
FT                   /product="Predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25390"
FT                   /db_xref="GOA:B7VQ91"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25390.1"
FT                   /translation="MPQQNIKFIAADMDGTLLNEHGKLDPEFFNLYERLEAQDIIFAAA
FT                   SGRQYYSLMETFAPLKDRMMFVAENGTLVMHKGQELYSCLLDTDAIKDIIKEARAIEGA
FT                   HVVLCGKKSAYIETKDERALAEISKYYHRREQVEDLLAVEDDFIKVAICHFDGSQEKVN
FT                   PTIDAKFGENYQVVVSAKIWLDVMNAEASKGTAIKHLQNTLGFTYEQTMSFGDYLNDLE
FT                   MLKESYHSYAMENAHPKLKEIARFAAPSNVDAGVFQVLEKLLA"
FT   gene            133736..134383
FT                   /locus_tag="VS_II0122"
FT   CDS_pept        133736..134383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0122"
FT                   /product="DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25392"
FT                   /db_xref="GOA:B7VQ92"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25392.1"
FT                   /translation="MSKKLQLDIISDVMCPWCVVGYKNLEQAVSELGLAEQIELEWQPF
FT                   ELNPDMPQEGENLRDHIMRKYGSSAEESQSSREQLAARGKAVGFDFNFYDSMRMVNSRH
FT                   LHVLLDFALAHGKQTELKLRFFTAHFTEQKDLSDLEVMAQELEAVGLNSTKALKRLKNT
FT                   DNLKQIEAQEFEWQRMGISAVPTVVFNRKSAVTGAQTVETYKQILQELIAES"
FT   gene            134418..135626
FT                   /locus_tag="VS_II0123"
FT   CDS_pept        134418..135626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0123"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25394"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25394.1"
FT                   /translation="MESLSLAQAQKMVLLSQKLPPKKLPSKKQRNGGALANTLSAIENL
FT                   GYVQIDTISVIQRAHHHTLWNRNQDYQLNHLDKLLERREVFEYWSHAAAYLPMRDFRFS
FT                   LHRKNGFASGKLKHWYKKDDALMAHVLKRIESEGPLMAKDFEGDRLNPGGWGGKPAKQA
FT                   LEILFMQGDLMVPSRVNFHKVYDLTERVLPSDIDTSEPTEQEYIEHLITRYLEANGVGI
FT                   ASEMSYLLKNTKPLIQTTLQQMLEDKQLMKVDIQGSDYYVLPGAFDLLNQPLSRTKLKI
FT                   LSPFDNLLIQRKRMQSLFNFDYLLECYVPEAKRQFGYFSLPILWQGGLVARMDCKVDRK
FT                   SGLLNIRNLVVEDRVKTHESLIYALCEELKHFMVFNQCDEMIVHNTTPSEFGKRLMSYW
FT                   QTV"
FT   gene            complement(135655..136593)
FT                   /locus_tag="VS_II0124"
FT   CDS_pept        complement(135655..136593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0124"
FT                   /product="Hypothetical transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25395"
FT                   /db_xref="GOA:B7VQ94"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25395.1"
FT                   /translation="MDKLTSMKVFVYVVEQGSFRSAANHFNLSATMISKHIHHLESSLN
FT                   SQLIHRTTRKQSLTDSGQLYYRECKRILEDISNAENLIQTLENQPQGTVKINCPVTYGN
FT                   KVLAPIVAKFLAHHPTINVELVLNNDLVDPYSSDIDLIVRIGDLSDSSLVARYLGDYEM
FT                   CYCAAPEYLNQHAEIRVLEDLAQHPSLGFSYSSRRDIIGRDTHIRHIQNSEPQSRDPQS
FT                   HQATHTAGNKGQVRLMSNNGDVLRYAALQGVGVLLQPTILVAEEIERGMLLEILPGMAP
FT                   LPKPIHLLYKTKQLSLKNRTFVEFLLAALSE"
FT   gene            136700..137023
FT                   /locus_tag="VS_II0125"
FT   CDS_pept        136700..137023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0125"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25397"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25397.1"
FT                   /translation="MPQTNETIFVTAELKIKTNIEREAAVEAIEQFCRDMQSEPGCIQA
FT                   IATYDQNQSDRVILLEQYANREAINQHFVMPHTQAFIERDITELVQAFETQRGPIKTQE
FT                   QEI"
FT   gene            137027..138001
FT                   /locus_tag="VS_II0126"
FT   CDS_pept        137027..138001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0126"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25398"
FT                   /db_xref="GOA:B7VQ96"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25398.1"
FT                   /translation="MKWGILGTSFISGVMADAIKGDAQSELYAVAGRTEKTLNEFAEQY
FT                   QPTRTFNSYEALIEDESVDIIYIALPNHVHHEYVIKAAQKGKAILCEKSLSVDMEKTEQ
FT                   ALQAVKASSVFFAEGLMYLHHPLIAKLHQELATGEIGEVRSIQGSYIAAIDQFVNPASK
FT                   GALYNLGCYPMSLIHSVAQHQFGESVFDDLQISAIGRRGQDGNICESSAMMRFNDHFTA
FT                   QIHTAEDHGLKHGFTILGSKGCITLDTNPWLPTAENTFTVEIYETSTREVKVEAQGDGF
FT                   HYQVCNIRQAVEQGDTQLAAPMASHQDSRVIMKLLTEWEQAAS"
FT   gene            138201..138539
FT                   /locus_tag="VS_II0127"
FT   CDS_pept        138201..138539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0127"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25400"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25400.1"
FT                   /translation="MRKSDKKIENQIRDVLTDVCEDTLKGFDGFLWVTHTVNFSSFPQS
FT                   LKIVCVFDTNQDRTNFLEVGGQQEVSVAIQKAFSQVGITLKSIDKHVSYDTQENCDRDH
FT                   QGKWNKRL"
FT   gene            138848..140416
FT                   /locus_tag="VS_II0128"
FT   CDS_pept        138848..140416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0128"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25402"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25402.1"
FT                   /translation="MNKNKITLTILAILPLLSACGSDSKSPAATTPTPAPTPGFTLPNE
FT                   SKLITNYNIDSAFNTVFPSNYQIAKDAGFDYFIKIPLRSDSSISITILATKGSDEDLRQ
FT                   AIGVWTSLLSENGANTELSKLDVFKMISQRQGTLLMASSEGDIGTIQQELLRLLKARES
FT                   KLASATPDNYLQLIAADDALFKKYGWFVHSQALGYNETTYAGETEYFTGYNSVTNVGKR
FT                   DASIEEILHITQAQGIAPLTGDGSKGGLQKRITEHSLSIFKDYKYVSVRGLYVYDDKDS
FT                   SKDYVPQSSIWSPQADGATFDEKRKAQWDDDWGGDDIGKDLGMPEQYKMGQTFSHEYFA
FT                   ALADTYYGMYGGFNSEFGGMDNYRYVTRETLPSDSTGFAIVKEFLPEYHQYTARIDSSK
FT                   VNTYLNANPSLNNIFKIQISSNDKEKYTFKSQYIKNLKIVGAEALDILGNSQDNYFEGN
FT                   SANNTFDGSDGTDVLKINGNKNDYSIEKLAGGVTKISGKSIGTDKISNVEYIKFNDEVV
FT                   KVDKI"
FT   gene            140862..143009
FT                   /locus_tag="VS_II0129"
FT   CDS_pept        140862..143009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0129"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25404.1"
FT                   /translation="MLPGQHEAGVDLSGSPLSANAVIDWEIANSDLVFGSYADKTDNKR
FT                   STTIGYMYNQKLELNSGWLENDLRNNAELHGVNFEDFFLHFSEDTVLAEVDNTHGENTL
FT                   LSGKPMILGYTASEDHAGFWLYQEPPWDADVFENFEQDGALYVYHAEQFERLTFKFSQF
FT                   AVSGEFWIEYPTAIDSHGRVSQWERLDVKKDKTLNMTRNQSVIWNLPGNWVRATTHDGS
FT                   GVSYGGGQYFGSTFLREGGRLYVVRVRWQSENADDRPRLKEVKLKNSFPTVKLTDAPTT
FT                   TPDGNAISQWRNIRGFDVSADLNGDNYLSPSEYRNRTNKNATARFRWESRVVPFGRMWS
FT                   ANSSWSLTNVANADYLSAIHRYYKQSWASQGLDGAYNDDTNKLIGSNQFYVHSGGHVQE
FT                   LGAVAGSNQADDLYKQQFSAFLQNLSVLESDASIGLNIGTANLLGRNGQSHLSEAGSLY
FT                   LREHYIFPSTGFSGYSGISKFWDNSALAYNGQRVIFQATTRYGRVQYLGNSEENWKKDQ
FT                   YSTLAIYHLNRHAQHSYFNQWNNSYVYGSDNTTADIFWQSGVPKNIAYQPSSLLAVDLG
FT                   EPSHQVLQGFEPIPLMLSTTTPQPTDYTIVGDSSMSEVVHADLPNGMTHVLPTFTYFMY
FT                   QSKNQVAAGGPEDMVLAREFSNGRVLYRTDFHGKNSSFYEAEKLMIVLDVPMKPVDENG
FT                   NIGEYVTEIHIGGYEGLFLLY"
FT   gene            143382..144011
FT                   /locus_tag="VS_II0130"
FT   CDS_pept        143382..144011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0130"
FT                   /product="putative phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25406"
FT                   /db_xref="GOA:B7VQA0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25406.1"
FT                   /translation="MPKLDKYKGIIFDLDGTLVNSMVAHAHAWEQTCQKFGIPYDKEWL
FT                   DQLGGMPSRKVTQEILKRYDLTLDAQQITSDKIANFEAIEHKGDVIPETYALLQQQYLL
FT                   KKIGIGTGAQAKHARAILKTTDIPSMIRTIVTSDDVENHKPNPDTFLKVASQLELEPSD
FT                   CVVFEDTIIGQHAATSAGMDCYMVENGQITKFVPANGLEVGSGPEI"
FT   gene            143965..144219
FT                   /locus_tag="VS_II0131"
FT   CDS_pept        143965..144219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25407"
FT                   /db_xref="GOA:B7VQA1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25407.1"
FT                   /translation="MFQRMVWKWVADLRSETKLRSIRSRINESGRNIRLEVDGGVKVNN
FT                   IKEIAEAGADMFVAGSAIFDSEDYQQAIDSMRAELAQLN"
FT   gene            144281..144427
FT                   /locus_tag="VS_II0132"
FT   CDS_pept        144281..144427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25409"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25409.1"
FT                   /translation="MYLIDVDLMENYVESGEVALLEFSSVISFSLCNKTTVNIDFGHIT
FT                   AQN"
FT   gene            144458..144595
FT                   /locus_tag="VS_II0133"
FT   CDS_pept        144458..144595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25411"
FT                   /db_xref="GOA:B7VQA3"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25411.1"
FT                   /translation="MNATVITNENNVSLAKPSVMNEVLFFAKSTVIMGAIILLVASAWV
FT                   "
FT   gene            complement(144807..146006)
FT                   /locus_tag="VS_II0134"
FT   CDS_pept        complement(144807..146006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0134"
FT                   /product="Probable glucose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25413"
FT                   /db_xref="GOA:B7VQA4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25413.1"
FT                   /translation="MRVFPLKDAPLVLLSLIFFIWGLITVSSNSLIPHYKEAFSLDYKM
FT                   AMLFPMAFFITRITVSLPTSFVMPKIGYRTTLKFCLIWCLLGCLAMAYLVRGEELVPTL
FT                   IGILLMASGVSAIQVVSSPYVSLLSTPDKSVIRQSVATASNSVGTVLGPLVLTAVILVA
FT                   ATFNVNSTAHQVSFLFLFIALFFLGLLVFLSKISLPDIKPKQMTGFWRGLTLLVKNRQF
FT                   MKLALVLLLYIGVEVSFGTFTITYLADQQYGDLGLVSATQIIALYWVLMFMGRLLFAKF
FT                   GNTINKHALFSLSCVVAALISALAIYQNHVWVGYLMLVVGLCNSTLYPIIYAQALHASG
FT                   KQNSQGAAILIMCSIGGVVLPFVQASLIDELSLSTSYIAPALAYVLMIVLYWSSLKHRA
FT                   "
FT   gene            complement(146096..146440)
FT                   /locus_tag="VS_II0135"
FT   CDS_pept        complement(146096..146440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0135"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25415"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25415.1"
FT                   /translation="MNCKETTMTIFRTAFFEADLTEEQKQDFYQYMENEVAPIIRTFPN
FT                   NQGLTLNKPEAIEAESHKNLLLMMQHSYENESVMAAALDSEQRIKSMHATKVIIEKYNI
FT                   HVHHINFVRD"
FT   gene            complement(146430..147299)
FT                   /locus_tag="VS_II0136"
FT   CDS_pept        complement(146430..147299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0136"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25416"
FT                   /db_xref="GOA:B7VQA6"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25416.1"
FT                   /translation="MFDSKNKFRLGIYEKAMPTTLTWEERLIHAKEAGFDFVEISVDET
FT                   DERRARLDWSDEEIYELRRLCEKHQMPFQSMCLSAHRKFPFGSMDDAIRTESLIIMEKA
FT                   ISLAYKLGIRCIQMAGYDVYYEPQSAETHARFIEGMQQATKMAERAGIMLGVEIMDTPY
FT                   LNSLSKFEVLKREIPSPYFMAYPDVGNISGWNYDVCTELKLSRDHLVQVHLKDTLRVSE
FT                   TCKGQFRDLVIGEGQVDFPAIFKTLAEIDYSAPLVIEMWAQNDNWFEDIKQAKATLKSI
FT                   ANQSGFEL"
FT   gene            complement(147309..148067)
FT                   /locus_tag="VS_II0137"
FT   CDS_pept        complement(147309..148067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0137"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25418"
FT                   /db_xref="GOA:B7VQA7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25418.1"
FT                   /translation="MSEQIKSLSKALTVLEFLGNYPNGVSLQKVSEGTGFNKSSVHRIL
FT                   ATFEDSGYVAQMCSGKEYRLTMKLVQLGHAAINSDVTGTVKPYLSELLDDVNETVNFLS
FT                   FDADNIIFKDKFEPVNSSFRTRTYVGLHSPMYCSAAGKCYLAFSSDSVRETYWKRNVST
FT                   MKPLTENTILDKSQFFGVLDKIKSRGYALDDEENEAGISCVAVPIFDKNNSPVYAVSVS
FT                   SLTPKMKALGYEEIASRIQDITTRIEQQLF"
FT   gene            complement(148075..148839)
FT                   /locus_tag="VS_II0138"
FT   CDS_pept        complement(148075..148839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0138"
FT                   /product="putative 3-hexulose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25420"
FT                   /db_xref="GOA:B7VQA8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25420.1"
FT                   /translation="MSSRILNTTTLTKRNISTIKDWCSCLNNLRMKWMPSTVLKPSKPL
FT                   LQMALDATDIDTALASIEHVADKLDVIEIGTILAFAHGVDSVRILREKYPNHIIVCDMK
FT                   ITDASAILTRLAMDAGANWVTVSAAAHIETIRSAKKVTDEFDGEVQIELYGHWTMEDAQ
FT                   AWVDMGIKQAIYHRSRDAELAGVSWTEEDLIKMQKLSDIGIELSITGGIVPDDLHLFKN
FT                   LSAKSFIAGRALAGSNGRDIAENFHTEIGKHW"
FT   gene            complement(148733..150226)
FT                   /locus_tag="VS_II0139"
FT   CDS_pept        complement(148733..150226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0139"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25422"
FT                   /db_xref="GOA:B7VQA9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25422.1"
FT                   /translation="MNYYIGIDSGGTFMKAALFNAKGEQQGLARVSASVINEKQGWVER
FT                   DLNALWGNAVDVIKQLLETTKVEPTSIKGLSISAQGKGVYLLDKEGQNLGHGIMSSDSR
FT                   SLPIVKEWLEQGKAQEIYPTTLQTLWTGHPVSIVRWIKENDAERYNNIGAVMMSHDYLR
FT                   YRLTGEVAAELTNISESNFFNSITGEYDKALLETFGIEEIWDALPPVVKPQQQAGKITA
FT                   AVANETGLAIGTPVFGGLFDVVSTAICSGINSSEDTLNYVMGTWAVTSGISKQVTQESH
FT                   NFVYGHYAVDNEYIIHEASPTSAGNYEWFADYLGENGQINHQQNQALVEALDPALSSIY
FT                   FVPFLYGSNQGLGLKSGFYGLQSHHTKGHLIQAIWEGILFCHNIHLERMRQRFPKANIL
FT                   KVTGGPASSPVWMQMLADLTGMTVEISDVDETGSLGAAMMAMVGAGEFASLEECTQAIT
FT                   NSTSRVEPNPEHYDTYQKKYKHYQRLVQLFKQFEDEMDA"
FT   gene            complement(150226..150714)
FT                   /locus_tag="VS_II0140"
FT   CDS_pept        complement(150226..150714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0140"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25423"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25423.1"
FT                   /translation="MLVGNTQPTQISKSYPVVIQNVLEYLNSLDQEKLALGRHELPGFD
FT                   SKQAWFVVLEYDKEPLGNFQPEVHKYHSDLQIILEGSEVMAWAIDTGEHSNAQPYNQER
FT                   DLQFYEYPGIELSFIHAKRNQFYLFTPNIVHITNIENDDSQPVRKLVVKIHNDLLEAK"
FT   gene            complement(150763..151626)
FT                   /locus_tag="VS_II0141"
FT   CDS_pept        complement(150763..151626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0141"
FT                   /product="Predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25424"
FT                   /db_xref="GOA:B7VQB1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25424.1"
FT                   /translation="MHKSSPHKSYKHKLDKHKLLALDLDGTVLNSQHTISQELVEAIKQ
FT                   VAQHTHVVIVTGRHHVAAKPYYDQLGLSTPIICCNGTYIFDYQNDTVIQENAIDKEIAA
FT                   EFITLSQAHDLKMVMYVRDAMLYSRARPIEYMEALLTWSQTFPESQRPNIQKVDDFQHE
FT                   AQISEYVWKFVVEGEVNTFAEIPFVKENFNGERSWIDRVDFAATGNSKGNALTRYIEPL
FT                   GISLEQCVAIGDNHNDISMLKAAGLGIAMQNADDTVKSSANLITPKNNDDKTGLATLLQ
FT                   DLFSAH"
FT   gene            complement(151637..152347)
FT                   /locus_tag="VS_II0142"
FT   CDS_pept        complement(151637..152347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0142"
FT                   /product="Ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25426"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25426.1"
FT                   /translation="MSQEQKNYQELKERVFAANLQLPKYGLVTFTWGNVSEIDRERGVI
FT                   AIKPSGVEYDVMTADDIVVLDLEGNRIEGKLNPSSDTATHIELYKAFPTIGGIVHTHSR
FT                   NATIWAQAGRDIPALGTTHADYFYGDVPCTRLLTKAEIESDYEKNTGLVIIEEFNQRDI
FT                   DPQAMPGVIIAGHAPFTWGKDGSDAVHNAVVMEEIAAMATATRAISPEVAIQPELLDKH
FT                   YNRKHGKNSYYGQK"
FT   gene            complement(152443..153417)
FT                   /locus_tag="VS_II0143"
FT   CDS_pept        complement(152443..153417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0143"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25428"
FT                   /db_xref="GOA:B7VQB3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25428.1"
FT                   /translation="MKTLLKLTLLASTIAMSSSAFAATTLKLAHAAPESDLQQDLSLFF
FT                   KKEVEARSNGEIKVNIYPQGQLGSDKQMIDGSRAGIVDLAMVGLNNYNGLMPESAAFTL
FT                   PFMFPDRQTAYKVLDGEPGKEVLANFEKFGLKGLGFPENGYRNMTNNEKPIRVPSDVEG
FT                   LQMRVNGSKALNDMFNELGANPQQLPVSELYTALETGVVDSQDHPISVTLSFKFDEVQK
FT                   YLSLTQHAYSPLVLTMNLRKFDKLTEDEQKIIEEVSAEAVAMQRELSIQKEDKMIAQLE
FT                   ANGMQVNRDVDGAAFQQAIQPVWSAYIEKNGDVMINKIKLAAK"
FT   gene            complement(153439..154719)
FT                   /locus_tag="VS_II0144"
FT   CDS_pept        complement(153439..154719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0144"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25430"
FT                   /db_xref="GOA:B7VQB4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25430.1"
FT                   /translation="MTLAIFLSVLIVSILLGLPVAFALLLSSMALMLHMDFFSADILAQ
FT                   SLINGVDSFTLLAIPFFLIAGEVMASGGLSQRIVRLATTYVGHRQGGLGYVAIMTSVLL
FT                   AGLSGSAVADAAALVSILYPMMKAAKYPEAPSMGLLASGGIIAPVIPPSIPLILVGVAG
FT                   GISIKNLFLGGIVPGLLMGMTLMFVWRWTVRKENLETSERATKAEKRAALKDGVWALML
FT                   PVIIIVGIRFGIFTPTEAAVVAATYAIFISTFVYKELTIKKFYHIVLNAGRSTAMVMFL
FT                   VGCAMVAAWLITVAQLPQQLAEMLGPLVDSPRLLMAVIMLLVLCVGMVMDLSPTILILV
FT                   PLLMPVIKMAGIDPTYFGLLFVINCSIGLITPPVGTVLNVVCGVARVPMSTAVKGVLPF
FT                   IAAYMALLTLFVIFPSIITVPMSFVIG"
FT   gene            complement(154719..155207)
FT                   /locus_tag="VS_II0145"
FT   CDS_pept        complement(154719..155207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0145"
FT                   /product="TRAP dicarboxylate transporter, DctQ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25432"
FT                   /db_xref="GOA:B7VQB5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25432.1"
FT                   /translation="MQSVLKSIWKSIDVIMAVILTCMVALVFTNVVLRYGFSSGLRPSV
FT                   ELSRLGLVWVVMLGAAVVLRRGEHLAVAEFSERLFPKAVPVLRRICWVIVLISVGMLYV
FT                   GSYRQMMSNWSDISQLTGLPSALFYLAGVVSGLLMGVIAFMRIFKPDWQLDSLDEEKE"
FT   gene            complement(155232..156233)
FT                   /locus_tag="VS_II0146"
FT   CDS_pept        complement(155232..156233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0146"
FT                   /product="Hypothetical oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25433"
FT                   /db_xref="GOA:B7VQB6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25433.1"
FT                   /translation="MPLVSTEKLQQEYERILLARDMKPEMATKLAAGFVEMANEGTYSH
FT                   GINRFPVFIDQVDKGQIKLNAEPECVNSMGALEQWDCNYGPGVLNGLICAERAMELARD
FT                   YGIGMVGMRNSNHWMRGGAYVLKMAREGFAGIASTNSIAVMPAWGGKDHRVGSNPLIMA
FT                   VAGDPPVVVDCSMSQFSYGQLQNFVLADKELPVVGGFDNEGELTKDPHVLWENKRLLPM
FT                   GFWKGSSMAIVLDMMLTAITGGHSVPALTEDMGGEFGVSQFLIAIDLSKTMDQSTYAQE
FT                   MKRIRDYVLESEPAETGSVMIAGSEIENFIKKHEAAGGIEINDGIWEQITSL"
FT   gene            156656..157825
FT                   /locus_tag="VS_II0147"
FT   CDS_pept        156656..157825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0147"
FT                   /product="Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25435"
FT                   /db_xref="GOA:B7VQB7"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25435.1"
FT                   /translation="MKIVIAPDSFKESLSAVSVAACIEKGFREIFPDAEFVTLPLADGG
FT                   EGTVDVLLQGLAGQKRTHQVEGPLGKLVNAEWAMLEPSEHNQNKTALIEIAAASGLDLL
FT                   KPEQRDPLIASSFGTGQLILEAIEQGAQTIILGLGGSATNDGGAGIVQALGGKLLDRAG
FT                   QELSRGGAALADLASIDLTGVDSRCSDIELIVACDVDNPLCGDNGASYIFGPQKGATPE
FT                   QVLMLDKALENFAQVAETQGYAGGDEPVYKRVGYGAAGGTPMGLGLLFNIQIKPGIEMV
FT                   LDVLQADDLLKGADLVITGEGQMDNQTLQGKTPYGIAKRASLQGIPIIGIAGSLGTEVE
FT                   ALYGEMNSLFGTVRSPQSLDQVLLEAELNLTRTARNIAATLKVGHAILK"
FT   gene            158027..159478
FT                   /locus_tag="VS_II0148"
FT   CDS_pept        158027..159478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0148"
FT                   /product="Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25437"
FT                   /db_xref="GOA:B7VQB8"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25437.1"
FT                   /translation="MSKKLTTAAGCPVAHNQNVQTAGKRGPQLLQDVWFLEKMAHFDRE
FT                   VIPERRMHAKGSGAYGTFTVTHDITKYTKAKLFSEIGKKTDLFARFTTVAGERGAADAE
FT                   RDIRGFALKFYTEEGNWDMVGNNTPVFFLRDPLKFPDLNHAVKRDPRTNMRSAKNNWDF
FT                   WTSLPEALHQITIVMSDRGIPATYRHMHGFGSHTFSFINADNERFWVKFHFKSQQGIKN
FT                   LSDAEAAQVIGDDRESHQRDLLDSIDNQDFPKWALKVQVMPEADAAKVPYNPFDLTKIW
FT                   PHADYPLIEVGEFELNRNPQNFFAEVEQSAFNPANVVPGISFSPDKMLQGRLFAYGDAQ
FT                   RYRLGVNHQHIPVNAPRCPVHSYHRDGAMRVDGNFGSTLGYEPNNEGQWAEQPDFAEPA
FT                   LNLDGAAAHWDHREDEDYFSQPGDLFRLMTPEKQAILFDNTARNLGGVPKEIQLRHLRH
FT                   CYKADPAYGEGIGKLLEIDVSEFKS"
FT   gene            159709..160581
FT                   /locus_tag="VS_II0149"
FT   CDS_pept        159709..160581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0149"
FT                   /product="Phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25439"
FT                   /db_xref="GOA:B7VQB9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25439.1"
FT                   /translation="MSKSALIVEGGAMRGIFAAGVLDAFMQDDFRPYDFAIGVSAGVSN
FT                   LVGYLSQAPKRSYNVITTMATDKTFFNPARFAKGGNLVDVKWLWDESNQRYPLDCGELF
FT                   SSVPLLAAVTNVDTGSADYCHIKPENLSNVVEATTALPIVYRETPCFSGGCYTDGGVAD
FT                   SIPVREAYRRGARDITVILSHPLSYRMKPQKYQWMLKKLLKKFPNIAESMAVRAENYNQ
FT                   SLEFIRNPPKDATIKVIAPPEAFAVKRLTMDQTVLNAGYEMGVKAGEEHLAIRNGVYGL
FT                   DTEDCHFCV"
FT   gene            complement(160700..161692)
FT                   /locus_tag="VS_II0150"
FT   CDS_pept        complement(160700..161692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0150"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25440"
FT                   /db_xref="GOA:B7VQC0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25440.1"
FT                   /translation="MLNIAFFSSKSYDEKSFELAKGELNAEFHFHDFRLTTTTAKMAHD
FT                   NEVVCAFVNDDLSRDVLEILAKGGTKLIAMRCAGFDKVDLDAAKEFGLQVVRVPAYSPE
FT                   SVAEHTVGMMMCLNRKLHKAYQRTRDANFSLEGLVGFNFHGKTVGVIGSGKIGLATMRI
FT                   LKGLGMNILCYDPYPNPLAKELGAKYVELDELYQESDVISLHCPMSKENYHLLDATAFE
FT                   KMKDGVMIVNTSRGELLDSTAAIEALKQSKIGALGLDVYDNEKELFFQDKSNDVIVDDV
FT                   FRRLSACHNVLFTGHQAFLTKDALFNIANTTLTSVDAFFTGNTSGNELV"
FT   gene            complement(162181..162513)
FT                   /locus_tag="VS_II0151"
FT   CDS_pept        complement(162181..162513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25442"
FT                   /db_xref="InterPro:IPR014510"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25442.1"
FT                   /translation="MSHLRIPSHWKIQRSTPFFTKDNIPAALLNHHNTAEGVFGQICVM
FT                   KGTVTFYGFADADATEPESVITIQAGQFATSPPQYWHRVELSDDAQFNINFWSEKETKK
FT                   MFNTRK"
FT   gene            complement(162576..163424)
FT                   /locus_tag="VS_II0152"
FT   CDS_pept        complement(162576..163424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0152"
FT                   /product="Ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25444"
FT                   /db_xref="GOA:B7VQC2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25444.1"
FT                   /translation="MSILNEITSLNKGDDMTDIPHGLVTGKVVHKTEWTEQLFSLQVSA
FT                   PVSPYQAGQFTKLGLRNSEGEFVRRAYSMVNAPEHEQGHQHLEFLIIKDQNGQLSPQLH
FT                   ELKVGDDIFVGKDPSGFMTLEEIPEIADDLWMLSTGTAVGPFISMLESMQIQQHNGSES
FT                   EKVTSFKNLVLVHAVRTEQDLTYQDRINQLVNHFQGKLQYVPIISRESVTGTLRGRIPS
FT                   LLLGGDLEQTTSVTFNQTRSFFYLCGNPQMVRDTSEALTNLGFEKHLRRKPGQFSSENY
FT                   W"
FT   gene            163720..164664
FT                   /locus_tag="VS_II0153"
FT   CDS_pept        163720..164664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0153"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25446"
FT                   /db_xref="GOA:B7VQC3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25446.1"
FT                   /translation="MLDNLRMALNVLFVTINTAMTAFTVSFFGLIKLILPISIVQKSCT
FT                   RLANFTFWCWASLNLWMLNVNNDIEWQVEGGEDISTKQWYLMMSNHLSWADIVILSSIL
FT                   KDKMPMTKFFLKHELLYVPFVGLACWGLDMPFMRRHSREFLIRNPERRNDDFEAINKAC
FT                   TKFKWAPTTLVNFVEGTRANHEKLATAKTPYRHLLKPKTGGVAFALSAMGPILDGIVDV
FT                   TLAYPENQASPFEDMLKGKMTKVVVRIKLHPMDENVNGNYFEDKAFKRRFHSWLNNTWK
FT                   EKDDYLDTVYGVDTPCKVETTDESDVAYKKQEQ"
FT   gene            complement(163858..164139)
FT                   /locus_tag="VS_II0154"
FT   CDS_pept        complement(163858..164139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25448"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25448.1"
FT                   /translation="MTSHERHIQAPTSQTNKRNVQQFMLKEELSHWHLVFQDRRQDHDI
FT                   RPTEVIRHHQVPLLSRDVFPALNLPLDIVIHIQHPKVKRSPTPKCEVR"
FT   gene            complement(164814..165557)
FT                   /locus_tag="VS_II0155"
FT   CDS_pept        complement(164814..165557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0155"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25449"
FT                   /db_xref="GOA:B7VQC5"
FT                   /db_xref="InterPro:IPR016876"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25449.1"
FT                   /translation="MKLSNRLQTLHSLVSNDYQHIWDCCCDHGFLGVQLLSDHKAPQIH
FT                   FVDIVPSLMNELEDKLTRYFPQCETAKQKVTSQWQVYCLDVAAIPLEKHTGRHLVIIAG
FT                   VGGDLTQKLVDDIHCKHPDKAIDFLLCPVHQQFELRNHLKALNFGLIDEVLIEENRRYY
FT                   EILLVSNNQGESDKNLDESGNNRTVTEISSVGDKIWTPNCEQQKQVSQQYKAKTLQHYL
FT                   RIHQGQEKQGKTSEVKHIIEAYQAI"
FT   gene            complement(165711..167525)
FT                   /locus_tag="VS_II0156"
FT   CDS_pept        complement(165711..167525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0156"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25452"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25452.1"
FT                   /translation="MDIMALPKTLIRLFKPYIILLTGGMLYLAAAQLEKVETTAKEQSL
FT                   SNIRIASSIINSNIEATFGKLYFLETSLSLSTSGPVGDQKFRDISDNILKRTPNFSDIV
FT                   QYQPQSQQYISTRGLPLSNEQIDAIQWNPIDSVVEGFYISSIYQKPDGRWVFAIKHTTE
FT                   KLNKEIWIEFDLLHTTQGLRDLKTLDRGYVFVVDRATERLVFHPDPKRIGSKSISYHAG
FT                   ISHQLSQGETVGQHEYYYQDNFKITVFDADNSLNWVFVSGTDRHDILTSSHQFTLTGVV
FT                   LGSLLLLWIGAHYLAHRLNMSLSQLNKVDDLASFKRELKAIFNSFTYQKGIQFCLYQAE
FT                   SHSFSTIDYHGNKSTVHSDKALAERFSPESMAYRSSKYADPLARKLKILQRHYCIPLHS
FT                   RNQLIAVIYVNAPLPISQSILRMIKDYTEVSLSNLLLHHQLSSKDLMTQLDNKSSFNIA
FT                   IDNYACEPDTYVALLDIDNFDHVNRAYGEAIGDKMIKLAAEAMRSYFPKPKGLCLARVG
FT                   DKEFAVLFKANDAKDAKHQLEQCRVSIAEKTIVTPDITLSLSISVGFSQIDGETDSALA
FT                   LAEQAKLIALQLGKNRVEGHIRGVAKAS"
FT   gene            complement(167706..169679)
FT                   /locus_tag="VS_II0157"
FT   CDS_pept        complement(167706..169679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0157"
FT                   /product="Type II secretory pathway, pullulanase PulA and
FT                   related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25454"
FT                   /db_xref="GOA:B7VQC7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25454.1"
FT                   /translation="MTRTLARPYPLGATLGNTGCNFSVYSPDCKSLSLALFDENDEFTT
FT                   YKLENEYADIRYVFVDGIKAGQKYGFITETDIGPILLSDPYAKAISEPLDYATPYTNEK
FT                   SFSMAKCLVVDDTFDWQDVEKPRISREETVLFETHVKGLSQLHPEVATNTKGRYLGLVS
FT                   PEMLAFYKQQNINSLQLLPIAACMHEPHLLDMGKVNYWGYNPYLFMVPDPRYAEKDAVS
FT                   ELKTAIRELHRNGIEVILDVVYNHTAEGGEGGTTFNLKALDSRYYIKHGCHYANFTGCG
FT                   NTVDLTHQPALNLVMDTLRYWVSEFQVDGFRFDLAATLGREGDNYNPEAAFFKAVAQDP
FT                   ALKETKLIAEPWDIGPNGYQVGNFPLGWNECNDKLRDITRSFWRGDQGYLKEFATRLMG
FT                   SRDIYSAAHWPYKLTVNYITYHDGFTMQDLVSYKHKHNEENGESNRDGHGDNRSENYGV
FT                   EGNTENLLVIATREKQKRNFMASLLFAFGIPHILTADVLSHTQKGNNNAYCQDGVTSWL
FT                   NWEDSERKTYFKAWLSEMISARQQYMVPFIKAFSGDKRNSNRIFWSRVDGTIMEHDDWN
FT                   RLSSVALHLGIGKDGDELIYLINQTNAPARFSLPSDRQQDWVTICDTNLRNVKPGHAEG
FT                   EMLLSPVSMAILHYSPNKTDSV"
FT   gene            170112..171515
FT                   /locus_tag="VS_II0158"
FT   CDS_pept        170112..171515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0158"
FT                   /product="Maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25457"
FT                   /db_xref="GOA:B7VQC8"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25457.1"
FT                   /translation="MKKVSLIAAAVASALVAGSAFAENDVALDVTSGDSSMEVEVKNPT
FT                   DVITDGWEVHGYMSSNVRVVDGKTVDTEFGKPDYKTAGTHGKSTNQVEFVIKKHSEYQN
FT                   GVWADYVLRTEYGNGNSYAYSSEGGQKKNDDSQFEVKEAFVELGGILGEDTSIWGGQRY
FT                   LNRAAGLLSGEFWKQSSGIGAGIQTKLAGHTAGIAYVMADPDAGSADSYAIDCKQDDGT
FT                   TSTDPSKCKVKKDGAKERQTLSSIDLYYYGVDAGIGSLDFDFKYGQQNINGGENEDGIG
FT                   AAVTLNTSYYGLDGWTQNVIAYGSGVMKNRGVNFGGWSGGGDKEESLFLTSYGVLNISE
FT                   KWQLGTEAVYFTALDQLFGADGLTRYMVAARPSYKLNDNIRLEATASYAHEEGDEGYWN
FT                   RTGDAVESDILNLEIATAFTANSDYFGRPQVKPYISYIKADDEASAKQIGIDNGKDEFV
FT                   FGVHTEIWF"
FT   gene            171594..172475
FT                   /locus_tag="VS_II0159"
FT   CDS_pept        171594..172475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0159"
FT                   /product="Maltose operon periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25459"
FT                   /db_xref="GOA:B7VQC9"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25459.1"
FT                   /translation="MTNKSSMLAVVLGALLSGCASDAQVQTKLDAPTNAEVCCSDFSQY
FT                   PYAQLNDNEDLKFDIDLGSPVGTFTTGNSHFAAFKFSERSGEMVVKLSSLMIDDSVFAP
FT                   EAMLLDENFKPVQTLKFEDFKVQASDAFTRTSYIERLRIDASKTPYIVIYTPADELGNK
FT                   VKVDHPAKVRAKEFGEVMPMVTDPVYTNQLGGRLELEIKTLKLRPYRAKPAVAPVVAAP
FT                   AALAATATAVVPKKADTQIRVQQETKDFYLSAIQNAVKSGDIPKALGLLDEAKALNVEG
FT                   AQEAFVRAVNAK"
FT   gene            172685..173512
FT                   /locus_tag="VS_II0160"
FT   CDS_pept        172685..173512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0160"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25462"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25462.1"
FT                   /translation="MQSELIIIDEFFIPQLNRTRTLRIYLPAGYHQTEHAYPVLYMHDG
FT                   QNVFEKSTATYGMCWDAQTTLDEMQRLGKLSGVIVVAIDSSHELNGMERYNEYSPWRAN
FT                   QEIKDLGVGDELLKFGGEGDEYMAFICHTLKPYIDQTYRTKPNREFTYLAGSSMGGLIS
FT                   LYGGSLYQNTFGVLGVFSPAFWFNKSSYFEYMKEFNFLSPTKIYMDMGTNEAREEASVD
FT                   FADVYLSGSRAMNTLLTQKPNVTLFYQEGQGHQHNELAWSLRFPDFIDFIFRQ"
FT   gene            complement(173629..176496)
FT                   /locus_tag="VS_II0161"
FT   CDS_pept        complement(173629..176496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0161"
FT                   /product="Glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25464"
FT                   /db_xref="GOA:B7VQD1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25464.1"
FT                   /translation="MAQRMLCLFCFGNQLAMQIPTLYLKGTFNGWGLDTPLFKEQDGSY
FT                   RANLCLSTDLYRFKISDSDGTKQWTLSGHESEATLCELEQAMPLINTQGIGNDLLLSPA
FT                   VAGQYSLKVQFGSSTPTITVTKGEYNDLSTPQREPIDTHLIEADIEVEESQPHWQHPDF
FT                   AIPHDQLFQQLTISETQSFPFVFGDNVDGYYHGATYSYVNGGKYRHHQGWILGTFASYI
FT                   DGKFNNKLEAERASLTPYGIEHHYDHSRESLSLVQGSRLVSLTVSSNKPSALSLIPELN
FT                   IPTTHSKVHTSDSNIVIELSPQVCPDGCPRFVAIASNHAVHAREISLDAHPELRDLVQL
FT                   SESNTKLMLTTSDKQTELVVYLGFAETLETASSLVNQAIKNNEHVLHQQRIYEFLTNNY
FT                   LWTNDLEYNQAVMWSRLASRTFVSHEFGTGIWAGLPWFKDCWGRDTFIALSGTSLVNGL
FT                   FSEAKEIIENSASMQMLDENSTNYGRIPNRVTSKTNIIYNTTDGTPWMIREALEYINYS
FT                   GDVAFAKAIYPTLKRFITGVEKHYLNEDSLNEDYLNKDSLMAHRHPDTWMDAKIDGMTP
FT                   WSPRGPKANDIQALWFESLNCAIQLAILVGDSESEKSWAIQAGKVKESFATKFWDDTNH
FT                   RLADHLSQGDVPDYSVRPNQLMTISIPQKSPLNQNEREQYIVKNAVETLLFPWGICSLQ
FT                   QEHVDFHPYHDNQAMYHKDAAYHNGTIWGWNAGFTITALNKFKQQDLSYQLSKSLAKQI
FT                   LTQGCRGTMSENLDAFQESDRDLVESGTFAQAWSVSEYARNAQQDYLGYCPRLLDNQVH
FT                   LTPNFPSCWSELVASLPFGQGNQLRLSFESKNGISHYKIQSNLEDTVSPEITLVLTLDI
FT                   NHESVAVISTPLTQSLKIMIDSHQQQVTVNDKQAQFEIQPKPNNAILRDLQFAKPDFAR
FT                   QHNSLMSKDYLLNKRNKQKLSAAKD"
FT   gene            complement(176527..177705)
FT                   /locus_tag="VS_II0162"
FT   CDS_pept        complement(176527..177705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0162"
FT                   /product="Maltose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25466"
FT                   /db_xref="GOA:B7VQD2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25466.1"
FT                   /translation="MKPLLKTLSICTLAALFNAPAFAMEEGEITIWINGDKSYAGLAEI
FT                   GKQFEEDTGVKINVQYPDSLEAKFQQHAATGGGPDIIFWAHDRFGGYAESGLLHELNPS
FT                   KEFKEKLVDFSWDAVTVNGKVVGYPLAIEAPSLIYNKDLLPNPPKTWEELADIQKEMAK
FT                   QNKKAIMWDVKNAYFTWPMISAGGAFAFEKTATGYDAKSTGVNNAAGVRGLQFLVDMVN
FT                   QGVVNPNMDYSVAEAEFTNGNVAMTINGPWSWGNLDKLGVNYGVAELPTLNGGKGNPFV
FT                   GILSAGINAASPNTDLAVEFLENYLFQDDALKTMNDDKPLGAVTLKSFQKILESDDRIK
FT                   STMTNAENGEIMPNIPQMTAYWFAEGAAIDNAMQGKQTVREALDTAAKQITK"
FT   gene            complement(178073..179716)
FT                   /locus_tag="VS_II0163"
FT   CDS_pept        complement(178073..179716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0163"
FT                   /product="Glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25468"
FT                   /db_xref="GOA:B7VQD3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25468.1"
FT                   /translation="MDIEMEQKWWHDAVVYQIYPRSFLDSNNDGIGDLNGIISKLDYLK
FT                   ELGINVIWLSPVYQSPMDDNGYDISDYQAIAEEFGTMEEMKRLMDEAKERDIKIVMDLV
FT                   VNHTSDEHRWFEQARSSKDNPYRNYYIWRDAKPDGSAPDDQGSIFGGSAWQWDELTQQY
FT                   YFHLFSKRQPDLNWENPKVQEEVHTMMNWWIDLGIGGFRLDVIDLIGKEIDKGITGNGP
FT                   RLHKLLQQMNQATFGNKDLLTVGETWGATPEIAKLYSGQGRNELSMVFQFEHITLTWEN
FT                   GDKWNPIPLDLREFKNVLTKWQLELADGGWNSLFWNNHDLPRLVSKYGDDKHFRVESAK
FT                   MLATCLHFLKGTPYIYQGEEIGMTNVAFDNLDQYKDIETHNFYKVKTESGVTHEHMMDA
FT                   IHENSRDNARTPMHWNKQPNAGFSDGTPWIELNPNYPEINVESALADPSSIFYHYKTLI
FT                   ELRKAHPAIVYGSFIPVFEEHDKVFAYVRELDGEKLFVVCNFSNDNLTLDIPEQYQTQT
FT                   LDCLINNYQTVTELSAKLELAPYESFAVKL"
FT   gene            179899..180816
FT                   /locus_tag="VS_II0164"
FT   CDS_pept        179899..180816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0164"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25469"
FT                   /db_xref="GOA:B7VQD4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25469.1"
FT                   /translation="MNKLYRYFLMVAHTGSIKGAAEKLNISQPSLTAAIKKLESDVGVA
FT                   IFTRKSKGVELTEYGVLFREFAQEQQEKHLSLMHRFTDMQQRQSGKLKLGTGEAWWEQF
FT                   VCKAVEEYKQQEKMGSLHLEFGNNLSLMHHLVQGDIDLFVGHEIYGLHERCKVTFYPLF
FT                   QDKEAVFVRAKHPLLTKKHLDPSLLRREMLAFPILQVTPDHSRHNSVLSDHVNSQPGGR
FT                   DSEEVGRDVYDVDSLFASLDMLRMSDAVMPYSHKMCDWMKDKGFETLLIDDSKLGNVGL
FT                   YAKQGAEDLKIKTFIEILQKANFD"
FT   gene            complement(180946..181239)
FT                   /locus_tag="VS_II0165"
FT   CDS_pept        complement(180946..181239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0165"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25471"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25471.1"
FT                   /translation="MRALPQVFPIYTKRLIMNFDINALKHHQLVEDGQLEGCYLHQPAQ
FT                   GSQQDDDAVLVERQALEKLGYKVVQVQAKGGATTFAEAMQKFAKKTGHQTKE"
FT   gene            complement(181650..186638)
FT                   /locus_tag="VS_II0166"
FT   CDS_pept        complement(181650..186638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0166"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25473"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25473.1"
FT                   /translation="MVILNQKKQLHQWYNRENNRLSKWTMSMKNVPDYLYSLPTEIEPP
FT                   IQSKVQDLPFDQLTWDNFERLTLRFIESYGKLEHCHMYGNRGQAQEGIDLFARHGTDEL
FT                   YTVYQCKRYKEYSVTNLKDAVATFLKGSWVDKTRTFYICISCEAVERKLSNEIETQAKI
FT                   LKNKGIDLFVLDKIKFSNELKLKPNIVHDFFGKEWVRLFCGEEYLVNYKNRLSANVFSE
FT                   YKQKLGKFYRTLFDNHEGSISNLSGQNTTPNFEDRYIVPDVINSIYLDSHDEGFSQSDQ
FT                   SKDVIDNMSIDLIDEIDTDCGAMGHIQSSTYQDNQDIENRLSSLDWIATEKNTVVIGGA
FT                   GSGKSALLKYIVLGLLDQIALKNRNLQENRSKLIPVWLPFGFWTNYMESQPNTSLVDCM
FT                   HAWFSGMNHQDLWPLIESAMEDDRLLLVVDGLDEWSSRQTALICLQKLTVFVKEKEVSS
FT                   ILSSRPSGIERLNMNTNNWSIGYLTGLSKEQQKKLIEICIGYRLKNQNNIDSKLYELET
FT                   RKISHELVSEISRSKDLLDLASIPLLIYMLIHLKTKNISLPHSRFSVYKELILDLVKVQ
FT                   PQRRRTAAQVTTHSSSFSEGELISILSKLAYEMQVNYPHGNVPIDNAKIFIKEYLSDES
FT                   KEFGLIKREATRQTDEFVDIGESEIGILVKKSTDEIGFFHRSLQEFLTALYASTETSAN
FT                   QKSLINKYIFNEQWMDVFLGLFSLLQRTSDVEDLVEYIANLKCEEHEEMSKELLLAKVA
FT                   FGDNKCSALTAKNISKKTFKSIEMGEYLPHRRELIKIVVNGYNSNKLHHEIVDMLGYWT
FT                   PKREHYSSGLFEQVERHWPVDDITRNMLLIGLSSEDIYTKKTASNVIARKLSSDKEMLR
FT                   LLMKLIKETMNYETRMVATSTVISGWINSREAKTLYNNLELSSSKLAILLRVLYESKKG
FT                   IFNENNREFLIACSEFHRDLSNVWNSIILECLNMGYIDNSLRNICMERVFSYGRGSSNF
FT                   DYDMARKILCVNYYDNAEFLSVFIEDLKNEHSHLLALHDIDIEFIEKVVKKSEVFHNVI
FT                   EEWAIKNKFSSYSMYHLFKTKKMKKHLLEEIVSDSSFIHWPVDALLYNWGMKDVDVKAA
FT                   ILKIVNESDRESSVIAHLYPIIFENKNECYCRLLILLKSKNINHMHYKRIIDAILSISS
FT                   DAQRKEVFGLVCTIVSAPGFRSSEKYLPLLWGMKELTPEIEKLAFDSLNGKDRNINIVA
FT                   AIVHDRDDLRKRLIDDIKVLDTPLRATISTLLSEINTDDSAYDLLNNYYLEVDASIKIQ
FT                   SAIGVYTSPLSVSSDDVVSRNYERLESEVYAVGMDHHEVREAAICGLIATKQLHLAKGL
FT                   KNPYGKDQFTIPIERHGLNTSEVYYSYLAKEWDYIESVFPNFINNLEGKELVSFFTYLS
FT                   PYIDSNESLKEKFRDYLYSSKLIVNDRILISSSKLITGESALLRMCFESLGLLAKGVDE
FT                   KSIVYRGDSVLALHILRKQFYGDTQVNELLEKFYNDREVNLDVVLVVSILTGFENKPYV
FT                   KEIKKKLKGEKIWLPTHFYTLSSKPTNQIVAEIISTMKYLQVAPRQYSKYFCSVMSELI
FT                   NGKATFDRELVKCIRNEKSIQIKLPLLVLYFQFKGLNGSTREIAIEMYNKQRRKVVPDI
FT                   VFDISEGRYSVSTLILTNMLYNKA"
FT   gene            complement(187101..188867)
FT                   /locus_tag="VS_II0167"
FT   CDS_pept        complement(187101..188867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0167"
FT                   /product="Glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25475"
FT                   /db_xref="GOA:B7VQD7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25475.1"
FT                   /translation="MYNKKHSIYQVFTRLFGNQNTQNTPWGTIEQNGVGKFSDFTNKAL
FT                   TEIRELGITHIWYTGVPHHAVINEYKHIGISDDHPSIVKGRAGSPYAVKDYYSVNPDLA
FT                   DNPAQRLQEFESLIKRSHDNGLKVIIDIVPNHIARNYQGLNNPEGVRDFGDQDDTTVEY
FT                   HRNNNFYYIPDSTFELPEIEPAFIPLGGEQHPNLASPFVESPAKWTGNGSRLSKPNFDD
FT                   WYETVKINYGVRPDGSKDFPELPDDYAMRDHLAHYHFWQHVDVPDSWVKFRDIALYWLE
FT                   KGVDGFRYDMAEMVPVEFWSYLNSSIKVKNQDAFLMAEVYQPDLYRDYIRLGKMDYLYD
FT                   KVDLYDGLKAVMQGKASTAIIPEIQHQMMDIEHHMMHFLDNHDEQRVASPEFVGNPHIA
FT                   KPAMLVSALLSSSPTMIYFGQEVGEPGAENAGFGQPSRTSIFDYIGVPQHQKWMNGGKF
FT                   DGGQLKDDEKQLRLFYQQVMTFSLNHSSMTGAYQDLHQSNQLSDSVYAFLRFDNQELVI
FT                   AAANFSQSKTDHIQLKVTAEVIHKLGIADGSYTLKEHIEGVQQQTLYVENGVGYFSAEL
FT                   NPLAAFAWVFPL"
FT   gene            complement(189145..192858)
FT                   /locus_tag="VS_II0168"
FT   CDS_pept        complement(189145..192858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0168"
FT                   /product="putative pullulanase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25476"
FT                   /db_xref="GOA:B7VQD8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25476.1"
FT                   /translation="MNEINTNKHEILQSTLKIAKTKSFNIAQTNNFKRSALAKAILPLV
FT                   TATLVAGCESDTSKTNSDSNSLYKAAENEVVIYYKRDVAAARASGSTYDGWGLHLWNGE
FT                   GCTSTDLVGMGLGNNGTDWDVPYEFKGINDTYGAYYVLKVDPDASDPHKCMNFILHNGG
FT                   DKAFGSANSKIDLTKLSQSQSVFGFHGSSALYYEPISERPVKIDGQKAHWLDSNTIAWE
FT                   AADGADSLKLFYALDNSITINDDKAIVGGQAVELKKDGKLSSALKERFRHLASLPALSI
FT                   DVDASTLRTILKSQIIVVAYNANGDVISSTEVQKPGVLDAVFANEEAGNAMGETLGAIV
FT                   EGSTTTFKLWAPTAQDVELVLYSEDRQSSKVIPMTESLETGIWATDSISNAVNSYYRYQ
FT                   VKVYHPTTGNIETRLVTDPYSLGLSKNSAYSQVIDLDEAALMPQGWAGYKRPTVKKDED
FT                   HVLYESHLRDFSFSDKLGTASLNGKYLALTEADRESVKHLKALKDAGLTTLHILPAFDI
FT                   ATINEDDASRVDITDTVSKLCNVKPTATLCGTEDENKTIEAVLNSYNSSTGDAQALMND
FT                   LRMLDSFNWGYDPFHYTVPEGSYATDPNGSKRILEFRQMVKAAHDMDLKLIMDVVYNHT
FT                   NASGVNDKSVLDKIVPGYYHRLNVNTGGVESSTCCDNTATENLMMGKLMVDSLKVWADD
FT                   YQVDGFRFDLMGHQPKSVMVEALKEVRNIDPNTLFYGEGWDFGEVANNARFEQANQINM
FT                   AGTEIGTFSDRLRDAVRGGSPFDGGVDSEGKHPLRFNQGFGNAAFANEETKVDQDSVNG
FT                   RLHNQDLVRLGMAGNLAEYVLLDYKGDTKLGKNVDYNGAPAGYTKMPSENISYVSKHDN
FT                   QTLWDNNAYKIAEGTSSAERARMQSVSLSTVMLGQGIPFIHMGSELLRSKSMQRDSYDS
FT                   GDWYNRVMFDGTGNNWNVGLPREDKDGANWELIKTIIADSTAKPAKEDIDLTKQQFLEL
FT                   LKIRSSSELFRLDTAEEVMKRVDFRNVGKDQIEGLIVMSIDDGISTGKDLDTTADAIVV
FT                   VINSTSKSQSFKITGATGFTLHTIQQNSADDIVKGATFSAETFTVPPLTTAVFVQTQGA
FT                   SQGAGLSVDNSQKDVSKIPPYGKTTVYVRGAMNGWNPTDAWAMNFVGNGVYSVTGALAV
FT                   GEYGFKFGGSTWGILDIGCHSVDLAKGSINIGSEGDCKLNVTEAGNYTFTLNAIHQLND
FT                   SAEKAVVSVTKQ"
FT   gene            193236..193625
FT                   /locus_tag="VS_II0169"
FT   CDS_pept        193236..193625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0169"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25478"
FT                   /db_xref="GOA:B7VQD9"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25478.1"
FT                   /translation="MLSSSIQIAITYLVLVAVSALFSESSKALLVWYLVIGIVTFFVYA
FT                   KDKRAAINGNWRVPEKTLHIFSVAGGWLGALIAQDKLRHKTQKQPFRLVFFVTVSLNVV
FT                   AFVWTLTPSGQATFGQWLSEIIKLF"
FT   gene            complement(193680..194318)
FT                   /locus_tag="VS_II0170"
FT   CDS_pept        complement(193680..194318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0170"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25480"
FT                   /db_xref="GOA:B7VQE0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25480.1"
FT                   /translation="MKVMTGQSLRSFYCWRITMPLEQLSALALFAFVSTFTPGPNNIML
FT                   MTSGANVGFARTIPHMLGIALGFAAMLLLVGFGLMGVFNAYPVSHQILKYLSLAYLVYL
FT                   AIKIALSGKAKSTKAFKPMTFIAAASFQWVNPKGWSMALTAISVYSSGSSWWELAIIAS
FT                   IFTLANLPSVTFWTAAGKQLQHWLTTPVRIKSFNYGMAGLLLASTIPMI"
FT   gene            194406..194846
FT                   /locus_tag="VS_II0171"
FT   CDS_pept        194406..194846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0171"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25482"
FT                   /db_xref="GOA:B7VQE1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25482.1"
FT                   /translation="MDRFDERILQELKLDGRISNIELSERIGLSASATLRRVQDLERKG
FT                   IIQGYRAVLDNGLMGVGFIAYVSIGLSSHSKAAQLEFEQHVSMEKEVVECHNITGANEY
FT                   LLRVETKDLPGYKKFHADVLGECAQVQSITTMVVMDTPKDER"
FT   gene            194873..195802
FT                   /locus_tag="VS_II0172"
FT   CDS_pept        194873..195802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0172"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25484"
FT                   /db_xref="GOA:B7VQE2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25484.1"
FT                   /translation="MPNTNQLLLFLDVVQQGSFTKAATLHDMDNSSLSKQIKKLEQDLG
FT                   VQLLNRSTRSFSLTSAGEDILAQTYVLKDTINQIQGIADSYQSEPKGVLRITSPIYFGQ
FT                   QYLQPIITQFMRKYPDVQIVLSLDDKIANIIAGQFDIAFRFSKLVESNLIAKKIADSNF
FT                   MLVASNDFVKEHGEPKTPQDLLSLPAVIYTNGDMTVDHLRISEEPHGNIFQSLTIRGNY
FT                   KVSDVRTMVSCVKDGLGYGFLDQSNLYASMKELGLVTLLPDYAISTVDTAIYAVYPHRK
FT                   QTKLVKEFITTVQDYIGSPTIWEKMQQG"
FT   gene            195778..195846
FT                   /locus_tag="VS_II0173"
FT   CDS_pept        195778..195846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25486"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25486.1"
FT                   /translation="MGKDAARLVGKSRHKLIDKIDK"
FT   gene            196083..197327
FT                   /locus_tag="VS_II0174"
FT   CDS_pept        196083..197327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0174"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25487"
FT                   /db_xref="GOA:B7VQE4"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25487.1"
FT                   /translation="MSTMGIAIGATALSLILIAVWLVSLSLRKKRLEQERKARAVAYRK
FT                   AIEKARIQEQKDRQFKAETGHVPSILYLAKEAERVNLKEALYWYDKAAHLDNVNGMYGI
FT                   VRLSMKCKEDLILREKANFWQLAISALDNDPLAKFEVGKALVFGRGVEKNLPKGSAYIE
FT                   ESAVSGNTEAMLFMGDWCLDRENPDYSPESSFMWYRKAAEKNSLDGKIKLGMSYLNGVG
FT                   VVANHREAVYWFETAAEKNCAEAMFKAGEAWIDHGEHGNAIAYIWLFLSAHFGYADARY
FT                   LRDKVGGDLGVDAVVGLQALTKPIMTKLTQEAITKHSIVKALNKLYKRDIPVHKKVKEA
FT                   SDEEGDELGVDKADLDTEASSAQGLNGNNHQQAAENHDGDKASVNRASQDKQANSNSGS
FT                   LDFSQPAVESNWKSN"
FT   gene            complement(197624..198841)
FT                   /locus_tag="VS_II0175"
FT   CDS_pept        complement(197624..198841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0175"
FT                   /product="Inner membrane sodium/carboxyalte symporter"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25489"
FT                   /db_xref="GOA:B7VQE5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25489.1"
FT                   /translation="MQNHNMLARIARGNLVLQILAGIVFGVVLAMVSPSAAQDAGLLGS
FT                   LFVGALKAVAPILVFILVAASIANQKKGQHTHMRPIIVLYLIGTFSAALTAVVLSFMFP
FT                   TTLTLVAGAEGANPPQGIAEVLHTLLFKLVDNPVSALMNANYIGILAWAIGLGLALHHA
FT                   SATTKAVFEDLSHSVSHIVRFIIRLAPFGIFGLVSATFATTGFDALASYGQLLAVLLSS
FT                   MLIIALVVNPLLVFIKTKQNPYPLVLQCIRESGVTAFFTRSSAANIPVNMNLCKKLKLD
FT                   EDTYSVSIPLGATINMAGAAITITVLTLAAVHTMGIEIDIFTAILLSLVAAVSACGASG
FT                   VAGGSLLLIPLACGLFGISNDVAMQVVAVGFIIGVIQDSAETALNSSTDVVFTAAVCKA
FT                   EQNKEQ"
FT   gene            complement(199011..199193)
FT                   /locus_tag="VS_II0176"
FT   CDS_pept        complement(199011..199193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25491"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25491.1"
FT                   /translation="MSPIVLITWGFLFQFDNGVVIYAHNVLSYSRLHFYICSVLNLSNE
FT                   NQQIYSSIKIHLFNI"
FT   gene            complement(199283..200347)
FT                   /locus_tag="VS_II0177"
FT   CDS_pept        complement(199283..200347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0177"
FT                   /product="putative GTPase (eng C)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25493"
FT                   /db_xref="GOA:B7VQE7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25493.1"
FT                   /translation="MNSQNAFSHPMSLQQLGWQPVFQQQLTLEDYDQSVIARITAHHRS
FT                   GYTLASEQGEIVLPIHQNQPAMTVGDWVILNSELQFGRLLDRQSLFSRKAAGSRVAEQY
FT                   ISANIDTVFIVVSLNNDFNLSRIERYLALANEAQVEAVIVLTKKDLCDDYEDKVQQVQS
FT                   LDSMLMIEAVNSLDQDSTQVLSPWCKTGKTVALMGSSGVGKSTLVNSLLGEAEQATGGI
FT                   REDDSKGRHTTTSRSLHLLTSGGLLLDTPGMRELQLADCAEGVSETFSDVEELAMHCRF
FT                   SDCHHESEPGCKIRKAIESGELSERRFANYRKLLREQARNGASLAEQRASNKQLSKMYK
FT                   TVQSEGRNLKKASD"
FT   gene            complement(200868..201326)
FT                   /locus_tag="VS_II0178"
FT   CDS_pept        complement(200868..201326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0178"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25494"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25494.1"
FT                   /translation="MKLKALALAGLLLTPLAQANNDIMVHDAYARATPPSAVNSAVFTT
FT                   LMNHSDKDRAIVSATTPAAGKVELHDVIVDGDVMKMRQVQAITIPANGKAVLKPGSLHI
FT                   MLFDLKSSLKEGEQIKMTLTFANGETQTFDAPVKKVMSGMKKMNHDHH"
FT   gene            complement(201441..202037)
FT                   /locus_tag="VS_II0179"
FT   CDS_pept        complement(201441..202037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0179"
FT                   /product="putative Sco1-related protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25496"
FT                   /db_xref="GOA:B7VQE9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25496.1"
FT                   /translation="MSRNWSLALVVAFVLGFGVKSYLDGQNEAQKQHAAKQQFSATTLF
FT                   GKDNQPTEIFDQTDDRIRIVYFGFTRCPDVCPTSLAMLAGALNQISDEAKAKIRPMFVS
FT                   LDPERDAAEASYEYAQYFHPMMEGLSGPLDVTTTLAHNYGVIFRKTKLEGSELEYTLDH
FT                   SSYFYFLKPDGTLITKVPHTLTPAPIVEAINTLTR"
FT   gene            complement(202034..202474)
FT                   /locus_tag="VS_II0180"
FT   CDS_pept        complement(202034..202474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0180"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25498"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25498.1"
FT                   /translation="MHSALKVAALGIALVAGFYGPQAIQQFESAMERASAEVNLDDYCM
FT                   LSTTSCEQNTVTMTLDRETAQPLAPTKIKVVWEGAASDTLMLSLTGLEMEMGSARFQLK
FT                   NIGNNTYEGDVILPVCTLDKMTWIGELTDGVDTVNPAIRMAR"
FT   gene            complement(202677..203636)
FT                   /locus_tag="VS_II0181"
FT   CDS_pept        complement(202677..203636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0181"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25500"
FT                   /db_xref="GOA:B7VQF1"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25500.1"
FT                   /translation="MYTAQNHPQLYEAMNYLSTFFKGMAMGAADVVPGVSGGTIAFITG
FT                   IYDTLLESIRRINPSVLGLWKREGFKAAFSHINGFFLISLFAGVFTSIATFAKLISWLL
FT                   VTHPVPLWSFFFGLILVSVFHILKQVEKRDMIRFVFLLLGVAFAYSITVLKPLQMEPTS
FT                   INILIAGAIAICAMILPGISGSFILLLIGMYGPVLGAVKEFQVDVLALFLSGCVIGLLT
FT                   FSHVLSWLLRSFRDFTLVFLTGLMIGTLPKIWPWKETISWRTNSKGEQVPLIQENLSPF
FT                   DFEAVTSQPSQLVMAIVMMLVAIALVLGLEKFAERNAD"
FT   gene            203925..204035
FT                   /locus_tag="VS_IIm0182"
FT   ncRNA           203925..204035
FT                   /locus_tag="VS_IIm0182"
FT                   /product="Qrr"
FT                   /note="regulation of quorum sensing in Vibrio spp. bound by
FT                   Hfq"
FT                   /inference="profile:Rfam:8.1"
FT                   /ncRNA_class="other"
FT   gene            complement(204183..206906)
FT                   /locus_tag="VS_II0183"
FT   CDS_pept        complement(204183..206906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0183"
FT                   /product="HTH-type transcriptional regulator malT
FT                   (ATP-dependent transcriptional activator malT)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25502"
FT                   /db_xref="GOA:B7VQF2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25502.1"
FT                   /translation="MKNFDMWIPSKLTRPGRLHNAILRPRVLDLLQNADCYKLVLFRSP
FT                   AGYGKTTMAAQWLLDKPNVGWYSIDDSDNDAFRFINYLLQSLNKATQNACPNAQKLAEK
FT                   RQFSSLHSLLSEVFAEMSDYHHECFLVLDDYHLVNNDDIQEAMRFFLKHMPDNLTLVVT
FT                   SRGTPPLGTANLRVRDLMIELGNDSLAFDTEETTRFFNQRVADGIDDTTADSICTYVEG
FT                   WPSALQLIALQAQHQKRTLAQSAESFSHFNQAHLWDYLVEEVFDLLDKETRQFLMQCSV
FT                   LDHFNDELVCALTQREDALGMIESLNRFGLFIYPLEGEKNWYRFHNLFGEFLAHERQAR
FT                   IPQQEAELHRSAAKAWIKQDTPHQALRHAQRAEDPELIIQILTDHGWPMFNQGELSSLE
FT                   MAIKQLTKDQLYSDPKLSMLRAWLAQSQHRYEQVGTLLEEAETQYQARNIELDTQQQGQ
FT                   YNALRAQVAINSNEPEKALELAELSLSQLNTTVYRSRIVATSVVGEVNHVMGNLSRALP
FT                   MMQQTEKLARQYQVYHQALWAILQQSEILIAQGYVQAAFELQDSAFKLIEEHQLKYVPL
FT                   HEFLLRVRAQIFWCWNRLDEAEECCYKGLDILGHHSPSKHLHSYSMLARISLSRGEIDK
FT                   ASKFIDQIQHLLRQSTYHVDWTANASLSLILFWQVKGNKEAIRDWLNVAVRPESASNHF
FT                   CQLQWRNIVRAHIILEQYEEAEEALTFLKSEAQRSHLITDTNRNLIVEAVLRTQINDED
FT                   SARVLLEEALHMTNQTGMVGNFLVDGGTIGHILDKLSNKPGLGDLERHRAQQIMKDIST
FT                   TQRSRSVHFDEDFVENLVNHPNIPELVRTSPLTQREWQVLGLIYSGFSNEQIAQELDVA
FT                   GTTIKTHIRNLYQKLNIANRKEAISTAENLLQLMGY"
FT   gene            207458..209911
FT                   /locus_tag="VS_II0184"
FT   CDS_pept        207458..209911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0184"
FT                   /product="Maltodextrin phosphorylase"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25504"
FT                   /db_xref="GOA:B7VQF3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25504.1"
FT                   /translation="MKPTQQKTFDKVSFQESVKKHLSATYATTIENADSRAWYLAMGRA
FT                   LAELTTFDLLETENDEKIKNAKSVNYLSLEFLIGRLTGNNLISMGLYEQITHAMEELGQ
FT                   NLTDLLEEERDPSLGNGGLGRLAACFMDSCAAQEYPTVGYGLHYEYGLFKQSFQDGRQQ
FT                   EAPDAWRGVEGYPWEVARPELAQHIGFYGHVEVEFIDGKEVRTWVPGMEVKAMPWDLPI
FT                   VGYESNTVYPLRLWECQAIAPFSLASFNNGDYFEAQHSLIDAGNITKVLYPNDNHEKGK
FT                   TLRLMQQYFHSAASVRDILRRHEAAGFSLEDLPKQETIQLNDTHPTIAIPELMRILIDE
FT                   KGLSWDQAWEISAHTFAYTNHTLLPEALETWSESLINRLLPRHMEIIFEINHRFMQEVR
FT                   KMWPGDGEKQAKLSIIQEGFHRMVRMANLCVIGSYKVNGVAALHSQLVKKDLFPEFNEI
FT                   FPGKLTNVTNGITPRRWLKFCNPGLSNLITGKIGSEWPAKLEQLEGIAKFATDAKFQKE
FT                   FMAVKKENKQRLADWVQENMGIELDTNAIFDVQIKRLHEYKRQHLDLLHILSLYHRILN
FT                   EPGFECEPRVCFFAAKAAPGYHLAKEIIFAVNKIAEKINNDPRIGNKLKVVFIPDYRVS
FT                   MAEIIIPAADVSQQISLAGKEASGTGNMKMALNGALTIGTMDGANVEIREEVGDENIYI
FT                   FGLEVDGVVALKAQGYNPYDYYNADPLLKASLDLLTGDEFTPGQPGLLRATFDSLLDGG
FT                   DPYLCLADFASYVKAHEDMGTQYKDQAGWAKKAILNTALVGKFTSDRSIRDYVNNIWKL
FT                   EAVNR"
FT   gene            210088..212268
FT                   /locus_tag="VS_II0185"
FT   CDS_pept        210088..212268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0185"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25506"
FT                   /db_xref="GOA:B7VQF4"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25506.1"
FT                   /translation="MKEQTVLKQVAEMANIADSYVSAWGDEAQVSEETITSLLASLGYD
FT                   TSSDDALLKSAERKHRKDVLDPVLVLRDGEPVEVTLNLGVSARESEFSWRLETEQGEVL
FT                   EGYLQSQVVRDERAEGGPLVFALPSDLAWGYHKLIVSRKRRKKPYEMTLIITPKACFKQ
FT                   SPIEQGKKLWGPSVQLYTLRTQHNWGIGDFGDLKQLVSDIASRGGDFVGLNPIHSLFPA
FT                   NPEGASPYSPSSRRWLNVLYIDVSSVPEFALSAEAQQTVGSAEFQQRLQKAREAHWVNY
FT                   TEVSELKMSILPLLFAEFKTRHLDKNSDRAQAFLAFVEEGGESLMHQAAFDALHGELHA
FT                   EDSGMWGWPVFPEKFRTFESPATQKYIKDNLDQVHLYMYLQWLADCQINDAQSLAEEKG
FT                   MVVGLYRDLAVGVADSGSETWADEGNLVMDASIGAPPDILGPLGQNWGLPPLNPEVLQE
FT                   TGYDAYIKLLRANMKHCGALRIDHVLGLLRLWWIPKGENATKGAYIYYPVQDMLSILAL
FT                   ESHRYQCSVIGEDLGTVPDEIVDILADAGVHSYKVFFFETSENDGGFISPKHYASQSMA
FT                   ALCTHDMPTLRGFWHCDDLKMGQEIGLYPDAQQLETLFDNRLECKQGILDSVAWHGFLP
FT                   EGVGRDASQVPMDSYLAEALQLHVAAGGSTLLSVQLEDWLEMDKPVNIPGTVDEYPNWR
FT                   RKLSMNLDEIFAHEGVNRIASKLTDVREKAAK"
FT   gene            212444..214624
FT                   /locus_tag="VS_II0186"
FT   CDS_pept        212444..214624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0186"
FT                   /product="1;4-alpha-glucan branching enzyme"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25508"
FT                   /db_xref="GOA:B7VQF5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25508.1"
FT                   /translation="MELSSISKQKQIYTQLSQACFTDPFAFLGPYLPSEHGSLRVWIPG
FT                   ADKVELIVGKEPRIKLAREGESGFILKQERDLRFTHYKLAVDWNGVEQIIDDPYQYHDL
FT                   YASYEDLHTPKDMYHHMGAQFITLERDGQTISGTRFLVYAPHATAASLVGNFNAWDGRR
FT                   HPMQRLDYGMWGLFIPDLEEGAQYKFELKGPDGEGLPHKADPWGFYSEQYPSFSSVTYD
FT                   HARYQWQDSQWQNRPVTQKRKEALSFYELHTGSWKRNAEGEFLNYRELAAELIPYLTDL
FT                   GYTHVELMPVSEHPFYGSWGYQPIGLFAPTSRFGSPDDFKFFVDQCHQAGLGVVLDWVP
FT                   AHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSYIYDLGKEHVRRFLVANALYWFEQF
FT                   HIDGIRVDAVASMLYLDYSRSHDQWIPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTI
FT                   AEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIQEDPINRKYHHDTITFPLVYAH
FT                   SENYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLRAYMGYMYAQPGKKLNFMGAEFGQ
FT                   TAEWNHDDQLQWFLLEYERHQGVQRLTKDLNNLYRSEAAMHDLDFDPKGFEWRLQDSAE
FT                   ASILAHERISESGERVLVVSNFTPVPHERFRLGVPAQGQYSLLLNTDSADYAGSGFEVK
FT                   QVAEVESIASEGLDTSIELRLPPLSTVFYKLN"
FT   gene            complement(214777..215616)
FT                   /locus_tag="VS_II0187"
FT   CDS_pept        complement(214777..215616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0187"
FT                   /product="ABC transporter: Transmembrane protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25509"
FT                   /db_xref="GOA:B7VQF6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25509.1"
FT                   /translation="MNASKVKFGINYIDTKSPLHALNGITKFVLFLAWVTVVLTTFDLR
FT                   LIALLIVTGLFLLKLTNVPVRVYKPLLLGTVSVLSLNALFMYLLAPQQGTELIGSETLL
FT                   LTLPGNYSLSQETLFYLITVTLKYMSMFPIALIFVFTTHPTEFAASLNRIGVPYKIAYA
FT                   VSLTLRYLPEVKKDFINIMHAQQARGVELSKKAPLLTRIKNVAKVLGPLIFSSLDRADE
FT                   ISNAMTLRGFGRHKSRTWYSYAPLKRIDYVWLMVIAFIVVLAIVKRVLEPQLFWYPF"
FT   gene            complement(215613..217307)
FT                   /locus_tag="VS_II0188"
FT   CDS_pept        complement(215613..217307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0188"
FT                   /product="ABC transporter: two domain ATP-binding protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25511"
FT                   /db_xref="GOA:B7VQF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25511.1"
FT                   /translation="MTIAFSNFSFRYESLDKPTLKNINLRIEKGEKIVIIGPSGSGKST
FT                   LGQCLNGLIPHAIKGEVSGSLEINGKNVSEFSMHDYTEQVGTVLQDTDSQFVGLSIGED
FT                   IAFALENQLMSNIDMYPLVKSTAKMVDLADMLERSPHDLSGGQKQRVSLAGILVDDVDI
FT                   LLFDEPLASLDPKTGKVTIEIIDQLHKETNKTIVIIEHRLEDVLHRDIDRVILMERGEI
FT                   VADMTPDDILASKLLETHGIREPLYLSALKAAKAPLTNEDKLSNLKALDYKRFRPAVQA
FT                   WFAERPAPVAEKQYQPLLEVHGLTYSYDGEKNALEDVSFKIGKGEFVSILGKNGSGKST
FT                   ITKLIMGVIDADSGSSYLNGQDLSELSIFERSQKVGVVMQNPNHMISHHMIFDEIAFGL
FT                   RNRGMAEQLVTEKVENVLELCGLSKFRHWPIEALSYGQKKRVTIASILVLEPELLILDE
FT                   PTAGQDYRNYTSMLAFIQKLNRDLGITVVIISHDMHLVLEYTTRSIVIADSKLIANAAM
FT                   TEVFSQPSLLERANLCTTSIYELATMMKIDDTNAFMQYFIDDERSSL"
FT   gene            complement(217314..217985)
FT                   /locus_tag="VS_II0189"
FT   CDS_pept        complement(217314..217985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0189"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25513"
FT                   /db_xref="GOA:B7VQF8"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25513.1"
FT                   /translation="MEGFYCIMRALFFIFAQKTFSLRRILIMANIMLYFQYSRLSMNFS
FT                   AKTVVVIAIGAALYGIGGLPMFGVPVFANTTLKPAMAVLALFSVLFGPIVGFLVGFIGH
FT                   WVTDLFAGWGVWLTWVLGSGIVGMVIGLFPMMTKNRLQQGELPMKDFALFVVLALAGNV
FT                   VGYGSSAFLDTILYAEPFTKVFTQLSIIAAGNTILIAVVGFLILKSVAKRNKQSRNLTE
FT                   A"
FT   gene            complement(218171..219301)
FT                   /locus_tag="VS_II0190"
FT   CDS_pept        complement(218171..219301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0190"
FT                   /product="putative multidrug resistance efflux pump"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25515"
FT                   /db_xref="GOA:B7VQF9"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25515.1"
FT                   /translation="MDLLLIMTYAALCITIFKVFKIPLNKWTVPTAVLGGVVLIGTLIL
FT                   LMNYNHPFTQIGNQVYSTTPIVSGVRGKVIEVPVEANKPLKQGDILFKIDPIPFEAEVA
FT                   KLQAKVKEASQGALGLESQVGEAEAAKIKAIAERDKAQREFSRYKRGFESGAFTEQQLD
FT                   TRRQAYKATEAAVKVAEANQQQAQIALNSEIGGENTAVAGLLADLRKAEFNLDQTVVRA
FT                   PTDGYVTQLALRPGVMAVPLPLAPVMTFVHTEAQFYTAAFRQNSLQRLQPGYEAEFLFR
FT                   ALPGKVFKGRIDEVIPAIGESQFQARGTLLGTDALRTSGRVFVKLTITDDLSEYHLPMG
FT                   TAVEVAVYSDSFTHVSIMRKVLIRMKSWQNYLYLDH"
FT   gene            complement(219301..219696)
FT                   /locus_tag="VS_II0191"
FT   CDS_pept        complement(219301..219696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0191"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25517"
FT                   /db_xref="GOA:B7VQG0"
FT                   /db_xref="InterPro:IPR011223"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25517.1"
FT                   /translation="MFLDYFALGLLIFVALVIFYGIIVIHDIPYEIAKERNHPHQDAIH
FT                   VSGWVSLFTLHTIWPFLWIWATLWRKDRGWGFAKLEEEQHDIHHRVDTLIDQVSALQNE
FT                   IAQLKQAGTEQNSTEKQTNNVQDQEAK"
FT   gene            219953..220867
FT                   /locus_tag="VS_II0192"
FT   CDS_pept        219953..220867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0192"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25519"
FT                   /db_xref="GOA:B7VQG1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25519.1"
FT                   /translation="MRMYIGELAAIGAAMVWACATWIYGQFGHRFSAMQLNIVKGVVAS
FT                   GMMLLVMPLIPMPEFELSANHFGILAISGVIGIAVGDSAYFAALKRIGANKTLLLESLA
FT                   PPLSGVLALMFLGAALTLQSWLGVVITTLAVTFVVFQPSKSANGNDISNDKAQWGGIGY
FT                   GLMASVCQASGVVISHYALVAGDIPPLLGALIRLTIGVFAVMLIIPFVEKKPYSSIKRD
FT                   LWAMTKLDKLWLLGAIFVGTFLALWLQQVALKNANPAIAQTLIATSPVFILVIYAIRGE
FT                   KVSKQSIIGTLAALGGISLFFYQ"
FT   gene            complement(220939..222522)
FT                   /locus_tag="VS_II0193"
FT   CDS_pept        complement(220939..222522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0193"
FT                   /product="GGDEF family protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25521"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25521.1"
FT                   /translation="MMETLLSKITDAGLDPSSVSGEEAIIFWNHIRQHVSTTQTEQAHC
FT                   YIISSEYRAELQQNQTSIDELKLALDLLHLPTDIEDILTVKTSLSNRLVEIGDYTSALN
FT                   EFVSSSTIAVEHGHIDEYVMAILGMGNLCDAYGDHSRALRYYQKINSIDHAISSRSLRL
FT                   KFKLYMVASLLLLNRITAASDLLNECEELSILVSDKLLTAQILLYQAKVLRAKKKHHEA
FT                   LRCLSKIQYPANSTQASWLATMTRLELAHCLSATGKQDYASMILSSTHKRVKPDSSPVL
FT                   AKRFYDSLSDVCLNQGRFEEALSYEKKGYRIETDLMKQIPISELGASQLRRLSRFELQL
FT                   KLILSEQENKELKETTEQHKNTVAQLQQDVFTDPLTGLHNRRWLDVKLKDLLLHETPFA
FT                   LMVIDIDHFKSINDELSHLVGDKAIVSVSQELRSYFKFRGASCVRFGGEEFLVILENTD
FT                   LAKAEMHSENYRERIFQFGWHEILGERGLTVSIGITLHRDGENTQRTFYRADKALYRAK
FT                   ANGRNQVCTE"
FT   gene            complement(222519..223988)
FT                   /locus_tag="VS_II0194"
FT   CDS_pept        complement(222519..223988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0194"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25523"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25523.1"
FT                   /translation="MDKNQYLLETELEQLKTRVDSEPLVILEIAQQCLVRSEQVLFEEG
FT                   AIQSFMLMARCCWNLMDYQKGLKYIKEAYKRQSRLDTDHFLPEILHLHALQFWGQAKYY
FT                   SAQQFWINALEQSALVDEVEIQIECLIGLGNIWRMTHEYKLARSTHQLAVKVANNSRIG
FT                   WLEGKARILLAWDYYLLNNYVEMLSVLDGAEEALKEYKDNTWHAEVWDFRGLALLGLER
FT                   LDDAERATAKAHKLAVEHNLVWMKAHSYISRARLELLRKRPEQAAELLRLAEESANEFD
FT                   NGELLSQICYQQSLVAEENQDFEAALIAFKKYRQYSTGMLKEQTNRVGLDKARSSKRQL
FT                   EQRARKLINRIRGQHEHDPEKHLSYVVSETFWWEKLVLFKTELKRSNHCIIMFHHIDTD
FT                   YLDVCTEVAHTLCNQNDFIARLSSERVALMLSEKDEAADQIFKTLTTMLDIYPWHRKGL
FT                   KGSRPTVSLNDILTFPFTLEQLEEDDAEVTE"
FT   gene            complement(223952..224140)
FT                   /locus_tag="VS_II0195"
FT   CDS_pept        complement(223952..224140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25524"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25524.1"
FT                   /translation="MISKQKHEITPKIGKDTCPLYAQREIIDAYPQSHSYNDCVINMFD
FT                   NYGSKPWTKISTFLKPN"
FT   gene            complement(224175..225707)
FT                   /locus_tag="VS_II0196"
FT   CDS_pept        complement(224175..225707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0196"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25526"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25526.1"
FT                   /translation="MKSVTPQPSSLGCSNNPEGEIVSNDKLPKDADGLQLNFCKTLACD
FT                   NFGLSDAKRYVLQHANPKRPAMVCRECGAFPPLLNNREVLSELHRLRQLHSDGLPACRN
FT                   DDCDNFGLSVHTHKHLYHAFGYSGDRQRYRCKDCQSTFVDKWSGSNKKLQFQENLMGLL
FT                   FMGYSVREICRKLEINPKTFYDHVDHIASRCRRKLAMIDARWVNHAKDYEFASHYQRLQ
FT                   PKSNNGVVWIATGEAHSGYILCQHVNYSQNEEPSGSADHNPYDDVARFVSKEHSSEANL
FT                   ELPQPSDKLKERIEQQYQVILARGNVEDPMGNLTTFSYPSKGALIRPPYTSYAHFLHVL
FT                   DMCDENKHVTIYMPQDPLLRSAALSVCLPRIQSQNVDLMYVEEDSGWQDDQNFEKIDIV
FT                   HMSWWRDRWAIASQGDSQKGICYLTGNNPEPKQWLNTASIQQTKFYQQRFQLLFDSFIN
FT                   EPRRKLRPGGILPLLDIFRSWHNLCYQDKQGLTAAQRLGVTEQPLTLKQLLS"
FT   gene            complement(225725..226435)
FT                   /locus_tag="VS_II0197"
FT   CDS_pept        complement(225725..226435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0197"
FT                   /product="Purine nucleoside phosphorylase"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25528"
FT                   /db_xref="GOA:B7VQG6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25528.1"
FT                   /translation="MATPHINAQAGDFAETVLMPGDPLRAKYIAETFLDDVKQVCDVRN
FT                   MFGYTGTYKGKKVSVMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVKLMDV
FT                   VIGMGASTDSKVNRIRFNNHDFAAIADFGLLEEAVNQARAQEVPVKVGNVFSADLFYTP
FT                   EADLFEKMEKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEDRQKSF
FT                   NDMMKVALETAINI"
FT   gene            226854..227756
FT                   /locus_tag="VS_II0198"
FT   CDS_pept        226854..227756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0198"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25529"
FT                   /db_xref="GOA:B7VQG7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041597"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25529.1"
FT                   /translation="MRVTLFVAAMASSCVSAATFVLPPAESRIVGRIQQHEVAAGETLA
FT                   IIAKQYDIGFLSLMAANKGVDPFLPAEGYVLSIPSRLILPDTPRKGIVINLAELRLYFF
FT                   EPEKNQVHVFPVGIGRVGRDTPEMITKISQKRPNPTWTPPNSIRKEYLEKGIELPKVVP
FT                   AGPENPLGEYALRLAYGAGDYLIHGTNKDFGIGLRVSSGCIRMEPKDIEWLFEQVSRGE
FT                   QVTIIDEPIKVSLEPDRSVFVEAHEPLTRSDGSKKLLQIPVELKWWLEDADLPNSKAKA
FT                   VIFAQNGVPVEIAPPVIEF"
FT   gene            complement(227951..228283)
FT                   /locus_tag="VS_II0199"
FT   CDS_pept        complement(227951..228283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0199"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25531"
FT                   /db_xref="GOA:B7VQG8"
FT                   /db_xref="InterPro:IPR006817"
FT                   /db_xref="InterPro:IPR016367"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25531.1"
FT                   /translation="MKRLYDKECIAHLLMINKQGVLMNKTLIAAAASVFILAGCSSEPE
FT                   EAAMSQMDQLTNQVAELTSEVEALKGDKAAAEMKAQEAAAAAMAAKEEADRANDRIDNI
FT                   AESYTK"
FT   gene            228566..229909
FT                   /locus_tag="VS_II0200"
FT   CDS_pept        228566..229909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0200"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   2461520; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25533"
FT                   /db_xref="GOA:B7VQG9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25533.1"
FT                   /translation="MESPLHFKDLGLDNRLLKNLKHYDFKKATEIQSKAIPVAIAGKDL
FT                   LASSKTGSGKTLAFVLPMIHKALKTKAFSAKDPRGVILAPTRELAKQVYGELRSMLGGL
FT                   SYEATLILGGENFNDQVKALRKYPRFIVATPGRLADHLEHRSLFLDGVETLILDEADRM
FT                   LDLGFAPELRRIANAAKHRRRQTLMFSATLDHAEVNDIANEMLDSPKRISVGVSNEQHL
FT                   DITQKFYLCDHLDHKEAILDRVIEEAEYRQVMIFTATRADTDRLTEKLNEKKLKAVALS
FT                   GNLNQTQRNAIMSQFERAVYKILVTTDVASRGIDIPNVSHVINFDMPKHTEEYVHRVGR
FT                   TGRAGNKGDAISLVGPKDWDSFKRVELYLQQDLTFSVLEGLKGKFKGIKPRKPAFAKGG
FT                   PAKKKTNTQAKKTPKKPVKRDKSFHKNVAVGDTVFIPKKKVAPKTDDE"
FT   gene            complement(230062..231345)
FT                   /locus_tag="VS_II0201"
FT   CDS_pept        complement(230062..231345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0201"
FT                   /product="Thermolabile hemolysin precursor
FT                   (TL)-(Lecithin-dependent hemolysin) (LDH)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   1791426, 3508495; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25535"
FT                   /db_xref="GOA:B7VQH0"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25535.1"
FT                   /translation="MFGSLNIKENTMMKNTAFILALTLPFGAYAAEDSIPTPESITSAQ
FT                   VLSTQGSETYSYVRCWYRTDASHDSPATDWKWAKKENGDYYTINGYWWSSVSFKNMFYS
FT                   DAPQSEIKQRCEQTLDIQHDAADITYFAADNRFSYNHSIWTNDNVVQANTINRIVTFGD
FT                   SLSDTGNLFNGSQWVFPNANSWFLGHFSNGLVWTEYLAKAKDVPLYNWAVGGAAGTNQY
FT                   VALTGVYDQVTSYLTYMKIAKNYRPESSLFTLEFGLNDFMNYNREVADVKADFSSALIR
FT                   LTESGANNILLFTLPDATKAPQFKYSTEQEIIKVRGKILEFNQFIKTQAKYYQSMGKNV
FT                   VLFDASALFASITDNPEQHGFRNASDACLNINRSSAADYLKSHSLTNDCAAYGSDSYVF
FT                   WGVTHPTTATHKYIADHILAYSFSTFDF"
FT   gene            231825..232766
FT                   /locus_tag="VS_II0202"
FT   CDS_pept        231825..232766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0202"
FT                   /product="Lipase precursor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   2162464; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25536"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25536.1"
FT                   /translation="MKKILIWTIACLSSFGVYAGTSASALETSGYTATKYPIMLVHGLF
FT                   GFDTLAGVDYFYGVPESLTKDGASVYVAQVSATNSSEVRGEQLLAQVETLLAATGASKV
FT                   NLVGHSHGGPTARYVASVRPDLVASVTSIGGVHKGSKVADLVRGTVSEGSVSEGIAVKL
FT                   AGGLTALINLLSGGTDLDQDGLASLEALTTEGSLAFNQFYPEGVPTSECGDGEWQANNG
FT                   VYYYSWTGSSTFTNLLDPTDGAMTILGLAFNEPNDGLVGACSAHLGKVIGDDYKMNHLD
FT                   EINGLLGIHHLFETDPVTLYRQHANRLKLAGL"
FT   gene            232806..233699
FT                   /locus_tag="VS_II0203"
FT   CDS_pept        232806..233699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0203"
FT                   /product="Lipase chaperone"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1512563; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25538"
FT                   /db_xref="GOA:B7VQH2"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25538.1"
FT                   /translation="MKKIAILSITTIALMSTAAVFLYLKKEDTSSYNNSEQSASSLKVS
FT                   SQQDTEIDSASAKDMMEYFVSGNTELTLEDIRDNVAKHHEQSQATIVDEALFAKYLEYK
FT                   AALTALDVQFDNTSISAEDLRALNQALLDLQAQFFSESEISILFTHDNRMREIALEKLL
FT                   LKQEGLDESEYQQRLESYLSEQPDYVQASHQNQVSLQQLSSSKGLDEQGLYLKRNELVG
FT                   EEATQRLEALDQQRADFDGALDIYFVERNDILNDSALSEIEQKETIAQLRETHFQPQQL
FT                   RRVEAIERIRAAESDQ"
FT   gene            complement(233889..235571)
FT                   /locus_tag="VS_II0204"
FT   CDS_pept        complement(233889..235571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0204"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25540"
FT                   /db_xref="GOA:B7VQH3"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25540.1"
FT                   /translation="MHRLIYLFIEGQFMRQLLSGLSIKIQILIPVLFSVVLLLTGVIIG
FT                   GDKLENAFKDVSTATDQLILHKEELSEIVDNSYGMRIKAIYSLFNPDDVNTLVETLNQK
FT                   RDQNSRLLSSLDTVPGMQDEVAAMSKAMDHYVSFSRNTMLPLLKAKHGNSVLTSDFDTR
FT                   YQTAIDQYRHAGNEMVKAIDTLSKKLNLLATQQVHTNGQQHTSTLNTATIGLLVILSIA
FT                   LVISWTLAGIIVKPINNIQATMREVAKGNLLVKAEEHGDNEISRLAQDVNKSVEQLRDT
FT                   VSSLSRISIEVASASTELAAVMTQSSANSDQEKQEVEQVASAVNQLESTAANVNENAVQ
FT                   ADSASKQADEMATHSMSLFNESNQANEQMAIQLSEAANVVGTLKEHSEKIGNVIEVIQS
FT                   ISEQTNLLALNAAIEAARAGESGRGFAVVADEVRMLAARTQDSTKEIQTIIEGLQVQSG
FT                   NANESMSSSLSMLEHNQTLSGEVSSALSGIANSVTDITEINTQVAAAAEEQSQVTSDIN
FT                   RNISNIYSLVSQNVTGITQAAAASHELSNLAEQQKQQLGFFKV"
FT   gene            235997..236818
FT                   /locus_tag="VS_II0205"
FT   CDS_pept        235997..236818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0205"
FT                   /product="ABC transporter: Substrate-binding protein
FT                   precursor; phosphate uptake"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   8760913; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25542"
FT                   /db_xref="GOA:B7VQH4"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25542.1"
FT                   /translation="MKKTVIGAIALLGALTVTPASAKETISAVGSSSVTPLMEVFSETY
FT                   MKTNSNVFIEVQGPGSSAGVKAAKNGSADLGMSSRNLKDSEKETTLVEEVVARDGIAVV
FT                   VNPKNGLDGLTAEQVTAIYKGEVTNWKDVGGADKPIVAITRDTASGTRGAFEDIMSLKM
FT                   KISGTKVSAISQRAQVANGNGALKTMVASNPYAIGYISLGTVDNSVNALAIDGTEASVD
FT                   NVKNGSYKVARPFLVLYKEGKPSSETQKFLDWMLTDEAQSLVENKGYISVN"
FT   gene            236943..237872
FT                   /locus_tag="VS_II0206"
FT   CDS_pept        236943..237872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0206"
FT                   /product="ABC transporter: Transmembrane protein; phosphate
FT                   uptake"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   8760913; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25544"
FT                   /db_xref="GOA:B7VQH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25544.1"
FT                   /translation="MTIATNSEQLMNSEATQLKRGLRKKKRVDWKERIFHGLFLTSAII
FT                   GIVSLAVIAFFIVRESIPAFQEAGLSGIVLGQNWLPPALYGVATMIVASVVSTLGAVVV
FT                   GVPIGVLTAIFIAEIAPKRLADIIRPAVELLAGIPSVVYGFFGLVIIVPLIQNVFQVPA
FT                   GNTILAGIIVLGVMILPTVITVSETSIRAVPRTYKEGSLALGASKIFTIFKLLVPAARS
FT                   GIMTGVILGIGRALGETMAIIMVMGNAPAMPEGILDSARTLTANIAIEMSYASGIHASA
FT                   LYATGVVLLVFIMSLNAILLYLNREKAR"
FT   gene            237937..238800
FT                   /locus_tag="VS_II0207"
FT   CDS_pept        237937..238800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0207"
FT                   /product="ABC transporter: Transmembrane protein; phosphate
FT                   uptake"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   8760913; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25546"
FT                   /db_xref="GOA:B7VQH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25546.1"
FT                   /translation="MNKIALKKARARKDAVLSGFIWAAAALTVGFLFWIMWYILSNGLQ
FT                   HVDWNFITDDYTRTGDEHGIFPMIISTIYMVIASIAVAAPLGIMTAIYLTEYAKVGSRL
FT                   VKIIRFCTESLAGIPSIIFGLFGMTFFVAILGLGFSILSGALTLSILILPVIIRTTEEA
FT                   LMAVSQTYREGSYGLGASKIYTIWRLILPSAMPGIITSVILSIGRVIGESAPVFLTAGM
FT                   VARIPDSLLDSGRTLTVHLYKLTTELFTIEEWNQAYGTATVLIVLVLLINTLTKLIARR
FT                   FNTATY"
FT   gene            238876..239625
FT                   /locus_tag="VS_II0208"
FT   CDS_pept        238876..239625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0208"
FT                   /product="ABC transporter: ATP-binding protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25548"
FT                   /db_xref="GOA:B7VQH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25548.1"
FT                   /translation="MNKFNIKDLDLFYGENQALKSINLPVPERQVTALIGPSGCGKSTL
FT                   LRCLNRMNDLIEGVKITGLLEMDGDNIYGNIDVADLRIKVGMVFQKPNPFPMSIYENVA
FT                   YGLRAQGIKDKKHIDEVVESSLRGAALWDEVKDRLKAHAFGLSGGQQQRLCIARTIAMQ
FT                   PDVILMDEPTSALDPIATHKIEELMEDLKKNFTIVIVTHSMQQARRISDRTAFFLMGEL
FT                   VEHNETSVIFSEPKDDRTKGYVNGDFG"
FT   gene            239945..242089
FT                   /locus_tag="VS_II0209"
FT   CDS_pept        239945..242089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0209"
FT                   /product="putative GGDEF family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25549"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25549.1"
FT                   /translation="MHVKAFAKQISATRDHRLLAESLFDYLIKMLGPQGIGIFSEPIPE
FT                   SDSLPLFSYGELTSLDHYPSTFWPWVSQFDTADGVLPMSLNTCKWEHSKALGGESFIMM
FT                   LDNAPACRTYLIIQNCIAEKVNQTFDQGLDGLQLAAARWQCIRAEKNAAIEIKHRDTRE
FT                   AQYLDEIKLRELFVENMKLVHQVALELSNPESLDALYKASVEAVRDRLGFDRAIFMLLD
FT                   MKKRCFSGTYGTDELGKTNSEHHTQYDLHQLESEYIEALSDNHTNLVVIEHAPLYTEGK
FT                   VVGQGWNGMLILREGDKPVGWIAMDNYIHRSPITNYQKQMLESFGSLLSQIYIRKRQEL
FT                   NIRMLHSSMVELSRCDSVSAVCKSAVSFAIQHLGIDRLAVFLTDKNCSYMQGTWGTDIK
FT                   GDIVDESYYRSELVERDIVSAARTYPNQVAFEESVPIYHDYNIVGVGWTAMTMLTTNTG
FT                   VPIAFIAADNLLTRSPLTSQLREVIRIFASSLAEVLQRTMAQEEIKKLNETLEQEVSKR
FT                   TQELENANEQLDVISKLDPLTRLGNRRMLSQVLDDLNCEEHGAFATQNEVTFGLILVDL
FT                   DHFGLYNSVYGHTEGDVALRAIGKILSTHVYGDQETFCRIGGEEFMLLMIGTNHTTTKQ
FT                   RAESIRQSIEDAKIFHCKSSTSQYLTASVGYASITSDQRQFDFDLLYGKADKALYKAKD
FT                   SGRNRVVSAMKRRKVAATLT"
FT   gene            complement(242225..243916)
FT                   /locus_tag="VS_II0210"
FT   CDS_pept        complement(242225..243916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0210"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25551"
FT                   /db_xref="GOA:B7VQH9"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25551.1"
FT                   /translation="MVTMRSLNKPFFSILLTLLLGAFSSFSALAATAVASVSQNSVTKD
FT                   EVFLLRVATDEKVSSGALDLTSLQKNFYVGTPSFGSSMRIVNGSRTVSSEWNITLAPLR
FT                   LGRLDIPSFDIEGTKTQPITINVSINKAAPKQSDMAEFQLNLSKDSLYPQEVAELDVKL
FT                   IIKADPRRLQDPQISLPNSSNLDVEPIGESKQFQDVINGQEVTVVQQSFHISSQQAGQF
FT                   QLQGPKLTGAVVYSTNNSSKTRLFQLDTPVESLNVTVKPVPKGYQGEWLPTSDFKLLQK
FT                   WSDSQGNELTDSNGFDSNKQGFELEAGDSLTRTITMTASNLTQHQLPKLNITYPKSIRV
FT                   YEEKPQFGTTQPGDAVVVYKQILIPKEAGNISLPDVSQAWFNTDTQSEQTTKALGLELS
FT                   VQASERASSSSPAPAMETPTQQASPTIVTVENPGMWPYLTALFAALWIISSAVAFYFWS
FT                   RRGTAVKQKQKDECQSDTAEALIAALKMKDGVKTRTLFEQWKTENPDLSDETLETIEAE
FT                   LTKLNQSLYAEACSPSQSWDPSEAIKAVKKPKRISNKAHKSTLERL"
FT   gene            complement(243910..245739)
FT                   /locus_tag="VS_II0211"
FT   CDS_pept        complement(243910..245739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0211"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25553"
FT                   /db_xref="GOA:B7VQI0"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25553.1"
FT                   /translation="MSNFTFIYPYWFLALAVLPAIWWLSKRQSKQGLLASHIARYLAPE
FT                   SNKPSKNRSTYFGVWWLVGVIALAGPSFEKNEQPSFEKTQARVVIMDMSMSMYATDIKP
FT                   NRLTQARYKALDLLSLWKEGLTGMVAYAGDAYTISPLTSDINTIKNLVPNLSPDIMPFQ
FT                   GGNAASAVKLAIEMMTHAHIYQGDLVLIADDIEGQEKKDIDSLLSGSNWTLSVLAVGTE
FT                   SGAPISLPTGSMLQTDSGQTVVAKTNVDNMRDLTRRSGGTFTELQLDNSDVEHIASYLD
FT                   RVATTSEVTKTNNSLNTRVNNGFWLLPFLLLPALGLFRKGVIWCGLAVFVSFSQPNTAF
FT                   ANPWKTDDQVGYQLYQDEDFQQAAEQFEQQEWKGIAQYKAGDFEAAEQTLQGLSGEDAR
FT                   YNLANAQAKQGKYDQAIKEYQRILESNPEHAYAKKNLEIVEQAREQQQQQQQDDSSQSS
FT                   QDQQQSSADNGKSQSQSGSQDQSNKQDQSENQDQNTDQSQADDSRSDSKTDEESDKQAV
FT                   QQNKADQADKHSQDKGDSASQTAQAQEAAKEDSDNNTQPAAAQASGQPMSSDPDMRKLE
FT                   QVESARDPSQLLKAQMILQARQKSAPNNQNKKW"
FT   gene            complement(245732..246775)
FT                   /locus_tag="VS_II0212"
FT   CDS_pept        complement(245732..246775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0212"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25554"
FT                   /db_xref="GOA:B7VQI1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25554.1"
FT                   /translation="MTAKSGFVKPFLQSEVVMNDFLNMGLLDVEFVWWWMFILVPLPLL
FT                   IYLFSPKSESSSALRLPFLPEDSNTKTPSSRLPKALSVIIWLLLVTAMARPVWYGEPVE
FT                   FQPKHRDLMLVVDLSYSMSQEDMQFNGEYIDRLSAVKHVLSDFIERRKGDRVGLVLFAD
FT                   HAYLQTPLTLDRDTLSQQLNQAVLKLIGTQTAIGDGIGLATKTFVDSDAPQRVMILLSD
FT                   GSNTAGVLDPLEAADIAKKYNATIYTVGVGAGEMMVKEFFMTRKVNTAQDLDERTLMEI
FT                   AKRTGGQYFRARDSKELATIYDTINQLEPVTNATKIWRPQQEWFVWPLSAAMFFAFMLL
FT                   AIRRNNV"
FT   gene            complement(246717..247250)
FT                   /locus_tag="VS_II0213"
FT   CDS_pept        complement(246717..247250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0213"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25556"
FT                   /db_xref="GOA:B7VQI2"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25556.1"
FT                   /translation="MCAIVNEPSIRSSVMNQPLDLSPIITPSAPSWWPLAWGWWLIIIT
FT                   AIVLIALVFFIIKRRQKNQYAKNEALACFRNSLPSNTLSPSAAQDIVRQAALSYFPREK
FT                   VAGLSGDDWLAFLDAQLAKPLFAAKQSQWQWQQALYQDTTLMSDEQTKAQQQLVNDCEI
FT                   WLRKALPPKRGRYE"
FT   gene            complement(247205..248155)
FT                   /locus_tag="VS_II0214"
FT   CDS_pept        complement(247205..248155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0214"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25558"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25558.1"
FT                   /translation="MVAHRDTRMKNQLPNHSDGVTLNLDELLQYKAQSVRWLPPAKSLW
FT                   SQLNGQHESNRKGRGMNFSEVRQYQAGDDIRSIDWRVTARTGKAHTKLFSEEREQPVIL
FT                   FLDLSSSMIFGSTLLLKSVQLAHFASQLCWLTVAQKDRIGAVIDTGQEIIEIKPSASNH
FT                   APLRILQKVIEINNAALTNPNNHSNTTLEHGLKSLHQLCPKGSDIIMLSDFVRYSESNY
FT                   SLINQIRRHNRVRLVHFYDPLEQGVTAFKGSKQITDGNKTQWFNFSSSKEKEKLSHAFD
FT                   QKQQQLMQMSLSLAIPYSSLSCAQSLMSQVSGVQS"
FT   gene            complement(248142..249098)
FT                   /locus_tag="VS_II0215"
FT   CDS_pept        complement(248142..249098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0215"
FT                   /product="putative MoxR-ATPase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 165787; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25560"
FT                   /db_xref="GOA:B7VQI4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25560.1"
FT                   /translation="MHKTNFEVLQNYLESQIIGQKELVKQLMIALLADGHILVEGPPGL
FT                   AKTRAVKSLADCVEGDFHRIQFTPDLLPADLTGTDIFRPETGEFTFQSGPIFNSLILAD
FT                   EINRAPAKVQAAMLEAMAEKQVTAGRKTYALPDLFLVMATQNPIEQEGTYPLPEAQLDR
FT                   FLLHLEVAYPDMESELEILRLNRGEAQGNQPVQPEPISQQTIFEARQEVLNIHMADTIE
FT                   QYIIRLVMATRQPKQYSDQLDQWLDMGVSPRATIALDRCARAHAWLAGRDYVTPQDVQA
FT                   MAFPVLRHRLLRSYHAQAEGVTANQVIAHLLSLVGSA"
FT   gene            249562..251478
FT                   /locus_tag="VS_II0216"
FT   CDS_pept        249562..251478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0216"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8188684; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25561"
FT                   /db_xref="GOA:B7VQI5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25561.1"
FT                   /translation="MLKTNSLSIKQKVVLGITFAVLASTVIVGAMAQKQARDVLSHRLV
FT                   DIELPGMLERINGEIDREVSQLLLAAEQVASNEFISDAIESTDRDAVLENKLVKQLNNV
FT                   RNQYQLNDASVANRQTAYYWNQDGFLRQLNQQQDGWFFGFTQSGQQTMVSMFQEATGEV
FT                   KMFANYQQPSGLAMSGLSKSMGDMVSLLNSFKIEDTGFVFLTNSQGDVQIHRERSLSDS
FT                   SLQQLYGPQSSQLLSKSGFNLITTEHKGQELFVASLYVPSMDWFVVGEVPTSEVFAELD
FT                   ATAKQMLIMTAVVALIFILMGVVLANSITQPIKLLAKRFGDLGEGDGDLAQRIEVKGND
FT                   EIAQLSKGFNGFIEKIHESMKEVFSTSQALQVAAESVSNKAHITHDNSQEQRDQTLQVV
FT                   AAINQMGMTISEIASNAATAAETATQASGNTEVGRSVVNKAKDAISRLAQDIESTGQVV
FT                   EQLASTTQDIGSILGVIRDISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLASRT
FT                   ADSTEEIQKMINQLQSDAKDAVTAMSAGKVITLEGVSASDEAVDVLGGISDRIVDITDR
FT                   NTQVATATEEQSTVVHTINQNIEEINAINEVTTGTAEQLAEASQELQQLSSRLDKMVGS
FT                   FKL"
FT   gene            251798..251998
FT                   /locus_tag="VS_II0217"
FT   CDS_pept        251798..251998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0217"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25563"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25563.1"
FT                   /translation="MSDFEKELEQMTQEMGDEPEVKLPSLEEQKAIVAEFKRLEAEGKL
FT                   TPEVLEQHFGQFNKTSDTPIH"
FT   gene            251958..252053
FT                   /locus_tag="VS_II0218"
FT   CDS_pept        251958..252053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25565"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25565.1"
FT                   /translation="MASSIKQVIRQFTKLFTTIGIKVEQAYIFIG"
FT   gene            complement(252277..253389)
FT                   /locus_tag="VS_II0219"
FT   CDS_pept        complement(252277..253389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0219"
FT                   /product="ABC transporter: ATP-binding protein;
FT                   Maltooligosaccharides uptake"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25566"
FT                   /db_xref="GOA:B7VQI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25566.1"
FT                   /translation="MASVTLKNVYKSYGDVQISKDVTLDINEGEFVVFVGPSGCGKSTL
FT                   LRCIAGLEDITSGDLYIGDQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLAN
FT                   ADKAEIDKRVEHAAEILQLGHLLERQPKALSGGQRQRVAIGRTLVSQPNVFLLDEPLSN
FT                   LDAALRVQMRSQITKLQRQLGCTMIYVTHDQVEAMTMADKIVVLDGGFVSQVGKPLDLY
FT                   HYPQNRFVAGFIGSPKMNFMSVHIEQAEAERVLVQLSNGMTFWIPVDGTTVNAGDRMSL
FT                   GVRPEHLLSAETGDATIEADVLMVEKLGNETQVYLNLDSADADVIYRQPDTLTIESGDK
FT                   LAIGIPAHRCHLFHSDGRACRRLYKEYGTD"
FT   gene            254055..255239
FT                   /locus_tag="VS_II0220"
FT   CDS_pept        254055..255239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0220"
FT                   /product="ABC transporter: Substrate-binding protein
FT                   precursor; Maltooligosaccharides uptake"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25568"
FT                   /db_xref="GOA:B7VQI9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25568.1"
FT                   /translation="MKNALSAVALGTIVALGSFGANAAIEEGQLTIWVGGDKAYEGMAE
FT                   VGKRFEEDTGVKVTVAFPDKLEEKFSQVAAAGDGPDMIFYAHDRFGGFAEAGLLVDIKP
FT                   SKETKEGIVDFAWDAVSYDGKTIAYPVAVESVSLIYNKALVPNPPKSWEEIPALNAKLQ
FT                   KDGKKAIMWPLRGGAYFTWPLLAADGGYAFKQTAEGYDIKDAGVATDGVQKSLGFIEKM
FT                   VKDKVISADMDYSVAESEFVAGNVAMTINGPWGWANIEKAGVDYGVATLPKFNGKASKP
FT                   FVGVWAGGISTASPNRDLAVEFMENYLLTDEGMKSLNDDKPLGAVALNSFQRQLDSDTR
FT                   IAATMDNAMNGEIMPNIPQFTTFWYSMEEAIGNVVDSRQSVEQALKGAEARMTK"
FT   gene            255318..256889
FT                   /locus_tag="VS_II0221"
FT   CDS_pept        255318..256889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0221"
FT                   /product="ABC transporter: Transmembrane protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25570"
FT                   /db_xref="GOA:B7VQJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25570.1"
FT                   /translation="MQSVQGSDAIPAPSSLPGSKSVFIKWGLLGSVGLINGYATILMYS
FT                   RGELAFALLTVILTALALYIFGSKKTYAHRYIYPGIAGMILFILFPLAYTVGLAFTNYS
FT                   AKNQLSLERTQTVLLDRSFQSGESYPFTLYKTDNGHQIVVKDGDQLLATDVFSLEGMTS
FT                   TEMDLSAIDSVQGEKEKIKAIIQNRSVISGVDFHLPNGDDIRMSGLRKFAAVAPLYTLQ
FT                   DDGETLYNNESGEILKPNMEVGFYQPVDEKGEFIGNTISPGFVVDIGTANFERVWKDDG
FT                   IKEPFISIFIWTVVFSICTVAFTLAIGLVLANVVQWEELKGRAVYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMVLESIFGLSPNWFSDPILAKTMVLIVNTWLGFPYMMILCMG
FT                   LLKAIPEDLYEASAIDGANFLDNFKRITFPLMIKPLTPLLIAAFAFNFNNFVMIQLLTN
FT                   GGPNMIGTSEPAGYTDLLVSYTYRIAFEGGGGQDFGLASAIATLIFLLVGALALLNLRF
FT                   TKLTQD"
FT   gene            256901..257791
FT                   /locus_tag="VS_II0222"
FT   CDS_pept        256901..257791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0222"
FT                   /product="ABC transporter: Transmembrane protein;
FT                   Maltooligosaccharide uptake"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25572"
FT                   /db_xref="GOA:B7VQJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25572.1"
FT                   /translation="MAMVQGKSLKYRVWATHIALWCFLALIIFPLLMIIAISFREGNFA
FT                   TGSLIPDNPSLEHWKLALGMSVTNADGSVTPPPFPVLTWLWNSIKVAGITSILIVTLST
FT                   TSAYAFARMRFKGKETILKAMMIFQMFPAVLALVAIYALFDKLGQYIPFLGLNTHGGLI
FT                   FSYLGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIGVVGEVPVASILLSDVNSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLLA
FT                   QRWLVGGLTSGGVKG"
FT   gene            complement(258382..258654)
FT                   /locus_tag="VS_II0223"
FT   CDS_pept        complement(258382..258654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0223"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25573"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25573.1"
FT                   /translation="MYLNFLEPLLSTTFPTLCESTLTNLKAVEYQWVRSLYVEGYDTNE
FT                   INHYIQACFGGDQTFADLFRRVALYQDSIYVLLQHLGCAPSSKEF"
FT   gene            complement(258885..259388)
FT                   /locus_tag="VS_II0224"
FT   CDS_pept        complement(258885..259388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0224"
FT                   /product="putative hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9139899; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25575"
FT                   /db_xref="GOA:B7VQJ3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25575.1"
FT                   /translation="MSSHNSRQDGKRDVTLRFLAEPGDVNFGGKVHGGAVMKWVDLAAY
FT                   ACSAGWSGKYCITAYAGGIRFVAPIHVGNLVEVSAKVIYTGSSSMHIAIDVQASDPKEL
FT                   NNRLTTHCIVIMVAVDENGNPTKVPEWVPETSEDIELRDSAIRLMNMRKQIGEEMEAHV
FT                   KYLK"
FT   gene            complement(260282..261175)
FT                   /locus_tag="VS_II0225"
FT   CDS_pept        complement(260282..261175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0225"
FT                   /product="putative transport protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25577"
FT                   /db_xref="GOA:B7VQJ4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25577.1"
FT                   /translation="MHYLLPFFTVCIWGANAIVNKLAASTIEPSAMSFYRWFFAMLILT
FT                   PFCIRPVMKQWAVIKPNLSKLAFLGFLGMVLNQSLGYYAGLTTTASNMALITSLVPLIS
FT                   VFLSVPLLHKSISSLSIVGGVLSLSGLALMLGKGDPLFFMHQELTQGDGYMLIAAFVYA
FT                   SYCVLLKRWKMPISSWVVIYIQGLFAVAMLTPLWLTSEQLLPPQQAIPLIAYAAVAASI
FT                   LAPWMWVKAIDTIGADSSAMFMNLMPVIAIVLASTWLGEKINQFHIIGGVMVISGVILA
FT                   QIKRKPRLEAPLPQQN"
FT   gene            261274..262062
FT                   /locus_tag="VS_II0226"
FT   CDS_pept        261274..262062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0226"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25579"
FT                   /db_xref="GOA:B7VQJ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25579.1"
FT                   /translation="MKKHSRNLHPSLSIDKAPSNVFMNFEAFLSNTETRVHSHSWGQVQ
FT                   LISGGILEMEAESTRFLAPPHLAIWVPAGVMHCSYNRKPLDYCSLNIAPELTQHLPDKT
FT                   SLIKITPIVSSIIDDFRDRGINVAETEQDQRLVQVLLDQLAQREVEHHFLPSTDNKYLA
FT                   PILASVEENPTDEVTLKDWAERVHTTERTLSRHCQTELGMSFTEWRLRVRYLYSMDLLR
FT                   NGQSVKEVALTLGYNQASPFITMFKRYANQTPEQYKNRLL"
FT   gene            complement(262176..262424)
FT                   /locus_tag="VS_II0227"
FT   CDS_pept        complement(262176..262424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0227"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25580"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25580.1"
FT                   /translation="MVFLFFLWLMYVCMFCAADVYFMRINKTMTTYNQHGTFYWFEVDG
FT                   ETYILFKVGSNSALLNQYYEDVTEQQSEIYGLLGAIP"
FT   gene            complement(262355..262564)
FT                   /locus_tag="VS_II0228"
FT   CDS_pept        complement(262355..262564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25582"
FT                   /db_xref="GOA:B7VQJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25582.1"
FT                   /translation="MISSVHNDELNRYIERLDLNLTKAQVRELGWQQGNEEVGKEKTAL
FT                   GSWFFFSFFGLCTSACFALLMYIS"
FT   gene            complement(262770..264620)
FT                   /locus_tag="VS_II0229"
FT   CDS_pept        complement(262770..264620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0229"
FT                   /product="Alkyl sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25584"
FT                   /db_xref="GOA:B7VQJ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25584.1"
FT                   /translation="MRKPMKLNSTTKSIKLFILTASLSATAIAQDTMFTSPQNVYNDSE
FT                   VVLTKYNNGGVVNASVIENVAKTQPEEAYIKQVTDGVWAITGYHFGYKTVIEGETGLII
FT                   YDSGDDIEEATEILELVRKHISEKPIHTVIYSHSHYVFGAQAIQQAFDGELKVIGHPEI
FT                   NKNVLESGGLGASIPELSPTLTARAYEQFSVLLPAEGPDAKSPTPIGKTQGFVPVNTPV
FT                   TQGQTMTVDGVEMVFYTDFDSDTDDQVIVYLPESKTVLNNHLWPTYPNFYTLRGSVYRD
FT                   PTVWAEGIRLIRDLNPEHLINTHTEPLSGHDEIQTTLNGYYDGIMYLYDQTIRGILQGK
FT                   TPEELTYSVQLPQDLAELPHNQMTYGEFSYYPKNIYYHALGWFNGEAETLNRIEPNLQA
FT                   KKIIEGFGGVDAVKQELNKTIANNELAWSAELGGYLVRVVPNDEEAKQLLADTLRQMGY
FT                   QTEASIPRSWYLTKALELEGKVQIPSVVFSDANSIIGSPAETLVGQFRVRLDPIASYGE
FT                   DQMMAITIKDSDAPTMGLHVRSTVAEFISDTEDYNRQADLEISVSKRTWAEYFVGEKSL
FT                   DQMLESADVSTNHKDDVRGFFSLFDQLNESKTRFVSPSQS"
FT   gene            265017..266057
FT                   /locus_tag="VS_II0230"
FT   CDS_pept        265017..266057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0230"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25586"
FT                   /db_xref="GOA:B7VQJ9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25586.1"
FT                   /translation="MKTESLRTVIPALLLSLSSTAAFAGMELQERKVPTPAGISTEFAQ
FT                   LFENRVISPAIPVPNNTAEWLALQAQFDAPGIKIAQQALERLDVTYEAKQFAGVDTFFV
FT                   TPKNIAPEYKDKWLVHIHGGAFVFGGGESALREAIWVANGLGAQVISVDYRQPPLHPFP
FT                   AAIDDAVAVWKELIKTQSPESTAIFGTSAGGNLTLATTLKLQELDLPAPGALFVGTPSV
FT                   DLKETSDSWLTMQGLDPLGQREGLIEGTFDVYAGGEALDNPLISPIYADIDEFPPTIFI
FT                   SGTRDLLLSDTVRMHRLLRSADVETDLHIYDGQSHGDYMSGILIDMPESEDAINELGQF
FT                   FNKHIN"
FT   gene            266265..268079
FT                   /locus_tag="VS_II0231"
FT   CDS_pept        266265..268079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0231"
FT                   /product="putative mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25587"
FT                   /db_xref="GOA:B7VQK0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25587.1"
FT                   /translation="MIRRFYSMLVAVFLTIPLCLTIPNALAMPSIAFELADTSSPKHTL
FT                   SSFIRDSSVVIEHWKNETLHLKEAQHAYSQVIRTMDLSMVPNRSRTVVVMEKIILLREL
FT                   LDRIDQGTHQLVPNVEQIRGEDIDHWRLGNTEIVLSRQTLGDRTDQFLFSSNTIQSLSR
FT                   WYRTMSVLPYYGKARPDYYQEFLISPGPMFSKQFVLSLPSSFNQLYGPLPLWQWLALTG
FT                   VLSLCKIMIRISFLLGERWNRRWEGKGLKWRAGRLLSLVGVVNLLFLARWVIDDGIWIT
FT                   GGVYQLFTTFFLLAQFFFVSWLIMAIFNYFADIYVFKKHNGKHVDSSLITVLARIFGGL
FT                   TIAILGIYVIEFMGFSISPILAGLGVGGLAVALAIRPILENVINGLTLYADGGVKIGEF
FT                   CRYGDKLGTIESIGLRSTRVRTLERSLITIPNSEFANMEIDNLERRDKRRMDHVLRLRS
FT                   ETTLEQLRVLIVNLRRLLLQHPIIEEDPVRVRLMGVGEYSININLMAYISCRDHEEFMA
FT                   VQEDILFSVLTQVESIGAKIAHSTQYQLVDVNANDNEEQKRKAEQVVAQWHEEQAFPFP
FT                   DFSFEYKYEIKNTIMYPAATSAVRPPSA"
FT   gene            complement(268214..269146)
FT                   /locus_tag="VS_II0232"
FT   CDS_pept        complement(268214..269146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0232"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25589"
FT                   /db_xref="GOA:B7VQK1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25589.1"
FT                   /translation="MKELQDLDLNLLKLLKAVVETRNTHAAADKLGISQTSVSRGMAKL
FT                   RETFGDQLFLRKAHGVEPSELAEKLAEAADEMYSPLIKVVESYHNFDPKIFTGEVTIAL
FT                   NIFLLELYGDGVFKVLQEALPQASFKLIYWQDKSLVEVLNGQVDYLLQLSGIPLPQDIY
FT                   QHKLTEVKLSLIARKDHPVLSKSSEWEDIHHLPITRILIDGINTKRAPIEDLYISKGYS
FT                   ANIVLATHSLTVLRSKLRNSDAFSFGSSFMTEDDSELRCYPLPNLPKEMRQIGVEGGYL
FT                   QSKRGFPLHQLLHQTMQSYFDSIVQPDGR"
FT   gene            complement(269443..270144)
FT                   /locus_tag="VS_II0233"
FT   CDS_pept        complement(269443..270144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0233"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25591"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25591.1"
FT                   /translation="MKTKLILLSCIISAYSIADENTIDFESAVEEFTEATIETTPIDFT
FT                   DPTAAYSSLQLGYSNEGLDAGFGYARAINDDWAGLIFAQSLNSFDTYRVRAAALSTNFG
FT                   SGVMGDYLYDDRHDTHTFVLNAMQVLPLHERLLIAPTLGAGVISSDNLNKDVPIAMAQL
FT                   YGVVTITEQVSMMIAPIYTTSLSDKTLKINTLDWEGNFSYQIADNQNISFKYSIYDETD
FT                   NKVGIHYTYAL"
FT   gene            complement(270220..270897)
FT                   /locus_tag="VS_II0234"
FT   CDS_pept        complement(270220..270897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25593"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25593.1"
FT                   /translation="MKLTKTSLLIASLISSPLVLANNNVDFSDSKQHYSGFDIGYGSND
FT                   FDIGLQYAKSLNNDWSLLSSYSSDDNFDNHELGFDFQRSDGLGLVFEYEHDTNFQSDNL
FT                   RANDYSFSLYKANTVNEQFSVVPQVTLGNLKHQQMSSSVYYTSASLDMTYNLNPSMWVG
FT                   FTPEYTYSLGKVKEKNGNQSTLRDWDYTAELGYQLNSTSAFVYSYQYDDGNNLSLFSFK
FT                   HSF"
FT   gene            complement(271085..271747)
FT                   /locus_tag="VS_II0235"
FT   CDS_pept        complement(271085..271747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0235"
FT                   /product="Multiple antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25594"
FT                   /db_xref="GOA:B7VQK4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25594.1"
FT                   /translation="MGILMHLETLFTYMTLTVLGLLPIMNPPAAATVLLGLSKGRDKSY
FT                   IVSQAKTTGVYLFIALCITFFIGASVLELFSISIPSLRLGGGIIIVAIGFNMLFPRPDN
FT                   GAAPSGQDSIALVPLTIPSLCGPGSMAMIISLAAQIATYENHTSMTSVYGGVVAGLALV
FT                   ALIATFTLTMAYPLLKALGQNGINAFTRIMGFLLICMGVQFFTLGIQEIVLEINELL"
FT   gene            complement(271772..273163)
FT                   /locus_tag="VS_II0236"
FT   CDS_pept        complement(271772..273163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0236"
FT                   /product="putative magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25596"
FT                   /db_xref="GOA:B7VQK5"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25596.1"
FT                   /translation="MTLITLAFSSEGAEKLYLKILECLTLRKAKRLNQTLLEAEPVELP
FT                   SVLRKLSDQQRIATWTLLSEVNPSLAANLLDHLSDPELLWLISQLSESSTIVLFQYLHS
FT                   ADRRLLLNELPSDLQKQLRQALPSTWKDEERAALIYPQDSAGGICKSEVLKLAADATID
FT                   SLSAILSVEEHNLDRLEWRYVYLHDTEGSYLGGLKIRDVLLLPRGTPLREYIDTTVPVI
FT                   SPDTDLNTIKSTLDTTLHPVVPIVDEQGFQIGIVGFKHLNEALYQRSKQQMLEQSGVFG
FT                   GDESRTMPVLKRNLRRLAFLLPSVALSYAAISIIAIYEPIIEQIAVLAAVLPLVANLSG
FT                   AAGNQSVAVSIRELSMGQISAKDLLYVVAKEIPIGAINGILIGGVLALLTLFTLGGEHS
FT                   GLPLVIAIAYTLSSTLAVVIGGTLPLLLKRLNFDPAMLSSPMLTTLTDAISFFSVLYLA
FT                   HAFLL"
FT   gene            complement(273075..273389)
FT                   /locus_tag="VS_II0237"
FT   CDS_pept        complement(273075..273389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25598"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25598.1"
FT                   /translation="MGLQFIADRKVDHATPIRLAISRVDYKVVLNGQFNPDGYRIYRPL
FT                   YSACDQEATTTNIRIKIASSVFSLIVKGLTYDINYISFFIRRGGKAVPKNTGVSNSKKG
FT                   "
FT   gene            complement(273209..273865)
FT                   /locus_tag="VS_II0238"
FT   CDS_pept        complement(273209..273865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0238"
FT                   /product="putative membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25600"
FT                   /db_xref="GOA:B7VQK7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25600.1"
FT                   /translation="MQEIISAIWLQDFDALLELNSLHVLLLLLGVVLFLESSFVFLPLP
FT                   GDGLVLFVGGMVGLGAIDFSSALMLLTSASFLGSIIAYLQGRWLHNTPFMRKAEQTLPD
FT                   ESLPKAKKLLNRFGFLSLFVSRFVPFVRVLTPMLMGVAQLSAIRTLIVSFTSSITWVFS
FT                   LLLIGKWIMRHPFVSQYQELITKWFLMGSLILMVTAFIALFIRLATKKRQPQTSE"
FT   gene            complement(273923..275014)
FT                   /locus_tag="VS_II0239"
FT   CDS_pept        complement(273923..275014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0239"
FT                   /product="Calcium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25601"
FT                   /db_xref="GOA:B7VQK8"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25601.1"
FT                   /translation="MLNVLKQEYKLPLGIVAVLFFKLIGDNLLTGELSQFAYIMITAVL
FT                   FYAVMSAIFSVVRHSDALAIKLGDPYGTLILTLSVVLLEVIMVSSVMLTGESNPFLARD
FT                   TMFAVVMAVLNGFVGITLLIGGMKYHTQTYNLDGIKAYLVAIIPLSLLCLVLPNFTSMD
FT                   SLGNMSTSLTWTLVLASIALYAVFLFIQTRSHTDYFIDGDNEDHHEHHGPLHSNIFHTI
FT                   MLVSYLMVVILLAKSLAIPINDGITEMGAPAALGGLIVALIILAPEAVGAVKAAVTNQL
FT                   QRAMNLFFGSVLATIALTVPAVLLISGVMNEPIQLGLAPAEMVLLGATLLMTSVSFSSG
FT                   RTNSLNGATHLILFFAYIILMFD"
FT   gene            complement(275309..276211)
FT                   /locus_tag="VS_II0240"
FT   CDS_pept        complement(275309..276211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0240"
FT                   /product="putative protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25603"
FT                   /db_xref="GOA:B7VQK9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25603.1"
FT                   /translation="MTKSISVTKIRQLMTMISLILLTLSITSIVARGFNWGLDFTGGVV
FT                   ADIQTKPNVTQVQLKSHLDSALSQDVQVTAAGSEGNWQLRFNDTDLDLRDALNQALLPI
FT                   DSNFHIANSSVIGPQVGLEMVEQGGLAILACFVLTLLYLSYRFEWRLALGSIAALIYDI
FT                   VIVLGLFAVTQIEFNLTVLAALLAVMGYSLNDSIIISDRIREVFRAKPDGETDALLDQS
FT                   IVSTLSRTLVTSGTTLVTVSALWLLGGSALEGFAIALCVGILSGTWSSISIGTLLPTRV
FT                   GLKPTHYKPEETESLESMP"
FT   gene            complement(276211..277998)
FT                   /locus_tag="VS_II0241"
FT   CDS_pept        complement(276211..277998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0241"
FT                   /product="Protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25605"
FT                   /db_xref="GOA:B7VQL0"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25605.1"
FT                   /translation="MKLKRSIAPINYSAKWKVIVLVLSVVLMLLSALPSAFGEREALHI
FT                   SNQTHSTHADDVYRYLVDNSIDVHSVSENNDRLVVTFASSGQQVPAQALMSDFIQPSET
FT                   VALTLEPSAPSWLTSLGFQPIKFGLDLRGGVQFLLDVDLVPVFNAHAQSVIDDLRQEFR
FT                   VRGRVENGEVVIARYNEALLGDIRTHLRTQYPNWTLSQSGERLMISMDEEEKRAIRTLT
FT                   VTQNLQTMRGRIEELGITEAAVQRQGENRIRIELPGVQDPTSAKNIIGATASLAFYHVE
FT                   PNVSARTKSINDQDGRPVILHRNSILGGEHIIDARASLGELGTPEVNITLDSTGGRLMT
FT                   NHSRSNIGNPMATLYSEYSQSETGQSIEQSEVISVATIQSTLGNRFRITGAGSMADAQN
FT                   LALLLRAGSLTAPVTIVEERTIGPTLGAENVKNGFAALALGLGFTLVFIACWYRRLGWV
FT                   ANAALTINLVCLFGLLALIPGAVLTLPGIAGLVLTVGMAVDTNVLIFERIKDKMREGRN
FT                   FSQAIDRGFDSAFSSIFDANLTTMIVAIALYAIGNGPIQGFAITLGLGLLTSLFTGVFA
FT                   SRILINYLWGRDTSHEVKL"
FT   gene            278312..278647
FT                   /locus_tag="VS_II0242"
FT   CDS_pept        278312..278647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0242"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25607"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25607.1"
FT                   /translation="MDCTIYLNDRKYRVCDIGEGRCTLVLSYAEGIESLHEHFSHQFLE
FT                   IERMIVIDISTCWSGEIDTLCEKDRCELIGDVRLLTDIYWLDDFEIKTDKGQEIFQGIS
FT                   ALALSTE"
FT   gene            278912..279706
FT                   /locus_tag="VS_II0243"
FT   CDS_pept        278912..279706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0243"
FT                   /product="putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25608"
FT                   /db_xref="GOA:B7VQL2"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25608.1"
FT                   /translation="MKMRLNLSLFLISTALSPVALADITYPDGYYLEVEGLNGNALKDM
FT                   LGVIAARGQKQLTYTQVWSALKDTNEDPNNPNNVILYYSGRSQSKDFTSSGNNDKNAWN
FT                   REHLWPKSFGFKRKDQWGYTDIHHLQPTDAEINSTRSNKDFDFGGSPLKKSPLNKTDYD
FT                   SFEPRDAVKGDTARSIFYMAVRYEGNNANMPDLYPVDDTSSTSGKPKVGKLCTLFQWHN
FT                   ADPVDNWERQRHEKAVQWQGNRNPFIDNPSWVNDIYGSRCNG"
FT   gene            complement(279767..280903)
FT                   /locus_tag="VS_II0244"
FT   CDS_pept        complement(279767..280903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0244"
FT                   /product="ABC transporter: Type C secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25610"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25610.1"
FT                   /translation="MMNRAISVFVLTLGILLLLGCDESTQPSAQNMGSILGAETQTENE
FT                   TAIDQAQFSPVVKGIEITFPADHQAHPNFRHEWWYLTANLIDEDGNALGVQWTQFRFAA
FT                   APQGSGNSTKETTWQSQQIYMAHSAVTTKDKHYADEKWSRDQAELAGVSTSPFRVYLDD
FT                   WQWNSSSDDLFPATLDANSDQFGYSLKLTSNAPYQKQGVQGYSTKSSDGKVASYYYSQP
FT                   FINVSGEVAIDGVTHLVSGKGWIDREWSSQFLLDSQQGWDWFALRLSDETSLVVFQLRN
FT                   STTGKASYSHARLMKQNGSSIAIKQQDIRLTAIKQTEIDGRDYPTEWQVSIPTQQIELT
FT                   VSALNPEAKMPLSVPYWEGPIVIEGTHSGTGYMELTGY"
FT   gene            complement(280900..283488)
FT                   /locus_tag="VS_II0245"
FT   CDS_pept        complement(280900..283488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0245"
FT                   /product="ABC transporter: Transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25612"
FT                   /db_xref="GOA:B7VQL4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25612.1"
FT                   /translation="MFKERGSNPKSSNVVSNPMKQTGFAQNQLTHTKLTLNLFAAHYRQ
FT                   SPLQAAAILIGIVLAVTLFVAVQAINLNAKRSYAESTEQLSAQAKNLIIPPAGQNYLSE
FT                   SLYFSLRQSGLSAALPVVEGRVRDGQGRRWSVQGSELIAALTSRARHARLDKQSNTQTK
FT                   EPNISLFDNALPLPQLLAGEPIVMMSQSQHQNLREVDTLTLDEVLTKVVVLPDEWQLGS
FT                   RMLMDIGFAQQLLNKQGQLSYIAIFDTKSDTNSNTQDKWQSLIGKQGQWISNNQSTDLG
FT                   SITDSFHLNLTAMSLLAFLVGLFIAYNGVKYSLLKRNRLLVQIQQAGIAPSIVFSALLV
FT                   ELVLLVTLGASLGFILGIQLSHWLHPTVAITLEQLYGATLLPGTWQWQWLVQALLLTLA
FT                   ATLVACWQHFKQRVRQPLSSHGGFYQAPEASNENQLFVIGSVLTIVALAGLWLSEHHRF
FT                   TMAWLGVLVVSIPLYLPKTLSVLANWSEKRTQSGLIQYLFAELRELISPLSLAMMALLL
FT                   AVTANIGMNTLVGSFESTLKQWLEQRLHADIYVSPAQGEIANVERALEQFENVETVYKQ
FT                   YYVDDNLQGLPTLLGTKDKDTLEQTMVFQSHLDDFWTRFYQGEFVAISEPTAVKLGLSL
FT                   GNQLKLDAIQEKTLIVGAIFHDYGSPNGEVLLAPNLWLESGFTDLPTSLGIKVSGDPQV
FT                   VYEQLRQQLNLHPSQLYDQAQIKSIALDIFSQTFAITRALNGVTLMVAVIGLFCACFML
FT                   LDARKAAIARLYALGVSQRKLMAMVVGQIVVLVAFTLVIALPLGAMVGYVLTDIVTLRA
FT                   FGWSLNYVWNWSDALSIAAITILVAVFATLIPLWRLVSKPVVSSLQSELL"
FT   gene            complement(283443..284156)
FT                   /locus_tag="VS_II0247"
FT   CDS_pept        complement(283443..284156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0247"
FT                   /product="ABC transporter: ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25614"
FT                   /db_xref="GOA:B7VQL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25614.1"
FT                   /translation="MESPIVTLTQASKSFVDGKDTHSVLDNVDFALATGASVALTGASG
FT                   SGKSTLLNLIAGFEPLSGGELSGGELWLDGENTSDWKDPQWSRFRHQKLGVIFQQFNLL
FT                   TPLNVKQNIAFPLHLNQQKWSDWCDYLVDALGISELLERHVSALSGGQQQRVAIARALA
FT                   HKPKLLLADEPTGNLDHKAGIEVMKLLSEITTQGNTAVLLVTHSPECASFMQTKLVLDD
FT                   GCLRNAVLTQRVATL"
FT   gene            284606..285568
FT                   /locus_tag="VS_II0248"
FT   CDS_pept        284606..285568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0248"
FT                   /product="putative alkylphosphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25616"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25616.1"
FT                   /translation="MFSCQSICKQFVILLAVIVCSLFTVSVSADTKSTLREETIIIGVI
FT                   SSNPKKAFKRAQPFADYLAENLSNYGIKTGQVVVARDSRQMARWIKSGQVDLVSETVFA
FT                   AQELMQYSGAEPLARRWKSGVAEYHSIFFSKRDNGVDSLGDLRGKTVVFEDVGSTSAFL
FT                   VPAAILLGQGYKLYELSSPREYPPKDKVGYFFSDEYSKSGGESNMMSWVHRNIVASAAF
FT                   SNLDWEKEIPEQVKQQLQVIHTSQAIPRSLVLIRPDLSSELKQNMLLVLLAAHESEEGK
FT                   LALKAYKKTKKFDAITPEIVESISWAEAQKRLVDEYISR"
FT   gene            285581..287767
FT                   /locus_tag="VS_II0249"
FT   CDS_pept        285581..287767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0249"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25617"
FT                   /db_xref="GOA:B7VQL7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25617.1"
FT                   /translation="MLMKLKGKLVLGNMLMVVLTMGCLSLSQWLISSYYSDEILEETAT
FT                   NIAENFTSQAQSQAEQTVEYLSDALFDPMYFYDIDNINSILEPAFENKDVIFIKVFDAN
FT                   GLIVHTGEDVVLGYGSNLDMPRVQENVLNKQEAYTEINSSALIVARPITMNKTRLGGIV
FT                   MSYSLKAVKDDIEKNNTIIKDITESSRSYSAVLSITLTMFMCLVSLLFSMLLAKTMIRP
FT                   INQLLQHSKRISKGIFQVPNNIQRSDELGELAQAFDSMDSSLKQRNEEVEFLAYNDPLT
FT                   KLPNRSQFIKCLERCIHRCKQSKEVFAVFFIDLDEFKRVNDNLGHQAGDELLSEVAQTL
FT                   TNSLKKMGQIATKDEPQCMIARVGGDEFLLRLSGIKTQDTVSKFASDIVNSLKQPIYLS
FT                   SVGESVVVGASVGVALYPDSGNTSEDLVKSADMAMYSAKENGKGRYCFFNQEIEQKILA
FT                   RGVIEKELRAAIDDFSQFRLLYQPKFDLKTGHVVGVEALIRWHHPTKGNISPIEFIPIA
FT                   EATDIIHTLGDWIVMQACKDIQEWDFRHHLPPEFYVAINLSPKQLYGDKALRTFQYQTQ
FT                   KHQVEVTRLHIEVTETALMFDKVSAKKTLDDLRSMGIKVWLDDFGTGYSSLGFLREFNI
FT                   DGLKIDRSFVNDLECDMNDRALCAAVVSMAHQLGIKVVAEGIETTIQSSFLAQSHCDYG
FT                   QGYLLAKPMCAETLSEKLETGLSKPKDTNVIYLK"
FT   gene            complement(287851..288837)
FT                   /locus_tag="VS_II0250"
FT   CDS_pept        complement(287851..288837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25619"
FT                   /db_xref="GOA:B7VQL8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25619.1"
FT                   /translation="MTDTKQNTRISQFRFGQPKESLKLEHVALGALDKDKVRVQIEATN
FT                   INPSDLLSIYGVGQYKHSHQPPRVPGFEAVGRVIESSNAEFAVNQRVLVATSGTWQNYV
FT                   DVSPDDLFQIPQHLENGYACQLYINALTAWVLTTEVAKLTQEDVLIINAGSSAIGKIFS
FT                   QLSESLGFKIIVVTSQPKQYPTISSWVLDANDDLVSQIKALGLPMPTVAFDAIGGSPGT
FT                   DLIHTLSNNGRFINYGTLSLDFYEPRFFEHAKSQSIDFSTFFLRYWEEAEGKDVRRDKF
FT                   TTMLDHFITNDIQLDVDRYLPFDEVQTAIDLIESKTTRLEGKIILLP"
FT   gene            289034..289309
FT                   /locus_tag="VS_II0251"
FT   CDS_pept        289034..289309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25621"
FT                   /db_xref="GOA:B7VQL9"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25621.1"
FT                   /translation="MNVPEVMSKWKTLLALTMALFALKFHLLLIWGLFCWFWGWENLRA
FT                   KEAFFVERIELKEHPVLFTLIIISWFVMGGVYFYMDNRVFEFFSSL"
FT   gene            289340..290551
FT                   /locus_tag="VS_II0252"
FT   CDS_pept        289340..290551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0252"
FT                   /product="Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25623"
FT                   /db_xref="GOA:B7VQM0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25623.1"
FT                   /translation="MKIYLIKASAGSDYSKYKASTGGPPQNIFAAAAATPKWYKLDMVD
FT                   ETIGAKADLYNDADLVVIFMSTPDAYRAYELASKYKKKGKTVIFGGLHTQFNPSEAAVY
FT                   ADCLAMGEVENYWVQLLRDAEFGSLQPIYESSEPVDLSMLNPYPTNIINPEAYNYTWSV
FT                   VVTRGCPFKCNFCLVPRFFDKFQKRPIENIVSELADLKTLGIEWVELHSDNLTHDREYA
FT                   LALFKAIEPLNMSFYGETTVLIARDTELLSAAVKSGFKAVLLGIETPSEEALKAQKKGF
FT                   VKPSKMKEYIAEIRTHGIEVWGDFLFGFDEHDTSIFKQTQKFVEDIKVDKVIPHYMIPF
FT                   PGSESFNQLEREGRLLTKDWSKYDGSHPVYQPSRMSVEELEEGLYWIWRKNASLKERVF
FT                   AWFN"
FT   gene            complement(290698..291039)
FT                   /locus_tag="VS_II0253"
FT   CDS_pept        complement(290698..291039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25625"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25625.1"
FT                   /translation="MKKLITSMSLLTAFVSGAALAEVNGEDFNEFPKQDAAHCFGWTAG
FT                   LDKDQDYAKFIVELSKDRTVSVKEDPYIMEEFGTAMGYSEAMLEFAGKEAADAKYKLVC
FT                   DPIKQSYGF"
FT   gene            complement(291159..291947)
FT                   /locus_tag="VS_II0254"
FT   CDS_pept        complement(291159..291947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25626"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25626.1"
FT                   /translation="MVENSQQLSDRYDEHGYFVIRNYFDEAQIASLRKVVLKFHESWKA
FT                   DNEEFYKEEAFNSSLITGSEYLPADDRSVLFDFISSKQVMDVVDAVIPNKPAFMNTQLF
FT                   FNPVNPQQKDFWHRDCQYDYDVDDQMKVIMETQVLHLRVPLFDEPGMELIPGTHKRWDN
FT                   EEEYNVRQEENGKVSSDDISGGKQIPLAAGDLLVFSADMIHRGRYGLDRLALDILIFDS
FT                   AADYVDYVDDDCLPTPAMLSNITDPRLFMNTLHLKSMLCS"
FT   gene            complement(292132..293013)
FT                   /locus_tag="VS_II0255"
FT   CDS_pept        complement(292132..293013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0255"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25628"
FT                   /db_xref="GOA:B7VQM3"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25628.1"
FT                   /translation="MSFSWIAFTLLAAFSQSWRNAFQSKLSGTMSVAGVTLARFIWAGP
FT                   IALIYLCVLYQWKPVSTPDFSGEFVFYIIAAAIMQILATGLMVMLFKLENYAIGAGLAK
FT                   CEAPVSAVLSVLFFGTALTLTGWVGVLIGTLGVLIMSSSSGWRSLSPKVFLLGMACSTA
FT                   FALTSLWVREASLSIGLPFPHSAAWVLFLVITLQTCIICTYLFFRERDTLRQIFKKSKL
FT                   VIMTSLASVIGSLGWFSAMSLQAVPYVKTLGQVEVIFMVLISYFWLGQSIARKDIVALI
FT                   LLSIAAVLVMWQ"
FT   gene            complement(293136..294467)
FT                   /locus_tag="VS_II0256"
FT   CDS_pept        complement(293136..294467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0256"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25630"
FT                   /db_xref="GOA:B7VQM4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25630.1"
FT                   /translation="MTLKEILNIPNVRYFLMFRSSYFARFYYPIFTLLYLDYGLTLSQF
FT                   AMLNVVWAATIVLAEVPSGAFADTLGRKKLVVLSSIVMFVEIAMIALVPTGNPDLVFIV
FT                   FLINRILSGLAMALASGADEALAYDTLKEQGNEELWPRVLQIQLRVASTVGIFVTLIGA
FT                   AMYDVNFMANIFHFLGLSEPESTKDLMRIPVFATLFVAMIAIYAAINMREEKKVMPSDQ
FT                   TKLATTIASLKLTADTGKWVLATPYVLFMLLYYSLFEHTSRMFLTMNSQYYLAIDIPII
FT                   YFGFIGAGISLLKIILAGQSRRLAESMEPKTFIVVMGLASMATYYWISLGWTIYGVIPA
FT                   LVLIFIIMTMNIFISYHLNKKTESHNRATVLSFKGLMFNLGYGLIGILYAYYYKLVSQG
FT                   YTEQEIEQNLAFLASLSSFFYYFTLLFVLISALFYFKNKKQPIF"
FT   gene            complement(294685..296196)
FT                   /locus_tag="VS_II0257"
FT   CDS_pept        complement(294685..296196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0257"
FT                   /product="CDP-4-dehydro-6-deoxy-D-glucose 3-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25631"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25631.1"
FT                   /translation="MNMISKAFVGSFTCPLRSAAMLVSVTALFSATAIAGNGDATETIQ
FT                   TRAGDFTFETDFLHGIPTQESSAKLFELMDYQRASQAYIWSVPLVSNYAWKQAYADMGA
FT                   EDGQITYVESHESKLGGLTYNTSTPYAITWFNVEKEPVVIEIPTNELRGAVHTMWQIGI
FT                   SQMTEPGVYVVKAKGAETPSNLPKGAKVFESDTNYVFLGVRLMADSDQQRMKDLEALKI
FT                   TDLNGKPLSSKGVNFPERGEDAKHPRGMAFWNTLNEAIQAEPVAERDRMMHDMLRPLGI
FT                   EKGKTFEPSGQQREILEQAVVMGEAMVKNIDFNKTERLPHAAYGKEGNFWEVATASTPN
FT                   QDRYYGMDLDGRAAWFYEAVTNDVAMHGFENGGWGQIYLDNYRDDNGKGLNGSNHYTLT
FT                   LDGDVNFADLFWTITVYNVENRAIIDNDIERADVGSNIEGTVKDAQGNYTFHFSPTKPA
FT                   SVNEANWVQTREDENWFVYFRAYSPSKAFVAQQPETLLPNFKRVD"
FT   gene            complement(296302..297090)
FT                   /locus_tag="VS_II0258"
FT   CDS_pept        complement(296302..297090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0258"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25633"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25633.1"
FT                   /translation="MLLQRSILSLTPLFLASVAFAEEAEIQDMSDPLAVYTQGGFGYTD
FT                   KGLNLKIGQTYDTGSDTTMGMNVFEVKGIAGEAIGWNNRGADDTIDSIRFRNFGVDLTN
FT                   GRGTQVDMSWDFDSNQGSASYSFIQALPQMGMFNFYPLAGVGVAAGEELVEGSGGNLDA
FT                   DQLRDRYNMHGTFYVAGMYAKMQLTDKIWLNYNPMYLGTMSGSSTFKDYGFEGSDSVLA
FT                   HEFAASYQINPRANVRYFANWTENTSIEDGDHRIEFNYQF"
FT   gene            297221..298147
FT                   /locus_tag="VS_II0259"
FT   CDS_pept        297221..298147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0259"
FT                   /product="Transcriptional regulators, LysR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25635"
FT                   /db_xref="GOA:B7VQM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25635.1"
FT                   /translation="MKLNNVDLNLLKVFVVVYQEKSLRKAAEKLFVSTPAVSQSVKKLK
FT                   ESLGEELFVLSNKQFLPTPYSDELYRRVFPLLDGLVTAIEEGKQFTPAELSEDFKIEAN
FT                   PHLLPWLTPSLFHQLSDESPLSRLISHTSSQDSLERLKSDEIDFVIHFEAENLPAEIIA
FT                   VPLVTLKFVLAVRVDHPFKEDVAQIDDLLSFPFAHVDLAYFDQNKHSRLEEEVLSQGKS
FT                   INMALRTTSVVGLIETIKHSNMIAPCMPPVIEQHKGVLRSIVIEGLEEDAEKMEVFAYL
FT                   HKKNQHSAKYKWLLDLIETAMIEANHQ"
FT   gene            complement(298191..300869)
FT                   /locus_tag="VS_II0260"
FT   CDS_pept        complement(298191..300869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0260"
FT                   /product="sensor protein LuxN"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25637"
FT                   /db_xref="GOA:B7VQM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25637.1"
FT                   /translation="MANNMKTFDLGLEAIFYAKAITLLATVAVVVMWLFYYCYRLKQKN
FT                   EAIVGTHHVPYIAYSICIITWISSNAYFHTGLLPGLGTTAAIFAAKLANLSSFLAFAFA
FT                   YYFSCQLAAENRSGKIHRWQQTILASMTGYSFYINLTPGLTVEDVTITAPSQFVIEFGP
FT                   HTPYFFIGVISLIALTLTNLVTMRANSSKLTLAKTNYMITGILVFMLSTATIHIGVAYF
FT                   LRDFSLTWLPPALSLSEMLFVGYALLTSRFYSFKYLTYISLNVLLVCAILVIPFCTVFI
FT                   PLTDGNQWLLAIPICAIIGITWSPIYKRVSPYSSLLVYRNKKTPVQQILALEEGFKLSI
FT                   DDAMRRLGRQLQIPEDKLRLVNSNYNETFYEDYLSSKESVLVFDELSEELDDTALAKRS
FT                   LKALYDKMSSNNTALVMPLFGHKKSVTHLLVSSHKSNNRMFSNEEISALQTLLTRVQST
FT                   IEADRRIRQSRALANSIAHEMRNPLAQVQLHFEVLKQHIDNQAPTQQILTDIENGQAAI
FT                   QRGRQLIDIILREVSDSSPEHGPITMTSIHKAVDQAVSHYGFENEKIIERIRLPQHADF
FT                   VAKLNELNETLFNFVIFNLIRNAIYYFDSYPDSQIEISTKTGSYENVLTFRDTGPGIDE
FT                   AIVHKVFDDFFSFQKSGGSGLGLGYCQRVMRSFGGRVECHSKLGEFTEFHLYFPIVPNA
FT                   PKAETLRTPYFNGWKHNQSTEDKAEADVKPESQTPSGDIEPEPASTLTESKQTERTQAE
FT                   NQPASSHLAPTVLIVDDKEVQRTLVQMYLSRLGVNSLQAKNGENAVELFRSHKVDLILM
FT                   DVQMPIMNGFDASQIIKARSPQTPIIALSGESGQRELDMIRKLMDGRLEKPTSLNALQH
FT                   LLDNWLEKGWAPNASKETENE"
FT   gene            complement(300854..302041)
FT                   /locus_tag="VS_II0261"
FT   CDS_pept        complement(300854..302041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0261"
FT                   /product="Lux M"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25639"
FT                   /db_xref="GOA:B7VQM9"
FT                   /db_xref="InterPro:IPR035304"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25639.1"
FT                   /translation="MELMSSLGSLLASSLPIEKKQHALVELVLHTYQPQQRTALFKTVT
FT                   EYRRNQLELLFPEHQAKSDSVMFEVMDYRDLIQRYPNTLSTEVALLEEAVGQCYIHWLD
FT                   FWCECEISAIKAKLPLSTHALYPMDLPIKDSAYYGVIIDQIENSQLIVQTPTRPQGLPI
FT                   SDAIALSNLEVFIKGEKWYEMLPLLHLSQTGKHFILLKHPTDEAFPTLVSSALIQDWSK
FT                   YETWLSYAPPFCNDKWKYSLSRRGYEGLAELHIFTPPALSKCDSIPEFDNKFQLQLAEM
FT                   QAVCEILRLTVSGNIQQKVYFLYLAQKEMLNLLHQAGYKIGFTIIDQPLILDFYKAIEP
FT                   QAYLPLGYCDLNETNLLTYRGLWNIELMLKAFNHVNFRDYRRCLRENKNTAWQII"
FT   gene            302458..302850
FT                   /locus_tag="VS_II0262"
FT   CDS_pept        302458..302850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0262"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25640"
FT                   /db_xref="GOA:B7VQN0"
FT                   /db_xref="InterPro:IPR000010"
FT                   /db_xref="InterPro:IPR018073"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25640.1"
FT                   /translation="MKKVRLTSLLGVATLFSVAVLAGCSQKSEVPAQSQENANPICSTK
FT                   NLTGGWSQSDITPQAKQALNAVLGQMNTSAELKQILSVRTQVVAGLNYAIEFEMDNGEV
FT                   WNTVVYRSLQGDIEMTQPAQKGRLCP"
FT   gene            complement(302973..303563)
FT                   /locus_tag="VS_II0263"
FT   CDS_pept        complement(302973..303563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0263"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25642"
FT                   /db_xref="GOA:B7VQN1"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25642.1"
FT                   /translation="MRVPMTSIPTHLQDAKTLLSENGFATGDTWYHGTSSALLASIQGQ
FT                   GLKRSGDKALNEAASKTMATIGNNYTESVEPVFLTQSKELAYYWAQQTIRERSTRFEGE
FT                   ERPIVLAVNLSEKQQAKVRPDVGAMSLLMMSVGEQFMSHLTEIYQENNIVGPDIKLRSA
FT                   DRMDYLNKLGMAYIDEDISRACVQELSEPALAN"
FT   gene            complement(303764..305362)
FT                   /locus_tag="VS_II0264"
FT   CDS_pept        complement(303764..305362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0264"
FT                   /product="Isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25644"
FT                   /db_xref="GOA:B7VQN2"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25644.1"
FT                   /translation="MSQITQDIEMIEVAKSAAGAPWDAINPESAARMRAQNKFKTGLDI
FT                   AQYTADIMRADMAAYDEDSSQYTQSLGCWHGFIGQQKLISIKKHFDGKTDRRYLYLSGW
FT                   MVAALRSDFGPLPDQSMHEKTSVAGLVEELYTFLRQADARELGGLFRELDAAREAGDVN
FT                   LQDRIQDKIDNHVTHVVPIIADIDAGFGNAEATYLMAKQMIEAGACCLQIENQVADEKQ
FT                   CGHQDGKVTVPHADFHAKLRALRYAFLELGIDNGIIVARTDSQGAGLTKEIAVVKEPGD
FT                   QGDIYNSYLDVEEIDVADMAEGDVCFNRDGKLVRPKRLPSGLYQFRQGTGEDRCVFDCI
FT                   EAINAGADLLWIETEKPHIGQIKEMMDGVREVHPNAKLVYNNSPSFNWTLNFRQQAYDA
FT                   MVAEGKDVSAYDRASLMSAEYDETELSASADEKIRTFQADASREAGIFHHLITLPTYHT
FT                   AALSTDNLAKEYFGDQGMLGYVANVQRKEIRQGIACVKHQNMSGSDMGDDHKEYFAGEN
FT                   ALKAAGEANTSNQFD"
FT   gene            305504..306457
FT                   /locus_tag="VS_II0265"
FT   CDS_pept        305504..306457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0265"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25646"
FT                   /db_xref="GOA:B7VQN3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25646.1"
FT                   /translation="MNIARIDLNLLVYLDMLLRERNVTRAANQLGITQPAMSNGLRRLR
FT                   DLFEDPLLVRTSEGMIPTERAHKLQPLIRNILANVEKTLQPTTEFNAEDSERVFRIMAS
FT                   DYAESTIIQPLLKRLSEIAPKIRLDIMTPSDVSYQDVEQGTVDIIINRFDDIPQSFHQM
FT                   SLWHDGFSCLFSCDNPIADNFDILSYLKAQHIWVSKTGMGTGVGINPSEAQKLGWIDEA
FT                   LMRIGKTRNITVFTRHYLSAILFAQQKNLILTIPTKAAQLQRNNPRLLIKPAPFAIEPF
FT                   EVKMAWSPLLQTNPDHQWMRRLIKSVANEIESGVTE"
FT   gene            306613..308796
FT                   /locus_tag="VS_II0266"
FT   CDS_pept        306613..308796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0266"
FT                   /product="Malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25647"
FT                   /db_xref="GOA:B7VQN4"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25647.1"
FT                   /translation="MSSRIQQGSLNIDSTLYQLINEQVIPGTGIVAEDFWQSFATILED
FT                   LAPKNRALLIKREDLQHQIDVWHQERAGQTLDAAEYKQFLQQIGYLVPEGDDFQVTTTS
FT                   VEPEIATQAGPQLVVPIMNARFALNAANARWGSLYDALYGTDVISESDGAEKGGSFNPV
FT                   RGAKVVSYARGFLDDAAPLNGVSHKDVTKYSISNVSIGNTLTATLDNGEEVTLIDRNQF
FT                   IGYQGDASAPSSILLKHNNLHIEIQIDPSAPIGSVDVAGIKDVLVESALTTIMDCEDSV
FT                   AAVDGEDKALAYRNWLGLMKGDLQESLEKNGKTIVRNLNPDRQYTSVTGGEISLKGRSM
FT                   LFIRNVGHLMTNPAIIDADGNEVPEGIMDGMITSLIAMHDLKGNSAYQNSTANSINIVK
FT                   PKMHGPEEVAFTNELFGRIEDALGLDRFTIKVGIMDEERRTSVNLKECIRAAKDRVVFI
FT                   NTGFLDRTGDEIHTSMEAGPFAPKTQLKTMTWIGAYEDQNVDLGLACGLQGKAQIGKGM
FT                   WPEPDNMAKMMDAKIGHPQAGANTAWVPSPTAATLHALHYHKVSVPSRQKELRERVRAN
FT                   VDDILTIPLLGNQKLTAQDIQNELDNNTQGILGYVVRWIDQGVGCSKVPDINDVGLMED
FT                   RATLRISSQHIANWLRHGICNEAQVMKTMKRMAAVVDEQNASDPSYRNMAPDFENSIAF
FT                   SAACQLVFEGCAQPSGYTEPVLHAMRLKLKAQG"
FT   gene            complement(309040..310467)
FT                   /locus_tag="VS_II0267"
FT   CDS_pept        complement(309040..310467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0267"
FT                   /product="Succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25649"
FT                   /db_xref="GOA:B7VQN5"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25649.1"
FT                   /translation="MLNIKNQHLLSFMVTETNNAVAVTNPATGELVGHAPISSQAELAN
FT                   AIERAHVAQKEWAKVPAKSRAASLHRWHQLILENKEDLARIMTIEQGKPLAEATGEVVY
FT                   GASFIEWFAEEAKRTYGDSIPSTVAGKRLVTIKQPIGVACAITPWNFPIAMITRKAAPA
FT                   LAAGCSFVVKPSDETPLSAFAVVELAYQAGIPKDLLQVVLGESPEQVGTLFTSHPLIKK
FT                   ISFTGSTRVGSILMAQAAQGIKRTSMELGGNAPFIVFDDADIDAAVQGAMASKFRNAGQ
FT                   TCVCANRFYVHSKVYDEFVAKFDQAVQQLKIGNGLDEGVTIGPVVSQNAKNNIQALIDR
FT                   AVEQGATPVTPTQELDGLFLQPVILKNVKHSMDIVQQEIFGPVAPVMQFETDEELIEMA
FT                   NDTIYGLASYFYSQNIHRVWNIAEALEYGMVGINDGLISTEVAPFGGVKQSGIGREGAK
FT                   EGIDEYMDIKYLCFGGK"
FT   gene            310935..311507
FT                   /locus_tag="VS_II0268"
FT   CDS_pept        310935..311507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0268"
FT                   /product="Malate synthase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25651"
FT                   /db_xref="GOA:B7VQN6"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25651.1"
FT                   /translation="MNMLTLDKTELHRNHSTFIAEAVFAVEMVKADKQLEKQKMAKQLL
FT                   DTLFPLEAGSHEDAVSYEIDYRHVQVYFKNGEHTGLKRAKHFVAYAGDKSKPSSILFRD
FT                   ESGTHVEVTIGARKGTGNLELVNIEDIQLETCTTFGQTEANLSSGIRHWVSLVKGDESG
FT                   RPSASSEDKEFTEKNGEDYNLGFCFAI"
FT   gene            312002..313609
FT                   /locus_tag="VS_II0269"
FT   CDS_pept        312002..313609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0269"
FT                   /product="putative transporter, BCCT family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25652"
FT                   /db_xref="GOA:B7VQN7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25652.1"
FT                   /translation="MSFKSKKYSIDSTDYQVGQDNVSKWGMDVHNTVFIASVGLSLLFI
FT                   ITLLALPPADAKAAIDSIKGAVLSKFDFLFMWGANIMLAFAVVLAFSPLGKIRLGGEDA
FT                   TADYSMSSWIAMLFAAGMGIGLIFWGVAEPTAFFTNWFGTPLDAEPFTEAGRELALGAT
FT                   VFHWGFHAWAIYGMTALCLAYFVYNKGLPLSMRSVFYPILGERVWGKTGDVIDVLTVLV
FT                   TLFGLATSLGLGGTQAASGISHVFGLENNIYLQQSIIVLIMGLAIISVMRGMDGGVKFL
FT                   SNLNMVIAFVFLGLIAVLNFTTVLDSVATAATGYVKNIVALSQSAGREDTTWLHGWTVF
FT                   YWAWWVAYAPFFGMFVARISKGRTVREFLLCVLIIPTLVTSAWMSIFGGVAIEQVINHV
FT                   GQLGLDQGITDVSLSLFYMLDAYSFGSILSVLAVALIIVFFVTTLDSGSIVIDGMTAGG
FT                   KLEVPVKQKVVWAVISGAIAMVMLWIGGTQSIQALQSITIIAALPFTIILLIGCFSLLK
FT                   GLLTEVDKGQENVSETAK"
FT   gene            complement(313812..314738)
FT                   /locus_tag="VS_II0270"
FT   CDS_pept        complement(313812..314738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0270"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25653"
FT                   /db_xref="GOA:B7VQN8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25653.1"
FT                   /translation="MESTYTYPIGKPGQKWQQAEREAWFAQRTVKREYQQEVVPKIKAL
FT                   ADRFDIEQYGALSYDEARFPLFVIKSKNWDESKPTILVTGGVHGYETSGVHGAIKFAAT
FT                   QAEKYAAHFNIVVAPCVSPWGYEVINRWNPNAVDPNRSFYDGTPAEESANLRALVASLP
FT                   EVLVHVDLHETTDSDETEFRPALAARDGIEYIEGMIPDGFYTVGDTENPQPEFQAAVIA
FT                   SVEKVTHIAPADDEGKIIGSDVTQHGVINYPMKKLGLCGGVTDCKYGTTTEVYPDSDKV
FT                   TDEECNDAQVAAVVGALDYVIQHELNA"
FT   gene            complement(314963..316180)
FT                   /locus_tag="VS_II0271"
FT   CDS_pept        complement(314963..316180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0271"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25654"
FT                   /db_xref="GOA:B7VQN9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25654.1"
FT                   /translation="MTLDLDIRTLCLIMVFLSGTYCIGLVIKQQSQARILGMRSFFCAI
FT                   FLLMVGFSLLSFGSHISPWLSKITSNMAIAGGFASMVFSLTQLRQSPSLYSVCVFLGLP
FT                   VVIVTLIYFTLYDASTNARVITMSFYITLCTVASVLVIKTGTVADVKAALVLLMSVFSA
FT                   HSIFMLVRIWITLKEPNIDDFLQASSIHQLAFIITAILLSTIGFTYNWLLNARLMQSLY
FT                   SSSMKDSLTQLYNRRAMNEMLRREWMRSVRHNHPLSVIILDIDHFKQVNDQHGHQTGDQ
FT                   VLKKIGIILQHNLRAADIPFRYGGEEFLIVLPDTRIGEACKVAEKLRIIIEETKFWRQQ
FT                   SANLTASFGLSELWAEDKVPSMIKRADEALYYAKENGRNTVCALTDEQGKLTKQDLPSL
FT                   ASPVQH"
FT   gene            complement(316352..317380)
FT                   /locus_tag="VS_II0272"
FT   CDS_pept        complement(316352..317380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0272"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25656"
FT                   /db_xref="GOA:B7VQP0"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25656.1"
FT                   /translation="MTQLTITRPDDWHVHLRDGEVLKDTVRDISRYNGRALIMPNTIPP
FT                   VTDTEMALAYRERIMAEQPSEQFQPLMALYLTDNTTPDEIRKAKESGAVVAAKLYPAGA
FT                   TTNSDSGVTSAQKIYHVLEAMQEVGMLLLVHGEVTAHDVDIFDREKEFLDTVLAPIVND
FT                   FPNLKIVLEHITTADAATFVKNANENVAATITAHHLLYNRNHMLVGGIKPHFYCLPILK
FT                   RNTHQLALIEAATSGSKKFFLGTDSAPHAKGAKESACGCAGSYTAHAAVELYAEVFDLE
FT                   GKIENLEAFASHNGPDFYGMPRNADTITLVKEEWNVAETMPFGSDIVVPIRGGETIAWA
FT                   VK"
FT   gene            complement(317573..317731)
FT                   /locus_tag="VS_II0273"
FT   CDS_pept        complement(317573..317731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25658"
FT                   /db_xref="GOA:B7VQP1"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25658.1"
FT                   /translation="MNKLVIIILCVLLPPVGVFFARGAGKDLLINIVLTFFFWVPGMIH
FT                   GLWVATR"
FT   gene            317950..319806
FT                   /locus_tag="VS_II0274"
FT   CDS_pept        317950..319806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0274"
FT                   /product="Flavodoxin reductase family 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25660"
FT                   /db_xref="GOA:B7VQP2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25660.1"
FT                   /translation="MSQSPIDRKASEQAPSLSQINVFPVKSVGGIALSSAWVEKQGLTF
FT                   DRRFMLALADGSMVTARKYPKMVKVSSSLQPDGLIFTYEGKEPLRLKYANFKMQEAPAT
FT                   VWKDSFTAYTTNDEADDWFSDVLGVRVELLFCGEQSNRVREKLGQNVSFADGYPMLVIS
FT                   QASLDELNRRSPETHSMDQFRSNFVVSNTEAFAEDGWKRIRIGEVEFEAVKPCERCILT
FT                   TVDVESGEFRATKEPLNTFSTFRANERGGVFFGQNLVAKNEGLVKAGDVVEVLETKEKE
FT                   HYEDSWVESLHLTCVEREEIARDFTTFWLEPAKENHSLPSYQPGQHLPIEMVIDGEKVS
FT                   RRYTLSSSPSRAGRLAISVKRVDDGQISNWLNDHFQVGDTLVAQNPDGAFYLEANPTHP
FT                   LLLLSAGSGITPMLSMLRYLADHGQIGDVVFYHQCSSEEDIPYQAEIDKIASEHAGLRV
FT                   IYSLSQPTKEWDGLSGRLSVSHVAKVEELHKRQAFVCGPDGFMDNAKKLLIQMGLNPQH
FT                   YHQEAFGVAQSTEEAVKQLQLSVNGYLFEGNNQSTLLEQAEYAGVSIASSCRAGFCGAC
FT                   KVTLESGQVHQPDVPALQDHERNMGQILACCSVPQTDIEVVD"
FT   gene            complement(319914..320744)
FT                   /locus_tag="VS_II0275"
FT   CDS_pept        complement(319914..320744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0275"
FT                   /product="NAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25662"
FT                   /db_xref="GOA:B7VQP3"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25662.1"
FT                   /translation="MEQLIRDEMRVLPSIDPHFEVTRRVEFIKTKLQQSGCKSLILGIS
FT                   GGVDSTTCGRLAQMAVDSLNESAGSDEYQFIAVRLPYGEQKDEDEAQLALSFIQPSQSV
FT                   SVNIKAGVDGLHAASHVALEGTGLLPTDSAKIDFVKGNVKARARMIAQYEIAGYVGGLV
FT                   IGTDHSAENITGFYTKHGDGACDLAPLFGLNKRQVRELAATLGAPEQLVKKVPTADLEE
FT                   LDPQKADEAALNLSYDQIDDFLEGKAVSQDVSDRLVGIYKATQHKRQPIPTIYD"
FT   gene            320854..321375
FT                   /locus_tag="VS_II0276"
FT   CDS_pept        320854..321375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25664"
FT                   /db_xref="GOA:B7VQP4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25664.1"
FT                   /translation="MEKIAIFGSAFNPPSLGHKSVIDSLAHFDKILLVPSIAHAWGKEM
FT                   LDFDTRCQLVNAFISDLSLEQVELSLVEKSLFTPGESVTTYTVLSALQKLHRDAELTFV
FT                   IGPDNFFKFSSFYKSDEITEQWSVMACPEKVKIRSTDIRNALISGSDVAKLSTKSVTKI
FT                   LQDSGLYTIM"
FT   gene            321404..321889
FT                   /locus_tag="VS_II0277"
FT   CDS_pept        321404..321889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25666"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25666.1"
FT                   /translation="MLKRAIPATMIIAACSLPAYAECDFFSLDSVMLTSDDENSCLDFS
FT                   TSLEAFGQSMLELSGLSEPEPQTKPDYWSDWVIQSKDAPLLTQSLESNYVGLGMWFPEE
FT                   LEDEQYNMSTEEWLMNHGLQLSIGFGDKVEGQPRMRFDYRWHDSSDADLMMQVELPF"
FT   gene            complement(322012..322638)
FT                   /locus_tag="VS_II0278"
FT   CDS_pept        complement(322012..322638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25667"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25667.1"
FT                   /translation="MNFAIEYTSAYFSHLVITPRKKVLKHSLVSVQSGLVLIKLGKQEY
FT                   AVESGQSVWVPYDCLTSLTYFPNTQVNRVDFSVRLTDSFPRQAGYVTQTNLSSALLEKL
FT                   EVTKSRSLKTNNTEQAFKDMLSVLKQEVLSFKPLLCESALSQRFNQWNVDDSNLPQEHT
FT                   LVMVMREAKKRMQSGQKRTLVIDDLFSGKEEEFEQLCMLVFGEDL"
FT   gene            322802..323920
FT                   /locus_tag="VS_II0279"
FT   CDS_pept        322802..323920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25669"
FT                   /db_xref="GOA:B7VQP7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25669.1"
FT                   /translation="MNEKMTSPTDPYVDIRPYGDDEIPAALNRLINDEEFISAILHYRF
FT                   SNHASWFKALMSPILRVYLKMKWSKLTSVESIQIEVKKYLRDTLAKTTKGVTYTGLESL
FT                   DANQAYLFVSNHRDIAMDPALVNYALHLKNHQTCRIAIGDNLLKKPCATELMRLNKSFI
FT                   VKRSLKGPREMMKALGQLSSYIKHSLETGNSIWIAQKEGRAKDGNDFTEPAILKMFHVE
FT                   GRKQKIVFPEYVKSLKIVPVAISYENDPCDTAKAIELFEKDVNGSYEKGEFEDIESIIQ
FT                   GIIGNKGRVHVGFGQVIDQDFDTPEALAQEIDRQIHDNYKLFPVNLLAAEKEDESITAA
FT                   VKQEFEDKLSSLPQGARQYLIDSYANPVKNIG"
FT   gene            complement(324050..324649)
FT                   /locus_tag="VS_II0280"
FT   CDS_pept        complement(324050..324649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25671"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25671.1"
FT                   /translation="MLRIIVLIIGSLTITNVTAEPLDQYQILNHLDNYGNLYLRNKPYT
FT                   SLPTGLVVDGNLNIEKTAITRLPKGLEVKGSLKGGNSLLARVPSGVKIKGYADLIGSKI
FT                   TRWPKGVRVGGFINLTDTPLIRLPNGFRVKGDLSVIRTPLTELPNGIVVDGDLYIGGSA
FT                   ITEFPDTMTVKGNIYLGGNTITTWPTQLDLGGAVAR"
FT   gene            324751..325053
FT                   /locus_tag="VS_II0281"
FT   CDS_pept        324751..325053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25672"
FT                   /db_xref="InterPro:IPR009971"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25672.1"
FT                   /translation="MKGESVIEIKRQILKGFVIVTSVFCSASANANKIISTPAKAAVVV
FT                   TQSGSQQRVCYYDDKAYSLGAVVEVSGVLIRCAAENDFETNGALGWIEIIKKDEK"
FT   gene            complement(325090..325431)
FT                   /locus_tag="VS_II0282"
FT   CDS_pept        complement(325090..325431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25674"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25674.1"
FT                   /translation="MLARITADFVRGLFMSQDIGNNDVCEACGCAGEIGFIIKEGDDVA
FT                   EVTVYGNSKALIETEFAKYVELAKQVSSNVEFEASELTEESTELNARFKFEVSAEKIIF
FT                   ELKTRSLAR"
FT   gene            325919..326380
FT                   /locus_tag="VS_II0283"
FT   CDS_pept        325919..326380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0283"
FT                   /product="LuxT regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25675"
FT                   /db_xref="GOA:B7VQQ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027402"
FT                   /db_xref="InterPro:IPR027404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25675.1"
FT                   /translation="MPKRSKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSR
FT                   TGISHHFPKKTDFTAALDGRIFKMFMEHIDFENGLDAFSASWVAALEDAEFLAILRLLF
FT                   HHIVTAENAHEFAANGIDRLYKLTETQFGDASGKELEWLIGKSLIHMSQ"
FT   gene            complement(326774..327556)
FT                   /locus_tag="VS_II0284"
FT   CDS_pept        complement(326774..327556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0284"
FT                   /product="hemin ABC transporter, ATP-binding protein HutD"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25677"
FT                   /db_xref="GOA:B7VQQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25677.1"
FT                   /translation="MFPSALKATDIEVKFGSKVILDGVSIEIEAGKVTTLLGPNGAGKS
FT                   TLLKALCQEISSTGDIQYFGHTKDKWPSQKLAKHLAMLPQHSTLTFPFLAHEVVELGGI
FT                   PLQESNKKLTSIASQKMDVADVSHLSKRLYPSLSGGEKQRVHLARVLTQLHYSGDQCIL
FT                   MLDEPTSALDLAHQHNTLKIARELADNHNAAVIVVLHDLNLAAQYSDRLIVLKEGNLVC
FT                   DGCPWEALKPSMIEDVYGYTSIVEKHPTMNFPQVHPAQ"
FT   gene            complement(327556..328605)
FT                   /locus_tag="VS_II0285"
FT   CDS_pept        complement(327556..328605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0285"
FT                   /product="Hemin transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25679"
FT                   /db_xref="GOA:B7VQQ3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25679.1"
FT                   /translation="MRLFMLLRSVPLKTSMLGFGAILVLTALYSVTVGPMDISLADSAA
FT                   SLFQPSNDLAPHINLVIQEIRLPRTILCMLIGAILALCGAVMQGLFRNPLAEPGIIGVS
FT                   AGAALGAALAIVLFSELSLQYPAFMNFAAVPIFAFLGGALTTLLVYKLGTGKFGTSVTI
FT                   MLLAGVAISALSGAGIGFLNFIADDQMLRDLSLWSMGSLAGAKWSGILLAAVTLVGLFV
FT                   IFYRQAMSLNALLLGESEAQHLGIPVQKLKRRLILLTAAGVGVTVSLSGMIGFIGLVIP
FT                   HLGRMLAGPDHRILLPLSAVLGALLLTAADMFSRVVLAPAELPVGIVTAIIGAPFFLYL
FT                   LFQQKGRIL"
FT   gene            complement(328699..329589)
FT                   /locus_tag="VS_II0286"
FT   CDS_pept        complement(328699..329589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0286"
FT                   /product="hemin ABC transporter, periplasmic hemin-binding
FT                   protein HutB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25681"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25681.1"
FT                   /translation="MKDLKVLNKLKNNKHLLAIAAMGLVLAAPIANADDAKQPRIISAG
FT                   SAVTELVLALGAEEQLIAIDVTSHLPQSKTLPKIGYHRNLSAEGLIALSPTTLIGSDEM
FT                   GPDNAISQLKSVGIDVEIVNTEANVEGLLKRIDQIAKITHTEAHSQQVKAEVNQKIAAL
FT                   KANQVPNNEAKKVLFLLLHEGRPANVAGGETSPNAIIELAGGVNPAAKSLTSYKPLSME
FT                   SLVEMQPDVILVSGRSYQKIGGADAILKSLPMLAATPAGMNKQIITVKGSALVGGLGLE
FT                   SLSEAKRINALIYPL"
FT   gene            complement(329765..330178)
FT                   /locus_tag="VS_II0287"
FT   CDS_pept        complement(329765..330178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0287"
FT                   /product="TonB system transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25682"
FT                   /db_xref="GOA:B7VQQ5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25682.1"
FT                   /translation="MIKTPHSSQTQSLVPDLTPLLDIIFIVMVFLLLTASVKLESLEVE
FT                   LPSSDIKNVSEVHKDSISVNILDHEPYWAINGQEYIDWENFKIALLEETGTSDKKPIII
FT                   GADKAANVENLVKLLSFLQENGIPATQLLTEEG"
FT   gene            complement(330175..330876)
FT                   /locus_tag="VS_II0288"
FT   CDS_pept        complement(330175..330876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0288"
FT                   /product="Biopolymer transport exbB1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25684"
FT                   /db_xref="GOA:B7VQQ6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25684.1"
FT                   /translation="MQQISYLQDQLGLMTWPLLICSALTAMIIAERIFQVMLSIGVGKR
FT                   AIRHELNQISPTNSKEIEALAQSISGKRPLLYKGVSMLLAHHSFSKGLREDAAGIWLQE
FT                   KRHQLHAGLRLLGLIGVISPLIGLLGTVLGLIEMFKGVAATTGSITPNDLADGLGLAMR
FT                   TTAAGLMIALPAISGAQLLGLWADRVLAQLEHTLNYVNVWLEGMSIQTSQSGDTQGTPV
FT                   SKASIGDVSQA"
FT   gene            complement(330879..331646)
FT                   /locus_tag="VS_II0289"
FT   CDS_pept        complement(330879..331646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0289"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25686"
FT                   /db_xref="GOA:B7VQQ7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25686.1"
FT                   /translation="MNVNVPRYVIAGGASLVIHAAMLFVAQESKVFAMPAGSQSNTVSI
FT                   NFTPKSVPSQAQKKTVTEPVEPEPIKETLSHPEPKPVEPKAVEPKQAKPAPKKKAITNK
FT                   PQPKKVEKKVVEKTAEKKPIQKKPVTQPEKLADKKVDKNMDESANQPRQVNQGVSNQEP
FT                   VLITRPSFSARPTPPSYPRQARRRGVEGVATYEIWLDAEGKQIKQALVNSSGALMLDNA
FT                   ALKAIKKWKFSPHTVNGRAIAHRVQIPVRFKLD"
FT   gene            331801..333210
FT                   /locus_tag="VS_II0290"
FT   CDS_pept        331801..333210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0290"
FT                   /product="Oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25688"
FT                   /db_xref="GOA:B7VQQ8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR026332"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25688.1"
FT                   /translation="MSVDIYKFDESILGVSSPDPLRFAFAKKQSAHAGGSSIPVDPSKK
FT                   LEIFDELMLSEGKKQDKRCLYIHIPFCRVRCTFCNFFQNAASRKLVDEYFDALMVELKQ
FT                   KAKTSWAQSGLFHAVYIGGGTPTDLSPLQVELLGKAIRQYFPLANDVEMTLEGRINRFG
FT                   DEMFDRSLEGGFNRFSFGIQSFNTQVRRSAKRLDDREVVLERISSLSRTEQAPIVLDLL
FT                   YGLPHQSMEVFQQDLEDYMSTGAHGIDLYQLIVSGNAPMLNLVEKGKIPPPANTPDKAS
FT                   MYLAGVEFMAKHKVKQLSVNHWTRDNRERSIYNSLAKTYAEVLPIGCGAGGNIGGHGVM
FT                   QHRTLDSYMESIKQGQLPIAMMTKQSSLEPIFSSLKAGFDSGVVRRSTLPSFMGQDTFD
FT                   YLKPLFSHWEKNGLVDLSEDYLSLTIAGSFWAVSLAQSVIQVLNTEYQTLHPAPTASGL
FT                   GAHPHASLKHA"
FT   gene            333269..333790
FT                   /locus_tag="VS_II0291"
FT   CDS_pept        333269..333790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25690"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25690.1"
FT                   /translation="MTDTTFAMTETLEQRVAGILEEEPKLLPTAIAEKLGVSEVEVVAA
FT                   FPGDMAVMLDGSRAQDILEGLVGWGPVTTIMHSFGSIFEVKAPFPKGKVARGYYNLMGK
FT                   EGELHGHLKLDNIKHIGLVSKAFMGRESHYFGFFSETGENIFKIYLGRNEKRELIVDQV
FT                   ERFKALKERA"
FT   gene            333932..334462
FT                   /locus_tag="VS_II0292"
FT   CDS_pept        333932..334462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25692"
FT                   /db_xref="GOA:B7VQR0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014419"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25692.1"
FT                   /translation="MEQQVKQERLQGRLGPEIKEFRQERRTLQLATVDQDGRPNVSYAP
FT                   FVQNQEGYFVLISDVARHARNLKANPQVSLMMIEDEESSKQLYARKRLTFDAQASVVER
FT                   ETELWTQVIGQMQERFGEIIDGLSQLQDFSLFNLKAENGLFVKGFGQAYQVSGDDLVDF
FT                   VHLQEGHKKVSNE"
FT   gene            complement(334516..335430)
FT                   /locus_tag="VS_II0293"
FT   CDS_pept        complement(334516..335430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0293"
FT                   /product="Chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25694"
FT                   /db_xref="GOA:B7VQR1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25694.1"
FT                   /translation="MAKPISKASQSQGMLMFKLSLTQSFAIGTLKVREIVPFQPMTQIP
FT                   YSHHHVIGTVTIRDLTVPVIDMSAAIGFRPITPTEYQDCVLIVTDCLRTVVAFLVRSID
FT                   KIIECDWKSIESPPASVGTNVFVTGITRFEDRIVQMLDVELLLSKIYPAYENAHIPMLT
FT                   DVERERLKALNILLVDDSLIARKQLSDALDSINIPYSICNNGLDAIDLMRGEAAKGTAI
FT                   DLLVSDIEMPGLDGYELAFEVQNDSALSHAYCILHTSLSSEICVDRANQVGAHEALEKF
FT                   NAGELIEAMLRGAKVLNDAAMTA"
FT   gene            335714..335992
FT                   /locus_tag="VS_II0294"
FT   CDS_pept        335714..335992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0294"
FT                   /product="Peptidyl-prolyl cis-trans isomerase C"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25695"
FT                   /db_xref="GOA:B7VQR2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25695.1"
FT                   /translation="MARTAAALHILVKHKELAEDIMTQLKKGAKFQTLAKKHSTCPSGK
FT                   KGGDLGEFKKGQMVPQFDKICFSGETLVPHLVKTKFGWHVVKVLYRT"
FT   gene            336291..337661
FT                   /locus_tag="VS_II0295"
FT   CDS_pept        336291..337661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0295"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25697"
FT                   /db_xref="GOA:B7VQR3"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25697.1"
FT                   /translation="MLSTPATDVILHAFDWCYADVMKNAPLIQELGYKSVLVSPAMKSL
FT                   RGPKGCDRDTGTQWWQRYQPQDYRVIDNQLGDTQDFTAMVNTLKQHGLRTYVDVVFNHM
FT                   ANESSIRGDLTYPNQQDMASYQQDSEYYESVRLFGDLSKPLFDENDFVEAFGIKNWKDT
FT                   WEVQNGRITGGASDPGLPTLLDNDNVVTQQRAYLKALKVIGVKGFRIDAAKHMTLSHLR
FT                   KVWTDDICEEMHIFGEIITDGGATKEEYELFLEPYLKHTRLGAYDFPLFNTIFKAFEEQ
FT                   GSFKSLINPYCFGQALSNMRAITFAVTHDIPNNEVFLEHVMDEVDEQLAHAFILGRDGG
FT                   VPLVYSELSTSGILDKSGQPRWLNDWQAPYMKNMIQFHNHVHGEAMQVVEANDDLLVFV
FT                   RGDKGIVVINKSKRSKTASLNWTGAVTDLLSGEVFECVGKDLTIKVESNQCMMLTTN"
FT   gene            complement(337828..339699)
FT                   /locus_tag="VS_II0296"
FT   CDS_pept        complement(337828..339699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0296"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25699"
FT                   /db_xref="GOA:B7VQR4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25699.1"
FT                   /translation="MKFSHKVVAASSALLLVTVSLLSIQQLYTVKSAVENHVNASLKEM
FT                   VSGIKNTVASEMNAKKALAQSTTEVIEINPQDRTYVQNILEKPKLKGSFLAVGFGYDAN
FT                   GFVIENDDGWEAGPDYDPRIRPWFIDAKSKNSLVVTDPYVDVSSKKVIISIGTPVQENG
FT                   RFTAGMFYDLELTNLATLVNQVNLFDAGYLFLVTADGTTIAHPNAKNNGETLSSYLPQA
FT                   TIREGSQQIEVDGKKFLVNFTHIPSEDWYIGAILDEEIAFQTVEDLKNSSIIYSLIAVI
FT                   LSIIALTVLIRVLMRPLETLNQAIQDVASGQGDLTKRLDTNTDKEFSDLAKGFNTFTEN
FT                   LQNQIIQSKAIGVEIKRGTEITVKGAGESANAMNTQLQELEQLATAMNEMAVTATEVAN
FT                   NAQGAAAAAREADDATLDGTSVVSDTTQAIDNLSARIDQAVAEVQVLESATANIETILK
FT                   VINDIADQTNLLALNAAIEAARAGESGRGFAVVADEVRTLAQRTQESTTEIRNMIEQLQ
FT                   AGASSVSNAMNQSKDTATDAVERAQQANSSLDRIRDAIQRISDMNIQIASAAEEQSLVA
FT                   EEINNNTVKIKDLSTQVSNAAQDANTAMQVQTDNVRQQDELLNKFTV"
FT   gene            complement(340153..341523)
FT                   /locus_tag="VS_II0297"
FT   CDS_pept        complement(340153..341523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0297"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25700"
FT                   /db_xref="GOA:B7VQR5"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25700.1"
FT                   /translation="MSNNTNTAQPEKSKGSFWVFLIPSLIGLFLFMAPISYQGDLTIPV
FT                   AILAKSIQAVFGESLVAIITAIVAFMSVASVLSTIFKPTFITSNSFLNGLFNPSPLWLL
FT                   VRIIGGAAAFMAFFQVGPEFIWEENTGGLVLEGLLPTLFSVFIFAGLLLPLLLNFGLLE
FT                   LFGTLLSKVMRPIFNLPGRSAIDCMASWLGDGSVGILLTSKQYEKKFYTQREAAVVGTT
FT                   FSAVSITFSLVVIAQVELEHLFLPFYAAICLAGIVAAVIIPRLPPLSMKKDTFIDGTKP
FT                   HKDADAIPAGHSTFSWGLELAVNKASQVKSAKSVFGEGIRNAVDMVFGVLPVVMGLGTM
FT                   ALVIAEYTSVFSFLGQPFIPFLELLGVPEAVAASETIVVGFADMFIPAILAASIDNEMT
FT                   RFVIAAMSVTQLIYMSEVGALLLGSKIPVNILELFIIFILRTLITLPVIAGVAHLIF"
FT   gene            complement(341752..342435)
FT                   /locus_tag="VS_II0298"
FT   CDS_pept        complement(341752..342435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0298"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25702"
FT                   /db_xref="GOA:B7VQR6"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25702.1"
FT                   /translation="MNHMISKLPRWVEYGALLLAGLAGSVNAIGLLGFQHQAISHISGT
FT                   MSLLGSSLLTPTSTSMHLLLIITSFMLGAAFSGFFIENQALKLGRRYGVALCIEGGLLF
FT                   LALWALLQGYTSGQYFASAACGLQNAMITTYSGAIIRTTHMSGIITDLGIMIGARLKGM
FT                   PFDRRKAKLLMFIVVGFLFGGLSGACLFQRFEILALAFPASFAFIIAFSYWLYLTYRTE
FT                   ASVNL"
FT   gene            complement(342577..343059)
FT                   /locus_tag="VS_II0299"
FT   CDS_pept        complement(342577..343059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25704"
FT                   /db_xref="GOA:B7VQR7"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25704.1"
FT                   /translation="MQTIKGFSIIINTGLTRSGAWMDINHIKERNIRSCECRCGAVNLV
FT                   CRGEPQRTSVCHCYECQKRTGSVFGVQARFPIEQVTLNGEVTSFSRISDTGNEVTYQFC
FT                   PKCGTTMLLQSVAAADFYVVPLGLFKEQDFPLPSFSVYEERKHGWVKFEHQMSHYN"
FT   gene            343092..343739
FT                   /locus_tag="VS_II0300"
FT   CDS_pept        343092..343739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25706"
FT                   /db_xref="GOA:B7VQR8"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25706.1"
FT                   /translation="MKKKILPIPLILLIPIIMLVVVILAGIYRFSLSDEEILAKFPSSQ
FT                   VSYDPVVETVFDLKTTNPWTIKVPETNAYAFINEVDGPRSIAFGRYDSGVERGVVTVDT
FT                   NNLSRVILGEASFFVAPMWVSNQGSGVFYYLGLFKHDQHRSRVVLVDQFFLGDRVRIQT
FT                   LEITQLLDSQSKLSGEGFIGFTRHSAEQSFPELQSEKVLMSFSFNAQSIDEQ"
FT   gene            343863..344162
FT                   /locus_tag="VS_II0301"
FT   CDS_pept        343863..344162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25707"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25707.1"
FT                   /translation="MINKRFFKTKDEVEVTFELEAQEANSVSIVADFLDWKATPMKKLA
FT                   KGKVYKFKTRLPKDGEFQFRYLVDDQQWVNDANADRYIPNEFGEDNCLVSTVNV"
FT   gene            344408..345700
FT                   /locus_tag="VS_II0302"
FT   CDS_pept        344408..345700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0302"
FT                   /product="Hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25709"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25709.1"
FT                   /translation="MYSKIFSSPFAELSPVKKAAILGLPLIAAISVALQYSQSNLTKTI
FT                   DLDLPDSTVIESILSPPSATVIEPPTFEYQIQSGDNLSSIFTQLGFSYNSMMSVMETDL
FT                   NFLALDTLRPGNTLRFWRDEATGNLSKMELQFSVADKVVYRLLDDGSYEFEDISIPGEW
FT                   KQKPLVGDIHGSFSMSANKVGLNSIEIDHIVTLLKDKLNFSRDLRAGDQFEVLQKEQFV
FT                   DGVATGKREIEAIKIMNRNRVVSAYLHTDGQYYDANGDSLQRAFQRYPVSRGWRQSSQF
FT                   NPKRLHPVTGRVSPHNGTDFATPIGTPVQATGDGKVIMTRKHPYAGNYVVIQHGSTYKT
FT                   RYLHLSKILVRKGQTVSRGQRIGLSGKTGRVTGAHLHYELIERGRPVNAMKANIPMADS
FT                   VPKKEKATFVAARDEADKLLKKALEKQSNNS"
FT   gene            complement(345872..347824)
FT                   /locus_tag="VS_II0303"
FT   CDS_pept        complement(345872..347824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0303"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25711"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25711.1"
FT                   /translation="MQVALLILKTALLQDRIHKIIHIQLTHDSGWLRMVTMTQHTRNSI
FT                   IDTEHIGRLLKLEGIDLLESAVLTLHQTFGTQYTSIIEKKHFPDQMVPLVIAHSDHVLH
FT                   DKINARHGHIYQQAVNQKHPDCSFAQYIVQSLPTSAFRQEITSQNSVAIPARSQSGEVM
FT                   GVLFSTFSSPMSTDQQQDVIKHHQLFADIVIHTLREMWFNDRSEQLVNQLSYEVSHDSL
FT                   TGLLNRSCLSDTLESITQQSVTPFTLALLDINSFKAINDMHGNYIGDKVLQFVAETLRR
FT                   TLPDNNLTFRTAGNEFAFITYHSDPIAVCEQILDKIKQGYTSIDIKIDFDVSIGIARSD
FT                   GDNKDVEQIIFNTSLALKECQHSQDTYIQCYDTHLRVRYQRKTELIAALRSELDSPISD
FT                   SQAPNDNGMYVVVQPIVDHIDTRWDYFEVLTRWKTTRHGDISPVEFIQVAEESGLIVEL
FT                   GERIIELVCRAKTRLERGLGYKVKLGINCSAHELTDSKRYISYLTRTIEQHHFKANEFV
FT                   IELTETVLLSPTQETKSALDFLRGQGFTIALDDFGTGYSSLNYIHSYPIDCIKIDATFI
FT                   RNLLTNSTSESVVWLIVQLAHRLNVSLVAEGVEKREQLEKLHAMGCDKIQGYLYSPPMR
FT                   PEAIVSYVTHSEPLA"
FT   gene            complement(347897..348793)
FT                   /locus_tag="VS_II0304"
FT   CDS_pept        complement(347897..348793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0304"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25712"
FT                   /db_xref="GOA:B7VQS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25712.1"
FT                   /translation="MDWILNVKSYVKVVEEGSFNGAARKLNTTSSAISKRVNWLEERIG
FT                   TQLLKRTTRSISQTEAGALFYLRAKDQLDNWQSIIDETRSVNQTPAGLLKIGATIAVGS
FT                   KFLVQYMDDFLEKYPDIKVQLITTTPGQLPELGLDLVISRELEQLNSLSFKKTPLFEHK
FT                   ASFYAAPSYLAKHGYPINEQDLEQHNSLIWGERPTREVTLTKGQRITLNGNFATTNPEA
FT                   LFHAAKRGMGVLLTIKAMIKEDLKQGTLVPVLPNITADEVMVYAYYPKLDYSHTRTKLF
FT                   LDHLKDRLDKERNSQVL"
FT   gene            348902..350107
FT                   /locus_tag="VS_II0305"
FT   CDS_pept        348902..350107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0305"
FT                   /product="Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25713"
FT                   /db_xref="GOA:B7VQS3"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25713.1"
FT                   /translation="MSQSTFKKTPLLLAMMIIATGQVGVSIYLPSLPLIASDLSVTQVD
FT                   VQLLVTLFLVGFGLSQLFYGPMSDAVGRRPIFLLGQGVYLIGTVVCVVFSDNMTALEVG
FT                   RLLQGLGAGSASVLGRSVLRDSYDGLQLTKALSYISVTASIMPIIAPVFGGWISFHLGW
FT                   QAVFLFVLVYLLAIFTLGYFVLHETLPYGKSRFEVSQVVKNYGRLLTNRQVLTSASYNW
FT                   MSYMASLVSLSLFPFLMQEQLGLTAAEYGSLMIVPSAGLLIGSVALNLLNRRFSTPQLM
FT                   SLAILIILASGTWLLTHELSIFNLVWAFTWLAIAQGISFPLSISMLLEPHKKKAGAVSA
FT                   LSGSIQMCLAGLLGGYLVESWVTTHLQLGVFYLIIGACMATVLWSSTRMNKKATATEVE
FT                   YS"
FT   gene            350230..350580
FT                   /locus_tag="VS_II0306"
FT   CDS_pept        350230..350580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0306"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25715"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25715.1"
FT                   /translation="MQQNEFEVLVKAICALDGLPQALELLKSNEDTEVAEAAGSLTGQF
FT                   ALAEVEGEKRIYHVTLQENEQGEEQEYIEHVMNEGDDLIKFAAWFFETMFELKQKDTYQ
FT                   IAGKTYRQPKRN"
FT   gene            350824..350958
FT                   /locus_tag="VS_II0307"
FT   CDS_pept        350824..350958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25717"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25717.1"
FT                   /translation="MNYELGHAYLGQMVAKNMMHEALYGKPKPKKASFIKRMMKKMAK"
FT   gene            complement(351134..351751)
FT                   /locus_tag="VS_II0308"
FT   CDS_pept        complement(351134..351751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0308"
FT                   /product="Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25718"
FT                   /db_xref="GOA:B7VQS6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25718.1"
FT                   /translation="MKKPVKITLYRWAGSWGPFKVNIPCGECTLTKDILKDTFENELSD
FT                   VDVELEVKDWLSHWWEPLKLGSWHAPILVVEGKVVSQGEALNRGVLVQSVIKEWTKRDS
FT                   LKGNIVYGKATCPFCVKAKKMLDEAGVEYQYHDVVKDSAALYRMIPEVKAHIGEKTPVT
FT                   VPQIWLDGKYIGGADNLEAWMKENGLDTIPNNVVDLSNQSTG"
FT   gene            complement(351820..352710)
FT                   /locus_tag="VS_II0309"
FT   CDS_pept        complement(351820..352710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0309"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25720"
FT                   /db_xref="GOA:B7VQS7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25720.1"
FT                   /translation="MSQHHPIQGASWMLTAGLAFAVINSLTQVASIHFGLTSTTVAVIQ
FT                   YAIALFAILPYLKTLGIRRALKTDNLKLHVFRVFLSVIGIQLWIWALAYPVPIWQGIAL
FT                   LMTSPLFATIGSGFFLKEKVGAARWGATLAGFAGAMVILEPWAEDFNWATLLPVGAAFF
FT                   WACYSLMVKKLSSQDSPSTMVVYLLLLISPFNILLAAPDWQTPSGGTIWAILIVIGVMT
FT                   ALAQWAIVKAYSVADASFVQPFDHAKLPLNVLAGWIVFSWVPPGRLWLGAAIIIASVAF
FT                   ITHWETKKPAKIKKV"
FT   gene            complement(352866..353861)
FT                   /locus_tag="VS_II0310"
FT   CDS_pept        complement(352866..353861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0310"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25722"
FT                   /db_xref="GOA:B7VQS8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25722.1"
FT                   /translation="MIMKKAVLASAVVAALVSGSSLAATVYSSDGTELKIGGRAEFRGD
FT                   FIGSGGAEVEGSMKDKTRFRLNLGGKTELTDTATAFGFYEAEQDTGSDKFENRYMYAGV
FT                   DFDGQAVSVGRQDMASVIVSDFTDITEFSGVQQAFGAASDKEDGVFAYRGGFDALQLEA
FT                   TYQTNSKKDSDGYGISGVYSLPMGLDLGLAYSGEDLGENKGSADQILAGLAYSLDNLYL
FT                   AATYSTGDLDDKATGTDAKSFTAMEFAAQYKFTKQVSAAVVYTYQEDEINSGAKVDAVD
FT                   GIELAGYYKLNSNFRTYLSYYVNGLDEVKNAKGIVTAGEDTLRLGVRYDF"
FT   gene            354232..355245
FT                   /locus_tag="VS_II0311"
FT   CDS_pept        354232..355245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0311"
FT                   /product="putative succinate dehydrogenase subunit Sdh"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25724"
FT                   /db_xref="GOA:B7VQS9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25724.1"
FT                   /translation="MKTEYLGDVLQGRQVIGALNVEDLPIGEHQFWFQVTSDGLGQPKN
FT                   MPVSVFKGSQDGPKLMITAGIHGDELNGVLAAQQIIRDLVGKTLKGTVTVVPTVNLSGL
FT                   LNHSRDFISSDPGSCPANLNRLFPGDAHGLAAERFVASLWDRLLKHNATFAVDLHTQTR
FT                   GAVYPLYVFADYRVEQCLEMARLMQPDCVLNDPGDPGILETVWNRSGIPSITVEVGMGK
FT                   FTQPDMIQRAVDGVFNILSYYEMLDAEGLRDKKPLPSIDWIEGNNVVSIRADIGGFVLP
FT                   QVELLQSVEQDDLLAIQYDAFGNECRRYHALSAGRVLSYNVDALREPGALVCRLLS"
FT   gene            complement(355397..355858)
FT                   /locus_tag="VS_II0312"
FT   CDS_pept        complement(355397..355858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0312"
FT                   /product="PTS system, 3-keto-L-gulonate specific IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25725"
FT                   /db_xref="GOA:B7VQT0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25725.1"
FT                   /translation="MDCFMSLFDLIGNQGVIINSEENLTVDAAIDLTCSTLLASKKIEA
FT                   SYVEAIKQKHKDIGAYYVLAPKIAMPHARPEDGVNEASLQVTVFKKGVDLESEDNGDVY
FT                   LSITLAAMDSDSHIHTIMALSELFQNDDDIDAIIAAETDQAIIEILKRY"
FT   gene            complement(355843..357099)
FT                   /locus_tag="VS_II0313"
FT   CDS_pept        complement(355843..357099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0313"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25727"
FT                   /db_xref="GOA:B7VQT1"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25727.1"
FT                   /translation="MQNFFEFMLGLLKEPAIMVGLIAFIGLVAQKADISTILKGTIKTV
FT                   MGFLILGFGAGALVGALNNFSVVFTEAFGVSGVIPNNEAIVALAQEAFGYEMALIMFFA
FT                   FVVNILLARITPLKYIFLTGHHTMFMSMLVAVILSTANIEGTVLVAIGSIIVGTLMVVM
FT                   PALGQKYTEKVMGTDQLAIGHFSTLSYIVSGFIGSKFGDTSKSTEDIQVPKSLMFLRDT
FT                   PVAVATTMAIFFMLASIIAGGEFVETVSSGQNWVVFTFMQSLIFAGGVYIVLQGVKMLI
FT                   AEIVPAFKGISDKLVPGAKPALDCPMVFPVAPNAVLIGFLCSFAAGLLAMAVQGALGWT
FT                   IIVAGVVPHFFVGGAAGVYGNATGGLRGAILGSFTQGLCISFLPMLLLPVLGGLGLEAT
FT                   TFADFDFGVVGLILGWIVS"
FT   gene            complement(357110..357379)
FT                   /locus_tag="VS_II0314"
FT   CDS_pept        complement(357110..357379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0314"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25729"
FT                   /db_xref="GOA:B7VQT2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25729.1"
FT                   /translation="MKKILVVCGNGLGTSLMMEMAVKEVAKKIGFEAEVDHEDLSSAAS
FT                   SNADIWVAATDVANQLKEGGKENIISLKNIFDKASIEEQLKTFM"
FT   gene            complement(357665..358150)
FT                   /locus_tag="VS_II0315"
FT   CDS_pept        complement(357665..358150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25731"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25731.1"
FT                   /translation="MKKMEAPHDMNNGARFKTNRHGYVTVVEYYNTYTVIVAFENTGNI
FT                   RAISATKLRTGQLTDRSVAPESIMIGEKVESVKHGILTITQVESENIVVLTNINNEEIR
FT                   MLLPAVQKMKDKTEEIDGENVTSPKPTSLSQLTKRNKKTKDVNSMLKKMLTDYGRYD"
FT   gene            358753..359961
FT                   /locus_tag="VS_II0316"
FT   CDS_pept        358753..359961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0316"
FT                   /product="putative nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25732"
FT                   /db_xref="GOA:B7VQT4"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25732.1"
FT                   /translation="MNILFGFVGVLALIACAYLLSESRSSINWKTVSRALLLQIGFAAL
FT                   VLYFPWGQLALTSLSNGVSSLLGFADAGIAFLFGDLATEGFIFAIRVLPIIIFFSALIS
FT                   ALYYLGIMQKVIQILGGAVQKLLGTSKAESLVATGNIFLSQGESPLLIRPFLKSMTRSE
FT                   LFAVMAGGMASVAGSVLGGYAGLGVELKYLIAASFMAAPGSLLMAKIIVPERSTPSDYD
FT                   HIELDKADQSNVIDALASGAMNGMKVAVAVGTMLIAFVSVIAMVNTGLESLGETFGFAG
FT                   ITLQAIFGYLFSPLAWLIGIPSDEVLMAGSYIGQKIVMNEFVAFIDFVENKALLSEHSQ
FT                   VIVTFALCGFANIGSIAIQLGSIGVMAPERRAEVANLGLKAVAAGTLANLMSACLAGIF
FT                   ILL"
FT   gene            360320..360589
FT                   /locus_tag="VS_II0317"
FT   CDS_pept        360320..360589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0317"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25734"
FT                   /db_xref="GOA:B7VQT5"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25734.1"
FT                   /translation="MNMRVLIGLIATFIGLFAMVYLIAGGTQFPIYQWPQEAYLGLVFS
FT                   VVWGTGVAASVAYVFSALVFVTVAVVCYAVGYKIGGLFSSNSDV"
FT   gene            360635..361246
FT                   /locus_tag="VS_II0318"
FT   CDS_pept        360635..361246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25736"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25736.1"
FT                   /translation="MHWLDRWKVYRYHRKQANRSNGDKAKALGWTSEESQLCRFEVIAR
FT                   SADFEKKSILDLGCGYGELFELLASIYRIQSYTGVDQHAGFLKKAKQSYTEDRCRFLSG
FT                   DMSQMSLEVHDVVIASGSLNYISRDSDYLTNMITRMFGLANQTVIFNLLSSSQYPSRNT
FT                   LMSYHPQGVYRFCKTLCDDVSLVEGYAEGDFTIVMNKAVS"
FT   gene            complement(361344..362552)
FT                   /locus_tag="VS_II0319"
FT   CDS_pept        complement(361344..362552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25737"
FT                   /db_xref="InterPro:IPR021928"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25737.1"
FT                   /translation="MKLKTLTLCTLLSISVAVAVHAQATSDTLTAFDTQQTVTIQEPVN
FT                   IQATIVPNVQSQAGILDSQEQSFKQSADLIRTTYESQLYTLPAFKEGHYGLRMYRQTLD
FT                   DKYSAAVWSDMARVASKLSRLSNDVHTMEQIVLYSEKRVASYVGDSDERSVRRYNITKH
FT                   MPEYLYLGVDLLGSMARANEYGLEHKNDAKLREIIRRYDFSRYVTNEDMVKAWAAQLAN
FT                   QVYWLRQLGEQDVVDEFVDTFKKAYPDDKDKKLSSQQYGNKIYGMTHVIFGDSEYYQHQ
FT                   VSEQEHQWIYDYFRENIDTILLRAKEDVIAEVGLTFLLAGLENDPVVEKTRLAIQASID
FT                   KTKGMIPSVTGDFDLKYGEHRNVLAIMLLDWQQVNEAPTYEGNPKVFTNIPYGLVENQP
FT                   LKH"
FT   gene            362826..364181
FT                   /locus_tag="VS_II0320"
FT   CDS_pept        362826..364181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0320"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25739"
FT                   /db_xref="GOA:B7VQT8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25739.1"
FT                   /translation="MPSGSSKQWPAKLLSLLFFLVVMSAIEFFHSKELSYLKDESYSEA
FT                   KKQLSIIRSRIEAAIVSDMYILNNLSTLVTINPDGDMKSWNKIAENIIRDGFHIRLIGL
FT                   AEDDILNFVYPMEGNEQILGIDYRDHPTQWESVEIARNIGNTVIAGPFELFQGGQAIIT
FT                   RTPIFRDPPFNQDYWGVSSAVISLDELFEDVGIGILENKYKLAIRGANSSGKDGAVFYG
FT                   SQDVFDNAFVTEQVSFPYGGWYLALSGNEHVLMDVQWYRIQAVRLVGYTIMLMLAFAFF
FT                   TIYRLYRIADSRSMHDELTMLPNRRYFMYSLKQAFKVTQKQRARTFAVVNIDLDGFKAI
FT                   NDTFGHAAGDQVLIECANRIKSELRGSDIVARIGGDEFLVLLPRIIDDQHVSSIVAKLR
FT                   RAICSTPVVYDTHSIYLRISVGWVIHNNNYSDVDALLKAADEKMYEQKRQIL"
FT   gene            364346..365917
FT                   /locus_tag="VS_II0321"
FT   CDS_pept        364346..365917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0321"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25741"
FT                   /db_xref="GOA:B7VQT9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25741.1"
FT                   /translation="MSFTSLGLSEPILKAIEAQGYDKPSPIQEKAVPAVLTGKDVMAAA
FT                   QTGTGKTAGFTLPILEMLSKGPRVRQNQVRALVLTPTRELAAQVNGSVVKYGINLPLTS
FT                   TVVFGGVKINPQMQKLRKGSDVLVATPGRLLDLYNQNAVRFDQLEILVLDEADRMLDMG
FT                   FIRDIRKILAFLPKKRQNLLFSATFSDDIRSLAKGLVNNPVEISVSPANSTAPTVEQSI
FT                   YPVDKKKKAPMLAKLIKDNDWRQVLVFSKTKHGANKLARFLEEQDITSAPIHGNKSQGA
FT                   RTKALENFKTGKVRVLVATDIAARGIDIPQLPQVVNFDLPNVSEDYVHRIGRTGRAGEV
FT                   GKAISLVCADEVGELFGIERLIQQVLERRELEGFAPVNKLPESRLDSRPIKPKKPKKTR
FT                   EHSDGQRSGENARGHKPAGKNKRHVAGNGSAPKRKPNSGNKASDSNSAAAGDDKSLRNN
FT                   GSNYKRGNKPSTNSSGKPGGAGKPKKSGFGGSNGSSKPSNKSAGNKPTGNKPSPSRSRS
FT                   KPASQK"
FT   gene            366376..366484
FT                   /locus_tag="VS_IIm0322"
FT   ncRNA           366376..366484
FT                   /locus_tag="VS_IIm0322"
FT                   /product="Qrr"
FT                   /note="regulation of quorum sensing in Vibrio spp. bound by
FT                   Hfq"
FT                   /inference="profile:Rfam:8.1"
FT                   /ncRNA_class="other"
FT   gene            complement(366620..368185)
FT                   /locus_tag="VS_II0323"
FT   CDS_pept        complement(366620..368185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0323"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25742"
FT                   /db_xref="GOA:B7VQU0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022055"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25742.1"
FT                   /translation="MHTISQQKFYNVNFTNMALSKSLVRQSHFLGTKIRNLRKRNHLTM
FT                   EDLSARCIRINPEYAPSVSYLSMIERGKRVPSIDMLEVIAQVFQKNPTWFLDDESEQQA
FT                   IAPDKGNRGGISGMALEPSFLFSNDILQIAIPEMLSQTGISGRQFAHLLIRAHQESNQN
FT                   HFPDLERAAEEVGLKRLNLSVEDLIDIARSLGINIRWVTRTPKDVVDELGINAKQLVTS
FT                   FFEPPSTIFLNEILKEYPTRLKYDLSVYIGHCILHSKEGLKSVLSVGNNNTWDDNQVSG
FT                   SSQLNSQDILQAWRDFESSFFAGALLCPKVPFRQLLDRTGYEIDVHKRAGVSPSVAMRR
FT                   MTVVSPYPHWHYFDAYGPGKLKAVYRGNGIPLPWGNMRTVADPCQHWAVFRRLSEPRAG
FT                   SSAQISILNVGDEPRIYCCESINMTDPAGNNRVLCAGIDLNPAIDAQGGNSRDIAEQLK
FT                   ASCVNNGGSVVIPRNIKKDLTTIAKILNINWIERGIETEARLICSRGGECPRQPSCYSK
FT                   CGEC"
FT   gene            368323..368925
FT                   /locus_tag="VS_II0324"
FT   CDS_pept        368323..368925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0324"
FT                   /product="Malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25744"
FT                   /db_xref="GOA:B7VQU1"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25744.1"
FT                   /translation="MNMLTFDKTEIQKQTKPFIAEAVFAVETISAKQQTEKQLKAKQLL
FT                   DRLFPLENGSHQDVTSYVVDYRHIMAYFKNGQHSGLKHPKQFVAYMGEKCDPDSILFRD
FT                   SSGSHLEVMFGCHKGTGCIELVDIDDIQLESCTTFGQSPMEVVQTNTERQGITTAIRHW
FT                   ISLVQGDEKGKPKACSEDKEFRAKSGEDYCLNYCYAL"
FT   gene            complement(369191..370228)
FT                   /locus_tag="VS_II0325"
FT   CDS_pept        complement(369191..370228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0325"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25746"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25746.1"
FT                   /translation="MVSAVKIMKKDEFQKSTANLKKAVPLMMKNRVSTTPANYALWYTY
FT                   VDNAIPQLTKDMDGILEYYGICPPAVGEQLYNNYVASKSETNINDLRANLELLVSEVSN
FT                   SMNDTLTDTSAFSEMIDKSFEDLARVDNESLSIDEVMSLVRQLVSESRHIRHSTQFLNS
FT                   QLNSATSEITKLKSQLVEVQKDALFDSTTTLYNRRSFDRDIETLCEAKQPLCLILLDID
FT                   HFKNFNDTYGHLFGDMVLKGIARKLKQMCREGISAYRFGGEEFAIIVPNKSLRIARQLA
FT                   DTNRRSLEKLSIKDRRSGQQVGSITASFGVAELEPGESAQSLIERADKLLYEAKSLGRN
FT                   RVMPL"
FT   gene            complement(370524..370754)
FT                   /locus_tag="VS_II0326"
FT   CDS_pept        complement(370524..370754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0326"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25748"
FT                   /db_xref="GOA:B7VQU3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25748.1"
FT                   /translation="MNKGQIMSNTNTGTVKWFNEEKGFGFISQDNGGADVFVHFRAIAS
FT                   EGFKTLKEGQKVSFEVENGQKGLQAANVVAQ"
FT   gene            complement(371098..372375)
FT                   /locus_tag="VS_II0327"
FT   CDS_pept        complement(371098..372375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0327"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25749"
FT                   /db_xref="GOA:B7VQU4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25749.1"
FT                   /translation="MTTLLIKNAKLQDQEGLKQILIENGQFSRILDNDAQINHQGDTLD
FT                   AEGGIAVSPFCEPHIHLDTTQTAGEPNWNISGTLFEGIERWAERKELLSIEDVKSRAKQ
FT                   TLKWQIANGVQHVRTHVDVSDPTLVALRAMVEVREEMKEWVDIQIVAFPQEGILSYPNG
FT                   KELLEEAVKIGADVIGAIPHFEFTREYGVESLHYVFDLARKYECLIDVHCDEIDDEQSR
FT                   FVETLAALAHKFEMGEKVTASHTTAMGSYNGAYASRLFRLLKMSGINFVANPLVNIHLQ
FT                   GRFDDYPKRRGVTRVKEMLAANINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVTQVMG
FT                   YDQINTSLDLISKNSARTLHIQDNYGIEEGKPGSLLILPADNGFDAVRRQVPVQYSIRH
FT                   GKIIAETQPAKTKINLDKTEDINFKR"
FT   gene            complement(372385..372720)
FT                   /locus_tag="VS_II0328"
FT   CDS_pept        complement(372385..372720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0328"
FT                   /product="putative cytosine transporter"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /function="7.5 : Nucleosides, purines and pyrimidines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25751"
FT                   /db_xref="GOA:B7VQU5"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25751.1"
FT                   /translation="MSIINGIIGTIFALWLYNNFVGWLTFLSLAIPPIGGVIIADFFAN
FT                   RKRYKDFANAEFQTVNWAGIIAVATGVAAGHFLPGVVPLNAVLGGAISYLVLNPLLNKK
FT                   ALKSQAA"
FT   gene            complement(372648..373622)
FT                   /locus_tag="VS_II0329"
FT   CDS_pept        complement(372648..373622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0329"
FT                   /product="putative cytosine transporter"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /function="7.5 : Nucleosides, purines and pyrimidines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25753"
FT                   /db_xref="GOA:B7VQU6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25753.1"
FT                   /translation="MAADNNYSLGPVPTSARKGVASLTMVMLGLTFFSASMWTGGSLGT
FT                   GLSFNDFFLAVLIGNLILGIYTSFLGYIGSSTGLSTHLLARFSFGTKGSWLPSALLGGT
FT                   QVGWFGVGVAMFAIPVQKATGIDTNTLIIVSGLLMTGTVYFGIKALMVLSAIAVPAIAI
FT                   LGGYSVLTAVDSVGGLEQLQLIKPETPMDFSMALAMVVGSFVSAGTLTADFVRFGKKPA
FT                   SAVLITMVAFFIGNSLMFIFGAAGAAATGQSDISDVMIAQGLLLPAIIVLGLNIWTTNE
FT                   NALYASGLGYLTSLVAQVLQCLSLTALSVRFSRFGYTTTSLVG"
FT   gene            373850..373924
FT                   /locus_tag="VS_II0330"
FT   CDS_pept        373850..373924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25755"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25755.1"
FT                   /translation="MNFTMNASDYDYEWVSVYWMDDVS"
FT   gene            complement(373934..374042)
FT                   /locus_tag="VS_IIm0331"
FT   ncRNA           complement(373934..374042)
FT                   /locus_tag="VS_IIm0331"
FT                   /product="Qrr"
FT                   /note="regulation of quorum sensing in Vibrio spp. bound by
FT                   Hfq"
FT                   /inference="profile:Rfam:8.1"
FT                   /ncRNA_class="other"
FT   gene            complement(374356..375579)
FT                   /locus_tag="VS_II0332"
FT   CDS_pept        complement(374356..375579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0332"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25756"
FT                   /db_xref="GOA:B7VQU8"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25756.1"
FT                   /translation="MLEGLALWALFIYLLRLIGMPWNKGTKAFSYLGGTSWLLFVWVGL
FT                   INYTPMDLSGGSVVQSPHIQLRPDSTNVSGKTTKVHIRPNQDVIEGQLIYEIDDTKYVI
FT                   ARDKASVQLESANVALDTARQEVSIAKVSYQSALEDIKASVAQIESAKTDLVLQSKTLD
FT                   RYQKQNKVVEHTITETDIDQQTAKVDLATYHVTTLESQLSKKEVDAENAKLNIHKAETN
FT                   VSKKQTEVDSAKATLAQAQWDLNSTKVTAPTDGFVTNFILREGQRVSMMPRIQMYTEEK
FT                   YVLMRVNHQAIRNVKVGQPAEFATAVYPGKIFSATVEGIVEATGEAQASLLGIDEQVRV
FT                   TTGRNLQNKHHFVRLKIDEAEGYDIPVGSVGLAWVSGEKPISFMAFLDVIRGIIIRMKS
FT                   QLYFFYSI"
FT   gene            complement(375573..375923)
FT                   /locus_tag="VS_II0333"
FT   CDS_pept        complement(375573..375923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25757"
FT                   /db_xref="GOA:B7VQU9"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25757.1"
FT                   /translation="MSLLSVPFVGTGADTALHVVAGVVLVATIAAACYGFWRVHELPIN
FT                   KAHSKEHHQLGLITALTWIGFIWHWVWVLAVILAFVDMEKAIINLRDTWKAPAEPTEQQ
FT                   VKNDQDGESQTC"
FT   gene            376058..377065
FT                   /locus_tag="VS_II0334"
FT   CDS_pept        376058..377065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0334"
FT                   /product="Hypothetical AraC-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25759"
FT                   /db_xref="GOA:B7VQV0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25759.1"
FT                   /translation="MNNCNFLRALGILGIYQHAVTNPVVNTERLGIPKSVFTNSMNLIP
FT                   VNEVDKWYGFLEQQTNDPDIILKLSDRVDIEKLGPLTNWFFSGHDLASTIRRVNIGLHC
FT                   LQSGAFLYGAQVGTMIKWCYDNPAYSETGKVHDSIRVAVFIMKILRRYLGDDFKPVAVS
FT                   IAGRRENIDLYHEYFGCTIQWGQPRTEVWIPSESRLSINQSLSNSKANLAMNFHDLDNY
FT                   LNMPDAGDEHKVTYEMINYSRHFGLPTLHKVSCLLGLSEQQFQRRLHKSGINFSTIMGY
FT                   ALSNVAVELLMYSVPVEEVSKRLGYTNVASFNRMFKKHRGLTPKQYIERFDSQY"
FT   gene            complement(377072..378061)
FT                   /locus_tag="VS_II0335"
FT   CDS_pept        complement(377072..378061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0335"
FT                   /product="putative urea transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25761"
FT                   /db_xref="GOA:B7VQV1"
FT                   /db_xref="InterPro:IPR004937"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25761.1"
FT                   /translation="MIRKDGQLNKIAYNLSYKRFNIAKECSQTMRTNKDILPFEGLLNG
FT                   IGQVYFTPSVMTSFLLLFAISIESLALAFLTLFGASCSYGFALLTNKPSHDIENGMYAL
FT                   NGALVGLFIGNFFGVTPFLVVVTMLGALLTVPIARIVFSFKKYRGYTSAFILTSWLIYA
FT                   IQSALDLSAFSPSNSALIPIISLEVGSWFSLPTAVLPLLKGISQVSFIDNALSGLVILV
FT                   AIALNNIKHALWVVLTVLISTVFSHMIGASGALIEQGLYGYNATLATLALVLYPRIPWP
FT                   LILLGMLLSCLITLGFHELSLLPLTAPFVLSTWIIVYLSTHFKKLDED"
FT   gene            complement(378058..378717)
FT                   /locus_tag="VS_II0336"
FT   CDS_pept        complement(378058..378717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0336"
FT                   /product="putative flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25762"
FT                   /db_xref="GOA:B7VQV2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25762.1"
FT                   /translation="MLSSTKRTTIKKGAHKAVFEQEKLHQIIDESLIAHIALQGEHGPM
FT                   VIPMLAWRVDDMVYIHGAKNSRLLKGLKKGEPTCLTFTLFDGWVLARSAFHHSAHYRSA
FT                   VVLGSFSVIDDNQEKDRLLNIFIEQIAPGRTDEVRLSNEKELTATELLAIPLTEASVKI
FT                   GKHGVNDDKADMDIPVWAGVLPYRTVVGPLETVPEQEGIIETPDYQQAYGERWYQN"
FT   gene            378808..380265
FT                   /locus_tag="VS_II0337"
FT   CDS_pept        378808..380265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0337"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25764"
FT                   /db_xref="GOA:B7VQV3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25764.1"
FT                   /translation="MQPIDVGDLQLDEQHDTRQTALFHAIREKIVQDLWSKGSKLPSTR
FT                   KLAVELSVSRNTVIYAYEQLVTEGYIESKQGSGFYVSVEQPEHFLSLSQPNSVQDPKVK
FT                   QTVSKPAANIATPNDINRRFAPGVPDLDAFPFAKWQRLLQRHSTRQNIAGNQEVQGSLA
FT                   LREALSGYLASSRSVHCSTDRIIITAGAQQAISIGLMATLAMGDKILVEEPGYRQVHKI
FT                   IDLLRLELDGVSVREKVGLDIEKVLSSNAKALYVTPSNQYPMGTTLNTEQRLKLIDWAN
FT                   QHQSWIIEDDYDSEFQFAHRPYTSMQGLAGKLGFDDRIIYVGSLSKVMFNGLRLGYLVV
FT                   PESLVAKCLEIKDALTGDTASHTQEALADFVREGDLLRHIRKMRRSYKLKHEAMIEAIK
FT                   SEFHGDLEVISQAAGLHVTVKWYQGISEHEWSRRAEFENIIIRPFDFYEYGSSDARDWS
FT                   GAVLGFGNIRLADIKPKIKQIARLFYQ"
FT   gene            complement(380313..381578)
FT                   /locus_tag="VS_II0338"
FT   CDS_pept        complement(380313..381578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0338"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25766"
FT                   /db_xref="GOA:B7VQV4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25766.1"
FT                   /translation="MTQLKQEITLISGIGQLSTTLLGTGLFMIPAIAAGIAGQLSLLAW
FT                   LILFIAICPIALTFAALGKRYPNAGGTAYFVRQAFSERLETSVAWLFVSVIPVGIPAAI
FT                   ALAGGFAQQLLPAPLDTPLGAQSFTIALLIAVNLMGSKSSGRLQTVIALSIFALVSAFV
FT                   WKADITAADIAVPTMTSDSMWSIGAALAVMFWCFVGIEAFAHMGEEFKNPQRDFPIAII
FT                   TGCFVAGLVYWACSVVIIKLGAYGSPEFDAASIPWVTEQLFGNGFKTVISVLGFFACFA
FT                   SLNLYTQSLSRMIWAQARQHTPTNKMAQLNSRGVPLYPTLAIGFIALISCVIGELSNLD
FT                   LEFFLKLANGIFVLVYLLAMLAACRLLTGASRYTAMISLVICTLVFICLSWSMLYAVTV
FT                   FVTLSLPWRKWLGKPTVSIDKL"
FT   gene            381822..382283
FT                   /locus_tag="VS_II0339"
FT   CDS_pept        381822..382283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0339"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25768"
FT                   /db_xref="GOA:B7VQV5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25768.1"
FT                   /translation="MDKFDRQILDILKTNARCSVSDIARDVSLSRSAVNARIKKLENDK
FT                   IITGYSAQVTEPDLPKNVGAYISLKFDMSSSNHNCESYAKNIYAIDGVQWCHSISGETD
FT                   MMLYVEVESMERLNQIRDQLQGYPELRHLMTHTVLTEFFNKQTSSFNMS"
FT   gene            382377..383324
FT                   /locus_tag="VS_II0340"
FT   CDS_pept        382377..383324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0340"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25770"
FT                   /db_xref="GOA:B7VQV6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25770.1"
FT                   /translation="MLGNINLNLLRSLHVLLEECHVSRTAQRLHITQSAVSRQLAQLRD
FT                   LCGDPLLVRDGNKLVPTNRALLLKGKLDDLLGEFDHLLDDKPFDPQDWQGELVLASSDY
FT                   VAQYILPIIVSEVSKDAPHINLAYRLWQPNFLETLNESGIHLASSMFPKKPDHVSSIKL
FT                   GEDKSVCLMRASHPLAKQSAISSEDIVNYSHIKVTGGGDKDSYSDIALKKQGHKRRIAL
FT                   QVPFFSSAGNVLMQDDYLMIVPEHIAYNLGRHLDVAYFSLPFETEMHTYWLMWHPKYDN
FT                   DSAHKWAREKAFKAIQKSSYNISMISNHTSDDNL"
FT   gene            383422..384039
FT                   /locus_tag="VS_II0341"
FT   CDS_pept        383422..384039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0341"
FT                   /product="LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25771"
FT                   /db_xref="GOA:B7VQV7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25771.1"
FT                   /translation="MMTVTIWFSLLAICLLGAMSPGPSLAMIAKHSLAGGRMNGLIAAW
FT                   SHAAGIGIYAFATIVGLAVVLEQSPMLFKGISLAGAAYLLYLGVNALRSKGGVAAKLEA
FT                   GEQMSYMQSAREAFLISILSPKIALFFIALFSQFVALGNELSNQVIIVSTPLIVDGLWY
FT                   TFITLVLSSPLIVERIRAKAQLIDRLSGVVLILLAVRVVWTI"
FT   gene            complement(384149..385312)
FT                   /locus_tag="VS_II0342"
FT   CDS_pept        complement(384149..385312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0342"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25773"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25773.1"
FT                   /translation="MHRNTILTLLALTTLSLVGCSNETTIPAYETSPNLPEYQQDSFDA
FT                   YVNETQDWLLKNRVFMTKDKQLEIRLNSPTEYKPAAPNGKAVLLVHGLGDSPYSFKDIA
FT                   THLAEQGYLVRTVLLPGHGSRVGDLMQPSLEDWQGVVAHHTKLLEQEYDSVWLGGYSTG
FT                   ANLVTSQAMNDPKISGLLLFSPAFQPSSSAVQYAELASYFVTWADQDPEDNVLRYNSLP
FT                   MNGASVYYQTSEVVREGLQDKHFDKPVFIMMSEGDSVIDTHFVQQAFTESMPNPNNVLI
FT                   WQGETTLDDPRAVQYSMKIPEQRISNGSHMGLLFSPSNPYYGINGSEKICSNGQEEGFE
FT                   AQCNATSEVWYSAWGYREEGKNHARLTYNPYFSDSMEKLDAVLNSEG"
FT   gene            complement(385366..385659)
FT                   /locus_tag="VS_II0343"
FT   CDS_pept        complement(385366..385659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25775"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25775.1"
FT                   /translation="MFMFRSEWKRYSNNIEKRGMNMKNILVTIVALFTGLLALFTSLIL
FT                   AIPLAIAALITGKRIQNQMKKQGFGAHMNTRQSSTSDAGVIEGEYEDLSSRK"
FT   gene            385873..387534
FT                   /locus_tag="VS_II0344"
FT   CDS_pept        385873..387534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0344"
FT                   /product="Hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25777"
FT                   /db_xref="GOA:B7VQW0"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25777.1"
FT                   /translation="MFCIQCEQTIQTPTVKGCSFAQGMCGKTSEVSDLQDVLVHSLQGV
FT                   SFWASLGRACDVIDTEVDEWAPKAFFATLTNVNFDPARIIEFAQQSHEFKQRLEQKVRA
FT                   AATLIGFEIPELSAAAQFDLPTDSSELLALAPQAAVNRGHDSQHEDVIGLRLLCLYGLK
FT                   GAAAYMEHARVLGQTDDAIFAEYHEIMAFLGTDPSDLKQLLDTSMQIGLMNYKVMEMLD
FT                   KGETDTFGHPQPTTVNVKTKKGHCILVSGHDLHDLEKILQQTEGKGINVYTNGEMLPAH
FT                   GYPELNKYPHLAGNYGSAWQNQQKEFANFPGAIVMTSNCLLNPDVGSYADRLFTRSIVG
FT                   WPGVDHLEGDDFSAVIDCALAQEGFKHDEIEQMITVGFGRNALMEAAPAVVEQVKEGNI
FT                   KHFFLVGGCDGDKSERSYYTDFTAQAPEDSVILTLACGKFRFNKNQFGDINGIPRLLDV
FT                   GQCNDAYSAIQLAIALSQEFDCGINELPLTLVLSWFEQKAIVILLTLFALGVKGIYTGP
FT                   TAPAFLTENLLKIMQDEFDMRSISTPEQDLKTILAA"
FT   gene            387647..388726
FT                   /locus_tag="VS_II0345"
FT   CDS_pept        387647..388726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0345"
FT                   /product="putative ferredoxin oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25779"
FT                   /db_xref="GOA:B7VQW1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25779.1"
FT                   /translation="MYAWSDSDSINLVCLKKWHETPDTVSFELGSIPQDLHFNFKPGQF
FT                   ITLGLDMPTKTDYRAYSVASCPEDNRLKLTVKRVEGGLVSNFIVDELDEGDEVSVLKPA
FT                   GAFNCIDCMPTATKKVTLVSAGCGITPVMAMAKYWLAQGSDIEIDFVHMARNKRETIYF
FT                   QELHQLDDAHSNFNLKLLLKDSEGTLAPQGRLDKNWLVKLSPDILDRTVYLCGPVGFMQ
FT                   NIESYLKELEFNMENFYQESFTPANPNTDSLANSNTASEESQAEASADSNGAVKVFVPA
FT                   FGAEVEAEAGTPLADSLEKAGVPIIIACRSGICGSCKCKVTKGSVESSSQETLTPEQIE
FT                   QGYVLACSSTIQSDVEVEL"
FT   gene            complement(388972..390408)
FT                   /locus_tag="VS_II0346"
FT   CDS_pept        complement(388972..390408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0346"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25780"
FT                   /db_xref="GOA:B7VQW2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25780.1"
FT                   /translation="MSPEKHLLDWQTSQTIAESIAPTLGQLYRQKGVEVILFGKTLVNA
FT                   TTIDIIKAHRIAKRYTGSPLTAEQTQPIIQHLLSMDLSPCRIDVGRLAHTFWQDREDTH
FT                   GLNDFLQTALLESLEGDAMTEPRDVVLYGFGRIGRLLTRLLIEKSGPGYPLRLRAIVVR
FT                   GGKDGDLEKRASLLRRDSVHGQFNGSIVVDQERKAIIVNGNFIQVIYANKPAEVDYTSY
FT                   GIENALVVDNTGVWRDAEGLSQHVACNGAKKVLLTAPGKGEIKNVVFGVNQNDIQPEDT
FT                   IISAASCTTNAITPVLKAVHDKFGVLSGHIETVHSFTNDQNLIDNFHSGDRRGRAASLN
FT                   MVLTSTGAAKAVSKAMPEMEGKLTGNAIRVPTPNVSMAVANLNLEKGTNKEELNEYLRE
FT                   MALSSTLSAQIDYTDSTEIVSTDLVGSRHPGVVDGVATIAQDNRAVLYIWYDNEFGYSC
FT                   QVVHCMEQMMGVRYKTYPEV"
FT   gene            391162..392187
FT                   /locus_tag="VS_II0347"
FT   CDS_pept        391162..392187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0347"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25782"
FT                   /db_xref="GOA:B7VQW3"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25782.1"
FT                   /translation="MINMSIRWRLIFLSTVSVFIMFGFTVNEVLKNDKKMNHLEATRIK
FT                   VEALQSFNAVSSGAYQWLVLSKDSPEKGPLFLELQAEVDRLAHYEIQLQQFDNSWTVEP
FT                   QLIELKSVLKKLARVTTSIDSDASQITVSNAQQIERAFDLLKGVLMELSEYRANIVDEK
FT                   ISQTDAMFINLTHYVFWTQREAWLSYRLYRSPELIDQYLLSYVGALERQQQLLGTFLRS
FT                   DSHSLEISKLLNMFSQDEFQDRFTSRLLKGDFSAPEIYEHVESLERKKLAISKAVGAYT
FT                   DQLKFDLTKNIALQKRQTAVMTLLILVVSGALLWLGVATSLRLNRNLSIILKGVSECAD
FT                   S"
FT   gene            392204..393817
FT                   /locus_tag="VS_II0348"
FT   CDS_pept        392204..393817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0348"
FT                   /product="putative sensor protein"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25783"
FT                   /db_xref="GOA:B7VQW4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25783.1"
FT                   /translation="MIHIQGNDELAEFTETLNRVMERNYHHNKELIIAKEDAISANKAK
FT                   SAFLANMSHEIRTPLNGIIGMAEILSQSQLSANQQEVLEDIESSSHSLLVLLNDILDLS
FT                   KIESGNLMLSPHNADLREAVYDSVSVILSKAISKDIELDINIDAQTPTQLFFDEYRVRQ
FT                   VLTNLLSNAIKFTSKGTITTDIAYTPMSLGRGKLECSVSDSGIGIEPEKLESIFEPFTQ
FT                   EDGSITRQFGGTGLGLAICRQLVDLMGGYITARSVKGGGSTFTFCLYVDTVEAHAQTFD
FT                   NLSRATIISNSFNYLDQLVKECERLNVRPNVVSSISDLGESLKESDLVLYCHTLHHSMR
FT                   KDLEALKALYPLTRVIVCQHHLFKTNLITETVHSTHTLPFLGRRFLNSLRSLDAGEVQS
FT                   PTVEVKDEEVRSLNRRILIVEDNLMNQKIASFFLEQAGYEYLIASNGQEAVDVITQGAQ
FT                   FDAILMDCMMPVMDGITATRVIREWETDQQTPPLPIIALTASVLEEDIKNCFEAGMNAY
FT                   LPKPYKSHQLYDLFSSLDIV"
FT   gene            complement(393850..394086)
FT                   /locus_tag="VS_II0349"
FT   CDS_pept        complement(393850..394086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0349"
FT                   /product="putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25785"
FT                   /db_xref="GOA:B7VQW5"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25785.1"
FT                   /translation="MKTMTQRFQTLLSVSNFSLAITALLMLLSIIVAYPMADYFSLPIQ
FT                   IFAHISTILVAGLLKISYVGRCVAQYSLGQEVR"
FT   gene            complement(394251..394877)
FT                   /locus_tag="VS_II0350"
FT   CDS_pept        complement(394251..394877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25787"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25787.1"
FT                   /translation="MYGSILITLALSTTQPYPEKFEKLYTEETEITYDDLVVDVHGYKV
FT                   PTRSAFRGWMLLNHAQDQVKAIGQQLKDNGITQSMPLHLVLLQGTDWAMSNTTLFTLPN
FT                   KKHVPKMINTLKYIQQYIEPEIGIVIPVSGERTDIYNKQAGGALRSKHLEFCALDLVPA
FT                   NDITRENLHVKLKKIHAEFGQKNNVGLGLYSGVRFHIDTCGFRQW"
FT   gene            complement(395048..395362)
FT                   /locus_tag="VS_II0351"
FT   CDS_pept        complement(395048..395362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0351"
FT                   /product="Hypothetical UPF0265 protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25788"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25788.1"
FT                   /translation="MSSVFEIVNQARRKNKLKRELLDNEKKVRDNRKRVDLLDNLLDYI
FT                   KPEMTHDEILGIIKNMKADYEDRVDDHIIKSAEISKARRDISRRIRELTEEDKQTQGKK
FT                   "
FT   gene            395459..395758
FT                   /locus_tag="VS_II0352"
FT   CDS_pept        395459..395758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25790"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25790.1"
FT                   /translation="MFNYSSLSLTYDCFYLTVQVSIPFRYCIDTTCEMNQQQLETEDLG
FT                   DDVVESSAEQNKLRDAYVQERTNLEVVEIELNRSKIIMIDEQGRKKRVPILSEH"
FT   gene            395822..396478
FT                   /locus_tag="VS_II0353"
FT   CDS_pept        395822..396478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25792"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25792.1"
FT                   /translation="MNTVLSPIEARIIGCLIEKEVTTPDHYPLTLNSLTTACNQKSNRE
FT                   PVLSLSESDVLDAVDGLIGRRMVSDESSFNSRVNKYQHRFCNTEFGDLQFTEQERAIIC
FT                   CMLLRGAQTPGELRTRTGRLANFSDVKEVESILEKLVAREAGALVVKLPREAGKRESRY
FT                   QHLLSGEVDIEAFATASVSAVSSSASSEKFEELESEVASLREEVAELKALVESLL"
FT   gene            396479..396793
FT                   /locus_tag="VS_II0354"
FT   CDS_pept        396479..396793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0354"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25794"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25794.1"
FT                   /translation="MSESDKNADWVVYLIRNRHNALYCGVTNNLERRFEQHQTGKGAKA
FT                   LKGKGPLKLVWSIGVGSKSEALKTEYAIKQLPKSRKEKLVSLKLIIEWQQDKIQYIPVS
FT                   "
FT   gene            397101..398195
FT                   /locus_tag="VS_II0355"
FT   CDS_pept        397101..398195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0355"
FT                   /product="Autoinducer 2-binding periplasmic protein luxP
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25796"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25796.1"
FT                   /translation="MKRLLILLGVAVFSASALSHGTHVLNGYWEYQDYLTKFPEQKALT
FT                   DKMVEAVQNLPVPLRQVQDEPITISVVYPGQQISDYWVRNIQAFEKRLDKLRINYQINQ
FT                   VFTRDNANPSQQSISLQEAIENKTDYLIFTLETTRHRKFIEHVLSSTDTKLILQNITTP
FT                   VRAWADRQPFMYVGFDHMTGSLKLADYFKQVSEPDSKYSVLYRSEGYISDARGDTFIHD
FT                   VNSDTNFALKSSFYTKSSKESGYQAAKISLANDKDLNFIYACSTDVALGAAEAIRESGR
FT                   DVLVNGWGGGSAELEAIARGDLDVTVMRMNDDTGIAMAEAIKWDLTGLEVPTVYSGEFE
FT                   IVTKEDSPDRILELKQRAFRYSDQ"
FT   gene            398195..400780
FT                   /locus_tag="VS_II0356"
FT   CDS_pept        398195..400780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0356"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25798"
FT                   /db_xref="GOA:B7VQX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015387"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25798.1"
FT                   /translation="MKKSYAITPKNTLAKLITRIIILVIGVMALGVLIHNYETSSRIVK
FT                   QETNRTVKQTSSLIQNMFDYRLSVLQIHQDSPQDSSSHSETLREYFDTNNEEALSYFFY
FT                   GVDQREPDHAPDLRFVSTYNGLAWEDGNGQFYGLDESSLKHISDEVAFSSNWHFIQLTT
FT                   DIGKRHLLARRTPIVDNKTGEVLGQLYVAIVLDNNFSLAESIQQGSNCENIVIEAHGTP
FT                   VTSTFSGDESYTIKDVLSYEMYEQLPRHFVTIATIKINAVETPLTIRAIQKNTNLIALE
FT                   DNYERTIIVMIVVIIIMSFLARSWIQRRVAAELDKLMEFTRSASGNEEFSKFDGSNIFE
FT                   FHHIGCTLEDTFERLSEQHQKFQDLFNFAHSPILVWSEKGDLIQMNPAARMALFDEDDN
FT                   YGAMAREFELRMLPNIQMVVQGSKLTGINVPIGEKVFRWNMSAIRVEHGITGVVVQGQD
FT                   ITKLIEAERQADRAREEAEHLASVRADFLAKMSHEIRTPLNGILGVSQLLKRSIHDEDN
FT                   RDQVDVLCHSAEHLLAVLNDILDFSKIEQGQFNIQKKDFLLGELVNTLDSIYRPLCEDK
FT                   SVEFTIVNHLIDDIKIHTDQVRLNQIMFNLLSNALKFTHQGSISVSFEIESILNTDFAS
FT                   LIVRVKDSGIGIDESKIDAIFEPFVQAEETTTREYGGSGLGLTIVKNLVDMLEGDIQVR
FT                   SVKDQGSEFIIEIPVELHSKPLFVDVKKQAHIEPEALFSRSLKVLLVEDNHTNAFIAQA
FT                   FCKKYGMVVTWAKGGLEAIELAKNTVYDLILMDNQLPNLGGIETTQQLREQIGVTAPIY
FT                   ACTADAQESTRERFMAAGANYVIVKPIKEASLHKAFVHFKQLYWDDTQH"
FT   gene            400737..400919
FT                   /locus_tag="VS_II0357"
FT   CDS_pept        400737..400919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25799"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25799.1"
FT                   /translation="MFISNNCTGMILSIKSKLESESLIQGNNGLLLLKNKIHCFRYVLD
FT                   GEILNGTANLIEYSG"
FT   gene            400885..401235
FT                   /locus_tag="VS_II0358"
FT   CDS_pept        400885..401235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25801"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25801.1"
FT                   /translation="MELQTLLNTLADTPESVQFEDTIQVIEAHYDFAESEFRNGDVVNA
FT                   AGQNNGSCKIFAFGLEQGLSAEQTLACFGQFYRNDVLGFPDNTDHQNIRNFMTHGWSGV
FT                   QFSQPALIAKSK"
FT   gene            complement(401372..401680)
FT                   /locus_tag="VS_II0359"
FT   CDS_pept        complement(401372..401680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25802"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25802.1"
FT                   /translation="MKTPCRAACKNNGGMCSGCFRTMDEIIGWKGLSEDERTSVMDNLS
FT                   GESSTHQCPQCHEPAQCDISAGKETCWCFELEKRDTSNIPKTGACMCRKCLSALPIQ"
FT   gene            402093..403457
FT                   /locus_tag="VS_II0360"
FT   CDS_pept        402093..403457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0360"
FT                   /product="putative heat shock protein 70 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25804"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25804.1"
FT                   /translation="MGDIMFIGFDYGTANCSVAAMVDGEPSLLPLEGSNHYIPSTVFAP
FT                   TRESVSEHLFRHLNIKPSDAIGEQVLRRAIALNREESIDLVPEDMAFGQAALDLYLEDP
FT                   RDVYYVKSPKSFLGASGLHDVQVSFFEDLVCAMMANIKHQAEITTQESIKQAVIGRPIN
FT                   FHGRGGEEANRQAEDILSRAAKRAGFLDIAFQFEPVAAGLDYESTLTENQTVLVVDIGG
FT                   GTTDCSLLEMGPSWSGKANRTQSLLAHSGQRVGGNDLDIYLAFKQLMSPFGMGSKGISG
FT                   IDMPLTQFWNPIAINNVEAQKNFYSRENLAALKLLRKEASEPQKLDRLMKVYHDTLGYS
FT                   IVRRAEEAKIALAESSQYRTAINVASELIEVDISVEQMIEAIETPKSKMIELVKEAIQQ
FT                   GQKKPDVIYMTGGSARSPILREAVQQAVPNVPIVSGNYFGSVTSGLARWAEVCFK"
FT   gene            403968..405026
FT                   /locus_tag="VS_II0361"
FT   CDS_pept        403968..405026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0361"
FT                   /product="outer membrane protein N"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25806"
FT                   /db_xref="GOA:B7VQX7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25806.1"
FT                   /translation="MNKKLLALAISGAVFGTQAVAVELYNEDGTAFSVGGHVSVNLNGS
FT                   EKGDTDVGTNSPRINFNATQELGNGFTADAKGEWALNYLNGGDESFTTRLGYVGLTHDE
FT                   LGRAVAGTQWAPYYDVASATDMPIAFANDFLYDNHGALGTGRADKMASYRNGFDFGEAG
FT                   ELSFGLGWQGSNTVTTDVYDDTDINDIIHSRTTVAYDDRIQATLGYSIAGVKLGYAFNT
FT                   GDFKEGGVSKTAESHLVSAAYGSYGSGLYLAGIYASNENMNAGLEESDAYELLAAYALA
FT                   NSLNLSVNYEVVEGEATKGAATQTDREELALQAEYNFTSNVVGYTGYQFDLNDADNRKT
FT                   DDKWTIGARFYL"
FT   gene            405444..406049
FT                   /locus_tag="VS_II0362"
FT   CDS_pept        405444..406049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0362"
FT                   /product="Fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25808"
FT                   /db_xref="GOA:B7VQX8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25808.1"
FT                   /translation="MMNSKRTATPSKVLCIGRNYVDHIEELNNVIPDSMVVFNKPSTSV
FT                   TSSLSSFHQETLHYEAEICFIVENGEYSAVGLGLDLTKRELQSSLKAKGLPWERAKAFD
FT                   GSAVFSRFVPIDNLDLSDLNLELFINCVRVQKGHVEQMLYSPQTILEELSSYTTLLDGD
FT                   VVMTGTPKGVGEVHQGDIFLGRLKCGETTVIEIEWVAR"
FT   gene            406200..406832
FT                   /locus_tag="VS_II0363"
FT   CDS_pept        406200..406832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0363"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25810"
FT                   /db_xref="GOA:B7VQX9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25810.1"
FT                   /translation="MIDLTILPVYLTAVVALLLLPGPDMLLIASSSMSYGRKVGVFASL
FT                   GNATSGIILTVLAAMGVSALIAMSPVALKALHLLGGAYLLKMGWDCLRTEQGNAPELSD
FT                   NRAAKAYYQRALISNLLNPKALVFFVMFLPQFVSTSIEATSGEQMLVLGLLLNVLGLTF
FT                   NFLLVALVGTIGKSLVENAKFRTYQQKVMGGVFIVLAVWMLSSFFTS"
FT   gene            complement(406960..408690)
FT                   /locus_tag="VS_II0364"
FT   CDS_pept        complement(406960..408690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0364"
FT                   /product="Probable phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25811"
FT                   /db_xref="GOA:B7VQY0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25811.1"
FT                   /translation="MIMQDAMNWLARDPDPRTREELQYLIDEGMHDELEDRFIQRLEFG
FT                   TAGLRGKVGCGPNRMNRLVIQETATGLGHYLIEHVANAPMRGVVVGYDGRLDSKQFAID
FT                   TASVLTALGIKVYLTSNVAATPIVAFGIEHFNAAAAVVVTASHNPPEYNGFKVYWENGA
FT                   QIIPPHDAGIAAEIDIASTKPIPLMSLSDAETQGKLVWLTEGYYQTYRAAINQSPHVSK
FT                   EIESANTTITYTAMHGVGAQMAEDLLHDSGFHKVFSVAEQREPDGHFPTVNFPNPEEKG
FT                   AMDLVVNLAKSVDADIACANDPDADRFAVAVRTDDKVRTEDASYKMLTGDQVGVLFAHY
FT                   LLSKPHTKNQLVGNSIVSSTLLEKVANSHGATYFQTLTGFKWLANIGMQLEDEKNEFLF
FT                   AYEEALGYTIGTQVRDKDGLSAIVVFAQLVEELKSQGRTVWDLLAQISFEHGVHTNAQR
FT                   SIALDPDSPSIGSKLRSAQPKVINGVAISVIEDLQSSLRFIVGGATEAINLPASDVLIY
FT                   HLEDGSRIIVRPSGTEPKVKVYYETVTKFEGTETYDDTRKRGEEYMDRLIEQHQKELNS
FT                   "
FT   gene            409209..410468
FT                   /locus_tag="VS_II0365"
FT   CDS_pept        409209..410468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0365"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25813"
FT                   /db_xref="GOA:B7VQY1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25813.1"
FT                   /translation="MKRLLVRLAWLLKSFVVVLVSPLVHASSEYNMTQGVTEISGKVYE
FT                   LHMLIFYICCAIAFVVFGVMFYSILRHRKSKGAVAAHFHESTKVEILWTIIPIIILIAM
FT                   AIPATKTLIAMEDTSQSDLTVKITGSQWKWHYSYFGEDVEFFSLLATSDKEIEGIEVKG
FT                   AHYLLEVDKPLVLPINRKVRFLMTSDDVIHSWWVPAFAVKKDTIPGFINEAWTKIDEPG
FT                   VYRGQCAELCGRAHGFMPIVVHAMEEAEYDAWLAEQKELAVAAQQAAQDALDASLSLEE
FT                   LNTIGEEVYKTRCAVCHQVNGEGIPGAFPAIKGSPIALGDVDVHIDTIVYGRGGTAMQA
FT                   FDNQLTEKEIAAVVTYQRNAWGNDTGDIVQASDVNAYKAKQEGGEQASDEQGSTDETQG
FT                   STDETQGLMDEAQNDAKEQL"
FT   gene            410465..412126
FT                   /locus_tag="VS_II0366"
FT   CDS_pept        410465..412126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0366"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25815"
FT                   /db_xref="GOA:B7VQY2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25815.1"
FT                   /translation="MSSPINKPVKSAPAEDQALSHSAEGTLGNNDLPVDDHDSHAAPKG
FT                   WARWLYSTNHKDIGTLYLWFSFAMFLTGGAMAMVIRAELFQPGLQLVEPDFFNQMTTVH
FT                   GLIMVFGAVMPAFTGLANWMIPMMIGAPDMALPRMNNLSFWILPFAFLILIGSLFTEGG
FT                   GPSFGWTFYAPLSTTYGPDSTALFVFSVHIMGISSIMGAINVIVTIVNMRAPGMTWFKL
FT                   PMFVWTWLITAFLLIAVMPVLAGAVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGH
FT                   PEVYIMILPSFGIVSAIIPAFSGKRLFGYHSMVYATCSIALLSFLVWAHHMFTTGMPVF
FT                   AELFFMYCTMLIAVPTGVKVFNWVATMWRGALTFETPMLFAIAFIVLFTIGGLSGLMLA
FT                   IVPADFQYHDTYFVVAHFHYVLVTGAVFSIMAAAYYWLPKWTGHMYDHKLSLWHFWTSV
FT                   ISVNVLFFPMHFLGLAGMPRRIPDYAIQFADVNQVVSIGGFAFGLSQLIFLWLAIKCVR
FT                   GGEPAPSKPWDRAEGLEWTVPSPAPHHTFTHPPKVD"
FT   gene            412138..412812
FT                   /locus_tag="VS_II0367"
FT   CDS_pept        412138..412812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0367"
FT                   /product="putative cytochrome c oxidase assembly
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25817"
FT                   /db_xref="GOA:B7VQY3"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25817.1"
FT                   /translation="MSDKQSDPNQDKKQPKRLSNKRSTQKLTGYLVLSVVAMFGFGFAL
FT                   VPLYDVMCEALGINGKTNTVSAVQPQGMLPDYSRTVRVEFMSHIKPDMPWQFSPEVRVL
FT                   EVHPGEMVQTNYIAKNLSGASLVGQAVPSVSPGMGATYFNKMECFCFNQQPLDGHKSAE
FT                   MGLIFYIEPDIPESIHTLTLSYTLFNITSQVSGEASKPEVSTSTLNTLQSGSPKASTLA
FT                   SN"
FT   gene            412851..413735
FT                   /locus_tag="VS_II0368"
FT   CDS_pept        412851..413735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0368"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25819"
FT                   /db_xref="GOA:B7VQY4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25819.1"
FT                   /translation="MSSKKEVYFVPHQSHWPLVGAVALFLVAVGAGLTVQNMGTDAAGG
FT                   VFGKAVLLVGFCVLLYMLAGWFSNVITESLSGVYSEQISRSFRQGMSWFIFSEIMFFGA
FT                   FFGALFYARMISVPWIGGAGNNAMTHEVLWPMFQSMWPLTTTPDGVTTEAMSWQGIPLK
FT                   NTIILLLSSVTLHMAHLSLEQNKRMALIVWLEVTIVLAGFFLFFQVEEYLHAYQEMGLT
FT                   LQSGIYGNTFFLLTGFHGLHVCLGTIFLIVLLVRVAKDHFTPKDHFAFQAGSWYWHFVD
FT                   VVWLGLFVFVYVL"
FT   gene            413858..414820
FT                   /locus_tag="VS_II0369"
FT   CDS_pept        413858..414820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0369"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25820"
FT                   /db_xref="GOA:B7VQY5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25820.1"
FT                   /translation="MSLFPLCLPEAIWIRPFIKLKAIKNSKATKTTLNNRTKVDDAIVI
FT                   TPNRLIDDEHKFRSKGFWIAVVLTVVSVGALIKLGLWQLDRGNEKLRYEQQLSERAQQS
FT                   PRSLDTVISEWKDSRTQAQGSSELPSLNGLRVDVELETPSGLVVLLDNQINQGTVGYVI
FT                   YMLGEVRFKDENNSLVAEKQLLIDLGFVAASNDRRELPQLGNITLPTNMSGRLYTRSVN
FT                   PLSHELGLENTMPKRIQNINITALSEYTGQEVLPFVFQPQSLDSWPYEMLWRPTAMKSE
FT                   KHFGYSFQWFVMAAVLLFLTMLIGYRYLKATPITRNKDG"
FT   gene            414861..415421
FT                   /locus_tag="VS_II0370"
FT   CDS_pept        414861..415421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25822"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25822.1"
FT                   /translation="MAELRSRRTKGRLVLIGLVLIFALPAIIAKTVLDKNWYTSGVTNS
FT                   GELVEPRITLADFGVTVPMAGEGWVVGYIAPTECESLCEQQLHYLNQSYLALGKNKERV
FT                   TAVVFVSEGNSLSGSLNKPDLSLLAGGDQLSTEFSPASIVIIDPLGQLVMEYKSVSDPS
FT                   QLVSQSKGMIHDLRKLLKLSRVG"
FT   gene            415571..416593
FT                   /locus_tag="VS_II0371"
FT   CDS_pept        415571..416593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0371"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25824"
FT                   /db_xref="GOA:B7VQY7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25824.1"
FT                   /translation="MMRLTILLTLTVIVLGAYTRLSDAGLGCPDWPGCYGKITVPSDAQ
FT                   AVNQANLQFPERALEADKAWIEMIHRYFAGTLGLLIFVVVAWCIKKNITAAGLPLFISA
FT                   TVIFQALLGMWTVTLKLMPVVVMAHLMGGFTLLSLLCLLYCRLSQFQSRFGEASYSSTL
FT                   KAWTLFGLFIVVGQILLGGWTSSNYAALVCTQLPICEGNWMSYLDFKNAFDFAQHGHDN
FT                   YEFGVLEYPARLTIHVMHRFGAIVATLTVLMIVYQLWKFGQVPHQKLSVIVALVLFTQI
FT                   SLGISNVWFHLPISVAVLHNLVAAMLLISMVVTNFVVWQRKPSESLVKNSVLQGGNHGQ
FT                   "
FT   gene            416583..417557
FT                   /locus_tag="VS_II0373"
FT   CDS_pept        416583..417557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0373"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25826"
FT                   /db_xref="GOA:B7VQY8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25826.1"
FT                   /translation="MVSRTSTQHGVVVQGVASTPKITANNDIALSNETAAKNKATWKIY
FT                   LTLTKPKVVALMLLTALVGMCLAVPNGLPLQQTLFGMIGIGLMAGSAAAFNHLIDKKID
FT                   GQMTRTNRRPLPSGELSSARVFSFAAGIGLLGFVTLVVWVNQLTAWLTFASLLGYAVIY
FT                   TMYLKRATPQNIVIAGIAGAMPPLLGWTAVTNELHSNAWLLVMIIFIWTPPHFWALAIH
FT                   RRDEYAKVNIPMLPVTHGIEYTKTSILLYTLLLSIVCILPVLVGMSSWIYLSASLVLNG
FT                   GFVYHAWVLKYRDEPNIAMKTFKFSIYHLMILFVALLADHYLL"
FT   gene            417691..418044
FT                   /locus_tag="VS_II0374"
FT   CDS_pept        417691..418044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25828"
FT                   /db_xref="GOA:B7VQY9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25828.1"
FT                   /translation="MEFTEQDRDALYQTWMSQKSRMRITQMEFSKKLGMNQLDFSRVLR
FT                   GEKALTMSFVSHFCRLLHLEPRNVLPSLKEDNESGPKVVYLKSRMSVDGEIQNAYIEGN
FT                   QVIVEYAHTVQNH"
FT   gene            418162..418812
FT                   /locus_tag="VS_II0375"
FT   CDS_pept        418162..418812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25829"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25829.1"
FT                   /translation="MLVATSMFLFGCAGGPIKTATKFTSYEDFRPGPDGGVDLVWARIG
FT                   LRDEQRLKSKLDAYDSVVIDRVFVLAEEGTLDQEDIQELTDHMVSRLEAKISPHKTIVD
FT                   EPTGNTLRLSIALSNVETPNPILAVTSSVLPFGLAMSTISKVTTGEHTNVGSASVELLV
FT                   SDAQDGTPLFAAIDREAGNKDFSTMIDSLDDAKDAINYWVERLGDTLQNIDDV"
FT   gene            418825..419043
FT                   /locus_tag="VS_II0376"
FT   CDS_pept        418825..419043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0376"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25831"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25831.1"
FT                   /translation="MLEKENLIKLARMQMPFGKYAGRTLIDLPEEYLLWFDKKGFPQGE
FT                   LGDLMQLCLALKIEGLDSVVQPLKYDY"
FT   gene            complement(419340..419477)
FT                   /locus_tag="VS_II0377"
FT   CDS_pept        complement(419340..419477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25833"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25833.1"
FT                   /translation="MQAHIAADVTLVIIFNHPSFQLLINNLKVDARFIRAHSELKTTLI
FT                   "
FT   gene            419627..420304
FT                   /locus_tag="VS_II0378"
FT   CDS_pept        419627..420304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25834"
FT                   /db_xref="GOA:B7VQZ3"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25834.1"
FT                   /translation="MENLSIKIPLFKTLGVITAFNAILVFGGTIASVVAVDSITAKYQS
FT                   AKEDINKANMEYLKAKNELNNVESQVKILKVLIESEINNMTKEVKDKMETAIENINASA
FT                   NTVSNKKDIGLIDIGSAVKSIADKKGASLIGIDSTVKSIIDKKDAGLIVIDSALKSIAD
FT                   KKDVGLLDIDAAVKSITDKKDASLSDINISVNPILDKKRIPLSGVNTGKVEKDVVKQTN
FT                   IKG"
FT   gene            complement(420608..420964)
FT                   /locus_tag="VS_II0379"
FT   CDS_pept        complement(420608..420964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0379"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25836"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25836.1"
FT                   /translation="MVLNCTGGTMSDYSYFCGIDLAKNHFSLHAVDQNGKVILHKSVTR
FT                   SKLLTTIANMPLMRIGVEACGGAHYWARTLYKLGHDDRIMAVKYVIPYRTKGKNARIIW
FT                   SLLHNQTEYENYAA"
FT   gene            421035..421463
FT                   /locus_tag="VS_II0380"
FT   CDS_pept        421035..421463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0380"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25838"
FT                   /db_xref="GOA:B7VQZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25838.1"
FT                   /translation="MRFSYRSQKANEEALWQLEVAKLYIDYAKYCSTLFSSLLAGQVTL
FT                   LGAVFSELESREFAVYAIVLMVFAVASAYSIAETELRRLRVREIDRDFPRYAVLKKYFP
FT                   NHTLVQTGKSFLTGILVVSSICCYLYFLHLGNVIKLSL"
FT   gene            421959..422291
FT                   /locus_tag="VS_II0381"
FT   CDS_pept        421959..422291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25840"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25840.1"
FT                   /translation="MKSVFVESTIFEKYRNEYLSDDEFRLFQAELMSNPKQGDVIQGTG
FT                   GLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLTIYGKNEMSDLTADQKKQLKAFMEA
FT                   WRNEQS"
FT   gene            422278..422592
FT                   /locus_tag="VS_II0382"
FT   CDS_pept        422278..422592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25841"
FT                   /db_xref="GOA:B7VQZ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25841.1"
FT                   /translation="MSNRDLFAELSTALVEAKEHSESKLTLKTHQVNNISELDISPNEI
FT                   VSIREQFNMSRGVFARLLHTSSRTLENWEQGRSAPNGQAVTLLKLVQRHPETLSHIAEL
FT                   "
FT   gene            423194..423523
FT                   /locus_tag="VS_II0383"
FT   CDS_pept        423194..423523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25843"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25843.1"
FT                   /translation="MTYCKINEMKVSPTMAGYLREIESKVELGNLLAISVSSIPLLELF
FT                   TTRVAPHTRIKEIGEYDWEQFGSAMLSIYPTTRRLVNVIADEARLYSKNRQEVQFWSCV
FT                   YDATR"
FT   gene            423438..423962
FT                   /locus_tag="VS_II0384"
FT   CDS_pept        423438..423962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0384"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25845"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25845.1"
FT                   /translation="MLLLMKLACIVKIDKKSNFGVVYMMRLGSLVLILLSNSLFANELS
FT                   SAHVKLNSKTDYCLGLQSEGMNAVDNEWLSSLSDFDLKVTLLELNRLAMTRCVQVEFKD
FT                   YTYQLFQASIQLGDIKPMKVWFDLNYRSQPEEFKSSKKKLADEIKNLSKLDAFYLPFDT
FT                   KKYYEAIRKVK"
FT   gene            complement(424285..424524)
FT                   /locus_tag="VS_II0385"
FT   CDS_pept        complement(424285..424524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0385"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25847"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25847.1"
FT                   /translation="MVLNCTEGTMSDYSYFFGIDLTKNHFSLHAVDQSGKVLLHKSVTR
FT                   SKLLTTIANIPPMRIGVEACGGAHYWARTLTHEL"
FT   gene            424597..425118
FT                   /locus_tag="VS_II0386"
FT   CDS_pept        424597..425118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0386"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25849"
FT                   /db_xref="GOA:B7VR01"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25849.1"
FT                   /translation="MITDDYMSEAVVYVVFWLICLFITIKFVLFSKNKNRSVLHSRLAI
FT                   SGFIIGGATALFLAFTFSLQSEAIGELNKEMTDPKNANLKDINQALLLAINSYFEIFKQ
FT                   VVTVFGSGIGASLLASGLVMKAQFGYDDHCDNTRIQNDSCQDIASSKERSLLKFSRVSK
FT                   SVKAAFQNNI"
FT   gene            425805..426857
FT                   /locus_tag="VS_II0387"
FT   CDS_pept        425805..426857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0387"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Phe-sensitive"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25851"
FT                   /db_xref="GOA:B7VR02"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25851.1"
FT                   /translation="MFQTDDVRINKVKELLPPVAVLEKFPATEIASSTTFESRKAIHNI
FT                   LEDSDDRLLVIVGPCSIHDTEAALEYGKRLKVLRDELGDNLEIVMRVYFEKPRTTVGWK
FT                   GLINDPYMNDTFKLNDGLRLGRKLLLDLTDMGMPTASEFLDMITPQYVADLISWGAIGA
FT                   RTTESQVHRELASGLSCPVGFKNGTDGNIKIATDAIRSASASHHFLSVTKYGHSAIVET
FT                   AGNPDCHIILRGGKEPNYSAEHVGKIKEELEASGLPQKVMIDFSHANSSKQFKRQMNVS
FT                   DDVSAQISGGDKAIFGVMIESHLVEGRQDLVDGKAATYGQSVTDACIGWEDTETVLRQL
FT                   AGAVEARRNK"
FT   gene            complement(426970..428394)
FT                   /locus_tag="VS_II0388"
FT   CDS_pept        complement(426970..428394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0388"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25852"
FT                   /db_xref="GOA:B7VR03"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25852.1"
FT                   /translation="MKPTLDLNCFKNNDIRGIIGDQINGYFAYLLGKAFGEYALSTTPE
FT                   ASFDGLAQVVIGRDNRETSLSLQEAMTKGLIESGITVVDLGMTGTEEVYFATRHLGAIG
FT                   GIQITASHNPINYNGMKLVGLDASPISKNSGLDEIKRRIKILNQELNCNLPFVHAQPSN
FT                   SSRSTSILAPYVDHLLSYISPSELSPMKIVVNAGNGVAGHVIDALEKKFNELSASITFI
FT                   KVHHTPDGNFPNGIPNPLIIENQIATRNAVLEHSADLGIAWDGDFDRCFFFDEKGNYIE
FT                   GYYIVGLLAEAFLLKEPNATVLHDMRMTWNTIEIAHKRGGKAIGIKAGHALIKEKMREL
FT                   NAVYGGEMSAHHYFRDFGYCDSGMIPWLLVIELIGETQQSLHQLTSSSMDKFPSSGEIN
FT                   RRVSNPEEVMACVLLHYRDNAVEIDHTDGLSMNMGTWRFNLRKSNTEPLIRLNVETKQD
FT                   RTLLSLKVDELLSFLI"
FT   gene            complement(428410..429990)
FT                   /locus_tag="VS_II0389"
FT   CDS_pept        complement(428410..429990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0389"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25854"
FT                   /db_xref="GOA:B7VR04"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25854.1"
FT                   /translation="MVTWRQYSNTPNYHSMILPVILAGGSGSRLWPLSRELYPKQFLNI
FT                   AGEQSMLQQTLQRLQGLEDYLTDSKCAAPFIICNEEHRFIAAEQARSANIQHSGILLEP
FT                   VGRNTAPAIALAALQALGKSTNNEQDASDPILLVLAADHHIANTSEFQQVISRGVDYAK
FT                   QGKLVTFGITPNAPETGYGYIKQGEPLSPLVQADSRITEQSTHHAYTIDCFVEKPDKAT
FT                   AEEYIRSEQYLWNSGMFMFKASRYLEELSQHHPEILAACQLALSKQNTDLDFIRIDAEA
FT                   FKNSPSDSIDYAVMEKTSHATVIPMDVGWNDIGSWSAIWDVSDKDEHNNVIEGDVLTVD
FT                   SQHNYIHAENKLVATVGVDNLIIVETKDAILVANKDKVQGVKSIVSQLNQAGRTEHIHH
FT                   REVFRPWGKYDVVDLGKRDKVKRITVKAGHKLSLQMHHHRAEHWVVVAGTAKVINNEKT
FT                   YLVEEDQSTYIPLGHIHSLENPGDSPLEMIEVQTGSHLSEDDIIRYQDSYGRDVRNQQA
FT                   SSSQNNKSK"
FT   gene            complement(430125..431237)
FT                   /locus_tag="VS_II0390"
FT   CDS_pept        complement(430125..431237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0390"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25856"
FT                   /db_xref="GOA:B7VR05"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25856.1"
FT                   /translation="MNEFITQVQTYINQSHSDWANSVLFITIASFLAWVAWRIIHNRLE
FT                   ILVQKTPFHWDDLLLEALKTPVSTLLWCWPATVSVGLILQDQFGNEINWLKTLKHILII
FT                   CTFVWFTLRMITNTEAYVLEQKTRDETTVQAIAKVARLFFMVMGGLTIMQAFGLSLSGL
FT                   LTFGGVGGLIVGLAAKDLLSNFFGGMMIYFDRPFKVGDWIRSPDRQIEGTVERIGWRMT
FT                   IIRTFDKRPLYVPNSVFSNIVVENPSRMLNRRINETFGLRYQDADKLALIVDEVRSMLE
FT                   THPDIDAKQTLIVNFDKFGPSTLNFFIYTFTKTVNWVRYHEVKQDVLLQVLAIIHKHNA
FT                   DIAFPTQTLKIDPQDFGEAQGMVISNSEGH"
FT   gene            431422..432078
FT                   /locus_tag="VS_II0391"
FT   CDS_pept        431422..432078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0391"
FT                   /product="KtrA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25858"
FT                   /db_xref="GOA:B7VR06"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25858.1"
FT                   /translation="MSDKQYAVIGLGRFGLSVCKELQSSGSQVLAVDIDEERVKDAAAF
FT                   VSQAIVANCTSEETVKELRLDEYDMVMVSIGSDVNSSILTTLVVKESGAKAVWVKANDK
FT                   FHGKILSKIGADHIIMPERDMGIRVARKMLDRRVLEFIDLGSGLAMTEIVIGSNLLGKK
FT                   LGDLKLCKQNGVEVLGFKRGPNLTKAPELDVSLEIGDVVIIAGPKETLSRKLRNW"
FT   gene            432106..433473
FT                   /locus_tag="VS_II0392"
FT   CDS_pept        432106..433473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0392"
FT                   /product="KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25859"
FT                   /db_xref="GOA:B7VR07"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25859.1"
FT                   /translation="MNSVKRKGTFYTLKSDKKPRKGSEPKIILTSFLGVLIPSAILLTL
FT                   PVFSVTGLSFTDALFTATSAISVTGLGVVDTGQHFTLAGKILLMFLMQVGGLGQMTLSA
FT                   VLLYMFGVRLSLKQQALAKEALGQDRKINLRKLVKKIIIFALVAEFVGFVLLCFRWVPE
FT                   MGWATGSFYALFHAISAFNNAGFALFSDSMMSFVDDPLVIFTLAGLFIFGGLGFTVVGD
FT                   LSSNWRKGFQHLHLHTKIMLTATPTLLLVGTVMFWLLERNNSATMEGLSVQGQWLAAFF
FT                   QSASARTAGFNSVDLSQYTQPALLVMIVLMLIGAGSTSTGGGIKVSTFAVAFVATWTFL
FT                   RQKKHVVMFKRTVTWQAVTKSLAIIVVSGALLTTAMFLLMLTEKAAFDRVMFEVISAFA
FT                   TVGLTAGLTANLTEPGKYIMIVVMVIGRIGPLTLAYMLARPEPSLLKYPEDTVLTG"
FT   gene            complement(433580..434722)
FT                   /locus_tag="VS_II0393"
FT   CDS_pept        complement(433580..434722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0393"
FT                   /product="Methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25861"
FT                   /db_xref="GOA:B7VR08"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25861.1"
FT                   /translation="MNKLSKILVSLVVALPLTSLFVSQTGTANTMDKAMDSGKSEIATL
FT                   AGGCFWCTESDLEKLTGVTDVISGYSGGELENPTYKQVSSGKSGHIEVINVTYNPDVVS
FT                   YEQVLDQFFRHIDPTDDKGSFVDRGPQYRPAIFYHNQEQKDVAQNFMMEIDKAQIFGEP
FT                   LKTELIKFEKFWPAEEYHQDYYKKSKVRYNYYRYASGRDQYLDKIFGDDRKENPKTIRQ
FT                   IIDGKNATANAKTYTKPSDAEIKASLTSLQYDVTQDDATERPFDNKYWDNKQEGIYVDI
FT                   VTGEPLFSSKDKYKSGTGWPSFTQPISEAYVVTTTDYKLLYPRTEVRSKFGDSHLGHVF
FT                   KDGPKPTGLRYCMNSAAMRFIPADKLAEEGYEEYMEMFEG"
FT   gene            434919..435317
FT                   /locus_tag="VS_II0394"
FT   CDS_pept        434919..435317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0394"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25862"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25862.1"
FT                   /translation="MQAEVKWVEGFKFLGQSQSGHSVVMDGSGGATAPSPMEMVLMAAG
FT                   GCSSVDVVDGLKSAGQSITGCNAKLETTRRETAPKIFTAINIHFEVTGDDLDPELVAKV
FT                   CADSLEKYCSVCLMLGAGVEMTHSWEIV"
FT   gene            complement(435461..436522)
FT                   /locus_tag="VS_II0395"
FT   CDS_pept        complement(435461..436522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0395"
FT                   /product="outer membrane protein OmpA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25864"
FT                   /db_xref="GOA:B7VR10"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25864.1"
FT                   /translation="MKKLSKIMCAVVAASGLAAAPSIAATTYVGAKVGMGWLDSACVSG
FT                   EKCDDDAIGAGIYSGYNFTDRLGVELSSDFLGDYKTSFSKNGVTSNFSDPLIAISLTPM
FT                   YRLPVQQEFDVFFKAGPAYISHGGETDVVLSAGIGLEKQLSSDWAVRVEYQYFDDFDDN
FT                   YVQDLNSNFVTVGLSYNFGTGNTTASAAAASAAVVTQAPAEPIAEPEVVVVEEEVVVTK
FT                   AKTESFSQGMFETNSTELSSEGKTALIPLVEVLQAHPQSSVNVVGHTDSTGAAEYNMMI
FT                   SKKRAAAVAAYIEEQGIAADRIAASGEGEENPVASNATAEGRAQNRRVDATIPSFEYQE
FT                   KAQMEEVIVETAE"
FT   gene            complement(436874..437692)
FT                   /locus_tag="VS_II0396"
FT   CDS_pept        complement(436874..437692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0396"
FT                   /product="Predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25866"
FT                   /db_xref="GOA:B7VR11"
FT                   /db_xref="InterPro:IPR006323"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25866.1"
FT                   /translation="MNTTSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFRQGFDFDIDLA
FT                   EAREPMGIGKWDHIQAVGRIPAVNARWNAQFGRSMTSEDVDAIYAAFMPLQKAKVADHA
FT                   APILNAIEVVNNLKEKNVKIGSCSGYPREVMDVLIPAAADYGYLPDNVVATDDLPQGGR
FT                   PAPFMALKNVIDLGVTNVAACVKVDDAAPGIDEGHNAGMWTVGLVLSGNEAGLTYQEYV
FT                   DADEATLAAAREKASIKLNKSNPHYLIDTIADLPRVIADIEKRLLAGERP"
FT   gene            complement(437777..439216)
FT                   /locus_tag="VS_II0397"
FT   CDS_pept        complement(437777..439216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0397"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25867"
FT                   /db_xref="GOA:B7VR12"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25867.1"
FT                   /translation="MTTTNQEPILKATHFRSEGDVNTTPAREKWNESLNDDATQVMLKR
FT                   DADVFLHQAMSTPCLDTLEAAQGIYIQDATGKKYMDFHGNNVHQLGYGHPHIINKVTQQ
FT                   MASLPFSPRRFTNQTAVQCAEKLTQICGGDLNRVLFAPGGTSVIGMALKLARHVTNNFK
FT                   VVSLWDSFHGASLDAISVGGEACFREGMGPLMAGVERIPPAVSYRGAFPLNDSLSLRGQ
FT                   SSGDNNETACDVHYADYLEYVIEKEGGIGAFIAEAVRNTDVQVPSKAYWKRIREICDKH
FT                   NVMLIIDDIPNGMGRSGEWFTHQAFDIEPDILCIGKGFGGGLVPIAAMITKDKYNTAAQ
FT                   VSLGHYTHEKSPIGCAAALATMEVIEQENLLEKVQADSAFVREQLLQMKEKYPVIGDVR
FT                   GIGLLWGVELVTDHITKTRAFDEAETVLYQCLNDGLSFKVSQGNVIQLSPPLIISRSEL
FT                   EVALSVFEKAIAKVCKDFEYL"
FT   gene            complement(439216..440325)
FT                   /locus_tag="VS_II0398"
FT   CDS_pept        complement(439216..440325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0398"
FT                   /product="Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25869"
FT                   /db_xref="GOA:B7VR13"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25869.1"
FT                   /translation="MNMRNEYLLLTPGPLSTSETVRQAMLKDWCTWDDEYNKDVVEVIR
FT                   SKLVTLATKQTGYTSVLMQGSGTASVEATIGSVISKSGKLLVVDNGAYGARIAQISEYL
FT                   NIPCHVVSPGETSQPDLNEMETALAMDSDITHVAIVHCETTTGMLNPIENFAKLAKQHN
FT                   KTVILDAMSSFGGIPMDIADLGIDYMISSANKCIQGVPGFGFVIAKQSELEKCKGQARS
FT                   LSLDLFDQWHCMESNHGKWRFTSPTHTVRAFYQALLELEQEGGIEARHNRYQTNQTTLV
FT                   AGMRSLGFEPLLNDDLHSPIITSFYSPTHSDYQFKEFYDRLKEQGFVIYPGKVSNADCF
FT                   RIGNIGEVYPSDIEALIGAVKNAMYWDIK"
FT   gene            440720..441730
FT                   /locus_tag="VS_II0399"
FT   CDS_pept        440720..441730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0399"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25871"
FT                   /db_xref="InterPro:IPR017663"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25871.1"
FT                   /translation="MMKNRFMKGSLAVLVTLLAGNAYAAQEVTVYTAFETDILAKYKNA
FT                   FESENPDINIKWVRDSTGIMTAKLLAEKNNPRAEVVWGLAGSSMALLKEEGILKPYTPQ
FT                   GVEALRSNLNDPQSTQAWYGNDAFFNAVCFNEVVAKQLNLPAPKSWDDLTKPIYKGHIA
FT                   MPNPASSGTGYMQVSAWLQNMGEDQGWNYMQKLDQNIAHYTHSGSKPCVQAGMGEVAIG
FT                   ISMASRGAKLKTQGAPLSVITPEGIGWESEAVGLVKPSDAAQRVIDWSISKAANELYIE
FT                   MYPVVGHQDVTGKAENFPNVEKNMAKMDFARMGSERADVLKTWSEKFDAKSEPKS"
FT   gene            441851..443272
FT                   /locus_tag="VS_II0400"
FT   CDS_pept        441851..443272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0400"
FT                   /product="ABC transporter: Substrate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25872"
FT                   /db_xref="GOA:B7VR15"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017715"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25872.1"
FT                   /translation="MKKHYSYWFKQALEQEFGSINAGLESAKPLQKDVNCDISIVGGGY
FT                   TGLWTAILIKQQQPQKHVVVIEKGLCGSGASGANGGCMLTWSTKYPTLKKLYGKEQAKW
FT                   LVKESEKVIYEIEAFCNEHKIDAHLYRSGTYYTATNESQKGGMKPVVNELVKQGINSWK
FT                   KCDQSLPDKAGSDRHIEGYYSEAAGSVQPALLARGLRRVAIELGVEIYENTEMTSLDYG
FT                   SPARVQTKGGTITSDKVILALNAWMLDHFKEFKRSIVVVSSDMVVTKPIPDKLKQFGPE
FT                   KGAAVVDSRIFVHYYRDTEDGRLMLGKGGNKFSFANQVESMFNQTTNYLPILNQSFQKL
FT                   FPKLEQNEFDYNWSGGSDRSVTGLPFFGNLKGQNNIYYGLGYSGNGVAQTRMGGKILSS
FT                   MVLGDDNEWTRSGLTSGPRGYFPPEPFRWVGAMMVRDAVRRKENAEDSGNTPLWLDKQL
FT                   AKLAGAAGKADKVES"
FT   gene            443500..444609
FT                   /locus_tag="VS_II0401"
FT   CDS_pept        443500..444609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0401"
FT                   /product="ABC transporter: ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25874"
FT                   /db_xref="GOA:B7VR16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25874.1"
FT                   /translation="MSNQTYLNIENVVKQFGQFTALKDISLSIDKGEFVCFLGPSGCGK
FT                   TTLLRAIAGLDLPTSGSIEQNGNDTTFLPPEKRDFGIVFQSYALFPNLTVEENIAIGLK
FT                   NQGMSTKEALETVESWLETIGLPTSGQKFPNQLSGGQQQRVALARALALSPGLLLLDEP
FT                   LSALDAKVRTHLRDEICQLQRKLGITTIMVTHDQDEALTMADRIVVMNHGVIEQVGAPQ
FT                   EIYQKPVSRFVAEFVGSMNFIQASVAAQGKMRIAESMLPLPGLDNLTPKLGDVFDIAVR
FT                   PEQIQFVDRFSESFPVRIVSSEFLGAFYRVECQLQHDSTAKEIIVDVSVKEFNQLKLRR
FT                   SDIRYVAFDQEGLRAYPSKSLQVMKDEAA"
FT   gene            444616..446340
FT                   /locus_tag="VS_II0402"
FT   CDS_pept        444616..446340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0402"
FT                   /product="ABC transporter: Transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25876"
FT                   /db_xref="GOA:B7VR17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017664"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25876.1"
FT                   /translation="MELTQMMQSKLLIQRRVQPFLARLSKDNVILFGLLAFLSVFMTLF
FT                   ILMPLWAMLKKSVQNADGEFVGLQNFATYFASQSLWQSVGNTFTLGLLVTVVVGVLAFG
FT                   YAYALTRSCMPFKGLFQVLGSAPILAPSLLPAISLIFLFGNQGIAKEVLGGNSVYGLIG
FT                   ISLGLIFWTFPHALMILTTSLRTSDARLYEAARALNTSSLKTFFMVTLPAAKYGLISTL
FT                   IVVFTLVVCDFGVPKVIGGSYNVLSTDIFKQVVGQQNFSMGAVTSILLLLPALLAFTVD
FT                   RWVQKKQKSLFDTRSVAYQPEPNTLRDGVCLLYCTVISVAVVIVLGMAIYGSMVTFWPW
FT                   NKTLTLNNYNFAEMSTYGWTPFFNSLTLGAWTAIIGTVLIFLGAYCIEKGRAFGPVRQA
FT                   MQMLSVVPMAVPGMVLGLGYIFYFNDLSNPLNFLYGTMAFLVINTVVHYYTVGHMTALT
FT                   ALKQLPEEIEATAASVNLPQYKLFFKVTVPVCLPAILDIATYLFINALTTTSAVVFLYS
FT                   TDTIPASVSVLNMDDAGQTGAAAAMAVMIMISAASAKLIHMLINKLFEKCTQAWRKR"
FT   gene            446409..447113
FT                   /locus_tag="VS_II0403"
FT   CDS_pept        446409..447113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0403"
FT                   /product="Transcriptional Regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25878"
FT                   /db_xref="GOA:B7VR18"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR017722"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25878.1"
FT                   /translation="MQYVKIKDVVVEQIDSGMLTPRQKLPAERKLAESFDTTRVTLREA
FT                   LSSLEAEGRIYREDRRGWFISPAPLRYDPTQTLNFTNMALSQNRKPKTELVAAKGMLAT
FT                   KEATRLLELQPFSDVYRVDRVRYLEDRPVVYVTNYIRPELFPNLLDYDLSKSLTDIYRE
FT                   HFGVVYQKIRYRVSTTSLLGETAQALRATSGSPAMVVERVNYNQDGDLIDCDIEYWRHD
FT                   AISIESIAQLER"
FT   gene            447251..448153
FT                   /locus_tag="VS_II0404"
FT   CDS_pept        447251..448153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0404"
FT                   /product="putative permease of the drug/metabolite
FT                   transporter (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25880"
FT                   /db_xref="GOA:B7VR19"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR017725"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25880.1"
FT                   /translation="MEFSAIVIVIISALLHAGWNVLGKSNQGSGSSFFLASGFAAAVIL
FT                   TPYLIWYVHSVGLSNILLPFWQLVFLSGICQIIYLIGLGAAYKQADIGVIYPMARALPV
FT                   LMVGLGTVLIGYELSANQWIGFTLITLGCLFVPLKQFSDLRLKAYLNLGVLWALIAAIG
FT                   TTGYSIIDKEALLLLDPLSTPVITNKHTAIFYLGIQFWAIVIPLSLWLLVSNQKIEFHN
FT                   AWLLRKRATLAGIMMASTYGLVLFAMTMTENVSLVVALRQVSIIFGVVMGIYFLKEKWH
FT                   ATRGVGVVFIIAGLVISLT"
FT   gene            448354..449370
FT                   /locus_tag="VS_II0405"
FT   CDS_pept        448354..449370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0405"
FT                   /product="TRAP dicarboxylate family transporter, DctP
FT                   subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25881"
FT                   /db_xref="GOA:B7VR20"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25881.1"
FT                   /translation="MKALTKTLIAASLTGLFATSAMAADFKLKIQSSDPSGDLNFKVQQ
FT                   KWAERVETMSNGRIDIDLLPVGAVVKHTETLGAIKMGILDGHITATGYFSGKDPAFGLI
FT                   GNMVGAWSDTTQLLQYMNYGGGNELMTELYKPYGVQFVGASTTGVESFISKKPIDGVAD
FT                   LKGLKLRAPEGLVQQVFAAAGATPVNLPGSEVFTGLSKGVIDAADYTVFSTNQKAGMND
FT                   IATHPVQPGFHSLPLIDISISQKKWDKMPADLQTMLQTSVRDFSYDMTTQLKMADQAAL
FT                   KEAQANPEITIHDWSQEERKKFREIAKGQWKVFAERSDNAGKVYTSVTVFLEENGLL"
FT   gene            449436..449993
FT                   /locus_tag="VS_II0406"
FT   CDS_pept        449436..449993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0406"
FT                   /product="TRAP dicarboxylate family transporter, DctQ
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25883"
FT                   /db_xref="GOA:B7VR21"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25883.1"
FT                   /translation="MTDKIPHAPAENDEQPRNALDRFVIKFSNLVSWLFIFTVLISFYE
FT                   VVMRYAFDAPTTWVHETASFIGGSLFIIGGIYAFAANRHVRVVLIYDSVSNQARKYLNL
FT                   VHHIVGLAFAGMLAYAAYFTAEEAWFAPWGEFRLETSGSVLNAPYPALLKGLIFVVLCV
FT                   LVVQFVLHLIQELMGLRKNDDV"
FT   gene            449986..451308
FT                   /locus_tag="VS_II0407"
FT   CDS_pept        449986..451308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0407"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25885"
FT                   /db_xref="GOA:B7VR22"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25885.1"
FT                   /translation="MFDLSSIGIAWGSLLMLVMMIGLLLTGMQLAFVTGFVAIFFTLCW
FT                   FGPDALPLIASRTYSFASGYVFLAVPMFVLMAALLDRSGIARDLFDAMKSVGRKVRGGV
FT                   AVQTLLVAVLLASMSGVIGGETVLLGILALPQMLRLGYDRKLAIGTTCAGGALGTMLPP
FT                   SIVLIIYGMTASVSIGDLFKASFLPAFILAGCYIGYVLIRCKLNPSLAPIPSDDETEED
FT                   IANQPSYFKALFFPLLSVATVLGSIYTGIASVTEASALGVVGIMISALIRGELNYNMLK
FT                   ESAIATMRTCGMIMWIGIGASALVGIYNLMGGIDFVEETILALSGGNATVTLLIMMAIL
FT                   LVLGMFLDWVGVALLTMPIFVPIITGLGFDPVWFGVVFCLNMQVSFLSPPFGPAAFYLK
FT                   SVAPKDISLGEIFSSLLPFIALQVLVLALVIIFPQLALWWQ"
FT   gene            451427..451924
FT                   /locus_tag="VS_II0408"
FT   CDS_pept        451427..451924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0408"
FT                   /product="Thermoresistant gluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25887"
FT                   /db_xref="GOA:B7VR23"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25887.1"
FT                   /translation="MKSKKILVMGVSGCGKSLIGSRIAQALEFQFFDGDDFHPQSNVEK
FT                   MRQGIPLTDEDRQGWLETLNKQYIEQPSAVIACSALKPQYREILRENNEGLVIVYLQGS
FT                   FDTIWNRHKARENHYFNGQEMLKSQFATLVEPELGEALFVDISQDVEQVVESALKQIKQ
FT                   IG"
FT   gene            451928..453436
FT                   /locus_tag="VS_II0409"
FT   CDS_pept        451928..453436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0409"
FT                   /product="6-phosphogluconate dehydrogenase, decarboxylating
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25889"
FT                   /db_xref="GOA:B7VR24"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25889.1"
FT                   /translation="MTQIKNDIAMIGLGVMGKSLALNLLDNGFNVAGFDLNADNIDRAS
FT                   SEAKLLNESFTGKGQFTQGTSLEHVLQGLAKPRVIALSVPAGKPVDIVVNSLLDAGLEN
FT                   DDIVIDTGNSLWTDTEARELNYKGKLRFFSTAVSGGEEGARVGPALMASGDQSAWQYVK
FT                   PMWEAIAAKVDANGLPVAQFEAGEACAAYVGPSGTGHYVKMVHNGIEYADMQLICEVYQ
FT                   FMRDVLNMPAQEIGQVFEQWNNGVLNSYLMEISADILQQEDVVTGKPFVDVVLDKAGQK
FT                   GTGLWTAVNSLQEGCPTPTIAQAVYARAMSGQKSQRVQGSKLLKGNVADASQLDKTEVI
FT                   SELHDALYCAKLSVYAQGFDLLKTASDKEGWNLDFTQIAKIWRAGCIIRAAFLQSITSA
FT                   YQQNSELENLLFDEAFIKQVEERELAWRIAVANSALYGVPMPGISSALSYFDSLRCEVL
FT                   PANLLQAQRDYFGSHTYSRVDRDEAEKFHVTWSQSPRTEVKVNA"
FT   gene            453913..454644
FT                   /locus_tag="VS_II0410"
FT   CDS_pept        453913..454644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0410"
FT                   /product="Peptidase E (Alpha-aspartyl dipeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25890"
FT                   /db_xref="GOA:B7VR25"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25890.1"
FT                   /translation="MNVMLFSNGKLPGDTSLLEYGKEWIRPMMEKTQPKKMLFIPFAMI
FT                   RGQYSDRTQQLQQVFDEYDCEVVSIHEAEDPVQALKEVDGIIISGGNTWVLNRMLHDLG
FT                   LVTPMRDAVINKGKLFIGWSAGTNVATPTIRTTNDMPIVSAAILPALNFVPFQINPHYI
FT                   EASISGHMGETRDERIEEFLCMNPSEVVVGIPEGTMLQVCEGKLTYHTATGKPMKLFKH
FT                   GQLAETFTADSDLAFLMDIGC"
FT   gene            454955..455956
FT                   /locus_tag="VS_II0411"
FT   CDS_pept        454955..455956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0411"
FT                   /product="HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25892"
FT                   /db_xref="GOA:B7VR26"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25892.1"
FT                   /translation="MLSKKKRPTLQDVANLVGVTKMTVSRCLRDSSLVSEALRDKISAA
FT                   VDELGYIPNRAPDILSNAKSNAIGVLVPSLTNQVFAEVIRGIEQVTAPAGYQTMIAHYG
FT                   YSAELEEQSIASLLSYNVDAIILSENVHTDRARKMLQTVSIPVIEIMDSVSPRIEQAVG
FT                   FDNFEAARAMTKTMLDRGRTNIAYLAARMDERTRLKMAGYEHAMQEADKTPVTLQTEDA
FT                   SSFTLGAKLIGELLDKHPEVNGIFCTNDDLAIGAFYECVRRGIQVPEKMAIAGFHGHDI
FT                   TVAMTPRLATVVTPREQIGKVAAQQVVARLQGNKEWVAKLDLGYEIEVGESI"
FT   gene            complement(456071..456853)
FT                   /locus_tag="VS_II0412"
FT   CDS_pept        complement(456071..456853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0412"
FT                   /product="Siderophore-interacting protein ViuB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25894"
FT                   /db_xref="GOA:B7VR27"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25894.1"
FT                   /translation="MSKPSPITLTVTQTSTITPNMQRITLSGEGLSKYPTECAGGYIKL
FT                   LFSPLGTTDLSQLNEGERPTMRTYTIRQYNPVENWIEVDFVRHITTDLQCGFAARWAMN
FT                   AKVGDTVSVAGPGLIQGLNLGSDWFFLAADMTSLPALSAKVKSLPEHAIGHAVIQINSA
FT                   ADKQTLEAPKGIKVTWLIEDETEETLSQTVRNSEWLDGQVSIWTACEFESMRELRQYFR
FT                   NEKEVAKENIYISSYWKRGVTEDGHKVLKQQDAQALAG"
FT   gene            complement(457057..458580)
FT                   /locus_tag="VS_II0413"
FT   CDS_pept        complement(457057..458580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0413"
FT                   /product="Dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25896"
FT                   /db_xref="GOA:B7VR28"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25896.1"
FT                   /translation="MGNYTTYQHKCENKIMWNRLNKSMMFCQMMFGLSFYGVMVILTRF
FT                   FLEDLNYNEADTMMVVGAFSAIGPLFAIAGGFIADKFLGAYRSLTIAFLGFASGYGLLV
FT                   LGAAATNVPMALCGIALASYARGLMSPSYPSLYKRTFKTQEDFENCYPINYSVNNIGAL
FT                   LGQYLFPMLVLVVGFHGGFLLSGVLAGAALLMMLFVRKGLVEASAEIDQQPVSTKNWAA
FT                   FLGLSAAMIGLVFFMFSNMDIGQNIVYAIGAAAIVYFVSLMLKSKKSDMLKMGTILIIT
FT                   FLTTCFFVYYGQMMTSMTMVAINTMRGDLLGFIPVAPEASMAMNPLWCMVAGPIITGIF
FT                   SKLEKKNIHFSTATKVGFSFILTAIAFGILTMAVTTVGEDILIRPEVFLAIHFFLAFGE
FT                   VIVGSMVVAFILSVAPKHIENFSVSLFSVAIAMSGIVGAVFSTSIALEKGQEITQEIVQ
FT                   TVYGDYFQMLTVLAVVMVGIAMAASFIIRKMLDAAKAADETIELEQANS"
FT   gene            complement(458945..460315)
FT                   /locus_tag="VS_II0414"
FT   CDS_pept        complement(458945..460315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0414"
FT                   /product="L-serine dehydratase (L-serinedeaminase)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25897"
FT                   /db_xref="GOA:B7VR29"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25897.1"
FT                   /translation="MLSIFDIYKIGVGPSSSHTNGPMIAGFNFTQKIDAQLTQVERIQI
FT                   DLYGSLSLTGIGHHTDRATLLGLLGNRPDTIKITSANQAMRKAIEDKSLLVSGNHEIHF
FT                   DVESDLLFHKTNLPLHENGMTISAFDASGSLLEMETYYSIGGGFIATADELQNGKQEAK
FT                   TQVEFPFTSADQLLELSEQQGLSLGGLILRNEVSFQGMDAIDQKADQIWKVMSLCMQRG
FT                   FDTEGILDGGLEVTRRAPALLKKLEANASIENDPMEIMDWINLFAFAVSEENAAGGQVV
FT                   TSPTNGAAGVIPAVLMYYHRFIKELDTKQLKDFLAVSGAIGILYKTNASISGAEVGCQG
FT                   EVGVSSSMAAAGLTALRGGSNEQICIAAEIAMEHSLGMTCDPIGGLVQVPCIERNAMGA
FT                   MKAINASRMALKRTSKCLISLDKVIATMYQTGKDMNKKYRETSLGGLAVIHMAPPCE"
FT   gene            460691..461569
FT                   /locus_tag="VS_II0415"
FT   CDS_pept        460691..461569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25898"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25898.1"
FT                   /translation="MSIIHLLIVLGKRLNENKLTNEGTSRVDALVEYLSGPLAEESNQQ
FT                   TAVAFCGGVTQGQTVSEADMMHEYFRELENQREYPFPIGAVLLEQHSTNTVENIQNLAS
FT                   EMIESGLFTRGQSVTVTFVSNDYHLQRIFEIQSLMDEQGLLKVLVEKCSALGVELQIDP
FT                   QREAHVAVPYPHQTEQGQLFLLMDALTTYRVYLEGVSVGAFKRDLDSVRREPERLSLEA
FT                   LLAAKELVGRSSHFDIVESLLPVLETCIQNTPVGIGIEKVREYLALLDTNLTLLNRYLD
FT                   PESDHTHRWWR"
FT   gene            complement(461764..462018)
FT                   /locus_tag="VS_II0416"
FT   CDS_pept        complement(461764..462018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0416"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25900"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25900.1"
FT                   /translation="MKKIGLMAVFAVVLGGCANDYAEYSEGQRVSVANPAAVYCVQQDG
FT                   ELDTVTENNQRTTYCVFDDGERIEQWEYYRNNHEQKEES"
FT   gene            462389..462907
FT                   /locus_tag="VS_II0417"
FT   CDS_pept        462389..462907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0417"
FT                   /product="MutT/NUDIX protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25902"
FT                   /db_xref="GOA:B7VR32"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25902.1"
FT                   /translation="MRHLKTTIHPDIDHLDNKTVYKRNAARAIVLDGEDILMLYTERYH
FT                   DYTIPGGGLDDGEDVIAGMVRELEEETGAKNIHSIKPFGIFEEFRPWYKDDADIMHMIS
FT                   YCYSCKIDRELGETAYEDYEVKNGMKPVWMNIHEAIAHNEKTMAESPKKGMSIERETFL
FT                   LHLIAKEML"
FT   gene            463412..465523
FT                   /locus_tag="VS_II0418"
FT   CDS_pept        463412..465523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0418"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25903"
FT                   /db_xref="InterPro:IPR031025"
FT                   /db_xref="InterPro:IPR032295"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25903.1"
FT                   /translation="MKYKQVIYLMTAVASAPVYATTVDLDFSNHVEATNGSSSWAGPTY
FT                   DGSSMHFLNVGTHDGKTIDAKVSSSVFGDATFLFHAPNYKVGATQPSGDIGFLYQTNSA
FT                   GSAGLTYTFEFYDGTDGLSGTFSVPYTLPEFDMIGYDIDGEPVQSEQVRVFKSEGFYSY
FT                   QLGSASASLMAEESADGTSVLFTGPGTNYSETDTSGAVKFTYKNTSIVTLQFETVTSSS
FT                   SSFPNPIFSAFDGNWDLSGFTTPIESSDESDFGDAPDSYGTLQASNGAEHAISSTLYLG
FT                   ASVDADTDGQPGASSNGDDLDVGGNDDDGIALLTNLEVGLDSLINVNVVGSGYLQAWAD
FT                   WDMNGSFEDDEQILKNHSVVDGSQVVPIRVGDDAVVGSVQTRFRLASSPNIPSDGYVGD
FT                   GEVEDYVFNVTDPGTTVQHSNYYTAAFEDNWPEVGDFDLNDVVVYYRTTILSKEDAVLR
FT                   MDITGTIMAYGASYGNGLGWKLSGFDESDVDLQTARVQKNGATRVNISPFTGEDKSVAS
FT                   PGGDLVVVASLNLKNDLPINGECMFHRTNPSCSPTLEADQMTFSISLPFASGSEPTASS
FT                   LMPLSGFDPFIFGAGAGYYHGDSFSTSPGKDLEIHTADFPPTSRGTLVSDFYGIAQDDS
FT                   DPSSDKYYRTTQNMPWGILISSSWNHPSEYIDVSEVYPEFAEWATSGGASKPTWYQNPN
FT                   ANKTWSTED"
FT   gene            complement(465520..465708)
FT                   /locus_tag="VS_II0419"
FT   CDS_pept        complement(465520..465708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25905"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25905.1"
FT                   /translation="MLPTVELLGGVTGTGAVVLLGGATVLGDEAVLSPPPPPPQAERNT
FT                   KPTPLKISLIVFINPPD"
FT   gene            465536..466069
FT                   /locus_tag="VS_II0420"
FT   CDS_pept        465536..466069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25906.1"
FT                   /translation="MKTIKLILSGVGFVFLSACGGGGGGDSTASSPSTVAPPSNTTAPV
FT                   PVTPPSNSTVGSNNVVTPAPVVIPQSIKSSELSIPEGFDFSTEREVSVNVDVASSQSSR
FT                   GFMSIYTEFNGDVVDYTSQVLRSPINQDIEFSATLLLPNHVDKVWVEVWYPSAMGSEVK
FT                   LLVNIEDDNVDVIL"
FT   gene            466296..468059
FT                   /locus_tag="VS_II0421"
FT   CDS_pept        466296..468059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0421"
FT                   /product="ABC transport system, Transmembrane and
FT                   ATP-binding site (ABC-IM)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25908"
FT                   /db_xref="GOA:B7VR36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25908.1"
FT                   /translation="MNKRQFVAHYLRMNRTSYLLAIVFIFLVNWLQVEIPRYIQLAIDL
FT                   IEDASTTGHQQLQTYVWIVVGMSVAMVVVRILSRIYALNPGRITEAALKSTLLQKLNRL
FT                   PSSFHERFASGRLISIMNNDLSGIRLMFGVGFLQFFNALLALSLTPLYMWRISPELTLY
FT                   SIIPISIAFVIFRVGFKRMKTLHLEHMKRLQNLSAQLMSYLSGIDLIKIQQMSPWVKAE
FT                   TEKLNQLLLECRLKITRIQVFFMPVLDYANDLMKIIILGLGGYMLMRQELTLGEITAFL
FT                   TYSVLLAMPLMQLGRIATIYQRGMVGIQSVQTILNAKVPDLDEDKLTELDVESLKGKTF
FT                   SIRNLSFSYSGEERLILDDISFDIPAGKKVGVLGGIGAGKTTLVNCLNHHLDVPEGSVF
FT                   LGERDVTSFSRSDLRRYVKTVTQDPFLFSATVEDNIRFGSLDTDLAKSQVDEVLELSQL
FT                   ANDVTRFEHGDQTLVGEKGIMLSGGQKQRLSIARSLLQPTDLIIMDNVLSAVDYETERK
FT                   ILEGLFKRLENQSVLVVSHRVNALEYMDEIIVLNEGKVIAKGDHATLLKTCDYYYDTWQ
FT                   LQQNETEAAAC"
FT   gene            468053..469837
FT                   /locus_tag="VS_II0422"
FT   CDS_pept        468053..469837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0422"
FT                   /product="Hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25910"
FT                   /db_xref="GOA:B7VR37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25910.1"
FT                   /translation="MLKGVDLKYLKHFFKFAKKYKRSAILGIAMLPLSVITSLLFPWLI
FT                   IQVIDVHLSHGDMDGLLEYVFYLVAVLVASYVVDTTYSYNLRKTGQYTITDMRSVLFAR
FT                   VLKLPRSYFDNTPIGVTLSRLTSDLETIGETFVQSVVGLVKDSINTIALLVMMFFIDWQ
FT                   LTMIVLIIMPPVMYLTVYVRNRLRELYKVTRSSLARGIGFLQEVLFGMKTVQMYRAEEQ
FT                   VEQRYQGYTDEFLRAQKKINKYDAILFSFISGITSITIAIMIWYGSEQVIEGALTLGVL
FT                   IAFINTLEKVFVPIRDFTSQIASIQSSFAAFDHIEELFVEPTEEEGRNLLLSSKVEKQL
FT                   EQFVSLEFKSVSFRYKDDSPYVLKNVSFVLEKGHQIALVGSTGSGKSTVLRLISKTYQD
FT                   YEGSILLNGIELSQVSSEDSAHLFSMMMQDVHLFEETIQFNIALGKTHLSRTEVEQAAR
FT                   YVYADKFIEQLPQSYDFHLEKNGSNLSVGQTQLISFARAVAQGGQLMMLDEATSSVDSI
FT                   TEDLIQKAMQRLFKEKTVIAIAHRLSTVRHSDTILVLEKGEIVEQGNHRQLIAHNGIYA
FT                   ELLEESVVGGIDCRKSRL"
FT   gene            469967..470806
FT                   /locus_tag="VS_II0423"
FT   CDS_pept        469967..470806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25912"
FT                   /db_xref="GOA:B7VR38"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25912.1"
FT                   /translation="MLRILLIAVISVFSTMSFASEEVEYSELDYLDRPLMERYILDELK
FT                   QLRMDQQDLERRLTIQMTDRELAVADKSLNYANVTVTYFFYIIAGVASLIALVGWQSLK
FT                   ELKHTTKEMADQRLNSIAQEYEKKFNVLERDLKRKTRIISENNREIEIINEIHNLWLRA
FT                   QNAQTAEQKIEIYDEILKVRPGDLEALTYKADAAMDMQEYHWAMSLCNRVLEVDDQNAH
FT                   ALYQRACSYARLGAEGQAIDDLERSIEASGSMRELLAEEPDFEMLRGLDRFEALCEE"
FT   gene            470954..472210
FT                   /locus_tag="VS_II0424"
FT   CDS_pept        470954..472210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0424"
FT                   /product="Hypothetical metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25913"
FT                   /db_xref="GOA:B7VR39"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25913.1"
FT                   /translation="MKFLRTGLIVTAISAFSLALYLSLSPEPPEDIAIKITPYQGVVSA
FT                   DEKPSSSDVESSSLVRVHYFVKVGDTLSNVFTSWKLPYGTAQKILEADLESLKLDTIKP
FT                   GDHLELLLDSDSKQLVELIYHESLVEQAVYTENDDGSFSYQFIETPGEWKEKLYAGAVQ
FT                   GSFSTSAYKAGLTSAQIANITRTLKDKINFSKELRAGDSFNVLVKEQYTEDHLTGKTEV
FT                   QGVSIKLRNREVAAFLAADGRFYDREGNSLEQAFNRYPIDKQFRRITSSFNPFRKHPVT
FT                   GRVSPHNGTDFATPVGSPVYSTGDGRVVALRDHPYAGKYLVIEHNSVYKTRYLHLSRFL
FT                   VKKGQQVKRGQEIALSGATGRLTGPHLHFEVLVRGRAVDAMKADLPLASSILPKDKGAF
FT                   LARIASFDDIISEQEGRTS"
FT   gene            complement(472311..472739)
FT                   /locus_tag="VS_II0425"
FT   CDS_pept        complement(472311..472739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0425"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25915"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25915.1"
FT                   /translation="MNSHAQRQNSAMLFKSKTKLSIHTASNNSSSLQEAIMIITTTQSV
FT                   EGKRIVDYKGVIAGEAILGVNVFKDMFSGIRDFVGGRSGTYEKELEKARNYAFKELEQK
FT                   AIEAGANAVVGVDIDYEVLGTGNGMLMVSASGTAVVVA"
FT   gene            complement(472690..473616)
FT                   /locus_tag="VS_II0426"
FT   CDS_pept        complement(472690..473616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0426"
FT                   /product="Glycine cleavage system transcriptional activator
FT                   (Gcv operon activator)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25916"
FT                   /db_xref="GOA:B7VR41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25916.1"
FT                   /translation="MKKLVPLKSVYAFIAVAETGSMTEAARVLYVSHSAVSQAIKSLEQ
FT                   LVNKPLFQRVGRRVVLNAAGKRYYRKVAPALEQVIEATEELAKTTNDHRITLNMVNSLA
FT                   MHWWIPRVSEFQSFAPSLDIRISTLTGTFDIEQEGVDIALVHGKPSEWDRYYSEKLGDD
FT                   DLVLVCSPALLKNQMGLSVEQLVKQNPTIGVFNPRRQHDWQVWCDHYQIPMPTFHSNLT
FT                   FDVSIQAVQAAIRSLGVLVTHRLFVKDDISHGMLVEISEPVANPHQDFYFVCPKNKLKQ
FT                   ESVLKLRTWLRHEFTRSETKLSDVVQE"
FT   gene            473708..474718
FT                   /locus_tag="VS_II0427"
FT   CDS_pept        473708..474718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0427"
FT                   /product="Permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25918"
FT                   /db_xref="GOA:B7VR42"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25918.1"
FT                   /translation="MSDITKATAFMLLSTFSLSLSGLMAKYLSVSMPVSLLSFVRFLLP
FT                   SLFLFLFLMFYKITKPSLGMWKPLVMRAIFMVACQWCFLTSLQTLTLVEGVVLFSTGPL
FT                   FIPLLEKLMFGTKIHTTTVICLVVTFVGVVMMAGDWSQFEFGSEFFRPALLLGLLAGVF
FT                   NSGSQVSLYRASKTSLTPAELNAWTFLVAAIIVIPMVVFTSVSAAPDALESAAGNGTLS
FT                   ALLSFEGLRWIGLGAFGLALFTINTQIFRSKAYKLADSGSQLAPLIFTNMLFSALWQSL
FT                   FFDDVFSTQQLIGINLIVVASITNTLLAKRHSKANTENRCGCSDWSGCCGFGLCR"
FT   gene            complement(474756..477779)
FT                   /locus_tag="VS_II0428"
FT   CDS_pept        complement(474756..477779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0428"
FT                   /product="chemotactic transducer-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25919"
FT                   /db_xref="GOA:B7VR43"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25919.1"
FT                   /translation="MRRRRYPLSIHITSLFLILTTLVGTVLISISYRHSQELLLGTVRE
FT                   VSNEHRDKLESVFKQAIAPVITTLNVMAVSPFVAHQTSSVEKESWLASVDIIFKQNTNL
FT                   VALFYGSEDGDFRIFRPLSSIKQRADNNAPAKATMMVSSTNLDGENFITFLDGAHQVIS
FT                   TRQAESKFNPTTRPWFRNAKPDGSIQLSEPYLFYFLQTNGITLSRRSLDGKHVVGADFT
FT                   LKSLSSQISELAYSPQTRLALFDQHFNLLGQHQLDLSIPKLTSQPNDTSKTEKTNNQTT
FT                   GKLSGSEQDQSFFNVPKREQMEALKASVIAPLVSDEEKLNLNLKNVEYNLNTWALTLTP
FT                   VELTQNVTLYLAEATPHNELLSDLISMRDKQVAVAIGMLFICFAIVWFVANRLSQPLNT
FT                   LMQLTDNIARFDFRRTHYPKSMIQEVANLAHSIELMEHTLHDLITLLRDTAGNQEFSIL
FT                   AKNIAHQSYLITKAETIVLFTQSKEKDVFDTAANLAILPFKADINDFIKHTPWLLCQLK
FT                   SGETIHLNREDNVLNYYQDSIFNSDLYLFPLLNREKLLVGIVAIGYERPITKMQADKHA
FT                   FLRELLSFAEIAKDNIDQMQQQKDMLNAFIELIASAIDTKSPYTGGHCQRVPELTKWLT
FT                   QATIDDDRYYPQFSLDNKQWEELMLAAWLHDCGKVTTPEYVVDKATKLETIYDRIHEVR
FT                   MRFELLKQQAETDYWKAIANGALQEEQLKVLEQSLSELDEEFAFVAECNLGGESMTDEQ
FT                   LERLDRIAKRQWKRTLDEQLGLSWSEKERFNTQQDPAEKDEIEPRIKDQTLPVMEPLLA
FT                   DKPEHKIPWDNGFNPADVWQEAFVLKPGEVKYNQGELHNLKVRRGTLNDEERFMINDHI
FT                   IQTFTMLNKLPYPSYLKNIPDIASGHHERIDGKGYPRGLNEDQLPLPSRAMAIADVFEA
FT                   LTSSDRPYKKGKLLSESLNIMTDMATSGHIDPKLYLLFLENKIYDKYAERFLETKQRCE
FT                   IKPNEHIDRVKEYIRSLF"
FT   gene            478058..478804
FT                   /locus_tag="VS_II0429"
FT   CDS_pept        478058..478804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25921"
FT                   /db_xref="GOA:B7VR44"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VR44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25921.1"
FT                   /translation="MELKVDTHTHTYASGHAYSTLIENAKSAKQNGLAMFCTTDHSESM
FT                   PGAPHYWFFSNQRVLPRFIEDVAIIRGVESNIMNTQGEIDIHPSVDKNLDWVIASFHEP
FT                   VFRPSDVATHTEALLNVIKGGRVDALGHLGNPNFDFDFEVVIQCAAEHNVAIEINNTTL
FT                   KGNSRVGSVDRCYEIARIAKAKGAFITTGSDAHFCIDVGGLDLVSSLLGEVGVDSSKVI
FT                   THSPQQFLAFLVLRGRQSIAEFSVFE"
FT   gene            478976..479371
FT                   /locus_tag="VS_II0430"
FT   CDS_pept        478976..479371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25922"
FT                   /db_xref="GOA:B7VR45"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25922.1"
FT                   /translation="MKTRSILLSGLIAASVLSGNAFANVDLKKNMQEMKLAFKQAAEAQ
FT                   SIEEMQKPIVRLDTLVAELKTGVYPIEKEDNFMEGFKKISASLDSIEQKLDQGDLESAQ
FT                   QELRTIDGLREEYHEKRNPSIWSKIFG"
FT   gene            479698..480048
FT                   /locus_tag="VS_II0431"
FT   CDS_pept        479698..480048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25924"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25924.1"
FT                   /translation="MRRTSFNFSMLLATALSWVLVTLMPVINAHGNSAGVWASLCTVNG
FT                   FELVQIEEGEPNTHKGKPCPFSHFSTFHQDNLPTTLLTTRLSSIVSDSYAFLALSERYT
FT                   RQAPRGPPFDIA"
FT   gene            480160..481695
FT                   /locus_tag="VS_II0432"
FT   CDS_pept        480160..481695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0432"
FT                   /product="Iron-regulated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25925"
FT                   /db_xref="GOA:B7VR47"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25925.1"
FT                   /translation="MLRNESQTPAKAQATSQSKSSATTGSKTNIKSKDRNKTLYFLTWR
FT                   WHFYAGLFVIPFMLMLSMTGLVMLFDDEIELAFHQDAIEIAVSGEPIKVSQQLAAVQHQ
FT                   YPQGTVTQFVPSKVPDLSNRFSVSLEDGTSVFATVNQYTGEVVGEIPRSDSLYQLANDI
FT                   HGTLLIGDWGDYLIEVAISLSILLLISGIYLWLPRDNASRAGFLKLRFGSGTRVLMRDL
FT                   HANIGGTLSFILLLFILSGLSWTGFWGGKLVQAWSTFPAQMWDDIPLSNETHASLNHGS
FT                   EEEMPWNLEQTPLPLSQDKPAEHVHQVEEASEAHDHSKMGEDHSQHVLSASNFSIDDVI
FT                   EKAQSIGFTQYKVNFPRSETGVYTVAANTMGGDIIDPTQDRTTHLDQYSGRILGEVTWQ
FT                   DYNLFAKTLAVGISLHQGDISIINKLLNTLFCLAFIVVSVTGGIMWWMRRPSGQRKLGT
FT                   PPKFGDAGLWKAGLVTVVVISILFPLAGATIVTAMLLDWLLFSRVEKFKTALS"
FT   gene            complement(481826..482209)
FT                   /locus_tag="VS_II0433"
FT   CDS_pept        complement(481826..482209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0433"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25927"
FT                   /db_xref="GOA:B7VR48"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25927.1"
FT                   /translation="MLKGIHHAAIICSDYEVSKRFYTEVLKLEVIAENYREARQSYKLD
FT                   LALPNGAQIELFSFPDAPERPSFPEAQGLRHLAFCVDDVQHAKSYLEEQGIEVEPIRVD
FT                   EFTGKSFTFFADPDGLPLELYQI"
FT   gene            complement(482209..483189)
FT                   /locus_tag="VS_II0434"
FT   CDS_pept        complement(482209..483189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0434"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25928"
FT                   /db_xref="GOA:B7VR49"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25928.1"
FT                   /translation="MSISKKYQPTGRVPNVMINPKLIALLPDLASFILVVNEGSFTAAA
FT                   KQLGVTPSALSKLITRLEKALSVKLFERTTRTLIITQAGQLVYDQSVVMINAAQQAVEL
FT                   STSDHTEPAGSITVAAPEAFLNSVLQPFVVPFLNQYPEIQLKLRAADGDIDILRQGIDI
FT                   AFRLTDKPDESLVLKELGKTNLVLCASPDYLDAKGTPHHPTELSEHDCLYLAETDKDHI
FT                   WDFLKDDEFYTVPVSGRYAVNHSQMRLKGVKEGLGVGIFHDFVIQDALAEGSVVQVLED
FT                   WTIKSNYHGAIAMQFAQTKYMPARLRVFIDYAMEHLGDKLAGEIN"
FT   gene            483488..484627
FT                   /locus_tag="VS_II0435"
FT   CDS_pept        483488..484627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0435"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25930"
FT                   /db_xref="GOA:B7VR50"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25930.1"
FT                   /translation="MAWPFLIVFLYEDYGASAIEVGTMLAASAVVGAGTGLYSGYLSDK
FT                   LGRKWVMVFGSWIAAISYSGIALASEVWQFYVLIMMTGLMRPMIEAPAKAVIGDNLTDQ
FT                   KDRELALNIRYFLLNLGGALGPLIGITLALAHPQNLFFVAGGTYVVYGFWLLLGIERKG
FT                   TFTKPDPSQLPDFTATLSVIRKDNIFVKLMVANFIMMFVYAQVESSIPQVIVRSSITDA
FT                   AQLIAGLVLVNTLTIIVFQFPMLKWLEHVPLFVRTRIGMILMAVAQIGFLFTPNDWPLG
FT                   WGIACFILSLGEVIAFPTLNVQIDRMAPPHLRGSYFGAAALYSLGFAIAPLFGGVVIEI
FT                   LSAYWLFALCFILCLVMIWLYWLAEHTEDCVDRESIVQS"
FT   gene            484944..486137
FT                   /locus_tag="VS_II0436"
FT   CDS_pept        484944..486137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0436"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25932"
FT                   /db_xref="GOA:B7VR51"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25932.1"
FT                   /translation="MSSAFYQQIQTQIEEVKEEGLYKSERIITSAQKAAVSISTGEEVL
FT                   NFCANNYLGLANHPDLIEAAKDGMDQHGFGMASVRFICGTQDSHKELEQKLSKFLGKED
FT                   TILYTSCFDANAGLFETILGKEDAIISDALNHASIIDGVRLCKAMRFRYSNNNMEELEQ
FT                   QLIAAKEAGARHTLIVTDGVFSMDGVVANLPAICDLADKYGALVMVDDSHAVGFMGENG
FT                   AGTHEFHNVVDRIDIITGTLGKAMGGASGGYTSGKKEVIDWLRQRSRPYLFSNSVAPAI
FT                   VSASIRVLDLLAESGDLRTQLWENSAHFRTRMEAAGFTMGGADHAIIPIMLGDAKVAAE
FT                   FAERALEKGIYVVGFSFPVVPKGAARIRTQMSAAHSREQLDRAIDAFIQVGKDMAII"
FT   gene            486247..487278
FT                   /locus_tag="VS_II0437"
FT   CDS_pept        486247..487278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0437"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25934"
FT                   /db_xref="GOA:B7VR52"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VR52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25934.1"
FT                   /translation="MKIKALSKLKPEEGIWMTEVEKPEMGHNDLLIRIKKTAICGTDVH
FT                   IYNWDEWSQNTIPVPMVVGHEYVGEVVGIGQEVRGFEIGDRVSGEGHITCGHCRNCRGG
FT                   RTHLCRNTTGVGVNRTGAFSEFLVIPAFNAFKIPAEISDDLASIFDPFGNAVHTALSFD
FT                   LVGEDVLITGAGPIGIMAAAVAKHVGARHVVITDVNEYRLDLARQMGVTRAVNVMEEKL
FT                   EDVMSDLGMTEGFDVGLEMSGNPSAFNSMLTNMNHGGKISLLGIPPSDMAVDWNQVIFK
FT                   GLVIKGIYGREMFETWYKMASLIQSGLDLTPIITHHYKVDDFQKGFDMMRSGMSGKVIL
FT                   DWE"
FT   gene            complement(487458..488681)
FT                   /locus_tag="VS_II0438"
FT   CDS_pept        complement(487458..488681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0438"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25935"
FT                   /db_xref="GOA:B7VR53"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25935.1"
FT                   /translation="MITNDAVIMGMLAVILGGVFITESSQNSALKKFYSFVPGLLLCYF
FT                   VPSLLNSLGIIDASNSKLYFVASRYLLPSALVLLIISADLRKIFGLGSKAVIMFLTGTV
FT                   GIIIGGPLAILIIDQVNPDLVSGDVWRGLTTVAGSWIGGGANQAAMKEVFEVDDQLFSA
FT                   MITVDVICANIWMAVLLIMAGRQKKIDAWLKADTSSIEELKETVSKYQEENARPTTTTD
FT                   LMKITAIAFGLTGLAHLFSDMIAPWISTNAPELAKYSLTSGFFWLIVMVTTFALIASCF
FT                   KSTRSLEHSGASKVGSAFIYILVATIGMQMDVTAILDNPGYFFIGITWLTIHALLMIVM
FT                   AKLIRAPLFFMAVGSQANVGGAASAPIVAAAFHPALAPVGILMAVLGYALGTYGAYICG
FT                   LIMQAAAG"
FT   gene            488848..489003
FT                   /locus_tag="VS_II0439"
FT   CDS_pept        488848..489003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25937"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25937.1"
FT                   /translation="MNALVAACEACLDICNVTQTLEDGRYELERRLKGLKECIYTRIDG
FT                   MVYVER"
FT   gene            complement(489208..491133)
FT                   /locus_tag="VS_II0440"
FT   CDS_pept        complement(489208..491133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0440"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   protein kefC (K(+)/H(+)antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25939"
FT                   /db_xref="GOA:B7VR55"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25939.1"
FT                   /translation="MTGYFLQAFIYLLAAVIAVPIAKRLGLGSVLGYLIAGVVIGPIIG
FT                   LVGEETTTIQHFAEFGVVMMLFLVGLELEPKMLWAMRNRLMGLGGLQVGGTTAIVMGIA
FT                   LFFGQPWTIALTIGLIFALSSTAIVLQTFNEKGLSKTEGGKNAFSVLLFQDIAVIPMLA
FT                   FIPLLALPELIEAAQSAVASASDHHEELSLVAGLPGWAYGLVITASIAIVVVGGHFLSR
FT                   PLFRFVASSGLREIFTATALMLVIGIAALMSLVGLSPALGTFLAGVVLANSEFRHELES
FT                   NIDPFKGLLLGLFFITVGAGINFDVLFNDFGLIIGLTLGVMLLKALVLFTLALIFKIRN
FT                   SDRWLFTLSLAQAGEFGFVLLSFSAQNHVLPADIVQTLSLVVALSMFLTPGLFILFDKV
FT                   ILPRYEQKSNDREADTIEEKGTVIIAGIGRFGQIVNRLLVSNDVNTVVLDHQANQVDLL
FT                   RSINIKSYFGDATRHDLLHTAGIEEAAMFVVAIDNQDSSVELVKYVKHTYPNVKILARA
FT                   FDRGHSYRLREAGADSVVSETYHSALEMGAEALRSLGHHPFFVEQQKSTYQRVESRKSE
FT                   KLYQAWSEAEENPRYDNNYRQIFIHLEEAMKEDMKKDRSDKHSRSERGWTPPPKGYADG
FT                   FEEEQT"
FT   gene            complement(491137..491805)
FT                   /locus_tag="VS_II0441"
FT   CDS_pept        complement(491137..491805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0441"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25940"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25940.1"
FT                   /translation="MYIYNSNKYYSLMDKEGYMSKNRVLVLFAHPSQHRSEANKPLFEQ
FT                   AKRIEGVTCVDLYAEYPTFKINIDREQKRLLDHDIIIFQFPLYWYSTPAILKEWQDLVL
FT                   EYGFAYGTDGNELQGKSLLCSITAGGKKEAYQTDGYNHFTIRELLHPIEQTASLCGMNY
FT                   LAPLALFGSRTALEEGRIQDHVNSYKSLLEAFVAGEVDLKKASKAEKLNHYVDEMMSRG
FT                   "
FT   gene            492055..493131
FT                   /locus_tag="VS_II0442"
FT   CDS_pept        492055..493131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0442"
FT                   /product="Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25942"
FT                   /db_xref="GOA:B7VR57"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25942.1"
FT                   /translation="MSTDLRQQCNLLLSGHFDPTPAQTFAQMAEWCETHDVAHDTYGDG
FT                   EFIESFENKVADLLGYEAAVFVITGTMNQPTALEIACQEKRNPLVAMHESSHIMRHERQ
FT                   GYQIQNRFNVLPVGNVFRTWNVDDLKAWPDEIAAALYELPMREIGGQLPEWEELEAIKQ
FT                   YCKEQSIHLHMDGARLWECGAYYQKPYSEIAKGFDTAYVSLYKGLNGLGGSLLLGDKAF
FT                   VAKASAWMKRQGGNVYHRTPYVVSAAMQFDQRIELMPALYERTKQIYQILQDYPQFKVN
FT                   PQQPQVNMLHLYLPVGFEDGIILRDNIAKKHKIWIGNPAISELPTQCKIEWYVGDNLLN
FT                   LPDHELIDILDFINEELI"
FT   gene            493609..494043
FT                   /locus_tag="VS_II0443"
FT   CDS_pept        493609..494043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25944"
FT                   /db_xref="GOA:B7VR58"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25944.1"
FT                   /translation="MRTVGNIIWFLFGGVFMGLAWWFFGLLAFLTIVGIPWGRACFVMG
FT                   NFSFFPFGQEAISRDELTNETDIGTSPLGLIGNIIWFLFAGIWLAIGHIMSAVACFITI
FT                   IGIPFAIQHLKLAVISLAPIGKTVVDKREAEAARVRNYKG"
FT   gene            complement(494164..495087)
FT                   /locus_tag="VS_II0444"
FT   CDS_pept        complement(494164..495087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0444"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25946"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25946.1"
FT                   /translation="MSRWIVSTSLLASLVTHSAQAEEQNECHSQPLEDAPVEKAYHYLN
FT                   SKFCQPALWFDSFFVDDRITEDARAGTSVRWYNDFIYSEGGDVDYSTKLNARLHLPFAS
FT                   KRLKLIYESVSDEEFFDFFPQDSEELESALGLRYDAYAKGYSSFNIKATLRPRIEARYR
FT                   FTYPLTTDAVFRLTQRVYQEKQETGEITDIDFDLSLSDDFLARWSNFAGYNDDLKGWEY
FT                   GTGLTLYHYLSQDQALQYSATIAATSEPYNHYEYSQVSITYRENVWKEWLFYELIPRYQ
FT                   WEREPYEKHTEEANITLRLEVLFNNV"
FT   gene            complement(495325..496473)
FT                   /locus_tag="VS_II0445"
FT   CDS_pept        complement(495325..496473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0445"
FT                   /product="Alcohol dehydrogenase II"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25947"
FT                   /db_xref="GOA:B7VR60"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25947.1"
FT                   /translation="MSTAFYIPTINFMGTGCLKDAADSIQSQGFKKGLIVTDKILNQIG
FT                   VVKQVQDLLSQRGVDAVVFDGTQPNPTITNVNDGLELLTDNDCDFVVSLGGGSPHDCAK
FT                   GIALVASNGGKIADYEGVDQSEKPMMPLIAINTTAGTASEMTRFCIITDEARHIKMAIV
FT                   DKHTTPLISVNDPELMLAKPASLTAATGMDALTHAIEAYVSIAATPITDAVAIKAIELV
FT                   QAHLRTAVAHGEDIEAREQMAYAQFMAGMAFNNASLGYVHAMAHQLGGFYDLPHGVCNA
FT                   ILLPHVQRYNAQVCPDRLRDVAKAMGVNVEGMTAEQGAEAAINAIVQLANDVNIPTGIA
FT                   QLGAKLEDIPTLSDNALKDACGFTNPKQATHEEISAIFEAAM"
FT   gene            complement(496712..496897)
FT                   /locus_tag="VS_II0446"
FT   CDS_pept        complement(496712..496897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0446"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25949"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25949.1"
FT                   /translation="MKHFLPSSVMLTPFLVKYYDEQPEDTSDALDTDESQQPQIEANDD
FT                   SRKPSTQTELEPTLSE"
FT   gene            497111..497785
FT                   /locus_tag="VS_II0447"
FT   CDS_pept        497111..497785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0447"
FT                   /product="5'-nucleotidase (Nucleoside
FT                   5'-monophosphatephosphohydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25951"
FT                   /db_xref="GOA:B7VR62"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25951.1"
FT                   /translation="MKYDWIFFDADETLFHFDAFQGMKLMFSRFGVDFSEQDYSVYQEV
FT                   NLPLWVDYQDGRITAAQLKHARFESWATKLETTTAALNSAFLAAMADICSLLPGAKELM
FT                   ESLQGKVNMGIITNGFTELQSIRLERTGMTDYFDHVIISEEVGVAKPDAEIFEHAHKLI
FT                   GLPSKQRVLMVGDNPHSDILGGLDFGIETCWLNSQEKATPAGINPHYQVKSLADLQALL
FT                   LA"
FT   gene            497965..498897
FT                   /locus_tag="VS_II0448"
FT   CDS_pept        497965..498897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0448"
FT                   /product="Transporter, drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25952"
FT                   /db_xref="GOA:B7VR63"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25952.1"
FT                   /translation="MLKSHRHSCYGIAAILLWSCLIALSRSVSEQLGPIGGAASLYTVS
FT                   SLLLVCVMGLPKLSRFSKSYLLIGGALFVCYEIFLALALGMANSRHQALEMAVINYLWP
FT                   ALTVLFAVLLSDKKINWLVYPSIVLAFFGVAWSISGDQGLSVEQIAANIATNPKTYSMA
FT                   FFGAIIWAVYCNYTQRVAKGQNAIVLFFIATAITLWIKYALSDETGMVMTSSAAIDLVL
FT                   AGACMGAGYALWNTAILGGNMVFLATMSYFTPIFATLLSSMILGLSLTMTFWQGVCMVT
FT                   VGSLACWWVTRDKKTTVKASASKNVHSQS"
FT   gene            complement(498928..501090)
FT                   /locus_tag="VS_II0449"
FT   CDS_pept        complement(498928..501090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0449"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25954"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25954.1"
FT                   /translation="MFAPSYNTRLSYFSDRDMTPSKHFNYFLSEKINDIVEAPNEASIL
FT                   TIEAKIREFASENDLPIPSAVDYFCTGSRLLKLGQVHQAFEHLTEALHRSEISNIHDIK
FT                   FCIEYSIGVALIRLGCYSKAIISLTKASASKAVNNERLLTRIYNNLGYIFLETQDYSKA
FT                   QYYCKLAWEIEKNSLQASSRSILSNLAIIDSTLGNKAEAERKFTLCRELLNKHPSLIGT
FT                   YFYHSCYAEHLQSINQIDEALSSFKTAIEICELLGDNFYLIETLKNYCSCAIEHERNDI
FT                   LEPYLSRAISLGNKYGSATSLQKLASSLFNFSRQEATEAQQSKIVEKAFELQSIAFQNL
FT                   SESNNEAVFQLYQLYSERPALEKAHSFTTDLDLITSFGEYLSSHSNLTDMMQRLHEDLK
FT                   KVMPVESLGLALYNEDTQQLTYEIYLDLGVTLEPFTVDCTKQATLSAYCINNRIPFCHG
FT                   AFTKAALNKLLNKPLGEHALTGVTKEDYSSVIMLPLILEGKRLGVLTVQSIEPNAYQEH
FT                   HLSLMKHLGSYLSIDLQNKQQKKQLEEQKMTLKTLMNLDPLSQLFNRLTLAESITQWRD
FT                   TVEIEQPYALLLIDIDYYKQFNDCYGHVKGDEVLVTISKQLKHHFSAESFKVFRFGGDE
FT                   FLVLCTGETKNALLAKTSQLLSGVHDLNISHKKSKCSDRLTLSVGGAIFTHFDILNLTN
FT                   EELIQKTDKTLYKVKDQGRNGILIED"
FT   gene            complement(501151..502047)
FT                   /locus_tag="VS_II0450"
FT   CDS_pept        complement(501151..502047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0450"
FT                   /product="putative cation efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25956"
FT                   /db_xref="GOA:B7VR65"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25956.1"
FT                   /translation="MCDRKSQNENRVLLFSALLASGFAIGGLVLGLLVGSLVIVFDGVY
FT                   SLISLLLTLLSLAASKYINRPSDREFPFGRAIIEPIVIAIKAIVILLVVGYSLYSAIGA
FT                   LMTGGREVDASIATLFGIFNVLGCGYAWWYIANKSKRISSGLIQAESKQWQMDTLLSVA
FT                   VTAGFVVAWLVAYSPFAEYAVYADPMMMLLMSFYFIKVPFDMLREAMRELLMMSATKDI
FT                   CDAVDKNVVAVDKDAEQDLELMGVTKVGPELRVNVDIHTNDQDAITVDDIERTRHQLKR
FT                   RLSKMPYELQLNLNITA"
FT   gene            502409..502759
FT                   /locus_tag="VS_II0451"
FT   CDS_pept        502409..502759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25957"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25957.1"
FT                   /translation="MKFDDLNDSELWVIANPIMDNLMDGSTKVDHAQHCRDFTQRMKDI
FT                   VTPEYLEKVCHHYQHSNGFFAEREPVALFRRSDSIAFVWKQAYTIAKGEFVAEMVLVEE
FT                   DGRYLVDHVMVF"
FT   gene            complement(502821..503699)
FT                   /locus_tag="VS_II0452"
FT   CDS_pept        complement(502821..503699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0452"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25959"
FT                   /db_xref="GOA:B7VR67"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25959.1"
FT                   /translation="MNLSQVQAFCSVADLGSVSEAARQLECNRTKLSMSIKALEKELDV
FT                   ELFVRSGNHVELSEAGKAIYKDCEGMLVTAARIKQTCLHVSGEFNAEIWIARDDSLPDE
FT                   MWQSLSHALNNKYPSTSFNFVLASSGDLANLVETQQVDFAFGVDYERVDDPRIIYNPLG
FT                   KIRMMSVCKKGHDLSAMRRVSDEVLRNSMQATMVYLNEKDNPELEPFSRRYIGFSSFDF
FT                   MLDTILREDAWGVMPEPLIRHLLREQELAVIKHTYGLTQEDYCMFTAAGMAEHPGMNWL
FT                   ADQISDYLFDF"
FT   gene            503849..504460
FT                   /locus_tag="VS_II0453"
FT   CDS_pept        503849..504460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0453"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25961"
FT                   /db_xref="GOA:B7VR68"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25961.1"
FT                   /translation="MEAMMAKQWDEYAPDWDNDPATAVFAQSAFDQLTQLVDLNGTRVL
FT                   DFGCGTGLLSQKISPFAKEIIALDISEGMIEELDKKELSNVEPVVDILSRGLAAQHPAF
FT                   RNQFDLVVASSVCGFIPNLQDTVSLIYTLLENDGVFVHWDWYLENDSEDFGVSEQRSQN
FT                   VLSAAGFSIVEVSTPFSIDTPQGTLKVLMGVGRKQVVPHL"
FT   gene            504872..506437
FT                   /locus_tag="VS_II0454"
FT   CDS_pept        504872..506437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0454"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25963"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25963.1"
FT                   /translation="MSHQSASSTSSTLSEQQQRFSNIISDANLSPKQKSSYLALEAEAS
FT                   LPYMPVSNEVEQALQQGVLCDMFEGHAPFKPRYVLPDYSKYLHQGSKYLELSAATNFDE
FT                   ALNMLTILYHHVPSVTSIPVYLGQLDDVLMPFVGGLTDEQVYQKLKLFWIMLDRTLPDA
FT                   FMHVNIGPSDNIVCRTILRVDAELKQIAPNLTFMYDPAVTPDDLLRHAASNICECSKPH
FT                   IANYPAHAAAYGDKRFGIVSCYNSLPLAGGSNTLVRMNLKQVALKSEDSVDFLQQVLPN
FT                   YSSIMIELMNARSRFLHEESNFFEGFLTKEGLIEEDRFAPMFGIYGMAEAVNILMEKEG
FT                   KAGRYGHDEQANQLGHRISEKLAEIVENSEVKYGLEGKALLHAQGGISLDEDVTPGVRI
FT                   PYGTEPDPVSYVRATAGHHKFYTSGISDILTIDETVKSNPEAMFNLCKGAIQAGYREFT
FT                   ANVASNDLVRVTGYMIKLSDIAKYDEQGSRTNTTFLGAEAAKNTGILERKPRVASLEMS
FT                   PTYE"
FT   gene            506514..507401
FT                   /locus_tag="VS_II0455"
FT   CDS_pept        506514..507401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0455"
FT                   /product="Pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25965"
FT                   /db_xref="GOA:B7VR70"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25965.1"
FT                   /translation="MARVKNNKTEKQAKVSRVLTFSCVDGPGNRLVLFLQGCNFDCITC
FT                   HNPHTINHCNHCGDCVSGCPSSALSLIEGKVKWDPLACTNCDQCVDICDHKSSPKITTM
FT                   TVSDVLELVRHNQFFLSGITVSGGEATMQLPFIVELFQAIKSDPQLAHLTCFIDSNGSL
FT                   TQQGWDKVLPYLDGAMIDLKSWQSETHQWLVGRGNHRVFETINYLADKGKLHEVRLLHI
FT                   PNKSDLDIEVEQVGYYLKGLPSDVRIRLNAFQHHGVIGEALEWPKCTEQQMQSFHDKLY
FT                   LIVQRPMQTPEVYT"
FT   gene            complement(507467..508393)
FT                   /locus_tag="VS_II0456"
FT   CDS_pept        complement(507467..508393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0456"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25966"
FT                   /db_xref="GOA:B7VR71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25966.1"
FT                   /translation="MSELCMDYLHLSRVSLKHLTALHIMLNTHSVTQTSEQLFVSPSSV
FT                   SKTLSQLRDILNDELFYRDGTKLIPTPFALKIAPTVHAILSSMNGLLHQKSFTPQEYQG
FT                   SFSLSMRESTFEVFASKISKITTELAPKAKLNIYSKQELGFDALLSGKVNLILLPHDIS
FT                   QPPTDNKELVWETILPDEMVCLMGAHHPLAQQELTVEGYLDYKHIGILDNELSKPYFEQ
FT                   NLVQCHKPRDMAISVADFGAAAVLCHHTPFLFTCSKQWAEHAKQAQGLVSKPLPFDYGK
FT                   VAYSLVWNKPNMNDQAIKWLCDLFLEA"
FT   gene            complement(508432..509721)
FT                   /locus_tag="VS_II0457"
FT   CDS_pept        complement(508432..509721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0457"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25968"
FT                   /db_xref="GOA:B7VR72"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25968.1"
FT                   /translation="MLHKLYFILFMPKLNLHRRDYVSILGGDISADELEKKLQPHFDKP
FT                   VNKLTPSPYLTEKNLTRRWAALDNADSQQELLDPHTQSQIQAYEKNIEHFIGTVKVPVG
FT                   ISGPLRVNGLFAKGDYLVPLATTEAALVASYNRGSKLITACGGASAMLLNEGVTRTPGF
FT                   AFQGLVEAGQFVAWAVTQYDQFKTLAESTTSHGKLTDININIEGNHVYLVFEFLTGDAS
FT                   GQNMVTIATNAVFEYIIEHTPVKPDHAFLDGNLSGDKKANTQTLRSVRGKKVTAEVNIS
FT                   AELVAKYLHTTPEKMVQFGQMTTVGGALSGTIGINAHYANALAALYIACGQDAACVAES
FT                   AIGMTRMELSKEGGLYASVTLPNLMLGTVGGGTGLPSQKACLDLLGLHGNGKSQALAEV
FT                   CAALCLAGELSIVGAFCAGHFSRAHHKLAR"
FT   gene            complement(509859..510179)
FT                   /locus_tag="VS_II0458"
FT   CDS_pept        complement(509859..510179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0458"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25970"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25970.1"
FT                   /translation="MSISGIQSGYAIIQQSTNMAEEAAIELNQNSKHSPKTNDTFQTSD
FT                   LSFNQIEPEQPISFKEKEPEPASSSTEALLKLTQSANYNRVGASVVDRQNEAIGSLLDI
FT                   HI"
FT   gene            complement(510301..510462)
FT                   /locus_tag="VS_II0459"
FT   CDS_pept        complement(510301..510462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0459"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25971"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25971.1"
FT                   /translation="MNTQQFEAFKQKIQLLNPQQLKALQGEIDENLETDQPSLLTDEEL
FT                   NVLNELFN"
FT   gene            complement(510815..513001)
FT                   /locus_tag="VS_II0460"
FT   CDS_pept        complement(510815..513001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0460"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25973"
FT                   /db_xref="GOA:B7VR75"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25973.1"
FT                   /translation="MDFSAKLRLYWANKTINYSVLILITLLGVVVPAWYYGQNTLITPL
FT                   ILGVIAAALAESDDSFTGRLKALTLTFICFAVAAFSIEILFDTPWLFAIGLFVSTFSFI
FT                   ILGAIGPKYASIAFGSLLVAIYAMLGAHESTNLWFQPLLLLTGAAWYYFMSMIWQIVWP
FT                   MQPVQQNLATVFDQIGNYIGSKAELFYPVSDLIPQPHRIIEAKLNASTVNALNMCKATL
FT                   LNRSKRGHIDGPSDRFLNTYFIAQDIHERVSSSHYRYQELAKHFERSDVLFRFKYLLEA
FT                   QAKACKEVASSLKVGAEYQHGEKSVLALDELMSSLNHLHQQNKPEWKSLLNQLDYLFNN
FT                   LATVEKQLSNISNPDAEKLEEGVLDDTNPHTLTAMWHKIKANLNTDSMLFRHAIRMAIT
FT                   LTIGYGIIQGFEIERGYWILLTTLFVCQPNYSATRQKLTARVIGTVAGLLIGVPLLTFF
FT                   PSQESQLVFIVVSGVMFFAFRINNYGFATAFITLLVLFCFNQLGEGYAVVLPRLADTFI
FT                   GSALAVLAVSYILPDWQSKRLHKVMADALDSNKDYLAQIIGQYRVGKKDSLSYRIARRS
FT                   AHNNDANLTAAVSSMLVEPGKYRTSEDESFRFLTLNHALLSYISALGAHRTRIDDEATH
FT                   KLVLDAHRVIHEHLDALNDQLFCHQEQCEVKNAYDPELDKRLSEWREEDESSVRMVLQQ
FT                   LHLIYRMLPELHTLATKFAVKVKIEKPLEKEISR"
FT   gene            513179..515254
FT                   /locus_tag="VS_II0461"
FT   CDS_pept        513179..515254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0461"
FT                   /product="Helicase IV"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25975"
FT                   /db_xref="GOA:B7VR76"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR022161"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25975.1"
FT                   /translation="MQLSANKTAQFFIQNEYHQVELDGPRLLLSSVGSEERIPFTIWSG
FT                   KIAIKRGLFWGSLQFFANQQDGKQRSWLVQGLPWEQCRQFARASVAAYQKWHDRQCEQL
FT                   AEHVPQWEDELTRLEQLPAFLPHSKVNTWVDMVNAGLENMTMTLEEAAQRMPNRIARMQ
FT                   PWLSETEIQQAERNQQWLETERQNWEVLFAQCESSPLNLSQQYAVLMNDDHNLILAGAG
FT                   SGKTSVLTARVAYLLQSHQAQAEELLLLAFGREAAEEMKQRLNSKIGISAEKVQVSTFH
FT                   QLGLKILNQVEPERVVISPLALDDNQRQAWCIDWLKKHWMTPTNFKRWQKHLSKWPIAY
FT                   LTGDDELGSHVSNLKLIGWLEKQLEQLNASGLTKKEVQQQLIDHRDYTRLNSELSLCWP
FT                   CVTAWQKELKEQNHIDFSIMISRATQYVEKGKFISPWKFIMIDEYQDISPDRLALVEAL
FT                   CNQSKAQHQASIFAVGDDWQSIYQFAGADVDLTTGFKDRFESSTIHHLDTTYRFNNQLG
FT                   SVANRFVQENPIQLPKELNSFKQQKQKSVYSAPSKEVEKILDQINRQAKGKANKSVMLL
FT                   GRNHYHKPELLEDWKKIYTSIDISFMTCHASKGKEADFVIILCVDEGQFPAKKKQLHID
FT                   GALTESSDMFPYAEERRLFYVAMTRAKEKVWITHSGDGSGFVQELHGSDYPVVRKK"
FT   gene            515386..515736
FT                   /locus_tag="VS_II0462"
FT   CDS_pept        515386..515736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0462"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25976"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25976.1"
FT                   /translation="MEHGSINYIEFAARDIAATKAFFSQVFGWIFEDYGPEYSAFEGKG
FT                   LMGGFYLADLASNAESGAALMVFYSEDLEQTECDVTDAGGEINREIFSFPGGRRFHFRE
FT                   PSGNEMAVWSDK"
FT   gene            complement(515923..517926)
FT                   /locus_tag="VS_II0463"
FT   CDS_pept        complement(515923..517926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0463"
FT                   /product="Transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25977"
FT                   /db_xref="GOA:B7VR78"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25977.1"
FT                   /translation="MEAIMNRKHLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWR
FT                   SHLNHNPSNPEWADRDRFILSNGHGSMLIYSLLHLAGYELSIEDLKNFRQLHSKTPGHP
FT                   EYGYAPGIETTTGPLGQGITNAVGMAMAEKALAAQFNKEGHDIVDHYTYAFMGDGCLME
FT                   GISHEACSLAGTLGLGKLVAFWDDNGISIDGEVEGWFSDDTPKRFEAYGWHVIPAVDGH
FT                   DADAINAAIEAAKADPRPTLICTKTVIGFGSPNKAGTHDCHGAPLGADEIAATRKQLGW
FT                   EHGPFEIPSEVYSEWDAKEAGAAKEAAWNKKLAAYEAAYPELAAEFKRRVNGDLPAEWE
FT                   EKASAIIADLQANPANIASRKASQNALEAFGAMLPEFMGGSADLAPSNLTMWSGSKSLE
FT                   ANDFSGNYIHYGVREFGMTAIMNGIALHGGFVPYGATFLMFMEYARNAMRMAALMKTQN
FT                   IQVYTHDSIGLGEDGPTHQPVEQIASLRLTPNMSTWRPCDQVESAVAWKLAIERKDGPS
FT                   ALIFSRQNLAQQDRDAEQVANIAKGGYILKDCAGKPDLIIIATGSEVELAVSAAAELTA
FT                   EGKAVRVVSMPATDAFDKQDAEYRESVLPSDVTARIAVEAGIADFWYKYVGFGGKIIGM
FT                   TTFGESAPAGELFKMFGFTTENVVNTAKEILA"
FT   gene            complement(518005..519015)
FT                   /locus_tag="VS_II0464"
FT   CDS_pept        complement(518005..519015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0464"
FT                   /product="Transaldolase B"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25979"
FT                   /db_xref="GOA:B7VR79"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25979.1"
FT                   /translation="MQMPTPLPLTRCYAIHRMIKMSNKLEQLRKLTTVVADTGDIEAIS
FT                   KYTPEDATTNPSLILKAAQIAEYAPLIDASIEYAKAQSGDKAQQVQDTCDMLNVNIGKE
FT                   ILNVVPGRISTEVDARLSYDMEGSVAKARQLIKMYNDAGITNDRILIKLASTWEGIRAA
FT                   EILEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGRIMDWYKAKEGRDFEASEDPGV
FT                   ISVSDIYNYYKEHGYKTVVMGASFRNIGEILELAGCDRLTIAPQLLADLEAAEGEVVEK
FT                   LIDSNGTKERPAAMTHAEFLWDHNQDPMAVEKLAEGIRNFAVDQGKLEDMIAAKL"
FT   gene            519415..520407
FT                   /locus_tag="VS_II0465"
FT   CDS_pept        519415..520407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0465"
FT                   /product="Transcriptional regulator, SorC family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25981"
FT                   /db_xref="GOA:B7VR80"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25981.1"
FT                   /translation="MSNNIQDVSEENTDLLTEVAVAYYQDGATQEEISKKFSISRAKVG
FT                   RMLKQARDEGIVEITVKYHPVFSAKIEQRLIERFGVKRALVALDQPNEEKQRLQVAGLV
FT                   SNYLTSTLKNGMVVTVGQGRNVSSIAHHTGVITPRDCKFVCGIGGIHPRGGMFNADHIC
FT                   RQLAKKYGGSSETLYAPAYAENKAQKSAFMENSTVKQTLDLARKADVALVGIGDMSENS
FT                   YMVDLGWFTAGEVVQSRLLQGVVGDFAGYDFFDVHGKAANTVMSDRVIGLGLEEFRPIA
FT                   EVIAIAAENSKPLALLGALRTGVVDVIATSVSNALTVLNLDEQLKHASP"
FT   gene            520677..523694
FT                   /locus_tag="VS_II0466"
FT   CDS_pept        520677..523694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0466"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25983"
FT                   /db_xref="GOA:B7VR81"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012045"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25983.1"
FT                   /translation="MRTKLICTFITALIAVCSVQATTLPAPTWHTMTFIDGSTKELRLM
FT                   GSQYMFWYQDHDGHLYVQGVDNQWYFAKYETSEKGGGSVVSTGVLASSDTEIPVESNIK
FT                   NLKIDPIHINESFDSPAANHKRFTPMNTQRSYLNSPSKKRITEQALLVIQVSFLDEQIE
FT                   NDFQSTIFGENQQSVQDYFLKNSYGNYKVVPAKENEGTKNDGVINITLDIDHPNCHSKS
FT                   EKNCQTKLNNVFTKAYEALDVDFDLSQYDSNNDNSISAQELSVMFVFAGNDKSSGTRKT
FT                   PTIWPHKYAHSTVEIDGKRISAYCLFADYQGDHQSTMGVIAHELGHLMLGLPDLYSYQH
FT                   DGSIGHWGLMGGGSWGRKPTDQYAGETPVNMLAWSKEASGFLKPKVLSNNGSIEVGTIK
FT                   GESVIHLDPYLKQFGPRAYVENRRKNDYDQALRGEGLLITAVNIDNQFNSSGPMQVQVF
FT                   QADGEGLLENGFSSGDSGDVFPGRESVTNLSDDSEPSLTAITAGRKTDISITNIVSDDT
FT                   KASFSLLVPNTNNKSSWVTSFGRTYPRYDANINVLGFPIDVVKGNQSIAGIHFYAKATS
FT                   VAMPMFYRLVEYPYQSRFGNAVIDEQAARLLHRGIARQGGGQIIFDEKIKLGLGTKLIV
FT                   LEIENGTPEYSTQFLDAYLGDGQRKSQFSGSISDYKTRGLSRGFGQNFPFAALFELPID
FT                   ARPIAVDDMISTEEDTPFMLNLLANDINLPKPNNYSFEIAQKPMKGVIKDGTYFPKVDQ
FT                   FGRDSFTYRLVDKLGYETDFASVEVDIKPVNDAPRLTIDRLEVTSKPGETVTFTVTDIT
FT                   DVDSSEHQIMWSQIQGPSLKLSGSRSKALQVTVPSDASKGERYRFTILVQDSSGGNAKQ
FT                   SVVLDVQRTEALLLGTKSLQVKYGDTIDLVPIINGDVYRLSILEFPRSGIANIVDSKII
FT                   YNAPAQRKLALYDTIRYKVLSADGDEWVGSFDIEVLPSVSNASSVSLSQDDSSGGSSSL
FT                   PILFILCMLLRLRKQR"
FT   gene            524243..525127
FT                   /locus_tag="VS_II0467"
FT   CDS_pept        524243..525127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0467"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25984"
FT                   /db_xref="GOA:B7VR82"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25984.1"
FT                   /translation="MKNVNRSIDVKYLRTFSHVAKHKSFTAAAESLFMTQPAVSQHIKK
FT                   IESTIGASIFDRKEGFLLTKHGKVLLDYADQTMSMYERLFEDLEKVELRDQFNIAISES
FT                   FCFDMVERVINEFRMLNNIDLSINSFTKSSLLDSSRYDLIFTMDRISQENGKSYQLNTV
FT                   NYVIAHSNSLDPHECYPQRVVFCSSLPKSYVQEILNDYKIDSNHVTSWVKTSSCQFLKN
FT                   ELETNGTILIFPEWSIRHNKCKTIPLRQKVNTYVWCSDEISQELETLGIKDKIQQLFQI
FT                   SDISSPMLEHNIM"
FT   gene            complement(525128..525586)
FT                   /locus_tag="VS_II0468"
FT   CDS_pept        complement(525128..525586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0468"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25986"
FT                   /db_xref="GOA:B7VR83"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25986.1"
FT                   /translation="MNIDLLVNITLISTNFLILSFICFFDGWHRKIPNNLNKIALIFSH
FT                   LVALNNGYLMSSLPIAILCFVVFFILWYLKVIGGGDVKLLCALIISIQPNLVTITLICI
FT                   GFLGGLLVFAMYIVGKVRGLPSFTKGIPYGIPIALSCFFFSTISILAN"
FT   gene            525798..526016
FT                   /locus_tag="VS_II0469"
FT   CDS_pept        525798..526016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0469"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25988"
FT                   /db_xref="GOA:B7VR84"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25988.1"
FT                   /translation="MYYKTLAKMAELKMKFEDDVRGVTAVEYAIIAVVMSALVLAAFNT
FT                   PALEKAIKGALTAVTNNLTSVTPKAKS"
FT   gene            526071..526847
FT                   /locus_tag="VS_II0470"
FT   CDS_pept        526071..526847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0470"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25990"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25990.1"
FT                   /translation="MNRVIILFLVALSIFSTLIYINTNYISTDEEPLGVQEQEEPKVSI
FT                   LVTQKAIKRSQPLTPKFYDKKFVPISDLDGYYYTLEDDLIVEPGALFKEDISEGTYITQ
FT                   DMISNPADRDYIYLSLNDGELPYFYEVTGIGVVQTATLTAGDKVSFVSTTSSKSNLVEN
FT                   GYGDIGDLVSRVIISGARVLQVIEGSEDSNSADSADKKYSLVIALNMRSVLKLEMAQKI
FT                   GDVNIIPSEIENRYLSIRSSDLLETQFGVRELRGKE"
FT   gene            526834..528174
FT                   /locus_tag="VS_II0471"
FT   CDS_pept        526834..528174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0471"
FT                   /product="Flp pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25991"
FT                   /db_xref="GOA:B7VR86"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25991.1"
FT                   /translation="MVRNNMTLKKKNIALLLCGILSCPLLASELMNLDQGAAKTINLKR
FT                   QISTVFVANQEVADYKIIDENKVVVYGVGQGATSVIVYDRGGNEIYNAELVVNQSLRLL
FT                   KQTLIARFPDENVVVSNVGDQVVLDGIVGSEEIKQKINRLVGEMLKKDRRRAAYELKDA
FT                   DGEALDELEYTAKYNYDQVINNLKVLTTEQINVKLTVAEVSSSFLTELGVTYSDSGQPG
FT                   TFVNKLLDFTAQDIVSVISASGDDKIGRVLAEPNLSVISGEQASFLAGGEIPIAVRDQD
FT                   GITISYKEYGVKLAMVAKVTDTENIRLTLIPEVSSIDESNKTTTGLISVPSLRTRRAQT
FT                   TVHLKDGQSFVLAGLLTSEERESLTKIPILGDIPILGALFSHSSTNRSKTELIIVATVN
FT                   LVDPVEQEQVKLPSFRRTSDLERLLRIDLSELDEPELENTINQGGFN"
FT   gene            528174..528635
FT                   /locus_tag="VS_II0472"
FT   CDS_pept        528174..528635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25993"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25993.1"
FT                   /translation="MRWIVITLIALITSACSHVDTPNSSVIEQLEERFEFDMASREDSI
FT                   SRSVAFIRELNAREPKATFYVKYKPDASEFVAKLRDRFKSESIAKDRYKIELADHDQEK
FT                   NILIIGRYVRIKSSDCGVMVFSKREDYQFGCSVEHNRNISLVNPIKKAK"
FT   gene            528638..529831
FT                   /locus_tag="VS_II0473"
FT   CDS_pept        528638..529831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0473"
FT                   /product="putative Flp pilus assembly protein TadZ"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25995"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25995.1"
FT                   /translation="MDLDILFRNSSSKVKSTVEATDLIVSDDNTLTESINDLYAIEGFP
FT                   KPLEVTDIDLDGVWNKSNIKLNHVVLDLRSASNVIEQVSEISIRLDVNISLLVLCDVDS
FT                   IKLRNQVHALGASYVLWDPELDSLLAAIKTTQEGESTVKKTRVAKRILVLGTKGGIGVS
FT                   CVSSVLAHSLAEQVNLKTLLVDHDSGALNSDIYIGVKGLKAKHNSIDLNQIDIDSAIAK
FT                   TYVHGVKDKLDYLVLEKNVACLTDHASTLYNLSNQLIDQYNFIIDSAPLSCYEEMHDQE
FT                   LSDKYHRIFIICEPSVSSLRSYNSLKKKIGKSEHQIIFNLNRPTKDFMMTLASAKERIK
FT                   AKDSIDFMYEPSLEKIVVQQGINELLKSKSASAVLTMVATLTGKKIKTKSRFSLFRK"
FT   gene            529828..531093
FT                   /locus_tag="VS_II0474"
FT   CDS_pept        529828..531093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0474"
FT                   /product="putative Flp pilus assembly protein TadA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25996"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25996.1"
FT                   /translation="MNQLKEIYIQLRDEIFDALDASTLVEISNQELEEQLKDSVNILID
FT                   KKQLQVSSLKRVDLVKALLDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEQS
FT                   PIQFVNEKQLNTIAKRIASNVGRRIDESKPLCDARLMDGSRVNIVIPPLAIDGTSISIR
FT                   KFKEQKIRLENLAEFGAMSVEMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGE
FT                   TERIVTIEDAAELQLQKPHIVRLETRQASVEGTGEITARDLVINALRMRPDRIIVGECR
FT                   GGEAFEMLQAMNTGHDGSMSTLHANTPRDAIARTESMVMMATASLPISAIRRTIVSAVD
FT                   LIVQVKRLHDGSRKVMYISEIIGMEGDSVVMEDIFRYEATSNFKDGKMEGEFRTPGLST
FT                   RSVIYERAKFFGLEQAVKEIFT"
FT   gene            531090..532004
FT                   /locus_tag="VS_II0475"
FT   CDS_pept        531090..532004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0475"
FT                   /product="putative Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25998"
FT                   /db_xref="GOA:B7VR90"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25998.1"
FT                   /translation="MTLILIASWSALLLYFLIHRSRQSKKLSSLIEMEAEFEGVKGVRS
FT                   VIDSQQFEESYKARLRKSYKKTIKVFQPNMSLKLILFASVTASVVYAVNEFFLRQDYFV
FT                   CLLLAEPILFFVFYSKLKQRQMNSFKTNFPDALNILSGAISSGQSIIHAFEYVGKQLDN
FT                   DVGKEFKLMAERLLIGEDPDDVLERSSNTFPYLEYFFFASTIRINLARGGQLKDVINKI
FT                   NRLMFDSRAVEKKKNALTSEARASAKIIACLPVIFLIILKFTSPENYSFVMFEEAGQPI
FT                   FYYVLVSELLGFFCIWLILRGVN"
FT   gene            532004..532870
FT                   /locus_tag="VS_II0476"
FT   CDS_pept        532004..532870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0476"
FT                   /product="putative Flp pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26000"
FT                   /db_xref="GOA:B7VR91"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26000.1"
FT                   /translation="MGFETVLIWGVIFIISMVLAIYCLRFWDNTRANIETRKIIGSTRE
FT                   EKKRKDLLKAVLSQISFNKIETKRKLVAAGFYSDFLADAYYLLKIIPFSVCLVLIGFDF
FT                   YNGETEVIFALLYLLGALLAFIIAPDSYVSARGKANIKHISSRLPFLLDLMNVCVHTGM
FT                   TIESSLEYLAKELHSVDSNLAHVVRVTVERSRLVGLEKALEEFYELVPTSESQSFVMTM
FT                   VQSLQFGSSVGPVLATLATDIRELNMMDLEERIGKMGAKMSIPLIAFIMVPIVVLIAAP
FT                   GILRMLM"
FT   gene            532867..533997
FT                   /locus_tag="VS_II0477"
FT   CDS_pept        532867..533997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0477"
FT                   /product="putative Flp pilus assembly protein TadD"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26002"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26002.1"
FT                   /translation="MIRNFVLSVIVLVLFSGCTTVNNQLDTKEQLLVGSDDSQKLIEFY
FT                   KANIQSDPVYKVKLVNLYLDLKDIKSAELYRNTYDDSDLDEPEYILTSARIYYQKKNFE
FT                   RALKELEKYKHEGGAEYEYQLLTGKILAQQKRFSEAIEHFEESRKQGASDREAGNNIAV
FT                   VKIMQSDYLGATDILYDLYLSNPNDQRVSSNLILSSVKSQRPDIALEVLKHSNSDEQAH
FT                   KQLSALMRSISKSKGKKAVTQSTIEMEQHFIGSQANSGGFVAPTSRVSKLDATTEFQAS
FT                   RHSVDGSVLDPRKLKPGAKPIYRVQVLATYTAIPSDFLNYLKTNYGSVYSYTHGLWKRY
FT                   CIGDFNDLDEAKAFLNSIDIKGAFVVDYTKKRYVRL"
FT   gene            533994..534530
FT                   /locus_tag="VS_II0478"
FT   CDS_pept        533994..534530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0478"
FT                   /product="putative Flp pilus assembly protein TadE"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26004"
FT                   /db_xref="GOA:B7VR93"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26004.1"
FT                   /translation="MRRFKRKQKGSLTVEVAMGIPIFLAIAFGWVEICILTFSMSMTDH
FT                   ALTTAVMRTKKAGDSSSSNSINYGQMINDELTKAGGALWSNVVKEGSVVIHVNYFRDYE
FT                   GFLKCTDTYASTDECPDKKDEPEDMALAVYALEYTYDPIVSIWFPDIAIKREVITIQEY
FT                   ERCSFKIGQGAGCAS"
FT   gene            534457..535104
FT                   /locus_tag="VS_II0479"
FT   CDS_pept        534457..535104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0479"
FT                   /product="putative Flp pilus assembly protein TadF"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26005"
FT                   /db_xref="GOA:B7VR94"
FT                   /db_xref="InterPro:IPR031582"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26005.1"
FT                   /translation="MKSSLSKNMKDVRSKLVRGQVVQAKQKGAFAVELAMVLVFASGIF
FT                   VAVVNHMLAINKKGQLDRASYSLTTIFAERKQLFNANMDICAGDCRKTEHNAFVIASAS
FT                   MKRMIPNFDKAKFGMRIDEIRLEETALSGGRVNYRRVQKTLTKGSIHGCNFPDMSDITK
FT                   QKAIEILPITSRGRRLPMYQVSLCYETPINVLGVANGEVFRLVSTSYSFARV"
FT   gene            535106..536422
FT                   /locus_tag="VS_II0480"
FT   CDS_pept        535106..536422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0480"
FT                   /product="putative Flp pilus assembly protein TadG"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26007"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26007.1"
FT                   /translation="MKSIKKNRGVAGILFVGLLPAMVIFMAFSMQMSQQMLAHSRLLEA
FT                   AEVASLALIASPKEDEDKNVKYARYLVDRYILDNSEDVDVAVFTRKCEYKDGCVQASGE
FT                   LAPFSDFVVSATAKYTSWISYEDVDLEPEFTVSGRAVTRKYLPQSVDVYFIGDFSGSMG
FT                   NSWKNGKMKLDVVKETIKRVVDDIEKFNTEEKSRVALLGYNPFHVKQTDKTVRVNAYGY
FT                   YGSWRKKYAYNYARSSPGTTVRRMFDKPKLYNEILEPKRGMSRYEVERLHTHNVNFAKY
FT                   YKFYDIPLTEDYDEFRSQLMNTKLQAGGGTSSWNGIIAAAQEANKATNLNPEQVFIVLS
FT                   DGQDGDKNYLQKLVDQGLCKKLRSTISAKRNRFQSNSPTEAEKTKVTMGVIGINYKVNE
FT                   SDGFGDCFGKKNIYHAKDGEDVYKYILNLINEETGKLKD"
FT   gene            536424..536990
FT                   /locus_tag="VS_II0481"
FT   CDS_pept        536424..536990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0481"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26009"
FT                   /db_xref="GOA:B7VR96"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26009.1"
FT                   /translation="MRYLVIMSTILLSPLSYANCLGNVGEYVTSKTLVSSHTVTTQVTG
FT                   KLIKLDEKPQNEVLNRESEVIQIAAQDDVCFYDKATQSLVLNYPTNVYLLDENHKQVLG
FT                   QYLSLVGDKSKIYIEGHADSLGSKSYNKALSSRRAGQVASYLKKDLHQGNRIVEYAYGE
FT                   SAPICKVTDNKATGCNRRVVITVKS"
FT   gene            complement(537128..539515)
FT                   /locus_tag="VS_II0482"
FT   CDS_pept        complement(537128..539515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0482"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26010"
FT                   /db_xref="GOA:B7VR97"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26010.1"
FT                   /translation="MPRCINHTGDINVVTCSLLKVVTNKRHLMALFKKNIWSLYALIVL
FT                   LTLILFSAFGITKWQSNRDDFTKQQHIQVEIFSSSVNSLLTSQEALLEVVGHQLAQQSD
FT                   FTRTASIQIRPILDKLLDTHPAIAAFGLLNPQGDYLSISSNLQLSDQFNLLDLPYTKDS
FT                   FLEAVSSNKMVLGRTYFHDSLNSLVIPMRKSISLDGKNVDAVMTAGLRLDSTILFENNA
FT                   HAGNYNTLTLLRTDNYRQFFSSDIESLDAYLKPVDNVLMDRITKSFSEQVTVSVKEAKT
FT                   GKYTYSFCIDDSAFPSLVSAKYIPDYKLWVVGRTDLAHVDGIFAKEFGALFFVFVVLQF
FT                   GFYFLVKSIAKNEQRTRSQLIYQANHDPLTSLPNRSYMRKNIGKWIEDESEPFSLLFID
FT                   IDNFKCVNDTHGHDFGDKVLKQIALRLMRFRSRVSLLVRESSDEFLFLTPLSSESEIKR
FT                   LSERIIEVLSQPYEVESAQFLLSCSVGIARFPDHGRDLDSLLRSADISMYKAKQQQNSY
FT                   SIFTTEMQDAHLYKMRVEQRLRIAIDKQALFMVFQPLVRADESTHGVEALVRWVDDELG
FT                   FVPPDVFIPIAESTGLMHKLGTFIIESSVMQIAHLHRTIEQKIGLSINISVRQFSHKSF
FT                   SEHLFTTLEKYQFSPSCLTLEITESLFIEDVAIVKPLFEALKENDIKISLDDFGTGYSS
FT                   LSMLKALPIDELKIDKSFIENIAVDQQSLTMVQNIIAIGKNFGMVVLAEGVESNEHFAI
FT                   LKACGCDLMQGYYFSRPIPYDELCKYLTPAQVMATELPEPTL"
FT   gene            complement(539867..540730)
FT                   /locus_tag="VS_II0483"
FT   CDS_pept        complement(539867..540730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0483"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26012"
FT                   /db_xref="GOA:B7VR98"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26012.1"
FT                   /translation="MDIRRMNQPLISPEQLQQRLLEEDNIVILDASIEFQIPSESEKIK
FT                   GQMIPSAIRFDYDKDFCNKHTLLPHMFPTEKHFNTRAQEIGINQDSTIVVYDNSGTFAS
FT                   PRAWWMFMAMGHNNVYILDGGLPAWIDAGYVTDTDYKTEVQAGNFDGSIQDNYFVNAQQ
FT                   IESYSDNKNANIVDARSQARFDSEVPEPREGLRSGHIPNSVCLPFAQVLNAGKLKPQEE
FT                   LVDIFSTLNLTPSQPMFFSCGSGVTACIILLAAKLAGYSSDMGVYDGSWTEWGANEKLP
FT                   IAVTKK"
FT   gene            complement(540751..541065)
FT                   /locus_tag="VS_II0484"
FT   CDS_pept        complement(540751..541065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26014"
FT                   /db_xref="GOA:B7VR99"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26014.1"
FT                   /translation="MKQLKIGFVILSIGIGLLLFLTYFPMTSSTGERIEARVISNTLTQ
FT                   SLDGHRRYLTVETQDNEIFRVSIPPTTDCPLDSVVVLDTLNNQITGQSSYQFIHCRAAP
FT                   "
FT   gene            complement(540962..541156)
FT                   /locus_tag="VS_II0485"
FT   CDS_pept        complement(540962..541156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26015"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26015.1"
FT                   /translation="MGAISIFSTGYVHFIESLSYLLKMTFKGLLYETVENRIRYIIDWY
FT                   WATFISHLFPDDIFYRRTH"
FT   gene            complement(541314..542147)
FT                   /locus_tag="VS_II0486"
FT   CDS_pept        complement(541314..542147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26017"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26017.1"
FT                   /translation="MRTLLNPAVLNPPIGSKHLPLTNVTYLRRMIMNMPIKQTVTNGRR
FT                   NFNNTILSSLSNAALKKNTAQSQSIRIPLLIASLTLVGCGGGGGDGGASTPNPSPSTPA
FT                   VTAPVTSTPVTSTPVTSTPATSTPATSTPVASAPVTPPSVVSSPVTVAINPAPTPVNAV
FT                   ISNGPQAYKMDELVIPDGFDYNSVDQFDLNIDISNISTDRSFVSVYSRFTTRTDSTYKP
FT                   DYSSKVIGGPLDNGTFTSNFSAPLSEDILLIEIWFYDGQAPLQQVVASDGSQITW"
FT   gene            complement(542065..544200)
FT                   /locus_tag="VS_II0488"
FT   CDS_pept        complement(542065..544200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26019"
FT                   /db_xref="InterPro:IPR031025"
FT                   /db_xref="InterPro:IPR032295"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26019.1"
FT                   /translation="MRITTLSLLLSAPLVANAAPFDTCPSQAYLFQSTPVQVWGVNLVT
FT                   GSTTLLEDDTGMNANINGVGFDFQDRYIYGYDTTNKRLVRLGQDFQAEVINTSGLPTDH
FT                   TFYVGDVYDHVYYLYRTGKGLFTVDLSPLDADPNATVTVNKIAGSPATVKLTDFAFHPS
FT                   DGSLYGIDNNSGGLYSFNPTTGAETYIGDTGELGTFGAGYFDVNGYYYVSRNQDGKIYR
FT                   INLSPDNASNIAAGIVPAVEFVSNGPSSGQNDGARCANAPVVDEDSNIDFGDAPDSYLT
FT                   LLASNGPRHELDGVTWLGTDAPDADLDGYVTPQSDESVGIDDEWANGGIGFVTALEAGL
FT                   DSKVVIEASTTGYLSAWIDWNQDGSFDGANEQVFTDYQLDAGENDLFLNVDINALTGTT
FT                   WARFRFSQQTNLSYFGGSTSGEVVDIQVDVLNDGATARYFPSASGYATLAYEDNWPYKA
FT                   DYDMNDAVIMYRITEILKDGKVVKSTIDGRLAAVGASYRNGFAVRLPNLDPSLVSSGSS
FT                   YMKHNGMFTDLDLEQGRSEAIFVIANDLTEKISTSCTFYRTISSCKEDEQFAFQIGITL
FT                   ASDGVSTGSWTDMPYDPFIFATPGYYHGENLPLHPGRSWEVHLPDQAPTEAFDTANLFE
FT                   AGLGVDDSNPSTGKYFKTADNHPWALLITSDTEWQWPLEYVDIVTAYPNFANFAESGGT
FT                   QSTDWFQTPAADQCYLP"
FT   gene            complement(544457..545212)
FT                   /locus_tag="VS_II0489"
FT   CDS_pept        complement(544457..545212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0489"
FT                   /product="Molybdopterin biosynthesis protein moeB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26021"
FT                   /db_xref="GOA:B7VRA3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26021.1"
FT                   /translation="MLMEILSDVEMLRYNRQIILKQFDFEGQEALKQSSILVLGAGGLG
FT                   CASAQYLATAGIGKLTLIDDDIVELSNLQRQVLHTDADIGKKKVNSAAESLQVLNPHLT
FT                   IETVDHRLDDQALGKLIETHSLILDASDNVETRNQLNRLCYASKTPLVSGAAIRMEGQI
FT                   SVFTYQDTDAPCYQCLSALFGNAALSCVEAGVMAPVVGMVGAAQALEAIKVIAQFGQPK
FT                   QGKLLILDAMSHSWREMNLMKMPNCSVCG"
FT   gene            complement(545219..546454)
FT                   /locus_tag="VS_II0490"
FT   CDS_pept        complement(545219..546454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0490"
FT                   /product="Molybdopterin biosynthesis protein moeA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26023"
FT                   /db_xref="GOA:B7VRA4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26023.1"
FT                   /translation="MGCCDAPGLMPIEEALDKLLSPIKPIQTTLSLPLAEALGYVLAED
FT                   ILSPIFVPPFDNSAMDGYALRLADLENGKVLPLAGKSFAGQPFEGEWPSNTCIRIMTGA
FT                   KIPEGCDAVIMQENTAETEAGIEIQQDDIKLNNNIRPTGDDIKQGDIVLSRGERLTPRD
FT                   IPMIASLGVSHVTVLQKPKVAFFSTGDELKPLGQPLEDGQIYDSNRYGIKPLIEAFGCE
FT                   AIDLGIIPDCTATLKETFEKAQQIADVVVTSGGVSVGEADYTKDILEELGQIGFWKLAI
FT                   KPGKPFAFGELDNAWFCGLPGNPVSAMMTMYVLVQPMLAKLAGHTAWTAPESIPAITKS
FT                   AFKKGPGRTDYQRGIYSIENGQFVVETTGNQSSGAFRSMSLANCFVVLERERGRVEVGE
FT                   TVQIQLFNSTLY"
FT   gene            546671..547324
FT                   /locus_tag="VS_II0491"
FT   CDS_pept        546671..547324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0491"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26025"
FT                   /db_xref="GOA:B7VRA5"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26025.1"
FT                   /translation="MSGLSESAKLVKDALASRGLETPMRPNQVSREEKKERIEHHMREI
FT                   LTLLELDLADDSLEETPQRIAKMYVDEIFSGLDYANFPKITVIENKMGVREMVRVKDIT
FT                   VTSTCEHHLVTIDGKTAVAYIPQGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQT
FT                   LLETDDVAVTMDAVHYCVKSRGVMDATSETTTTALGGIFRSNPATRHEFLHGLR"
FT   gene            complement(547390..548886)
FT                   /locus_tag="VS_II0492"
FT   CDS_pept        complement(547390..548886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0492"
FT                   /product="Hypothetical dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26026"
FT                   /db_xref="GOA:B7VRA6"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26026.1"
FT                   /translation="MFYKRRIKMKIWSVSFLATTVAVALSSNAIACTGLIVGKEASNDG
FT                   SIMIARNEDFSINNWNKYLKYRPAQDNQEGDWQLGNGLIVPMPKHFFAYSAIPDWDADT
FT                   VNRDGKFYEERGINEHNVAISATTSAEINDKVAKVDPLIDNGVIEAIIPTLILPQAENA
FT                   KQAVELLGHYIETYGAGEGNSLYIADTNEAWLFEIGSGHHWIAVKVPDDSYAMIANGLR
FT                   VHGVNLANKEVLHSKDIFEFVEQNKLLDNADEKSFNFAKAFGVIGDEYNIDREWLGQKI
FT                   LTPSLHQQSRMTQYPLFMKPDTKISVENVAEVLSATYKDTVLEGKSKRPIRVERQLESH
FT                   IIQLRPEMPEELQGIIWQSFGVLPESVLVPLYSTLQDYPKAYQVGDDNYSDDSAYWQFR
FT                   SLTALASTNPDKYLPVLKATWDKEETQLYKQVAHLDKTLTDMYKVDKQAALNMAADYSY
FT                   GQLKRTLDMATELRYKMITDLTKSTEKKYSEEEFKKIVNL"
FT   gene            complement(549372..549953)
FT                   /locus_tag="VS_II0493"
FT   CDS_pept        complement(549372..549953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26028"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26028.1"
FT                   /translation="MTEIQTQTEPQRQTKLEACLQLAGLDSVKALTTGYEKELKSFIDE
FT                   NHALFRHACENKPDNSARQTLLGLLTKVHIDASYRFESNKEANEAMQNVFDNTVGTEHS
FT                   DKFQNSNAQQLQLITHLWLFVQGRLGMDYSLANDHAAVAASLLSRVSKNTDDEIRVEFM
FT                   ASFYDGLNLYLAENKPSGFVHYFKRLFNLS"
FT   gene            complement(549946..550485)
FT                   /locus_tag="VS_II0494"
FT   CDS_pept        complement(549946..550485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0494"
FT                   /product="protein yaeQ"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26030"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26030.1"
FT                   /translation="MALKPTIFKFRISLTDMNRDYYDSFNLTIAQHPSETEQRMMARII
FT                   AFCINASPELEFTKGLSSIEEPDLWQKSLDDQILEWIDVGEPDPERVKKATRLSKSVSV
FT                   FSFNTKSNVWWEQNKGKFGYLKAQIVRLDNDGIEQLAAMTQRTMDLSVMLTGNSAFINS
FT                   DTQSAEVTWEELQSND"
FT   gene            complement(550601..550810)
FT                   /locus_tag="VS_II0495"
FT   CDS_pept        complement(550601..550810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0495"
FT                   /product="cold shock DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26032"
FT                   /db_xref="GOA:B7VRA9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26032.1"
FT                   /translation="MSNTVTGKVKWFNETKGFGFIEQENGPDVFAHFSAITGDGFKTLA
FT                   EGQQVEFTVSQGQKGPQADSIKVL"
FT   gene            complement(551259..552344)
FT                   /locus_tag="VS_II0496"
FT   CDS_pept        complement(551259..552344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0496"
FT                   /product="Hypothetical glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26034"
FT                   /db_xref="GOA:B7VRB0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26034.1"
FT                   /translation="MNNHHRILSYALALIASSPISSAFAWQVEKITDGLEIPWGLAYVD
FT                   DSTMLLTEKAGVIKHVNLKTGEQSTLFRLPNVWAKGQGGLLDIALSPFENEKFYVTYSK
FT                   DVDGEGVTTLASANYSNNEVTNWTDVFVSKSRTDTGRHFGSRITFDDNHLYFSIGDRGD
FT                   RDNGQDTMTHAGSILRLNADGSTPSDTPFSDNSKVLNEIWSYGHRNPQGLYYDFPTQKL
FT                   WSIEHGPRGGDEINLIKAGANYGWPVTSHGKEYWGPISVGESETKDGIEAPKKVYVPSI
FT                   APGSLIVYQGDKYPELKGKLLAGALKLTHINIVTVNGQGDAIKEERILEDLGERIRDIE
FT                   TSPSGDIFFSTDNGNLYRLKK"
FT   gene            552642..553835
FT                   /locus_tag="VS_II0497"
FT   CDS_pept        552642..553835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0497"
FT                   /product="Multidrug resistance protein mdtL"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26035"
FT                   /db_xref="GOA:B7VRB1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26035.1"
FT                   /translation="MSRRFDFKSILLACLVISIGQLSMGLVFPSLPWIAKDFDVSLEQA
FT                   QLLVSVYLLGFGPSQFIYGPISDALGRKKVLLSGLLIAMLGLLMIIFFSHSFTSMVMGR
FT                   FLQGLGTGCCAVLARASTRDRFSGADLPLAMSYIAMVASITPLIAPVIGGFINFHFGWS
FT                   MVFISLLGYVSLAWVVLAFKFKETVTQVSAIPSPKKMVSQYKELLTSRYFMSFASIGWL
FT                   NFSLMITTVSVMPFIMQNQIGMTSDEYAMWAVIPALGMLGGTSLCNRIRPMLGNKKTLL
FT                   CTPVLHIFAALWLFFCPLEPLYLMLGQFLMILGNGIALPCAQALVMLPYKKNAGAAAAM
FT                   SGGGQMVVSSMVSMGLVQLGLGEAWHLSLVIMLFTIITLINILRGFSSQEARESQLS"
FT   gene            complement(553978..554763)
FT                   /locus_tag="VS_II0498"
FT   CDS_pept        complement(553978..554763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0498"
FT                   /product="ABC transporter: ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26037"
FT                   /db_xref="GOA:B7VRB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26037.1"
FT                   /translation="MFQLSNIKIVRDERTILSIEDLTIPTNELTVVLGHNGSGKSTLVN
FT                   LLSGQMSPDHGSVELDGASLSSFKSKDLAKKIAYLPQKLPASAGLTVEELVRLGRFPWR
FT                   GALGRWNSEDKSIIQQAMERTGVTEFSQALADDLSGGERQRAWVSMLLAQQSPVLILDE
FT                   PTSALDVHHQFQLMGLLSELNKTENVGVIVILHDLNLALRYATHIVALKKGQIAFEGSA
FT                   DKLLDEQALSALYESPIRLIDHPVPAKTAASEKVAVVCE"
FT   gene            complement(554841..555599)
FT                   /locus_tag="VS_II0499"
FT   CDS_pept        complement(554841..555599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26039"
FT                   /db_xref="InterPro:IPR023998"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26039.1"
FT                   /translation="MLPQLHNIITRRKAPSLHQKIFAYSKQVTPYLSGSFGALNNKSIA
FT                   VTNENSHKELKRVYDGLSQSHPEAGKAYWLTRTWDLVCWQPIYVTFISIYGLHSLPDIK
FT                   NIGQFRYKEFITGYRFFNGDHQHGSPEELIPDAGEAILALTEFYRSQISEWTRIRPGFT
FT                   NHLLADLLLGSLIKLQQHEPSLTNDYIIAQAKLWLEACQLSENHLDSLKVDSSSGMLKL
FT                   IRISCCLVYKCDSRKYCDNCPRHPDNKKIA"
FT   gene            555855..556727
FT                   /locus_tag="VS_II0500"
FT   CDS_pept        555855..556727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0500"
FT                   /product="Transcription activator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26041"
FT                   /db_xref="GOA:B7VRB4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26041.1"
FT                   /translation="MAYIHANLSSALSLEDLATQSCWSRWQLQRVFQAETGLTVANYVR
FT                   ELKLSQAAEELLDGKDRVIDIALGLGFNSEISFSRSFKQMFGVSPSQYRKAGKRVGLKK
FT                   PIQVSETASNSENRALSFVEVRIDEREPFLVKGMTSEISGLFSLTQDFAQKVPQLWSRL
FT                   EGEVEIPDANMLQFIGVVDLTQSCFDGTNIYYWAGVELHDEISIPQLPSIISDKLEVLT
FT                   IPKQTYAVVKHRGPIEHLPHTLSWFVLNWLPNSGYRGVDGYELEMYPFGYQAHASDAEM
FT                   EYWVPIIKS"
FT   gene            556974..559103
FT                   /locus_tag="VS_II0501"
FT   CDS_pept        556974..559103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0501"
FT                   /product="ABC transporter: TonB-dependant outer membrane
FT                   receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26043"
FT                   /db_xref="GOA:B7VRB5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26043.1"
FT                   /translation="MTTHTRFKYSSLAVALLTAFSAQAFAEDTATSADSNVETITVMGK
FT                   AYRNTATKTVLAPEETPQTLNVIESEQMEQRGVKSVMQALRYAPGVSTENKGGAVVLSD
FT                   WVKIRGFDSTNNYYDGMMLPILPGWNVQPQIDPIAMERLEIFKGPTSVLYGSMPPGGMV
FT                   NIIAKAPKFEESTKIGLATGLDNLVEASIDTTGALSDNVAYRLVALGRKKDTQVDGVEE
FT                   ERYVIAPSIDWYVSDKTFINFNLYYQNDPALGQNVTLPLAAIESGKVSPSTFAGDVNYN
FT                   TIKRDFFITGYKFNHDFNSNWAFLQNFRYMKTDFYQESTSSGNFDASTGSLARSAYSTD
FT                   ESSTGISVDNQLSGLVSTGSLDHYLLFGVDYRNTEGDVAYDAFAGVDSINLYNPNNNKL
FT                   NPNDFTKTYYQNNDIEVSQLGFYFQDQMLIDNWVFIAGGRFDKVETTTKVSVLGGAPSK
FT                   TDTDDTNFSYRLGALYKFDNGLSPFANFATSFEPSVKLDTNGNNLDPETGEQVELGLKY
FT                   DSYENMISGSMALFQVNKKNVGVRPDGASPWTSVGEIRSQGIELEGRAQVTENLDVLAN
FT                   YTYTDMEITEDRNASNIGQTPVFVPDHTANVWANYFVRSGAMSGLRVGGGVRYVGETVL
FT                   NDTSDKNKGQVPSYTLVDLSLGYDLGEVNSSLKNTTANVVANNIFNEEYYTCWNESYCW
FT                   YGQEQTVEFNVNYEF"
FT   gene            559194..560144
FT                   /locus_tag="VS_II0502"
FT   CDS_pept        559194..560144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0502"
FT                   /product="ABC transporter: Substrate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26044"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26044.1"
FT                   /translation="MNLQRIASHVSKIKSLHIKLAVSVLASALSFNAMADYQVEDSEGV
FT                   KTLEAQPVRVAALNWDIAEQVIELGVTPVAVPDIAGYTDWVVQPAIPEGVADIGTRTEP
FT                   NFSALKKLNPDVILIASPQKDLQDRLSEIAPVLYYQTYSEQHSNAAAAIENFKKIGQLL
FT                   GKEEQANNKLAVMDERIAVLKAELDKAYPGDKPKVTSFRFASTTSVFIYGDNSIPQYAL
FT                   EQLGFENAMDLPASQWGISQKRMTELKNVKKGIALYFEPFPYQEKLDRSPVWKSMPFVR
FT                   NGQFSPVAASWSYGGATSILYNAEAMAQSLLTLAE"
FT   gene            560147..562141
FT                   /locus_tag="VS_II0503"
FT   CDS_pept        560147..562141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0503"
FT                   /product="ABC transporter: ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26046"
FT                   /db_xref="GOA:B7VRB7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26046.1"
FT                   /translation="MKSSGLVMGAALFFASLVHLWLGQSEFGPIGELLQQVSLISDSAT
FT                   FNSKVDDSFELMALIYVNLPRLVMAILVGGTLGTIGSLFQQLTQNRMMSPLTLGTSSGA
FT                   WLGLVILNVVAPMLVAQYSVWFALIGALLAMGLIVSIVGIKNMSGLPIVLAGMAVNLLL
FT                   GAFATAIILLNDQYAQNLFVWGAGDLGQNGWEQVIWLTPKLLPIFAIFLLAPRVLTLLS
FT                   IGTEGAAARGLNIGATFFVLMAIGVWLVSVSITSVGVISFIGLIAPNIARHLGFLKAKS
FT                   ELVASCVLGALLLCVTDSLAIFLAQWSLDMIPTGTATAVIGAPALIIIARKQLSAQDQL
FT                   FFSMPKGPKLISPLAYFLLGTMLFGLLALSTLSQPSSNVGYFVIPDAFEWSIRWPRMLT
FT                   AIFAGGGLAVAGVILQRLVYNPLASPDILGVSAGAVLALIFSSLFMGYSIHSLSPWIAF
FT                   LGSAIALCLLLFLGKKHQFAPSILILTGISLTAVLEALVQFSLTRVGEGKYTLLAWLAG
FT                   STYRVEPESAMILAMVITASIGAALLLSRWVTLIATGRQFASARGLNINIAYVALLCIV
FT                   AILCSVVTTTVGPVAFVGLLAPHIAAMMGARLVRVQIILSFLIGAALMLFADWLGQVVV
FT                   FPAQLAAGTLVSIIGGSYFIFLLLKSRRT"
FT   gene            562394..563206
FT                   /locus_tag="VS_II0504"
FT   CDS_pept        562394..563206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0504"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26048"
FT                   /db_xref="GOA:B7VRB8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26048.1"
FT                   /translation="MPNLDRITCSIDENQIATVVLNRPDKLNAIDMAMFEGVNNMIREL
FT                   KKNNEIRAVIVKGNGTDFCSGLDVKSLLNSKVGAMKLLFKWLPTLPNAAQYFSIGWREI
FT                   PCPVIFAIHGRCWGGGLQLASGGDFRIASPDANFSILEAKWGLIPDMGGAIAFRELMRK
FT                   DHTLEMAMTAKVLDSQTAKEYGLVTKIAEDPYAEAYALALECANRSPDVVAANKKLYNK
FT                   TWWSSPGFALFYETWYQIKVGLGKNRAIAAQREIHPDKPRPYVARRFK"
FT   gene            563300..564490
FT                   /locus_tag="VS_II0505"
FT   CDS_pept        563300..564490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0505"
FT                   /product="Long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26050"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26050.1"
FT                   /translation="MNKTFTYSLAATAIFTSLNAFASGLFLQEAVVANAGTTGAGDGVY
FT                   SRSAAAMWTNPATMSHMGESKTTINTMAFDLEMKYQDNQDSSGDGKGHSVLPSFGAFHA
FT                   HQVTDQLHLGIALGAVGGSSLDYGSDWAGAALLEEITLTAMQVNPSLSYKLNDQWSVGA
FT                   GIQLSWAALQQSSSLFIAKQDTDWAYGYNLGVMYTPTEKLKLGASYRSKLEHEFNNDVN
FT                   VFTGGKRSLNTGIDVPELVDVSASYALNSQLDLLASIQFHRWSQWDNTVLDLGTNENGD
FT                   FPISQTLQRDWDDVWKFAVGADYQLNSDWRLKAGFSYETSPQDDPSMQWVDLPVGEQYR
FT                   YSVGASTYWDDILIDVFYEYADLGSVEMNRDGPKGRNLLNGSFDGRIHFVGLSATF"
FT   gene            564490..565179
FT                   /locus_tag="VS_II0506"
FT   CDS_pept        564490..565179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26052"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26052.1"
FT                   /translation="MTLRTLLFVAAATLGSMGAFAEEKHPDDPTKIVTKAGVAYNEDLQ
FT                   FSGSIGLDEARMINARVNADGEEWRLGGSWLLPMGIVNFNFSRSEYDNDAYKNNYSIGT
FT                   FIPLSYFDIEPFGWQIFPMAGYSYNDGEVAVFDGENVGSDYVLMPSSTHGGYIGAFGLK
FT                   TITDEWSIMGFGGGSMGSDDYSGYWAGVGASYKLSDAQSFNVFTIFAEDDFGENNSVGA
FT                   SYTYEFK"
FT   gene            565513..566625
FT                   /locus_tag="VS_II0507"
FT   CDS_pept        565513..566625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0507"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26054"
FT                   /db_xref="GOA:B7VRC1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26054.1"
FT                   /translation="MSTLFTETRIGSMTLKNRFMRSATWENMATEDGHMTDKLYAIYEE
FT                   LAQGEVGLIVTGYANIVEEEKPNAGMIGMYNDSFIAEYQKLTQLVHDNDSKIVMQLAYG
FT                   GTKTTHDLGERVIFAPSEVPEKGTQTLGKAMTKDEIDYIVDAFAQASLRAQKSGFDGVE
FT                   IHAAHTYLINQFLSPYYNQREDEYGGNLENRMRFLLEIYIATRKLVGDDFPILVKLTAS
FT                   EFFEGGVTFDETRLVCKKLEQVGVDGIVVSGNIHGKADTMIGESHDGFTIQAEGYFHEY
FT                   GHAISQDVNIPVITVGGLTDFDAIEAIANNTGIEYFALSRPLLSEPHLVKRWKEGDRSP
FT                   VECERCSKCRTKRGNFCVVNKDRKVQLARM"
FT   gene            567046..567681
FT                   /locus_tag="VS_II0508"
FT   CDS_pept        567046..567681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0508"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26056"
FT                   /db_xref="GOA:B7VRC2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26056.1"
FT                   /translation="MQKKHWSKFELLHEVISNPNIHIKGQHSYYSDCWDNGFEGSVVRY
FT                   LHGDEVSRQWEPRWEIDELYIGDYVCIGAEVVILMGGNHTHRVDWFSLYPFMDVIEDAY
FT                   IGKGDTHIKDGVWLGMRAMIMPGVTIGEGAVVAANSVVTKDVEPYSIVGGSPAKVVKYR
FT                   FDESVIDELISMKIYEWPAEKFESLRQYLCDSNIKSLKQAVLDYDNCL"
FT   gene            567834..569480
FT                   /locus_tag="VS_II0509"
FT   CDS_pept        567834..569480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0509"
FT                   /product="ABC transporter: Transmembrane and ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26058"
FT                   /db_xref="GOA:B7VRC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26058.1"
FT                   /translation="MPASSMKNKGVVGKVLLPSLLINLLSLAVPLTVLQIYDRILPNQS
FT                   YGTATLLLAGAALAVAMEALIRFVRTWLLSAAASNTEKATYQTLVERVTTASSGHLRHI
FT                   GVGGVEEGLGSVSKVKDWYSGGVIAGFIDLPFALIFLGLVAYIGGELVAIPLAVWLITL
FT                   GIVWLSSIRVKSLSEEASQDEQERKAFLILLSQTIQGIKRQAVESRIFNQFKSLNNVRS
FT                   QSKAREEEQNAFAQECIQLAALATSVLLVITGSLWVLDGQLTTGGLAACSILSGRAVAP
FT                   LSALVGVRIKLNSIHSANQAIEKLSDLSLSDSSDSEQAENHLSDFEMLEIKQATVERYG
FT                   ELSHADVTLNKGELVLLESEDRHTNSHLLSSIAGIDDLKAGECFINGAAVSIASVTNIA
FT                   AYCGVKGQLVSGTILDNLCGFDPEKTQSASDYAKRLGLTKEITRLPDGLETQIGHTSAS
FT                   LLSMGNVKMLNIAAQLASDKPIIMLERPDSSLDLDALGNLAKVLEEEVTAGRTILMVSY
FT                   HSKLREFANRIITVESRAITVDSESNQEAVV"
FT   gene            569477..571729
FT                   /locus_tag="VS_II0510"
FT   CDS_pept        569477..571729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0510"
FT                   /product="ABC transporter: Transmembrane and ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26059"
FT                   /db_xref="GOA:B7VRC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26059.1"
FT                   /translation="MNRLDIGNPSGTNNRADTSGRQEVMNHLETESLSVLKQLEVNANI
FT                   QLFAHQWVDENGIESIDDMFALFDRLALPYRLVANLDEVGEHKSVLLVLGEHELVSGHL
FT                   ESKQFVAFNANDDITDVPQFCIVIEGPPLEKASPDWVGERLHAFRPIIPKLLLVSFITN
FT                   LFALAVPFITMSIYDHVIGGDAGHELQGIAIGAALLFVMMGWLRTLRSRVFASVSNRVS
FT                   REISQSLVQRLLRNSYAQNQQTASSSQQNQVMLSERISGVLSGPLGNALFDLPFILIFV
FT                   LAIGVLGGWLVLVPVVSLILYYLLAKRSIRSSSKRSMQSTVAGTNRQNMTNELSSKLAF
FT                   IRSAGFSEHWIQRFKKANLLASTVTFNQSVLQSRYTSIYYFIGVGSTLAVMGLGIGLIF
FT                   EQVMTPGGLIASMMLISKVTGPAQVLANSAMRFNSFNQSKLQVNRILSQPSEREFSYQH
FT                   HPLPVVAPNLKLEQVTLRYPKQSRPALSGVSFDIEAGEIVAITGPSGSGKSTLIEVLSG
FT                   LQPIQNGMVELEGVNLVQYDPQLYRHWCFIRAAYPDLLTLSIREWLNDGHKVEDQKMIS
FT                   AIEMVGGKRWFETLSGGLDTSISSIQPDSLFDMLSGSVAQILIDAKALVYDYPMFLMDN
FT                   PVPDAHPNAKRIFGGFVQSKKGKATVIYTSHDPDLIKLADKVVVLNEGAVVYAGPLEPE
FT                   QSSKQEQPSEPQASQEPQLSEQPLSQELQPSTQEASAQQNAAQQEQSKSKQGVAND"
FT   gene            571722..573035
FT                   /locus_tag="VS_II0511"
FT   CDS_pept        571722..573035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0511"
FT                   /product="ABC transporter: Membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26061"
FT                   /db_xref="GOA:B7VRC5"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26061.1"
FT                   /translation="MTKQSIEKGKRYGELVESQNTARSLALATWSVALCVIAFATWSVV
FT                   TQVDEIAKAKGAVIPEGEKQVLQSAIGGKLKQILVKEGQLVEKGQPLVEFDATFQRTAL
FT                   EELKSQQVTLLASVERMNALLEQREPNLAEFEVDYPEIVSQQKAQLNAQKALYFQKRVV
FT                   LEKESEQIAEQLRSVEKALPSYEKELNATKQELNILEKGYKAGNISRLRVLEMRQKLAS
FT                   IEQKIEEARGKKSVLIRQADSNDQKIIQLLAEAKAKVSDDRSKAVSDLSALNARVRSSQ
FT                   AKLTNTMLVSPLQGLVQSLPSTQNGGVIQPGGTVVEIVPVGGKADFKARLSPRDIGFVS
FT                   VGQPTRIKIDAFDYSRFGALKGAVESISPTTSQSERGEIYYEVVVSVDTPYFRDNPESF
FT                   SILPGMTGEVDITTGEKSVFQYLWKPIYTNVSVAFGER"
FT   gene            complement(573132..581666)
FT                   /locus_tag="VS_II0512"
FT   CDS_pept        complement(573132..581666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0512"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26063"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="InterPro:IPR041690"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26063.1"
FT                   /translation="MIKMANKKNVEANKKNTEIKNKKSNKLEQKKPTQKKKRRLHSHLK
FT                   VNIPLFQSLMMILPSLAKHAAAESIDNSSDAADQVTANNVTEKDVTDDHSKADSSAVAL
FT                   QEAQTSDSDINSTLSASHAAHGSSSHLVPSHHLSTLSHPQVHYIPSVSMPTISSGSNGQ
FT                   PTHSNAPTTPALPVSFMPEVIKGTYGELHVDANGQYTFVLNPNTPQYILLNQHQPGTDH
FT                   FALHLSNGSSIIVQIPVTGKQDTPNISGDLTGVVTEDHNIDSQGLLHANGKIDVIDPDQ
FT                   NQSSVTPEVISGKYGSLTIDADGHWQYQVDNSLSNVQALTAATSLHESFTIHTKDGTPQ
FT                   TIDMTIGGNDDNAVITGVDAGVVTEDLTTQVQGQLSVTDSDLGEDHFQASQVTSNFGTL
FT                   SITKDGAWTYNLDNNNPVVQKLGQGSTATDIVTVHSADGTAHQVMVTINGTNDHAVITS
FT                   STANSPSSFFAIGTSNGSSHVTEDKDLTVSGQLNITDIDSKEAHFSNSDLKGTLGTLHL
FT                   KDNGDWSYDLDNNKPQVQALGKGSSTTDIITVHSADGTPHQITITVNGTNDKAVISGTS
FT                   AGVVTEESQLQTSGILTVTDVDTGEAHFATSSTGSTDIAGSFGTLHLTDTGSWTYDLDN
FT                   TNPTVQALGKGATATDTITVQSADGTPHQVTITVNGTNGKAIIGGTNSGAVTEESQLQT
FT                   SGTLAVTDVDTGEAHFSNTDIVGSFGTLHLTDTGSWTYDLDNTNPTVQALGANKTATDT
FT                   ITVHSADGTPHQVTITVNGTNDAAVIGGTSAAAVTEETQLQTTGTLTITDTDGGEAHFA
FT                   NTDIQGTLGTLHLTDNGAWTYDLDNTNPAVQALGNGATTTDVITVNSADGTPHQITITV
FT                   NGTNDNAVVGGVDTASVTEKAAGDNMSPDHAQPGMATLRVSTLNANGHLSVVDPDSGQS
FT                   GFADNNVGYNYHGTYGDLILNPNGDWNYYADAGSLSHIGARPTTRGSAIDKLGEGETLT
FT                   DTITVHTKDGTPHNIVITINGSNDRPYCSSEVQLNAGTEDTRQTITAAALLQHSIDVDK
FT                   NDSGLLTVVNLHPDHGSILDNQDGTYTFTPEKDYNGKVHFSYDVKDAHGGVTHTGATTS
FT                   LSAVADKAVITGTDTGTIVEDHNVGPSSLQPVAASGLLSVTDPDAGQDHFQVNLLLGEQ
FT                   AIHDPFGGFLRITPSGAWGYEVANSRLQSLAEGEVEKVVYRVYSADHTAHDITITVTGT
FT                   NDKPTITATTLAHGTEDTHYQMQASQFGFSDIDTGDTLHSIAITGLPSATQGKFVLDGH
FT                   DVTAGQHIPTADISKLQFVPAQDFNGDVQFKYTVNDGHTDSAEATNTLHIDAVGDKAVI
FT                   SGVDTGDVHEGHTFTAPDGSMTGGYVDDRSPDHMHGNIGKLWNDEIHTDGHLSIVDADA
FT                   GESYAQTGVYYGSHGRVILQTNGDWSYFASIGQDVTGRAIDHLGKGESLTDTVTVKSAD
FT                   GTTHDIIITIHGDNDRPYCSGEVQLNSGKEDLAQTITASELLANTVDVDTNDAGQLTIA
FT                   NLHADHGTLVDNKDGTFTFTPDHDFNGKVHFTYDVKDAHGGVTHTGASATLLPSNDAAT
FT                   LQPTLASNFVTEDHLKSGTNTNELWSGWKNLDIQDIDSQPEAKVTQIEVNGVKHTVPAN
FT                   FAMNLAGTHGTFNFTHSTDGHDKWSYSADNSHAEVQSLSHGDSLTDTITLITADGTRIP
FT                   LTAKILGTDDHVIIDTPDALTAALGTAVEDKVTSISGTLLAHDSDSKDSVTFTAGNSVG
FT                   AYGTLHVDSNGQWHYDLDHSKANALQQGETKAEGFDITAISTDGSTATKHIEVLVQGND
FT                   DGAIISGQDSGQVTEDKHLQTSGNLTVTDPDSGEGHFTATSGSTQLGTYTIDASGHWTY
FT                   SLDPRVQSLHQGETTPDVFTVHSADGTAHVIKVTITGTQDAPIITGQSTGAVYEDSQTS
FT                   VSGTLNADDKDYGQSGFWAQSHIASTHNFGDLSIDRNGHWTFHLDPTNTAVNALGEHDT
FT                   LLETVTVNTIDGTSKEIQITIHGTNDGAIISGADTGSVTEDQFTGMQWLITKGQLTISD
FT                   ADTGEDKFDSMVHAQNNAGIGYDTKLGGHVLLSEDGSWQYNMDNFSPAVQKLAEGETAI
FT                   DTVTIHSVDGTPHEIQITITGTNDAPILGVNQTSSTTGTLTEADVDVNDTHTFSIVSST
FT                   GQFGSLSVDPNTGDYIYTPNTSITGMSYNSATNSYHGVDVFEVKVSDGHTEDSKFITFD
FT                   ASGHVTMSPTGGLVISTAVPQQPTVTTTLPTLLMVTNVAPTNSVTLNLASTSDSGSSNT
FT                   DNLTNDTTPTITGHTDIPFSKVTIYDGSTPVGHEVSDASGQYSVAVSSLSEGDHNLSAK
FT                   ALAPSSVLPATSSLLSVHIDTQVHVGIQTDPITADNVINAQESSSSIDITGSVSGDFNA
FT                   GDIVTLDVNGTQHTGVVDAKGHYSIAVPGSELIADADQKIEASVAVTDSAGNSAHATAD
FT                   VTYQVDTQVSVPTITFENAGADNLYSKAEIARGQANTITATVTPPGDAKIGEHLVVNGQ
FT                   DHVLDAHTLQHGIQIEVHPGSNVQATMTDEHGNTAGSQGFAASAIPEPIIVRPPSGSHQ
FT                   VSGTLGVPPLLPSLTPVPTAQSGWRIHLPNGQYVTSHHGQYGTLTIDPQTGHLHYQEQA
FT                   QVHTGPHGSASGIGQHEDKFEVALQGTNQDEVVAHVNIQILSHGPGNSGKLTVGTEVVD
FT                   MTITPVVHTSHPAPPPPPPVQHDEPDMASQADFTVTLSDDSNLDLTQQTHQEPEQKTSH
FT                   HGAAAYLDALGIKPDATSTTVHDQPADMDIVLAQVDQQDATTHDQAHLDMSDALEHHDA
FT                   NINHNQDDEHHHHNDVDGLPDIDPNS"
FT   gene            581891..582355
FT                   /locus_tag="VS_II0513"
FT   CDS_pept        581891..582355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26065"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26065.1"
FT                   /translation="MTNTFRKTWIIVFSIIAMLMSSYASSSSALMTKVMMMEMGSSKSA
FT                   CYHSDTSVNDSMAGCHVMSEDVHAEHSNISAHDLMAQCDMSSMSEDGSQMMGNHCSSAD
FT                   CCASVCSATSYPIQAVQAANSFVFSLARFQSVIIGQKVARAQSLLRPPTA"
FT   gene            582449..583909
FT                   /locus_tag="VS_II0514"
FT   CDS_pept        582449..583909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0514"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26066"
FT                   /db_xref="GOA:B7VRC8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26066.1"
FT                   /translation="MNMKPTTSVFVMNTSLVVAAALTMALFSSATLAATTASASNAQHI
FT                   SAHDQASSTQQLNTLIEIALSEDGNRKQYFAQSQAMRETGIASSTLMDPKLKVGFGGLP
FT                   VDSFQFDEDPMTNISVGLMQQFERGDTLNLQQKKVGQQADALALQVQARELTVANSMTQ
FT                   LWLELGYQQKAESVIRQNRRLLVELENYVQTNYSIGKSEAQDLLNAQLQVSKLDEKLQA
FT                   NQQVQRRLISQLSEWLGSDWLGSQVLDSQGTLNATNQIDWSLLESKLATNIDSTKHYQL
FT                   LTDHPLVKILSKISDVSISSNQTQVELAEQAYTPQFGVEVMYAHRQANNMAGEPASDLV
FT                   SAYLTVDIPLFTGNRQDKNLSAAQYQVGAAKSQKDTLLSQMNAQVNALLVDRSNLIQRL
FT                   DRYQTSLLPQTAARISAVERGYQNNTAQFNDVILATTDELALKLEQQRLITDLNIVNSK
FT                   LAALVSGFEYQVNQPQLNSSATKHTANQ"
FT   gene            583921..585630
FT                   /locus_tag="VS_II0515"
FT   CDS_pept        583921..585630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0515"
FT                   /product="Cation efflux system protein cusB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26068"
FT                   /db_xref="GOA:B7VRC9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26068.1"
FT                   /translation="MSSVKVATIALLVGGALGFGVNHFLINPAHDMSPMATSTEASDEP
FT                   LYWVAPMDPNYQRDKPGQSPMGMDLIPVYADDSSGVKDEPGTVFIDSSVENNLGVKTAK
FT                   VKFETLSPRIETVGYVAFDESTLWQTNVRAAGWVEKLYINAVGEKVNKGDVLFTLYSPE
FT                   LVKAQEELISAYKTGRKGLIKGSTERLITLGVDKTQIRSITRKGKASQTIEVKAPADGV
FT                   IASLNIREGGYLSPAQAVISAGPLGEVWVDAEVFERQAHWISSGSNAVMTLDAIPGKEW
FT                   LGNVDYVYPILDPKTRTLRVRLKFSNPNGELKPNMFANIALKPISDEAVLTIPRSSVIH
FT                   SGGLTRVVMSEGSGKYRSARIEVGREAGEKIEVLQGLEQGENIVTSAHFMLDSESSQSA
FT                   DLSRINGVEEEAETVWANGEISDVMQGSRMVTINHQPVPEWDWPGMVMNFTFAEGLDMS
FT                   DVQRGKAIDFEMRKTESGQYEVVDYKVNKHKIAGEVWVTGDITMLMADFGMITVKHQPV
FT                   PEWNWKAGEMNFQASDELDLSEFAEGQTIRFLVAKQGSDYVLKSLEAGEGEL"
FT   gene            585627..588770
FT                   /locus_tag="VS_II0516"
FT   CDS_pept        585627..588770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0516"
FT                   /product="Cation efflux system protein cusA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26070"
FT                   /db_xref="GOA:B7VRD0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26070.1"
FT                   /translation="MINAIIRWSISNRFLVLVATVAIVFGGLYSVKNTPVDAIPDLSDV
FT                   QVIIKTSYPGQAPQVVEDQVTYPLTTAMLAVPGAETVRGYSFFGDSYVYIIFNDDTDMY
FT                   WARSRVLEYLSQVAPNLPSSAKPTLGPDATGVGWVYSYVLQDKTGQHDLAELRSLQDWF
FT                   LKYELQTVEGVSEVATVGGMVKQYQVQIDPAKLRAYDLTLQQVNKAIQDGNQETGASVV
FT                   EIAEAEHMVRTTGYLTSIEDIQSLPLKVTDKGTPLLLGDIADINLGPQMRRGISELNGE
FT                   GEAVGGVIVMRFGENASEVIDSVKSKLAELQAGLPDGVEIVATYDRSTLIDSAVENLWK
FT                   KLAEEFIVVAVVCALFLFHIRSSLVIALSLPVGILGAFIVMHWQGINANIMSLGGIAIA
FT                   IGAMVDGAIVMIENVHKHIERTPLTDKNRWQVIGKAAEEVGAPLFFSLIIITLSFVPVF
FT                   ALEGQEGKMFSPLAFTKTYAMAAAAGLAITLVPVLMGYFIRGNVLPEHKNPVNRSLVAM
FT                   YKPLLNLSLKYPKVMIVIALGLMASAYYPTSKLGSEFIPPLDEGDLMYMPTTYPGISIG
FT                   KARELLQQTNKLIKTIPEVETTWGKIGRAETATDPAPLTMIETVIQLKPREQWRDGVTT
FT                   ESLRKEFDDLIQFPGLTNAWVMPIKTRIDMLATGIKTPIGIKIAGPDLSVIEDIGSQLE
FT                   PILNSVSGTASVYAERVAGGRYVTIDIKRRSAARYGLSIKEVQQVISTAVGGMNVGETV
FT                   EGLERYPINVRYPQSYRDSVVKLQNLPLVTPNGARIALSDVADIRYEDGPPMIKTENAR
FT                   PNGWVFVDIEGRDLGSYVAEAQKVVTDQIVLPAGYSLAWSGQYEYMERAKERLSVVVPI
FT                   TIAIIMLLLYLSFRRVGEVMMIMLTLPLAMVGGLWLMHILNYNFSIAVGVGFIALAGVA
FT                   VEIGVIMLVYLNQAWHYKKLDAEENQQTLQSEDLTDAIREGAGLRVRPVMMTVLTVIIG
FT                   LIPIMYGEGTGSEVMQRIAAPMIGGMASALLLTLLVLPAIFKLWKQREITHSQNETNK"
FT   gene            588877..589446
FT                   /locus_tag="VS_II0517"
FT   CDS_pept        588877..589446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26071"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26071.1"
FT                   /translation="MKKTLIAIALTLTTATAFAEMDHSNMDHSNMDHSMMKSGEMDHSK
FT                   MDHSMMKDGKMDHSMMNMEGMSEVGMPATGAKPDKVVHVLLSDDMKITFKNKVDIEPND
FT                   VVQFVVMNTGKIDHEFSIGSASEQLEHREMMKNMGNHAHDSGSTVTVKPGKAKQLLWHF
FT                   HGDNNVEFACNIPGHAEAGMVKSLTL"
FT   gene            589559..590044
FT                   /locus_tag="VS_II0518"
FT   CDS_pept        589559..590044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26073"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26073.1"
FT                   /translation="MNKTVLVLAITGALITWSTHSIAAKPEWAGKGKPDLEEVKTLAEA
FT                   KKVEGEIDDREKQLDSMIEEKNKKAKKSKNKKDKQKLDKELDDLEDEKEALEESKEKLK
FT                   DKKEKLEDDMDNDEEKSGLEKQKDKKAEQERKEEGKGSEKGQQQREENSKKWWNFWE"
FT   gene            complement(590206..590463)
FT                   /locus_tag="VS_II0519"
FT   CDS_pept        complement(590206..590463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26075"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26075.1"
FT                   /translation="MFKSNELTINIEAINVALAKVENANKIQLDTLKGYVNSEPEQAVL
FT                   AFRSLNEAESIDDKFKKIMAELPHLSGEAHHLLETSILLQ"
FT   gene            complement(590718..590867)
FT                   /locus_tag="VS_II0520"
FT   CDS_pept        complement(590718..590867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26076"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26076.1"
FT                   /translation="MCVHRIMAITSAFQADDAGSIPAARSNFSLSFIKHFLPAIPYSKI
FT                   FAVC"
FT   gene            complement(590789..590863)
FT                   /locus_tag="VS_IIt0521"
FT   tRNA            complement(590789..590863)
FT                   /locus_tag="VS_IIt0521"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(590902..590976)
FT                   /locus_tag="VS_IIt0522"
FT   tRNA            complement(590902..590976)
FT                   /locus_tag="VS_IIt0522"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            591502..592665
FT                   /locus_tag="VS_II0523"
FT   CDS_pept        591502..592665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0523"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26078"
FT                   /db_xref="GOA:B7VRD5"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26078.1"
FT                   /translation="MPSQFRINKIVEIGDTLHRSGCAPYKLEKYTQFYAKKHGVDVMIQ
FT                   ATPTAINYQFPDDNNAVILKRLKPASINLSLLANTIIRINQPSSEPVPEPVGYSKFVTA
FT                   LANMGIPPAYLMLVGSTLEAVGFSALLGLMVWVCQQVLHSRRAIAVEFISALLTGIFVA
FT                   FLASTGLPIPVWALCIASIVLFVPGLSIANALECLAFNDLVSGTSLLGQSALTLIKLFV
FT                   GIIMGLNIGEAIWGQAVSIDYTNAVPMWMHISGLVLISVSIGVMFNARPKDILLGLPVA
FT                   VLGMWGPFYLGFDSGWVVGTWVTTVLITLYGTWIAKKMELTGSIYIVQGIIILVPGSRV
FT                   LVSASQSVFEQSILPIPSIGLSALFMFSAIVAGQITAYSIYSPKVER"
FT   gene            592846..593184
FT                   /locus_tag="VS_II0524"
FT   CDS_pept        592846..593184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0524"
FT                   /product="Protein phnA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26079"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26079.1"
FT                   /translation="MSLPPCPQCQSEYVYPDQNNLICPECAYEWNPEEERLEREAARVK
FT                   DVNGVVLESGDKVTFIKDLKIKGSSSVLKIGTKAVIRRINEGKDHQLDCKLDGGGEMLV
FT                   TAKYVKKQ"
FT   gene            593284..593706
FT                   /locus_tag="VS_II0525"
FT   CDS_pept        593284..593706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0525"
FT                   /product="hypothetical acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26081"
FT                   /db_xref="GOA:B7VRD7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26081.1"
FT                   /translation="MIREYRPADNETVIDIWLTASIKAHDFVAPEFWESQVGNMRDIYI
FT                   PASTTYVYQIDGEVRGFYSLYEGVLAAIFVSPQHQGCGVGKQLIQHAKLECPNLSLNVY
FT                   KENQATIEFYLSQGFSIVSEQSDEHTGHQEYTMHLA"
FT   gene            593754..594248
FT                   /locus_tag="VS_II0526"
FT   CDS_pept        593754..594248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0526"
FT                   /product="hypothetical acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26083"
FT                   /db_xref="GOA:B7VRD8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26083.1"
FT                   /translation="MDMVKAALSHSTAFHHYVNACVEDGLDIYTGISDGSDAYLERRIA
FT                   YSKGGGLPEGWTPASTYFCFESGRILGVIRVRHGTSPYIHDVIGHIGYETLPQARGRGI
FT                   ASHMLSWVQRHVLSESAIITCERGNIASQKVIEKCGGQFLNTFYSEQDKHEVLRYQLEP
FT                   K"
FT   gene            594342..594812
FT                   /locus_tag="VS_II0527"
FT   CDS_pept        594342..594812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0527"
FT                   /product="hypothetical acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26085"
FT                   /db_xref="GOA:B7VRD9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26085.1"
FT                   /translation="MNYSTRSAQSSDYEFLFELKKAAEFEPIKAVFGWDEQIQRDIHAE
FT                   EWAEERPEIIEYHGKAIGSVLLQDKGDHFYFCRFFLLPEYHGKGIGSQVLKDFLTKADC
FT                   LTKADSLNKPVELCYLQGNRVGDLYLRFGFEITSQNDQFVYMWRSPRQHNGC"
FT   gene            complement(594859..595968)
FT                   /locus_tag="VS_II0528"
FT   CDS_pept        complement(594859..595968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0528"
FT                   /product="putative transcriptional regulator, AraC/XylS
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26087"
FT                   /db_xref="GOA:B7VRE0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26087.1"
FT                   /translation="MIIIINHDRVVTYKCTDDLLMQKRIAVMRNGQMSEVTSKRAKIGK
FT                   VTLTKKLEQTEKQIIVTQGQTTQTSLAEGKFLSYQYNELIFIHGGRCIELVDTKIISTA
FT                   HASVLITILLEGKLSFGYDDLEFDLDATHQPQGVVVNLTKPANFRRVMTASNKLNKINI
FT                   LVKPKWFESRVTEECKCRNFINTHNANFQLEVTEEIWKLTQDLTTCSSPNNFHQKLHIE
FT                   SLTQQILENSMHQLPQTCCLAHQTKPKIIKPATRVTNIEHQSYDERIEAVICFIEIHLD
FT                   QELSLKMLAEHFSMSVSNIQRRFKQSYNMTINGYIRLRRLEIARQHLERGLVSITEAAY
FT                   EAGYQHPSNFTNAFKKTFGVPPQGIAIKT"
FT   gene            595989..597995
FT                   /locus_tag="VS_II0529"
FT   CDS_pept        595989..597995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0529"
FT                   /product="Enterobactin receptor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   12065481; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26089"
FT                   /db_xref="GOA:B7VRE1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26089.1"
FT                   /translation="MESPVRSTIKLSALYIAIASTFSSSVMAEESTSHFDEVVVWGTKV
FT                   SSNTESIIADDMSLKQADHMSDLLREIPGVDVGGTHSINQRITIRGLSETDLDIRLDGA
FT                   SQHANMFHHIGNLTLNPDILKSADIQVGNNSVTQNGLGGSVLFETKDAKDLLRYDETFG
FT                   ARVYGGYATNASQQGSLTVYGLLSDNVDAMLYSHYMSRDNFEDGDGTETFGSEGDVYNI
FT                   LGKIGFEPSDLHRFELSYDMYRDNGDYSPRPDMSGGTNVGLSKNILIPTDYNRDTITAS
FT                   YELRGESHQGNVTLYNTETEIQRDEGVMAPRWPSNRLSKNTAKNQNFGLNAKFQSDYRL
FT                   MSFDNIATYGFDYMDKSSSSYYGSSKFMDESAISTALFVEDQFYFTQAFSVTAGLRFDD
FT                   YQRKAEVGSEDFDDVTWSLATQWGVTQDWTLFASTRSLFKGPELMESFIAYQDVAYLAN
FT                   DLKAETGQNTQGGVRFDKRLDNHFIGANLTVFQTNIDDYIAEKYQRASKSYLIYNLGDV
FT                   EIKGFEASLSYGYEMFNSKLSYALSETKNKDTGGAVAGGNGRSIDMGDSITLTLDYQSE
FT                   ALETIFGWNSMFVKDEDNVFDGQPIKEGYDVHNLFAQWVPSNLDGLSVTFGIDNVFDEQ
FT                   YTSHASRSGTARGFTLDDYEPGRNYKLSAAYQF"
FT   gene            complement(598168..599112)
FT                   /locus_tag="VS_II0530"
FT   CDS_pept        complement(598168..599112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0530"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26090"
FT                   /db_xref="GOA:B7VRE2"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26090.1"
FT                   /translation="MDNHKERAFYAVVGALVGDAASMGLHWLYDQERILHVAGFEPEFR
FT                   SPNQFDYQDKGYFAHQGKTSGEHSQYGAQLLTMVDSLVDNQKYDEASYIQHFRKWFDFG
FT                   GSWQGYIDKATRMSLLNIHQLELEGAPITACGADDTQLPAVSKIIPLVACTYTSHTLPA
FT                   MVENAVRVTNNNDKAVEWAQAITLLIQAAIQGNSPLQSVEMVRQTCSRFIHDQIDEALA
FT                   EPELSITDAAKKFGLHCELSAAFPLLIRIIAGAQSYKQGIRDNILCGGDSCGRAIVIGA
FT                   VLAACFYEEDGAIPTEWLSQVELNCGVLSLPIE"
FT   gene            complement(599305..600231)
FT                   /locus_tag="VS_II0531"
FT   CDS_pept        complement(599305..600231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0531"
FT                   /product="ABC transporter: Transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26091"
FT                   /db_xref="GOA:B7VRE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26091.1"
FT                   /translation="MSSTSALTTPKPNVHMKPWYQRLTLLDGVLLAVICVFAGWLYYRS
FT                   AVGINYQWRWEDAFTLIFIPPSQGSIPYFFQGLIATLRLSVWSMVLALSFGTLLGVARH
FT                   SKIAFFKTPALIFIQLVRNIPPLVFVFIFYFFVSNQLIPLLGLESILREHNGEINAVQA
FT                   FLFGPTNLWENLASGVICIGLLSSAYIAEVIRAGLEGIPKGQWEAADSLGLSALSKYRF
FT                   VVGPQVLTAITPPLAGQAISLVKDTSIVSLISIQEMTFVGTEMANSSGLIFEIWLIVGF
FT                   VYFALCFALSRLFKVIEQRSSAYLNHQ"
FT   gene            complement(600409..601218)
FT                   /locus_tag="VS_II0532"
FT   CDS_pept        complement(600409..601218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0532"
FT                   /product="ABC transporter: Substrate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26093"
FT                   /db_xref="GOA:B7VRE4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26093.1"
FT                   /translation="MKLFKTAITALLALAVSLPALASETPNLDKINERGSLRVGMSTFV
FT                   PWAMRNKQGDLVGFEIDVAKRLAEDSGWKVEFVPTAWDGIIPSLLSKKFDVIIGGMSIT
FT                   EARAKSVLFTEPYSHSGVQLAANKELAEGFTQISDFDSRRVKIAARRGAFTVQVARETF
FT                   PKAKVLQFDDDAQAFQEVLNGNAHAVIASSPKPEHETIKNADTLFIPFEERLSKGNEAF
FT                   AVRLGETDKAEFFNEWIKARTEDGWLKERYEYWFSTLDWQDQIAQGQ"
FT   gene            complement(601231..602031)
FT                   /locus_tag="VS_II0533"
FT   CDS_pept        complement(601231..602031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0533"
FT                   /product="ABC transporter: transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26094"
FT                   /db_xref="GOA:B7VRE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26094.1"
FT                   /translation="MMLIRIIKPALSALVQIVVLVAAVVWILDSGAQTMGYSWQWERVP
FT                   DYIAFYEDGEWWPAELVEGLLVTINISLISLVATLIIGLTTALLRNSNSVVGRTLATSY
FT                   VELIRNTPLLVQIYLLYFVFGPVLGLDRFSTAVLALALFQGAYTAEIFRAGLNGIARGQ
FT                   FEAAQSLGLSKTYTYWDVILPQVVQRTLPPLTNEVISLIKNSSIVSVMAIFDLTTEARN
FT                   IVSETAMPFEIWFSVAIIYLALTLSLSAVAAWLEHKLGANWRTQ"
FT   gene            complement(602028..602774)
FT                   /locus_tag="VS_II0534"
FT   CDS_pept        complement(602028..602774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0534"
FT                   /product="ABC transporter: ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26096"
FT                   /db_xref="GOA:B7VRE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26096.1"
FT                   /translation="MNNDLNNLKEMVKFKSLNKWYGDFHALKDIDLKIEQGEILVICGP
FT                   SGSGKSTLIRCINQLEPFESGELCVLEQVLPSKFNTPGQVGMVFQHFHLFPHLTVLENL
FT                   TLSPIRTLKKSKREAEKLAMHYLERVHIAEQANKYPVQLSGGQQQRVAIARSLCMKPEL
FT                   LLFDEPTSALDPEMINEVLDVMVELASEGITMVCVTHEMGFAKQVADRVIFMDEGQIVE
FT                   SNTPQALFENPQHERTQAFLNQILTY"
FT   gene            complement(603010..604158)
FT                   /locus_tag="VS_II0535"
FT   CDS_pept        complement(603010..604158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0535"
FT                   /product="Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26098"
FT                   /db_xref="GOA:B7VRE7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26098.1"
FT                   /translation="MQFTYVNPTVIHFGQGQINAISQAVDTSKKVLVIYGGGSIKSNGV
FT                   YDQVVASLKDHAWIEFAGVEANPTKETLDKAVALVKEENVEFIIAVGGGSVIDGSKYVA
FT                   AAAKYDGDGWDILAGKHQVTEATPIGAVLTLPATGSESNMGAVITRKETQEKLAFMNPA
FT                   VQPKFAVMDPDVMKSLPERQLINGLVDAWVHVCEQYITMPTDAMVQDGYAETLLKNLLV
FT                   LGKQYDERDNDAWRANLMWTANQALNGLIGTGVPQDWATHMIGHEFTALWHVDHARSLA
FT                   IVQPSLLRNQIEAKRGKLEQMGRNVFGLEAGADLAERTIAAIEAFYHSLDVATMFDGYE
FT                   ATKAAAIDNVVAQLESHGYLELGENKAITPQKTREILESAIQ"
FT   gene            604352..605236
FT                   /locus_tag="VS_II0536"
FT   CDS_pept        604352..605236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0536"
FT                   /product="Transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26099"
FT                   /db_xref="GOA:B7VRE8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26099.1"
FT                   /translation="MKTLAQLLQSYVEHKGWDDLEGIRETEIGGVWLYRSSGGNQRQPF
FT                   TYQSGIIMLGQGKKNIYIGDRPVTYAAGDYLVVGVPMPLECEALPVNGEPLLGLSISID
FT                   SQRLHSLVKKLEDQGFLESYCNKHKQNSSGLESTPMEEQMLESFTRLVKTLHCDIEANI
FT                   LGDAMVSEIVYRALTGSEGRVLFDLAHHDGHYARVAKALSKVHEEYDQTITVQSLADEA
FT                   NMSVSAFHNAFRNVTFESPLQYLKKVRLNKAKELIQLEGLRISDAARRVGYSSPSQFSR
FT                   EFKRHFNTTPRAV"
FT   gene            605901..607148
FT                   /locus_tag="VS_II0537"
FT   CDS_pept        605901..607148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0537"
FT                   /product="putative endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26101"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26101.1"
FT                   /translation="MSSDIIKISRNTENAPINSVSTQTVAFSHYNNFSAQLPVDPKTGE
FT                   IVIGDIKDQAAQCLSNIKSIVESINHVMDDVVKINIFVKNISDIDAIDEVYASFFNNSL
FT                   PTRTVVGVAALPNSDALVQMDALISNGEGTKPQAPCALVKVSRNTDNAPQSAVSTQTAA
FT                   FSHYNNLSAQLPIDVNTGELVSGGITEQTTQCLANIKTILESIGHVMNDVVKTTIYVKN
FT                   IADAEVVNEVCAKFFPSYVPARTVVNAAELPMGALIQIDTSVSHGDGTPPQLPEDTRLL
FT                   VIEANNTVDAPFMAYSHTVAFSHYNHISGQLPLDPKTNEVVAGGVKEQAEQCLKNIKAI
FT                   IESVDHSMDDTVKINIQLKDISDIDAVNEIYTTFFNAELPARTVVGVSEIPMNALIQID
FT                   AVVSNCEGTPPQDVVA"
FT   gene            607390..607746
FT                   /locus_tag="VS_II0538"
FT   CDS_pept        607390..607746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0538"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26102"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26102.1"
FT                   /translation="MQFRVILLLCLAIVGCSSNQELTPDPTTITLFYGETSISAGVLED
FT                   KTFNSVLADRRESVTFSGSLSKQNSGYLVDMLVIRENRAPRSKRQLNTLLLMKPGELVD
FT                   VGGVNNDVFRVILE"
FT   gene            607840..607992
FT                   /locus_tag="VS_II0539"
FT   CDS_pept        607840..607992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26104"
FT                   /db_xref="GOA:B7VRF1"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26104.1"
FT                   /translation="MQNNYVKELAVKTYQEDLKKEYVKSKARPFHGPSFIGGVLLSVVL
FT                   VGLFY"
FT   gene            608947..610356
FT                   /locus_tag="VS_II0540"
FT   CDS_pept        608947..610356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0540"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26106"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26106.1"
FT                   /translation="MLSTVNLLCLFFITLLIICTSFHLKSSEGKKKLSFVQQRLEREQN
FT                   KQRLKRFFCEETDLPNINYIQEKLLRTNRSTYKIMHVICVGRSADFYKFFDSKTSRIVK
FT                   TELHHYLSETLSPRVIGLFEDKYIVLVFESDTPWEEKKILEQQQKIQFSLPHEKKVGDK
FT                   TLTFDYSLASMILSNFDKPQDKNQLFRRMAYSVKKSLQSIDGVYIYNINDYEKNVRTRS
FT                   VIQALHHDIKKGGTQFELFYQPVVYSMNTSKEYLWEILLRWKRTEFGGPGVFMPLLATE
FT                   PHLHYSLTIIIFKKIIEYAKNTQDTLPNISVNISHADLSIVDFYDDVMELTKLVPELRS
FT                   KIVFETVEYSEGLLHSYAKENIIALKGAGFRFAIDDFGCGYSNFNLLSEKYFDFIKLDK
FT                   SLLQKCQEDIVANETLKFMVKLSERIDVTLIVEGVENPQHLRLLPKKSNILFQGFHFSK
FT                   PRRLISNVKTG"
FT   gene            610485..611939
FT                   /locus_tag="VS_II0541"
FT   CDS_pept        610485..611939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0541"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26108"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26108.1"
FT                   /translation="MKMMIPILCVLALSACGGGGDGGSNPTIHKKATGKVIDGYIVGAT
FT                   VFLDINNDGKYNANTEPRALTTKGGSYELDLNETQDKCLGYAPTIVDVPVGAIDEDLGP
FT                   VKNAYRMVLPPEFKEQVDFKNRFITPLTSSLWATVETSNGKSNYTCQDLMSDIEKQTKQ
FT                   AQALEHALTETIRTYNISEAKIYGDFIASEDSDLALKAQNIVTGLKKSFTDTKDLQQTN
FT                   PNSYVQVHYYFKDENGARNWYKKVYISSLGTNQSAKQTTTKMSDDLLTEVEVLSESTSV
FT                   NLSTQWGVYNNTFDIASINNFNSSIRPGCTFTEKIIIKDDKFDNVLSNIAYDGNIHNLV
FT                   NCQSLDLTNKIVSRTTSTWKYNKSIKEQLNRTYVDWNEHTFGKGDDFGLSTVVNVKSHL
FT                   NSLDTENIKINIMGRYKDYSSNELGDASKVIRSKIVNDQSKEITYWKTLFRASPTTYSR
FT                   RITSSDQTSVYEKSTDGTNWVVSSKP"
FT   gene            612150..612668
FT                   /locus_tag="VS_II0542"
FT   CDS_pept        612150..612668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0542"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26110"
FT                   /db_xref="GOA:B7VRF4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26110.1"
FT                   /translation="MDVFLHLLQTSDARALLEFEVDNRDWFEMSVPPREESFYSLSGVE
FT                   KQIASFLAEYESDEMIPMLIKDEQGIICGRINVRDIDQNAGSGELGYRVGRPFASKGIA
FT                   SNAVRKLLIYLAEHSSLKYVDAYALVGNVGSNKILSKAGFGLVERVENYALFKGKNKDA
FT                   NHYRKVLVE"
FT   gene            complement(612782..613228)
FT                   /locus_tag="VS_II0543"
FT   CDS_pept        complement(612782..613228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0543"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26112"
FT                   /db_xref="GOA:B7VRF5"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26112.1"
FT                   /translation="MHVQTYDLKQSNVGYSLGVIGVALVLAWIGIYKFTPTEAMLIEPL
FT                   IANHPAMNWLYNLFSVQAVSNMVGGAEIIVAIGLIVGFKKPTIAFYSGIAAAAIFVVTL
FT                   SFLVTTPNVWKVSDGILVTNFFLVKDILFLAIAISVIERNKPQK"
FT   gene            613510..613872
FT                   /locus_tag="VS_II0544"
FT   CDS_pept        613510..613872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0544"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26114"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26114.1"
FT                   /translation="MKIHRINPTKRWSDVTVFNGIASFVEVPETDTTAGIKNQVQQIFE
FT                   QAEEMMSLVDSDKSRVLSVTIYLTDFANFDALNEVWEEWFPEGCAPSRACVKAELAKPE
FT                   LLVEMSFMVAAGEKFQ"
FT   gene            complement(614016..615650)
FT                   /locus_tag="VS_II0545"
FT   CDS_pept        complement(614016..615650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0545"
FT                   /product="putative glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26116"
FT                   /db_xref="GOA:B7VRF7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26116.1"
FT                   /translation="MGEIHRLERAKYSEEIMSNLTQVANENINAESTSIDFNRAQSLGE
FT                   KLELGNPVFWLSGSFLTLFVILAFTNTSVLSELVNIGFSYSTKWFGAFWQVLLLLNFII
FT                   GLVLALSRTGHVRLGKLALPEMTTFKWMSIVLCTLLAGGGVFWAAAEPIAHFVSAPPLY
FT                   GNADPQAMAFNALSQSFMHWGFLAWAILGGLSSIVLMYLHYEKGLPLKPRTLLYPVLGD
FT                   KAINSWIGNVVDACSIVAVAAGTIGPIGFLGLQISYALSELFGISDSFATQSVVILFAI
FT                   AMYTLSALSGLSKGIQLVSRYNIILSVCLIVYILLVGPTSFIIDGYLQGIGEMVDNFIP
FT                   MALYRQDTAWLGGWTVFFWGWFLGYGPMMAIFIARISRGRTIRQMIVSISIVAPLVTCF
FT                   WFSIVGGSGLAFELENPGVISSAFEGFNLPAVLLAITSQLPFPTLIAILFLILTTTFIV
FT                   TTGDSMTYTISVVMTGTTEPNSAVRTFWGVIMGAVAIALISMGSGGISALQSFIVITAV
FT                   PVSFILLPCLWHAPKIAKQMARDQGLA"
FT   gene            616053..619211
FT                   /locus_tag="VS_II0546"
FT   CDS_pept        616053..619211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0546"
FT                   /product="Chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26117"
FT                   /db_xref="GOA:B7VRF8"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR009470"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR032798"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26117.1"
FT                   /translation="MHLNQGRVAKKVFTLSTLTASCLMAFNSYAAVDCSTLEAWDPATV
FT                   YTGGDQVSHDGSAYKANYWNQNNNPNQFEGDHAQWKKVDVCSGGGTPNEVPTASLTTPS
FT                   ASDIITEGDNVVLSATALDSDGSVTSVEFFIDGTSVAVVTAAPFEAAWAATSGSHQVSV
FT                   VATDNEGAASLASAVSISVDSVTPGNEAPTVSVALSASSVDVGGVVTLTATATDSDGTV
FT                   DKVDFYVAGSLVGTAATSPYTLNYTTTQAGSLAVYAKATDNQGATTDSALASLTVNGVP
FT                   TVSTCRPDGLYQTQGVDVPYCTIYDDEGREKMGADHPRRVIGYFTSWRAGDDPQAAYLV
FT                   NDIPWEQLTHINYAFVSIGSDGKVNVGDVNDPNNAAVGKEWPGVEVDPALGFKGHFGAL
FT                   ATAKKKHDVKTLISIGGWAETGGHFATDGSRVADGGFYTMTTNADGSINHQGIETFATS
FT                   AVEMLRKYKFDGLDIDYEYPTSMAGAGNPYDKDFMEPRRQYLWASYQVLMKVLREKLDA
FT                   ASAQDGNHYMLTIAAPSSGYLLRGMETFDVTKYLDYVNIMSYDLHGAWNDHVGHNAALF
FT                   DTGKDSELAQWNVYGTAAYGGIGYLNTDWAYHYFRGSMPAGRINIGVPYYTRGWQGVTG
FT                   GENGLWGRAPLPNQAECSAGTGEGEKNNCGHGAIGIDNMWHDTDPKGNEMGAGSNPMWH
FT                   AKNLEKGIWGSYAAAYKLDPVNDPSDVLMGTYTRNYDSVAVAPWLWNAEKGVFLSTEDK
FT                   DSIDVKADYVIDKEIGGIMFWELAGDYNCYVLDANGNRTSIDTTEQACNSGNGEFHMGN
FT                   TMTKAIYDKFKSATPYGNKVATGAIPTEALDITVSVGGFKVGDQNYPINPKITFTNNTG
FT                   QALPGGTEFQFDIPVSAPDNAKDQSGGGLSVIASGHTRANNIGGLDGPMHRVAFTLPAW
FT                   KELPAGGVYELDMVYYLPISGPANYTVNVNSVDYAFSFEQPDLPLGDISTGGGNPGDGG
FT                   TNPGTCDTAGLAVYPDLPQKDWAGNPSHANTGDQVVHNGSVYQANWWTSAEPGSDGSWT
FT                   KVCS"
FT   gene            619498..620967
FT                   /locus_tag="VS_II0547"
FT   CDS_pept        619498..620967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0547"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26119"
FT                   /db_xref="GOA:B7VRF9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26119.1"
FT                   /translation="MILKVRRKYILNFSIVLALVSLVLSAIQFNRTKESLLESNQFFFR
FT                   TIVNASYDIVDTTVNEAIKTYLKGVTDTVASHTLGVTPEQEVKEVIRIANELVIGESGY
FT                   IYLMSPQGVHLYHPFLQGQNRAHLTHIQTQLTSKSGMTQYSHANPHEVGKRAKVAYSVR
FT                   LPSGNTLVATTYKDELMYLVDLEALKDKLRKYSYGDSGYVYIVDLQGELVLRPNFEHEH
FT                   LKALIGYSSELLIDKVVAEPEGHFSYSISDDNGTTNKNIFYKFYPYLNWIISAGVLEQE
FT                   LNKNHSLLLASLMTLVISLLSIIAVLVLYLRHRHLKILDVASLDYLTGLSNRRDFISQV
FT                   KMRILECSPYPLKGVGIILLDIDHFKSVNDLHGHNEGDRVICAVAKVLKQFANENRLIA
FT                   RYGGEEFIFVTFDCNEYQLYELSEELRRSVEKIEGLVLPVTVSVGCRYANALFHIEGTI
FT                   DQADKALYQAKKNGRNNTQVYRESQYRIVCH"
FT   gene            complement(621058..621312)
FT                   /locus_tag="VS_II0548"
FT   CDS_pept        complement(621058..621312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0548"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26121"
FT                   /db_xref="GOA:B7VRG0"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26121.1"
FT                   /translation="MEFNMVEILGYAASIMVAISLTMKDIVRLRVLNFVGCTLFTAYGV
FT                   MIDAWPVVATNGFIACVNIYFLAKMQKEKKNEAMKAAKA"
FT   gene            621581..622165
FT                   /locus_tag="VS_II0549"
FT   CDS_pept        621581..622165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0549"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26123"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26123.1"
FT                   /translation="MIKRFICATKGVNKVALLALIAIGLTACTTNETTPTHNYGVVTSG
FT                   DFDFMKHGVVTYSWHPESEQVYLSEKYDKTVVTDLVREAIKEQLSLKGYQLKSGSGDVV
FT                   VGFGLAEESELNDESIFDAIQLSTGVPFYSDDGKVSEKGSLYIAFFVPNSEVIQWQALA
FT                   QSGIQPDLEPSESKQRVMGFVEMLFRRMPER"
FT   gene            622344..623528
FT                   /locus_tag="VS_II0550"
FT   CDS_pept        622344..623528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0550"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26124"
FT                   /db_xref="GOA:B7VRG2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26124.1"
FT                   /translation="MKRFSKYSLPLLSMFIVSNAAIVANTAVAAPSIVPSPPSLGAKGY
FT                   VLIDFNSGDVLVEKNAHTKLNPASLTKLMTSYVAGQEMKRGNISADDQVRISENAWAKN
FT                   FPDSSKMFIEVNTDVAMMDLYRGLIIQSGNDASVAIAEHVAGSQDAFVDLMNSWAASLK
FT                   LENTHFANAHGLDADDLYSTPYDIALLGRAIIRDLPDVYGLYSERSFSYNKITQHNRNG
FT                   LLRDRSLTVDGMKTGYTSGAGYSLASSATQGEMRLIAVVMGASSVKSRESDSKQLLSYG
FT                   FRFFDTLNPHQGGDQVAEEKVWFGAQDTLKLGVAEDTFITLPKSDSKKLTASIDLISEL
FT                   KAPISEGQTLGVVHYTVDGEDVQTQPLIALEAVEQAGLFKRLMDYVKLFFASLF"
FT   gene            623726..624019
FT                   /locus_tag="VS_II0551"
FT   CDS_pept        623726..624019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0551"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26125"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26125.1"
FT                   /translation="MTIEIKNVTEPEVTCANCQACCCRLEVMIITDTGVPEEHIAYDEW
FT                   GGETMLRLDDGWCSAVDRETLMCTIYENRPWICREFEMASFECVDQRKDVMG"
FT   gene            complement(624071..624967)
FT                   /locus_tag="VS_II0552"
FT   CDS_pept        complement(624071..624967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0552"
FT                   /product="transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26127"
FT                   /db_xref="GOA:B7VRG4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26127.1"
FT                   /translation="MDKIECIRIFVETAQLNSFTATANKLDVTQSAVSKKIAWLESDLG
FT                   MTLFQRNSRKISLTHAGKDYLTYCSRLLEEMSTIESRLKRETESVEGELKISAPSAFSS
FT                   MLLSEPLQAFIEQHPGIRINLSIDDRIVNLNEHNIDVAIRASQLKDSGLKARFLFNNKV
FT                   HYFASPDYLEKQGIPLYPQDLSEHQCLTYSLMSPANEWRFTDKSDKTNTIKVNQIFTSD
FT                   SPDMLLKMARQGLGIVALPDWMGKEYVEKGELKRLLEDWSNNQLPMYVVYHASDYLPQR
FT                   IRVFIDFLAKYLSARNS"
FT   gene            625084..625464
FT                   /locus_tag="VS_II0553"
FT   CDS_pept        625084..625464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0553"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26129"
FT                   /db_xref="GOA:B7VRG5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26129.1"
FT                   /translation="MILKKGGNMSTVVSVLLVVFFLLASSIKTIAWQKKVFEIQLGFFK
FT                   SYGLNRVIMFLVGMVEFTGAVLLLCALVGLAPEHTQLMGGLILASTSLGAIYFHLRFDT
FT                   WKDGIPAMVTLLGSSFLVIASY"
FT   gene            complement(625545..627236)
FT                   /locus_tag="VS_II0554"
FT   CDS_pept        complement(625545..627236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0554"
FT                   /product="Pseudouridylate synthase, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26131"
FT                   /db_xref="GOA:B7VRG6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26131.1"
FT                   /translation="MIFMSANLAQYTPLHLKNDNTNVDLPLPTRFTFPYYYTPHPTCEF
FT                   AMQQLQQSLLDCGVNETSQGNLYAVLLVQNPTTQELGYLSAFSGWQLYPSLASQLNNIN
FT                   FVPSAFDSEQFQSHNSANLARQSQLADDIEKLQQSHNLDALLTEFEELKFESAQSIEAF
FT                   QLAMAANKSQRNELREQANQEKALGNLDSAANLLKQLGNQSSQEKRDLKALRIEWKQKI
FT                   AERQSQVDAIESELTSRKQEYQAISAELEAQRLSHYRFNNQALESKNLLELLDGKDALE
FT                   GSGDCCLPKLLNFAFEHGFQPLALSEFWWGLPPTAVIRQHANLYPVCQSKSFEILDHQL
FT                   NGIELEENPLIVNPAVGKSFDIVYEDDEIVVVNKPEEFLSVPGKFIEDSVYTRIKARYP
FT                   DATGPLIIHRLDMSTSGLLILALTAESNKHIQKQFIDRTVEKRYTALLDGEIDGKSGDI
FT                   SLPLRGDITDRPRQLVCHEHGRNAETHWEAVSTNNGKTKVHLYPKTGRTHQLRVHCAHP
FT                   SGLGVPIRGDDLYGYKRERLHLHAGYLKLIHPTTGEWIEFEVPSEF"
FT   gene            complement(627379..627999)
FT                   /locus_tag="VS_II0555"
FT   CDS_pept        complement(627379..627999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0555"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26132"
FT                   /db_xref="GOA:B7VRG7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26132.1"
FT                   /translation="MITLHHLNKSRSKRIIWLLEELGVDYQIKPYQRDSVTFLAPPELK
FT                   AVHPLGKSPVIEDDGVVISESGAITEYLIDKYGQGKFAPVRGTADYVEYSQWLHFAESS
FT                   GILPMLLKIFVMKDGCETNFLGGYADDENQKILTFVNEALEGKTYLVADTLTGADFMMS
FT                   FIVEIVGNFGATALYPNIAKYGDLLTSHPAYQKAEQLELEHSN"
FT   gene            complement(628034..629065)
FT                   /locus_tag="VS_II0556"
FT   CDS_pept        complement(628034..629065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0556"
FT                   /product="putative NADP-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26134"
FT                   /db_xref="GOA:B7VRG8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26134.1"
FT                   /translation="MTQQDNRRIVLASRPVGAPTQDNFRLETVAAPTIKDGEMLLRSVY
FT                   LSLDPYMRGRMSDAKSYADPVAIDEVMVGATVCQVEESNNSDFEVGEWVLAYTGWQDLG
FT                   VSDGEGLIKLGKEPTHPSYALGIMGMPGFTAYMGLLDIGQPKEGDTLVVAAATGAVGAT
FT                   VGQIGKLKGCRVIGVAGGQEKCQYAKEVLGFDECIDHKADDFAEQLAKACSNGIDVYFE
FT                   NVGGKVFDAVMPLLNTGARIPVCGLISQYNATSLPEGPDRMSSLMGTLLVKRIKMQGFI
FT                   IFDDYAHRYNEFAVQMTEWLSQGKMHYREHLVEGLDEAPQAFMGLLEGQNFGKLVIKTN
FT                   EAK"
FT   gene            complement(629203..629856)
FT                   /locus_tag="VS_II0557"
FT   CDS_pept        complement(629203..629856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0557"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26136"
FT                   /db_xref="GOA:B7VRG9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26136.1"
FT                   /translation="MEYTSKSRRLDDWSNLTYSKPMNDKTNDTRLHVLDVGYQLIVNNG
FT                   FNGVGLSQLLKEADVPKGSFYHYFKSKEQFGEALIQHYFETYISRVETILVHGEGNHYQ
FT                   RIISYFTRWSQIENGTCNAHKCLVVKLSAEVSDLSDPMRQALLKGAEKVTHTIEQCIVG
FT                   GIDDGSIKLEESQETAQNLYSMWLGASLLSKLSQSSRSLESALNLTQQILKGKN"
FT   gene            complement(629964..630437)
FT                   /locus_tag="VS_II0558"
FT   CDS_pept        complement(629964..630437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0558"
FT                   /product="peptidyl-prolyl cis-trans isomerase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26138"
FT                   /db_xref="GOA:B7VRH0"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26138.1"
FT                   /translation="MSKFIIPVIVFILAGFMIYRTWMNHKSGEENIEQGQQFLIENGAK
FT                   EGVVTTESGLQYLVLEEGTGTEHPTKNSKVTVHYHGTLIDGTVFDSSVDRGEPISFALK
FT                   QVIKGWQEGLTYMVEGQKVRLFIPSQLAYGKGGSGPIPPSATLIFDVELISIK"
FT   gene            complement(630480..631106)
FT                   /locus_tag="VS_II0559"
FT   CDS_pept        complement(630480..631106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0559"
FT                   /product="putative disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26139"
FT                   /db_xref="GOA:B7VRH1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26139.1"
FT                   /translation="MFKPFTKFITALAAVLIIAGCSETDEPQKGVQYEALPTALTEFNL
FT                   SPITEIFSLNCGHCRQMESAIPEIESLTDQTIGKMHVTFNESAQISAMIYYTAVMQLDA
FT                   TPDHAFMDDLFAAVQMGADATPEQRQQALETAFTSRGLVSPYQLNKEQQIALFDYVKKA
FT                   EEISVKGQINSVPTFIINGKYQVLTAGHQDVQGIAKTINYLLTQP"
FT   gene            complement(631230..631388)
FT                   /locus_tag="VS_II0560"
FT   CDS_pept        complement(631230..631388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26141"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26141.1"
FT                   /translation="MLNIIAKYLITSPTTYADKLFTNVYIGTERKTLDKNFIRKESTSQ
FT                   KSVFDHS"
FT   gene            631360..631971
FT                   /locus_tag="VS_II0561"
FT   CDS_pept        631360..631971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0561"
FT                   /product="putative protein F-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26143"
FT                   /db_xref="GOA:B7VRH3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26143.1"
FT                   /translation="MRYLAIMLSIALAGCETTLPTGLFGEDMLQTAPKTDYDIMYPEWG
FT                   VVQTTHQQGTITTNYGRGVSTNDPLEVFLRQNRIDFEVLPGNHVMVKLVQHVNFKTGST
FT                   SPEPAYNNWLDTLGSYLSRRQDIDVVIEGHTDNTGSDRVNDPLSEQRAKEVKARLESNY
FT                   VSSRAIYTRGFGEYVPACNNASVQGKACNRRVELMLIVAK"
FT   gene            complement(632080..632517)
FT                   /locus_tag="VS_II0562"
FT   CDS_pept        complement(632080..632517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26145"
FT                   /db_xref="GOA:B7VRH4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26145.1"
FT                   /translation="MLRASDKTCVYNAANCNANFKYVERVMKFIRWFLGRVILLLNFVF
FT                   SPRGVKRSQEEQSKVNEQAKTHTLYQFEACPFCVKVRRSMKRQSVQFELRDAKNNEQHR
FT                   AELEAGGGRVKVPCLRIEKDGKTEWMYESSDIVSYLENQFA"
FT   gene            complement(632529..634121)
FT                   /locus_tag="VS_II0563"
FT   CDS_pept        complement(632529..634121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0563"
FT                   /product="Anaerobic nitric oxide reductase transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26146"
FT                   /db_xref="GOA:B7VRH5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26146.1"
FT                   /translation="MQDISASTLMEMTIGLASGVNDQDRFNRLIDAIRKTITCDCVALL
FT                   SLQGDTLVPIAMQGLSRDTFGRRFIISEHPRFDAICASRSPVRFDADSSLPDPFDGLLI
FT                   DHDGDLPMHACMGLPLLFGDKLLGVLTLDSLKPDVFANIPARNLEVLAAIAASTMQMAM
FT                   TFSQLEHQAKQSKQLLEELNVEAWERDGGELIGNSDTMVALKNDIAVVAPSEFNILIHG
FT                   DTGVGKELVARTLHHQSQRKRNPLVYVNCAAIPENLVESELFGHVRGAFTGADKNRLGK
FT                   FALADGGTLFLDEIGELPLAAQSKLLRALQNNEIQPVGQDNIQTIDVRVLAATNRDLKQ
FT                   EVEDGRFRADLYHRLSVYPIAVPALKDRGDDISLLAGFFLEQARRKLGINQVKFRSDVL
FT                   VFLNRYGWPGNVRELEHVISRSALKALARSTNKNLVTITKEDCGPLDQDQPIATTQVKN
FT                   TPLSTPTIDLSAGLRGATDDFQRSIITEVLEDANFNWAQAGRVLKTDRANLTRLSKRLG
FT                   LNVAKSHTIERTK"
FT   gene            634471..635667
FT                   /locus_tag="VS_II0564"
FT   CDS_pept        634471..635667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0564"
FT                   /product="Flavohemoprotein (Hemoglobin-like protein)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26148"
FT                   /db_xref="GOA:B7VRH6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26148.1"
FT                   /translation="MLNNLHINIIKSTIPLLESAGPALTQHFYQRMFTHNPELKDIFNM
FT                   THQRTGRQGVALFEAIAAYAKNIENLAALTSAVERIAQKHTSFNIQPDHYQIVGLHLIE
FT                   TLRELAADAFTPEVEEAWTAAYLFLAQVFIDREAELYLQRKQAVGGWEAARAFVIADKI
FT                   EESALVTSFILQPKDGGDVLDYTPGQYIGIEVKPEGAQYSEIRQYSLSDKPNGKQYRIS
FT                   VKREGQGQETQGVVSNHMHDTVAVGDEVSLYAPAGDFMYQERSKPVTLISAGVGVTPMQ
FT                   SMLEFLNNQQKNEPVLYLHACENVGQHSFTTRVKDIVADKGWEAKTWYMNKGESACENT
FT                   HEGQMDLASISDTKGFEESDFYICGPVGFMKNIVEQLDALKVDRSRVHYEVFGPHANF"
FT   gene            complement(635827..636852)
FT                   /locus_tag="VS_II0565"
FT   CDS_pept        complement(635827..636852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0565"
FT                   /product="Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26150"
FT                   /db_xref="GOA:B7VRH7"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26150.1"
FT                   /translation="MIRVYVLHLTEWSKSLNWRRLTQVKNVPPSQASLALGVIGLGQAW
FT                   ALYLPGVGELIRPYLAAFGALLLLPVLLRYLTSFDTFINDIRHPLSGSLMAPMSMALLI
FT                   LCDYLAEISPIIAYPVWFCALLLHFTMMVLFFSFQILNFKMSNIVPSWFLYPVGLISSS
FT                   LAGTQFGHTVFSETLAATCIGIYFLMLPVVLYRLVFEGNLPRRARPTLAIMAAPVNLSL
FT                   AAYLVNFDNPDPILTGALAGIAITMTLLIYLCYIRLMRLKFQPSIAAVTFPSVISAIAM
FT                   HRLTTFFGAEYPQWYWLHKFGFFELTIATILVIWVAGGYVKMYWPEFFDSDYMSKKVKR
FT                   S"
FT   gene            complement(637090..638535)
FT                   /locus_tag="VS_II0566"
FT   CDS_pept        complement(637090..638535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0566"
FT                   /product="chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26152"
FT                   /db_xref="GOA:B7VRH8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26152.1"
FT                   /translation="MQSRLNPFRSLISMTRREKIKQSLLAKMPRDAINQFLSRDKTPAS
FT                   VLFLSCIVGVLAGVVGTYFEVAVHFITETRTDWLKDEIGSYLPLWLAAFLISAAFAFIG
FT                   YFLVHRFAPEAAGSGIPEIEGAMDGMRPVRWWRVLPVKFFGGMGALGSGMVLGREGPTV
FT                   QMGGSIGRMVTDIFRVKDDDARHSLLASGAAGGLAAAFNAPLAGIMFVVEEMRPQFRYS
FT                   LISIKAVIISAVSANIVFRSINGQSAVITMPQYQPPELDALWLFLLLGVLFGLFGVIFN
FT                   KLITLSQDLFVAIHKNDRKRYLMTGSLLGGCFGLLLLYIPELTGGGIGIIPNITNGNYS
FT                   ANVLLLIFLGRVLTTLLCFGSGAPGGIFAPMLALGTLFGYAFGLIAAAFFPELNIEPGM
FT                   FAIAGMGALFAATVRAPITGILLVIEMTNNYYLILPLIITCLGAVIIAQMLGGQPIYSQ
FT                   LLNRTLKNEKLRQQDLPQQEEVR"
FT   gene            639037..640020
FT                   /locus_tag="VS_II0567"
FT   CDS_pept        639037..640020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0567"
FT                   /product="putative cobalamin synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26153"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26153.1"
FT                   /translation="MTKKVPTNIITGFLGVGKTTAILNLLKNKPENENWAVLVNEFGEI
FT                   GIDGALMTDQGALIKEVPGGCMCCTAGVPMSVGINALLRQKPDRLLIEPTGLGHPKQVI
FT                   ATLTSEQYTPYVDLKATLGLVDPRNLSIEKYTSNQNFNDQLDSADVIIGTKVDLVHSED
FT                   IDAFNDWVTDQTPAKVFHKLIHDGEVPLEVLDIERVYGSASSHIEAHHHDHAEQEPQFQ
FT                   LPPGEAFIRKENKGQGYFSCGWLFGAEHKFDFDALFSMLSDLTAERVKAVVNTDQGCYA
FT                   FNVANQVVSVNEITLDGFESRLEVIDSQLMPWDDLEQILLKLCGIK"
FT   gene            640203..641489
FT                   /locus_tag="VS_II0568"
FT   CDS_pept        640203..641489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0568"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26155"
FT                   /db_xref="GOA:B7VRI0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26155.1"
FT                   /translation="MSFSSQGFAPELVKALTECGYEKLTPIQQKAIPMARKGHDIFATA
FT                   QTGTGKTAAFSLPVIQHLLNSGKKASRGTARGLILAPTRELAAQIAQNIKDYVKYTELS
FT                   VSAVYGGNKMSSQVRQLELGVDILVATPGRLEEHLEAGNVSIANLEFLVFDEADRILDM
FT                   GFINAVRKIMLDVETSPQIMMFSATTSTQLNQLSVDILRKPKRISVERENSTAATVGHV
FT                   VYPVDQERKTELLSELIGRKNWRQVLVFVNYKETANDVVKELKLDGIKAVLCHGDKAQS
FT                   ARRRALDDFKEGRARVMVATDVAARGLDIEDLPHVINYDMPFLAEDYVHRIGRTGRAGK
FT                   QGHAISFVNREEELTVVQVEKLIQQRIRRVEQPGYEPKKRDAYIEKLNTKSAYKNRQGR
FT                   KNNANEEPQDQASAERRLTMMKRIKNRRK"
FT   gene            641777..642274
FT                   /locus_tag="VS_II0569"
FT   CDS_pept        641777..642274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26156"
FT                   /db_xref="GOA:B7VRI1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26156.1"
FT                   /translation="MMIGELAGVAVVSIAAVLGIASIMLNYPWLFTGFKFVGAAYLFYL
FT                   GVQMWRSRGKLAISTDNQTTKVSNDWDLVVQGFVTAIANPKGWAFMISLLPPFINSNKD
FT                   LAPQLLILVSIILFSEFVCMTLYATGGKSLKHMLGKADNVKLMNRIAGTLMMGVGVWLF
FT                   VS"
FT   gene            complement(642526..644553)
FT                   /locus_tag="VS_II0570"
FT   CDS_pept        complement(642526..644553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0570"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26158"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26158.1"
FT                   /translation="MSKETFDSTRFNKSNNKPFEEVLDANLSRRNVLKGGLGISAMTAF
FT                   GAFGLAGHSTANAATMQATSAQKSTATLAFESVKGSLTDSVVVPKGYTAQVLVPWGTPL
FT                   NKQGKAWLKDGTNNAQDQANSLGMHHDGMHFFPLDGNSNDGLLVINHEYIDQKALHTNG
FT                   PTYDEGNRPSLDEVRKEINAHGVSVVRVKLEGNQWVMVDNDPLNRRYTGATVIDLSGPV
FT                   AHSEFAKTKFSQDGSQARGTLNNCGNGYTPWGTYLTCEENWPGYFVNKGETTPAQERIG
FT                   IATDKTRYGWDTLSGNKQQRLDEFARFDVTPSADSPIDDYRNEAHGHGYIVEIDPYTAN
FT                   SRAKKRSALGCFRHEGCTFGKLTEGEPIVFYSGHDSRFEYLYKFVSEAKWDPRDAEPSN
FT                   RLSVGDKYMDKGTLYVAKFNDDGSGTWLPLTLSSKTTNGGKLGDSFDSQAALIINTAGA
FT                   ADLVGATPMDRPEWCSVDPMTGTAYLTLTNNNKRKEANSANPRVDNKFGHVIRWDEGKT
FT                   AGEFDWDIFVFGSPAVDDKSINRSGLTDMNQFASPDGLAFDARGILWIQTDNGADEVTG
FT                   YTNDQMLAVVPSQLTDDNGNSAVIDANNQAQLKRFFVGPNGCEVTGFTISPDFKSLFVN
FT                   IQHPANWPSSQDATAQTQGNVRPRASTVVIRREDGGEIAV"
FT   gene            644806..645147
FT                   /locus_tag="VS_II0571"
FT   CDS_pept        644806..645147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26160"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26160.1"
FT                   /translation="MKLDKIENKNRRLRKKLYLGEFAILGFEVSCTTSIADFDQYDVFI
FT                   DEFIDFIDSIGLCFGGGGLELFEGFLCSIERYRSVTEAEQLQVAQWLEARAEVSKVEVS
FT                   ELVDANYAF"
FT   gene            645401..645568
FT                   /locus_tag="VS_II0572"
FT   CDS_pept        645401..645568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26161"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26161.1"
FT                   /translation="MKLLIDLIAILRVNNTTVRSGKGNGISLLFVLLATIGLDKGWNQN
FT                   EQTYSNQLSD"
FT   gene            645534..646217
FT                   /locus_tag="VS_II0573"
FT   CDS_pept        645534..646217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26163"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26163.1"
FT                   /translation="MNKRTQISLVISSAMLAFGAAQVQAAELEVTVTNATKGIYFTPIL
FT                   AAAHDSSLFMFRTGESASAELESMAEGGDISGLSSLIANAGGVVVENPATGILNPGVAT
FT                   TFDIDTGDLAYLSLGAMLLPTNDGFVGLDSWKIPTQAGTYKATLNGYDAGTEANDELAG
FT                   SMPKPPFITFGAGGTGVETAVSNAKVHIHPGNIGDSDAAGGISDLDSSSHRWLNPVATI
FT                   TIVVK"
FT   gene            646227..646907
FT                   /locus_tag="VS_II0574"
FT   CDS_pept        646227..646907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0574"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26165"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26165.1"
FT                   /translation="MKARILFIAASVAVLAGCPDDDDDYYRYDVSVTNLTPNQPMSPLA
FT                   VLTHNTNFDLFEVGQSASVDLEYLAEGGSNAQLLALSDSDANVYQGISGNGLILSGEQD
FT                   TVSIRVDPNQEGYISVASMLVNTNDAFVGESGLSLKSLAVGDTFVMNMNVWDSGTELND
FT                   ELAATIPGPAGGGEGFNTTRDDTDVVSFHSGVISQDDGLTTSALSANHRFLNPGARITI
FT                   TRTE"
FT   gene            646990..647721
FT                   /locus_tag="VS_II0575"
FT   CDS_pept        646990..647721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0575"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26167"
FT                   /db_xref="GOA:B7VRI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26167.1"
FT                   /translation="MNSAAVNLMANMLLVEDDDDLAELVQMHLKFQGHNVERANTIEKA
FT                   QDLYLDGQFDLVVLDRGLPDGDGLDFCRMIRQKEDWTPVLMLTARDAELDKVSGLEAGV
FT                   DDYITKPFSVLEFQARVRNVLRRLSHVESVTQEAMTTESIMNFGGLIIQPERHQVSLNN
FT                   QDVPLTATEFTLLHFLATRPGRVYSKDELLDHVWNTHHSGYHHTVCSTVNRLRTKLAMP
FT                   NSDDDFIKTVWGVGYKFESKA"
FT   gene            647788..649161
FT                   /locus_tag="VS_II0576"
FT   CDS_pept        647788..649161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0576"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26169"
FT                   /db_xref="GOA:B7VRI8"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26169.1"
FT                   /translation="MSFKSRLVLFTSLWFLLVSVVIAYTYHWQKETIEHRTKQSLHKEL
FT                   AVHMRDDNPLMIGTDYNPKALKSIFHTLMLIGPDFDIYFLDSQGNITTNAAPEGTVLAN
FT                   QIDLAPIQQFLNDEPYPILGEDPINPGSPKVFSVAAIEELGSTVGYLYVVIGSNRHTVI
FT                   TNSQVDTPYIALAGLVLVSIFGFAIGAYLLVKRSLLNPIEAVTNKLQQQAEQDFRLEPN
FT                   FVHQVPELVPIARSYQLMAKHIQQQFLQLEYQSSHRRQSLLQLSHDLKTPLSSVLGYLE
FT                   TWKIQNPKSDPLIDVAYRNGNKLSEQLHSLLDSAKNDNPLPTYQYASIDFNVLMNECLE
FT                   TIQSQYRHKNVELNVNIPIGIKAVGDSDLLERLILNLLDNALRHSPSGTMVSLDVGLES
FT                   DSKRVKVVIHNEVEREAPNGSLGIGTKIAQSILMLHHSVLETTKAENSFQQSFYLPSV"
FT   gene            complement(649298..649801)
FT                   /locus_tag="VS_II0577"
FT   CDS_pept        complement(649298..649801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26171"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26171.1"
FT                   /translation="MQIQENTMQRDYTLTCLNNMPREELEEFSLRMIHRLVPEDAMTEL
FT                   FTFEQEEVTNEERMQSAKFDAMLRMTAIALSEVNLAFSESDNSQQNIERMTRLLLWHFY
FT                   AMSFNLEQAISLETHCDKVEKILLKAPTEAFGWVKELTELLHFYAELNEGNEGNEGNEA
FT                   KKDA"
FT   gene            complement(649939..650877)
FT                   /locus_tag="VS_II0578"
FT   CDS_pept        complement(649939..650877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0578"
FT                   /product="Permease of the drug metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26173"
FT                   /db_xref="GOA:B7VRJ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26173.1"
FT                   /translation="MFIMKLGYLSITVTLLIWASFFLSLKGGANSDLTPADIALTRFLI
FT                   PALALLPLVWKARSTIAAVPNRYLAGMFVGCGLPYLLVAGTAMQFVPVSHGSALVPGTL
FT                   PLFVTGIAVLFFKQPLSRHRVVGLGLVSLGILLFLGSSLSSFNFEYTKGHVLFLFGSLM
FT                   WATFTISARVANLNALVSAGFISFCSTLLLLILIFTGTLPSHLMDTPIAQWPVTELAVH
FT                   SAVQGVGAGLIAAFTYLYAVNTLGAERSAAFGSATPAVATLLAIPLFNEIPDTMTWLAL
FT                   GSICIGSLVASNIFMRNDQSMQYQPPSHSKA"
FT   gene            650699..650857
FT                   /locus_tag="VS_II0579"
FT   CDS_pept        650699..650857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26175"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26175.1"
FT                   /translation="MLRAFHTKGNNANAGMRNRVSAMSAGVKSEFAPPLRERKKLAQMS
FT                   RVTVIDK"
FT   gene            651018..651476
FT                   /locus_tag="VS_II0580"
FT   CDS_pept        651018..651476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0580"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26177"
FT                   /db_xref="GOA:B7VRJ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26177.1"
FT                   /translation="MDRIDRHLLELLQKDGRLTTAELADEVGLSASPCARRIKRLEEKG
FT                   IIDGYRVSLSREQVGIAMSVFVEVSLNNHQEVSIDKFESAVVEMEEVISCHVVSGAYDY
FT                   LLEVVSPNLMAYEAFTRKLQRLSNVKDIHTHLAIRQVKGNAPLPVYTD"
FT   gene            complement(651713..651955)
FT                   /locus_tag="VS_II0581"
FT   CDS_pept        complement(651713..651955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26179"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26179.1"
FT                   /translation="MLKTMAFNCLSNTEGTAEIRGKLLSVAKHMEEFGSVSELELCKIF
FT                   GETIWNDGVDYHSHAFSFRINAQTGDCSISNFKYH"
FT   gene            complement(652234..652809)
FT                   /locus_tag="VS_II0582"
FT   CDS_pept        complement(652234..652809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26181.1"
FT                   /translation="MNFLVKVVIISVPLSADIALADHCDRENWQTLLDRQLSFEERYNQ
FT                   YTKEFNQVLSTYESQTLLSKHFNEKQIIGLWAKYEQRFNVQLNSHMNTAYDVSEVLLKQ
FT                   AYIVSTELDGAESLTHSWQTIAKHCAKARLPRQTESAQVHVQSSQSLSQDLYTLSKKFR
FT                   QLSSKYRKEATMIDEARHTNQPINDVQN"
FT   gene            652906..653586
FT                   /locus_tag="VS_II0583"
FT   CDS_pept        652906..653586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26183"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26183.1"
FT                   /translation="MDLMKKALIALLVLLILGGGGAAYYFFVMKKDPIPPEKTEEPAVE
FT                   VAAQSESDLTSLTTPQPEPEQTEFYVLDRKLKVVEQPEIDGLITDYLYKGEKVELLEKQ
FT                   GEWARISDYIVLKEGGPQTAEWISMSGLSSDEVIISEQENREILDSYLSKSDDLKLHQE
FT                   KFRNTVAKLISEGECDPSDFEELGGWVKSVKYSDRDVYFIYCGGLSLENKIYLDVNTNE
FT                   IFTK"
FT   gene            654117..654857
FT                   /locus_tag="VS_II0584"
FT   CDS_pept        654117..654857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0584"
FT                   /product="Acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26184"
FT                   /db_xref="GOA:B7VRJ6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26184.1"
FT                   /translation="MKKLALITGSKGGIGSAISSKLVADGYRVIATYFTGNYQCALDWF
FT                   NEKQFTEDQVRLFELDVTNTAECALSLSKLLEEEGTVDVLVNNAGITRDSVFKKMDAEA
FT                   WKDVIETNLNSLFNVTQPLFAPMCEKGNCRVINISSVNGLKGQFGQTNYSAAKAGMIGF
FT                   SKALAAEGARSGVTVNVVAPGYTGTPMVEQMKPEVLDSIKNQIPMKRLATPVEIADAVG
FT                   FLASESGAYITGETLSVNGGLYMH"
FT   gene            654884..656095
FT                   /locus_tag="VS_II0585"
FT   CDS_pept        654884..656095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0585"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26186"
FT                   /db_xref="GOA:B7VRJ7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26186.1"
FT                   /translation="MEKVFMVAAKRTPIGAFTGSLKNVSAGELAGVAIKGALESVDLSL
FT                   DAIDEVIVGNVISAGQGMGVARQASIYAGLPEETPAYGVNMICGSGMKSVMDAAAHIKA
FT                   QDAEVVIAAGVEVMSQIPFVVPASVRNGHKMGDISMKDLLVGDGLTDAFNHYHMGMTAE
FT                   NIANTLNISRLAQDNYALESQQKAVAAIEAGKFNEQIVPVEVKQRRQTVIFDTDEYPKS
FT                   DATFEGLQKLRPAFDREGSVTAGNASGINDGASAIILASESAVAKYGLTPLVELTSYAQ
FT                   SGLDPKIMGLGPVEAVSKALDKANLTLEEIDLFELNEAFAAQALGVMYQLSEQHDLPLD
FT                   AFKPKVNVNGGAIALGHPLGASGNRIIVSLIHEMLEQKTTYGVASLCVGGGMGTAVLLK
FT                   GIEG"
FT   gene            656227..656574
FT                   /locus_tag="VS_II0586"
FT   CDS_pept        656227..656574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26188"
FT                   /db_xref="InterPro:IPR014176"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26188.1"
FT                   /translation="MYTDIFKTITDQTEKQFEPYLKFNKLVAKNIQTMTELQMNAMQTY
FT                   TDMGLSQMKAVSEIKDVNSLTAFNSQQLTALTQLSQQMMSDSTKLQAAAKEFKDDVETL
FT                   TTENLKTVTPA"
FT   gene            656648..658459
FT                   /locus_tag="VS_II0587"
FT   CDS_pept        656648..658459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0587"
FT                   /product="Polyhydroxyalkanoic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26190"
FT                   /db_xref="GOA:B7VRJ9"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26190.1"
FT                   /translation="MFQHFFSDYLVKLQQTNQQWWDNFEQNKEAAQSPLNQAMQELNFD
FT                   DASKIFEQAANQPAVLLQLQSQWWEQQLQIWQNAALMGNTESIISEERSDKRFIDDAWK
FT                   NDPFYSFIKQSYLLFSKSYIDTINSIEGIDEKTKERVAFFSRQAINALSPSNFIATNPE
FT                   LMKLTLERNGENLLDGLEQLQADVEASADILKIRMTNNNAFRLGVDVANTEGDVVFQNE
FT                   LFELIQYYPKTPQVNATPLLVVPPFINKYYILDLREKNSMVRWLLEQGHSVFMMSWRNP
FT                   GEAQRDTEFGEYVTEGVVKAVAAIENITGKEQINAAGYCIGGTVLASTVAYYAAKRMKK
FT                   RIKTATFFTTLLDFSQPGEVGAYINETIINAIEKQNDGKGYMDGRSLSVTFSLLRENSL
FT                   YWNYYIDNYLKGSSPMEFDLLYWNSDSTNVAAKCHNFLLRELYLENKLVQDKGVKVGGV
FT                   WIDLNKIKIPSYFISTKEDHIALWQGTYRGALNTGGNKTFVLGESGHIAGIVNHPEKKK
FT                   YGYWLNDNLDDSADEWLNNASHNEGSWWTHWDQWLQGFEADEKIEPFNQGSELHPVIGK
FT                   APGNYVKQVLPIVDKEVVDVQAPKSDA"
FT   gene            658717..659679
FT                   /locus_tag="VS_II0588"
FT   CDS_pept        658717..659679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0588"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26192"
FT                   /db_xref="InterPro:IPR016896"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26192.1"
FT                   /translation="MNYRMLMTLGVLFSANVLAELDEPGWGGEVGVLVGFGSETDDSEA
FT                   VKKGSLNSKGESDSSALVVPLGQLRYTFGSDSDQQVFMGTSRGDIIEGVFAFEFGYALE
FT                   YGNESVVSFSYLPTIANGEVWEDPFIANTARTKTDISGDTFRVQLDNLLDIGLSGDFAV
FT                   YKQDIKNDKSGVHLGVPTGVLQRDAKGYYASLSMEMPVSESSFIEPSLSYQKHLADGKA
FT                   VSFSDYSGSLTYIMMVDDHAFSVNADYSHRSYDASNPVFKKTREDNGYSATLGYEYMDV
FT                   MGWEDWGFNALAGYSSNNSNIAFYDTSGYLMSVGVSYHF"
FT   gene            complement(659861..661168)
FT                   /locus_tag="VS_II0589"
FT   CDS_pept        complement(659861..661168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0589"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26194"
FT                   /db_xref="GOA:B7VRK1"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26194.1"
FT                   /translation="MSMKKSFPIRGHLTTFFLGLSLLTALLFGELLIRHFEYGIEDSVK
FT                   MRLASEWLSFNEVRLINPEAKLPKSYVVSFYYDQLPNIKVDGKDVLRDVTFVNDEFTVV
FT                   FVDETVTNDIKKEAVFGVYRFALEDGRLVFGVARYDYRLIGDTIDVWFDHRFNLIIYIA
FT                   LGYIFFIVLALWLYSYRVGKKTEQLVEWSESASNDLLANPAPNFKFSEYNRVALYLEKA
FT                   LSKNAHLVEREQRFLSHASHELRTPIAIIRANMEILERISLPSDLQRPINRIDRASSNM
FT                   QQITETMLWLVRKSETPPNQSLVSVVALLDNLIEELEYLIQGEESDIIRNYLHAPTVEL
FT                   PETPIKIVVGNLIRNAFQYTHSGTIHIYFEKNSIVIKNINTQELDLPFQDSFGLGQDLT
FT                   EKICKKLGWHLEAEEIEGGLLARLHLPVEEKSNTNA"
FT   gene            complement(661171..661851)
FT                   /locus_tag="VS_II0590"
FT   CDS_pept        complement(661171..661851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0590"
FT                   /product="putative DNA-binding response regulator ColR"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26195"
FT                   /db_xref="GOA:B7VRK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26195.1"
FT                   /translation="MKSNLSINVLLVEDDKELAASVAEFLEFENIKCDHAYNGLSGFTL
FT                   AKQNYYDVILLDLMLPKIDGFTVCERLRDDGDDTPILMLTAKDTLQDKEAGFNAGTDDY
FT                   LIKPFAMKELALRIKALSKRRSSQQKRLVQGDLVYDLESQQVSRSGQVLDLNRLNLMLL
FT                   ELLMRRTPQVVTRREIEECLWPNDAPESNNIKVQVYQLRQKIDKPFESKLIETVVGQGL
FT                   RIKG"
FT   gene            complement(661841..664999)
FT                   /locus_tag="VS_II0591"
FT   CDS_pept        complement(661841..664999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0591"
FT                   /product="AcrB/AcrD/AcrF integral membrane family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26197"
FT                   /db_xref="GOA:B7VRK3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26197.1"
FT                   /translation="MMDNNLKTHGVIAWFVHNPVAANLLMVLIIVAGGFSVIQSRVESF
FT                   PSLPPTNITVSVEYQSGSARSAEESIAIKIEDSLLGVEGIKQIHSSSNSDGATVTITKS
FT                   SGYSLDKLQQDVKSVVDAIGDLPSEAKKPVITRQADLEEVVSINLFGDVPIGALQRYLD
FT                   ELRHKLLNSPLIQKVDYIGRKSQQVSIEIDEAKLQAFSLTMEQIVSQIRAESLTQTAGQ
FT                   LKGSQGTLVLKADQQHRSAKEFASLPIKRTATGQTILLSDVAHIELGFDDDGIITRYNG
FT                   HPSVGLKVKMYGQSNINQLAKETKSIVDAYQLTLPNGIHLTQWNDQSEPIKNRLSLLLK
FT                   NSAQGIALVVILLALLLNIRVAFWVAVGLPVTFAGAMVLMGDSFFGLTLNELTTFGFIM
FT                   ALGIVVDDAVVIGESIYEQREKHGASVESTIAGAQKVATPTTFGVLTTIVAFMSLSLIE
FT                   GELGKIFAQFAMAATFCLIFSLIESKLILPAHLARVKMEPTSAWGIPAVWHYIQQRVLR
FT                   GFKYITWHLYKPCLQLAIRYRYAVICGFFSLCILVGGSLITGKLKSVFFPEISTNFITI
FT                   ELAFEDDTGYGLVQRETLKVEQMAASLNDSLVKKYALSVPPIQSVLVETTNNSSQIIVG
FT                   LSSNTQRPISAGAIAKEWQSMVPTLEGIDSANFLADMISDKAISIELRSQNEATISNAT
FT                   RELTEHLSNVQGVHGIKSSLANTQAQVDIKVNDMGLTMGLTTSNLLQQLNMAYQGYEVQ
FT                   QFQEGSHEIKVKIQYPRAKRQTLDNLKYAQIRLSNGKLVPLNAVANISTRYVSKNIERM
FT                   NRNRVNVITADVDKTIASPEEIIDKLDSDLFKRLQNKYRDLNIVLSGQQQEQEQISNSL
FT                   YSVFAIALIGIYALLAIPLNSYFQPLLIMCTIPFGIVGALMGHLIQGIPISILSLFGML
FT                   ALTGVVVNDSLLLISRFNTKIMSGDTVYEALIESGTGRLRAIVLTSATTYFGLVPLLSE
FT                   TSPQAQFLIPAATSMGYGILFATVITLLLVPVLLMVQQDIKQLFHNITTQRSASFTGVK
FT                   KNEI"
FT   gene            complement(664986..666218)
FT                   /locus_tag="VS_II0592"
FT   CDS_pept        complement(664986..666218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0592"
FT                   /product="Secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26198"
FT                   /db_xref="GOA:B7VRK4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26198.1"
FT                   /translation="MKQILVTALGLLSIIATAMYIMKSIPEETTLALEAQPRQYIKVTT
FT                   VDIAAGQHRSTIEGYGQVISEETLTLTSQVSGVILSKAKKFQLGEQISKGDLLFHIDDS
FT                   SYQVLLANAEKELANAQLSFFQEQRKHQRAKKEWKTSGIEEAPSPLALREPQFKAAKAR
FT                   LNAAQQAVEDAKQQLNNTSIHAPFDAIVSQSNVTTGSVVASGTSLGQIKSIETAEVHLQ
FT                   LTERDWQQLPSDLSALSVTIQSASNSDSDSGQQWAARASHLSLLVEQSTRMRNLILKID
FT                   SPLQQPEPLLIGSFVRVVIQGKSHSDSFVVSSSSITADGNIWYVKEGQLHRHKTQSLFQ
FT                   DIDAIGFEQGNLNQHITLVVKPLSSYVEGMQVLALSDSSHADDTEKLALNRSLPTPASG
FT                   DKSLKEVNDGQ"
FT   gene            complement(666220..667587)
FT                   /locus_tag="VS_II0593"
FT   CDS_pept        complement(666220..667587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0593"
FT                   /product="putative outer membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26200"
FT                   /db_xref="GOA:B7VRK5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26200.1"
FT                   /translation="MNTHRPLSALLLLGSLTYLTGCASLSPTPQASLNNTTQIPEQWES
FT                   SQRYVNTTMSTQLLSLFNNQALADLVQEALTNNHDLHKTALRLKQAELLADQSDQYLQP
FT                   SLNTDFQASRQKTSQIQNSHKLSLNLSWEFDVWGRLADTASAANAKQQATQLDYVYAQN
FT                   SLAARVIETWLDVAYRARVIGVEQRWLQSLSNTENIVLEQVLDGFKEQADLDTARAATS
FT                   RVRASLAAKEQDQLIAIRGLNTLRGKSDNQLNRMIFTIPEVEAPPLRLPGEMIGSRPDL
FT                   LAAYQQVLAADKSAAVAYKDLLPKFTLSASVYRSGSTPNHLIDNPSLWNLVGGISAPLL
FT                   DQSSLQTQAKIAQLQAEESFVDYQKKLLVAINEVGNALDKEFYLKQQEQHYRDAFTFSK
FT                   ASMKNYQNLYQEGASDVLALLIAQQSIYQSKIQLLNTQRTRLSNRITLGLALGMGV"
FT   gene            complement(667829..669037)
FT                   /locus_tag="VS_II0594"
FT   CDS_pept        complement(667829..669037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0594"
FT                   /product="putative HD-GYP domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26202"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26202.1"
FT                   /translation="MNLMQFDLKDSVKISINTLVVGMFVTSIQKSERVYLSNAGRVSSK
FT                   KGIDTLINKGIKYVWVDKKLSAKGCKFHPVPDDETSEEQQKSSKNSPSKLVSREVRQKN
FT                   AERIIQEARGLAQKIITATFDSHTFVADELDGWADELIESALINSDALQCVSALRKKDA
FT                   YLLEHSVNVATLLVTFGKHLGFGKDRLKPLAIGGIIHDVGKVHIDDNVLHKPSRLTEEE
FT                   FAHIKQHQVFAKPIIKKIEGLSQISRDVCLMHHEKLDGTGYPNGLSGEQIPQHGRMACI
FT                   VDIYDALTADRCYKRGMSPAEAFKIMLGMTPNHLDRQLVYKFINCIGIFPIGAIVELSN
FT                   GHLGIVWSSNDDAPVEPVVKCFYSRKNKRFIDVKYVDLKHSWHTIVKAISPTKAEIDVT
FT                   PFF"
FT   gene            complement(669479..669616)
FT                   /locus_tag="VS_II0595"
FT   CDS_pept        complement(669479..669616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26204"
FT                   /db_xref="GOA:B7VRK7"
FT                   /db_xref="InterPro:IPR014175"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26204.1"
FT                   /translation="MSTLENVIWHILGYSAMPVIILGGFAGVAAVSLWLLSITKDKEID
FT                   "
FT   gene            complement(669628..670209)
FT                   /locus_tag="VS_II0596"
FT   CDS_pept        complement(669628..670209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0596"
FT                   /product="periplasmic nitrate reductase, cytochrome c-type
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26205"
FT                   /db_xref="GOA:B7VRK8"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26205.1"
FT                   /translation="MIKLLKAFWKRLATPSKAAVGVVLFLGFSGGLLFWGAFNTGMEAT
FT                   NTEEFCSGCHAPIVAEIQETIHYSNRSGVRAICSDCHVPHEWTDKIVRKVQASKELYAH
FT                   FIAKTINTEEKFKARRAHLAEREWARLKKNDSLECRNCHQFDYMDFSEQSPRSAKQHST
FT                   ALASGEKTCVDCHKGIAHKLPDMHGVEGWQ"
FT   gene            complement(670239..670700)
FT                   /locus_tag="VS_II0597"
FT   CDS_pept        complement(670239..670700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0597"
FT                   /product="cytochrome c-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26207"
FT                   /db_xref="GOA:B7VRK9"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26207.1"
FT                   /translation="MKKLITALLSAGLLLAGAVQAQAELDNPGGIGGVESLRGASELEA
FT                   TRAADDFKKFPRDQVLESDYVYQPPLVPHTIRSYEVSLNANKCLACHSWKNAKEMGATK
FT                   VSVTHYMNREDAVLADVSPRRYFCLQCHVPQANAKPLVENEFKPVDSLR"
FT   gene            complement(670826..673315)
FT                   /locus_tag="VS_II0598"
FT   CDS_pept        complement(670826..673315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0598"
FT                   /product="Anaerobic dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26209"
FT                   /db_xref="GOA:B7VRL0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VRL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26209.1"
FT                   /translation="MKMTRRAFVKANAAASAAAVAGVTLPATATNLIASSDQTKITWDK
FT                   APCRFCGTGCSVLVGTQNGKVVATQGDPEAPVNKGLNCIKGYFLSKIMYGKDRLEQPLL
FT                   RMKDGEFHKDGDFAPVSWDKAFDVMAEKWKAALKKNGPTGVGMFGSGQWTVMEGYAAVK
FT                   LMKAGFRSNNIDPNARHCMASAVGAFMRTFGIDEPMGCYDDFEHADAFVLWGSNMAEMH
FT                   PVLWTRITDRRLSHPHVKVNVLSTYYHRSFELADTGYIFEPQSDLAIANFIANYIIQND
FT                   AVNWEFVNKHTNFKQATTDIGYGLRDNDPLQKAAANPNSGKMTDISFEDYKASVAEYTV
FT                   EKASEMSGVSQDDLIKLAKQYADPNIKVMSLWTMGMNQHTRGVWMNSLVYNIHLLTGKI
FT                   STPGNSPFSLTGQPSACGTAREVGTFSHRLPADMVVANPKHRKIAEDIWKLPEGTIPPK
FT                   PGKHAVAQDRALKDGTINAYWVMCNNNMQAGPNINTERLPGYRNPDNFIVCSDPYPTAT
FT                   AQASDLILPTAMWIEKEGAYGNAERRTQAWYQQVKTVGEAKSDLWQIMEFSKRFTVEEV
FT                   WGEELLAKAPEYRGKTMYDVLYKNGNVDAFPLSEAQELNDDAQAQGFYVQKGLFEEYAA
FT                   FGRDHGHDLAPYDTYHKVRGLRWPVVDGKETLWRFKEGSDPYAKKGSGWDFYGKPDGKA
FT                   LIINAPYEAPPEVPSDEYDMWLCTGRVLEHWHTGTMTRRVPELYKAVPDALCYIHPADA
FT                   KARGLRRGDEVLIENKRGEVRVRVETRGRNRPPQGLVFVPFFDARILINKLILDATDPL
FT                   SKQTDYKKCPVKITKVS"
FT   gene            complement(673312..673617)
FT                   /locus_tag="VS_II0599"
FT   CDS_pept        complement(673312..673617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0599"
FT                   /product="NapD protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26211"
FT                   /db_xref="GOA:B7VRL1"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26211.1"
FT                   /translation="MALNEVHISSLVVHVSPEHLDEIKAQIEQYDNAEIYGSSPEGKII
FT                   VVLETENQGFVTDTIEEINNITNVLGTALVYHQIETGLDETDLETGSNNSQLEGEV"
FT   gene            complement(673641..674120)
FT                   /locus_tag="VS_II0600"
FT   CDS_pept        complement(673641..674120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0600"
FT                   /product="iron-sulfur cluster-binding protein NapF"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26213"
FT                   /db_xref="GOA:B7VRL2"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26213.1"
FT                   /translation="MVDLSRRRLFSRRKVDSSQIRLPWIKSLESFADDCTRCGKCIESC
FT                   ETHIIIVGDGGFPTVDFSKDECTFCYQCADVCPEPIFKSKEETPWLAKATISDKCLAQQ
FT                   NVECRSCGDMCEPMAIQFQLRAGSVALPKIELDECSGCGACVAVCPTSAILVSNA"
FT   gene            674374..676104
FT                   /locus_tag="VS_II0601"
FT   CDS_pept        674374..676104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0601"
FT                   /product="nitrate/nitrite sensor protein NarQ"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26214"
FT                   /db_xref="GOA:B7VRL3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26214.1"
FT                   /translation="MLIKPVSSVTSTIAKSLLFILLLSVATTGFAIFTLASSLNDAEAV
FT                   NVAGSMRMQSYRLAHDIQIESVDYDSHIREFESSLYSTSMTNLVSWEVPTDITNDYYLI
FT                   IGRWHELKQVLNSEDRKHYLVLVENFVIEIDRFVFKLQEFSENKLIKLAWAGGIGLGGI
FT                   LVISLFVVHFVRKQVVKPLHALVRASQRIKNSDFEVKLEVTNNNELGILTKTFNSMAKD
FT                   LGVLYRNLEDVVDAKTVELQNANQSLQALYYSSQELTVTRVAPENFRAILQHLVSLEGI
FT                   ESLRLEIVDNSGRSLIMDEGYDPTCDYEKFEMKLDDNELVLGYLYCSYHHGHSTKTLIE
FT                   SFIQLLSRAIYYNRAQKKAEQLIIMEERATIARELHDSLAQSLSYLKIQVTLLKRVIGK
FT                   LPEHKHREQSEQIASEIGNGLAGAYTQLRELLTTFRLSIKEGSFGDALSTMLEQLSERT
FT                   DAKIKLTNNLSSLELDAHSQVHLLQLIREATINAIKHANADLIDVCCIDEDGQVLVVIK
FT                   DNGEGFDPSSSKMNHYGMSIMQERAARLNGDLTIEAAQGEGCTVILKYKSLKEVKVDDL
FT                   "
FT   gene            676091..676723
FT                   /locus_tag="VS_II0602"
FT   CDS_pept        676091..676723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0602"
FT                   /product="Nitrate/nitrite response regulator protein
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26216"
FT                   /db_xref="GOA:B7VRL4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26216.1"
FT                   /translation="MTICKVMLVDDHPLMRRGISQLLSFEDEFEVIAEASNGTEAVALA
FT                   HEEEPDLILLDLNMKGMSGLDTLKALRTDGSSANIVILTVSDSPADIEAIVKAGADGYL
FT                   LKDTEPDELIELLKQAHSGDKAYSSVVARYLNDADSRNDIFDQLTEREMQILQEVAKGY
FT                   RNKQIADHLFISESTVKVHMKSLLKKLQVPSRTAATVLYLERYGDMK"
FT   gene            complement(676943..678322)
FT                   /locus_tag="VS_II0603"
FT   CDS_pept        complement(676943..678322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0603"
FT                   /product="Probable anaerobic C4-dicarboxylate transporter
FT                   dcuC"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26218"
FT                   /db_xref="GOA:B7VRL5"
FT                   /db_xref="InterPro:IPR004669"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26218.1"
FT                   /translation="MEISMLELLIGLVITIAVGYFIVKGYKAAGVLLTAGLALLLITGL
FT                   IGHTVLPAKVASTGNMVTDSLEFVKYMLQYRGGGLGMQIMLLCGFASYMTHIGANNVVV
FT                   KQFSKPLAAIKSPYVLLVAAYIVACLMSLAVSSATGLGVLLMATLFPMMTAMGISRPAA
FT                   VAVCASPAAIILSPTSGDVVIAAEKSGMSLDVFAVQTVLPVSICAIIVMAGAAFFWNKY
FT                   LDKKENTPMEKVDVSEIETTAPAFYAALPFLPIIGVFLFNGRTIPGLSLDIYTIVVGSI
FT                   FVGAVIDYVVKKFDGEKTLEDLDSCYQGMADAFKGVVMLLVAAGVFAQGLMSIGAIDNL
FT                   IGLAESAGAGGIALMLILTGLTVAAAIATGSGNAPFYAFVELAPSLAAKMGLNPAFLII
FT                   PMLQASNLGRTISPVSGVIVATSGMGKISPFEVVKRTSVPVICGLITVIFGTLVLVPMA
FT                   A"
FT   gene            complement(678877..679593)
FT                   /locus_tag="VS_II0604"
FT   CDS_pept        complement(678877..679593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0604"
FT                   /product="Transcriptional regulator of succinylCoA
FT                   synthetase operon"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26220"
FT                   /db_xref="GOA:B7VRL6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26220.1"
FT                   /translation="MARLPMYRQIADAIREKISSGEYKVGEALPTEAQLREVFSVSRVT
FT                   VRQALKLLIENDELESVQGSGTYVKENKINYDIYKQSSFQEKWAHLDVVTHSDVLAFEI
FT                   KPCSLAMSEHLDIKEGELVFYVKRVRFIDNNPITVEETWLPVALFPDLTYQVMQTSKYD
FT                   FIENTKGMVIDRSEQELVPILPPEDVAKQLGIDPTQPIIEKRTRGYLANNTVFEYSRNY
FT                   FTSNDYRFTLVARRQR"
FT   gene            679911..681845
FT                   /locus_tag="VS_II0605"
FT   CDS_pept        679911..681845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0605"
FT                   /product="PTS family enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26221"
FT                   /db_xref="GOA:B7VRL7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26221.1"
FT                   /translation="MKLTTLTNKSLVNLQTTFSSREEAIYALADQLDQQGKLHNKQEYL
FT                   DAVFAREEQGPTALGEGLAVPHGKTDAVKEAGFAVATLKEDMKWKGLDEDEDVNLIFLI
FT                   AIPNAEAGSTHMHLLTALTTTLVDDDVREAVLKATTAEEIFALLDGDNQQEEKQDNLDT
FT                   NAPTIVCVTACPAGIAHTYMAAEYLEKAGKKLGYKVHVEKQGANGIEDRLTAEQLNNAV
FT                   ACVFAAEVAIKESERFNGIPRVETPVAEPIKHGERILNEAIEESKKGNGAERKVATDDK
FT                   PKKLPLKTELKQALLSGISYAVPLIVAGGTVLAVAVLIAQIFDLQELYATKDSWLWMYR
FT                   KLGGGLLGTLMVPVLAAYTAYSLADKPALGPGFAAGIAANIIGSGFLGGVVGGLIAGYV
FT                   MRWVKEHVRLGPAFNGFLTFYLYPVIGTLVAGSLMLFVIGKPVAFLNQGLTDWLNGMSG
FT                   TNALLLGAILGLFVSFDLGGPVNKAAYAFCLGAMANGVYGPYAIFGSVKMVSAFTVTAS
FT                   TMIAPRLFKDFEIETGKSTWLLGLAGITEGAIPMAIEDPIRVIGSFLLGSVVTGAMVGA
FT                   AGIGLSTPGSGIFSIFLLHDSGLGAFSAAAIWFGAAIVGTVISTVTLLMWRGHAVKKGK
FT                   FEASTATQN"
FT   gene            682083..684737
FT                   /locus_tag="VS_II0606"
FT   CDS_pept        682083..684737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0606"
FT                   /product="putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26223"
FT                   /db_xref="GOA:B7VRL8"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26223.1"
FT                   /translation="MTTSRVHITPHMHWDREWYFTTEESRILLVNNMEEIMNRLESDPE
FT                   YKYYVLDGQTAVLEDYFAIKPENTERVKALVEAGKLIIGPWYSQTDTMQVSGESIVRNM
FT                   MYGIRDCMKFGDAMKIGYLPDSFSMSSQLPMIYNGFDITRAMFWRGCSERHGTNKTEFL
FT                   WQSNDGSEVTAQVLPLGYAIGKYLPQDEEGLRARLDKYFPVLEKPSVTKDILLPNGHDQ
FT                   MPIQKDIFEVMDKLREIYPDREFSMSRFEEVFEKVEAARDQLDTIKGEFNDGKYMRVHR
FT                   TISSTRMDIKLIHAEIENKIVNILEPLASIAWTLGFEYHHGLIEKMWKESMKNHAHDSI
FT                   GCCCSDKVHAEILNRYILADDMATNLIHFYKRKIVDHMPDREGCDKLAMFNLSPYEREE
FT                   VVNTTITIRAQEFSIFDENENPVEYFIQDKRQIDPGKVDRQIVHYGNYDPFMEFDIQIK
FT                   RSVPAMGFTTLHIQGNEKGAVKVAEQKDYLLENEYYRINVNDNGTLTIFDKETEQVFDQ
FT                   VLRLEDGSDDGDEYDYSPSRQEWLLYSDEFPVETSIDHQGFQSVANIAFRMNVPANLTE
FT                   REERTGQNGFVEAQCQVVLKQGSRRIEVRMELDNQADDHRVRVLVPTPFVSETVVADNQ
FT                   FGCITRLTNDPAMAVWEEEKWKEAPVPVYQLMNFAALENGNAGMAIMSNGLREFEVIAS
FT                   QGYENRDTFALTLFRGIGVLGKEELLLRPGRPSGIKIPTPDSQVRGKLVCEFTLCGFSG
FT                   NHIDANIMAQARDNVTQVECYNKIPYNAMKLNVGEQNLPMSFSLLSKEQSGAVLSVLKK
FT                   AEDEDALIMRVYNPAETGSVSDSISFTQAVSSWKETSMDERVREGDVATETFGDLSFGE
FT                   LASCQAKTFQVKF"
FT   gene            684784..685950
FT                   /locus_tag="VS_II0607"
FT   CDS_pept        684784..685950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0607"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26225"
FT                   /db_xref="GOA:B7VRL9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26225.1"
FT                   /translation="MKIVIAPDSFKESLDAHQVASCIERGFADVFPHAEFVKMPLADGG
FT                   EGTVDVLLEALNGKKQGLQTMDPIGRECTAYWASLEQTFDGIKMKTALLEFAQASGLDR
FT                   ITVEERSPLTASSFGTGLLIKDALDQGVEQIIIGLGGSATNDAGAGILQALGGKLLDKQ
FT                   GNELSGGGAELSKLASIDLDGLHPRCKEVTFVVACDVNNPLCGESGASAVFGPQKGASQ
FT                   AQVEQLDTAIGHFADIAQTHTSTNHRDTAGFGAAGGTPLGLSLAFNIQIKAGIEMVLDA
FT                   LGADKVLEGASLVVTGEGQMDNQTLQGKTPFGIAQRAQKLNIPTIGIAGSLGQDVEKLY
FT                   GSMSSLFGTVRSPQSLDQVLLEANQNLTRTARNIAATLKLGSQIFNEK"
FT   gene            685953..687140
FT                   /locus_tag="VS_II0608"
FT   CDS_pept        685953..687140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0608"
FT                   /product="putative mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26227"
FT                   /db_xref="GOA:B7VRM0"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26227.1"
FT                   /translation="MSLFKLDNVIQNYAWGSKDSINQLFGIVNPNQEPQAEIWMGAHPN
FT                   GCSKVDDTGEPLSHMIDENRIDVLGGYTAARFGELPFLFKVLAAETPLSIQVHPNKRKS
FT                   ELGFERENALGIPLNASNRNYKDPNHKPELVYALTFYKAMNGFRPIDDIIALFEEADIP
FT                   SLAIELDVLKANADSDSLKSFFSAIMSLEGERKEATLDELYAAHARPAKTVMGREALQY
FT                   SIEFKQYYPGDIGLFAPLMLNTVELAPGEAMFLFAETPHAYVQGTGLEIMANSDNVLRA
FT                   GLTPKYIDVPELIDNTIFEPIKPEDIRLKPVLKEGKMSYPIPVDDFGFDILSANDESKS
FT                   QYLRSAEILFCVEGEATVTSEGRSVSLKPGESVFVSSNSSVYQYQGNGILARAFN"
FT   gene            complement(687546..687941)
FT                   /locus_tag="VS_II0609"
FT   CDS_pept        complement(687546..687941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0609"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26229"
FT                   /db_xref="GOA:B7VRM1"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26229.1"
FT                   /translation="MDAKHHSYWIPELFLQPEFILILRELIEFKAEELKMSKLTIIATI
FT                   VSKEDKTELVKSEMIKLIDRTRVEDGCINYDLHQDNSNPAHFVFHENWESEAHLEKHLA
FT                   SQHIAEYMAATEDCIETFVLNKMTHIA"
FT   gene            complement(688090..689373)
FT                   /locus_tag="VS_II0610"
FT   CDS_pept        complement(688090..689373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0610"
FT                   /product="acyl-CoA desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26230"
FT                   /db_xref="GOA:B7VRM2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26230.1"
FT                   /translation="MTCYYISHYLYTIFKQNILIHVYTFNIDLHVYADILAHRCKLNGN
FT                   LLMNSADKQSTKKPPLIWLNIFVFSFSMLLAVVAAPVYGYFFGYGMEHWIWLAICFTFC
FT                   NLSITTGYHRLWSHKAFEAHSSLRFLFSLGGAFALQNSALHWSSDHRVHHKHVDNNDKD
FT                   PYSAKRGFWYSHIGWMIRNYSTSMYENYENCRDLKKDKIVMWQHKHYVLLALLMNFGVP
FT                   IALGVIYGDVLGMLLIVGAVRLVLNHHTTFFINSLAHIWGSQPFTDKNTARDNGVLAVL
FT                   TFGEGYHNFHHIFENDYRNGIYWWQYDPTKWLIKSASLMGLASKLKKTPQARIEKAEAS
FT                   MLLKRTQQKIMHRADKQQIADKLQQEFDALVSNMNEYYEVKKQLLESKREDVVKKYEHS
FT                   LLKVRYQQIKMNFEQQKKNWAMTVEQYA"
FT   gene            689399..689944
FT                   /locus_tag="VS_II0611"
FT   CDS_pept        689399..689944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0611"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26232"
FT                   /db_xref="GOA:B7VRM3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26232.1"
FT                   /translation="MEIKVAEYKDYERIAQLHADSWKLYYRGILADDYLENDVLEDRSV
FT                   IWQTRLINPPFNQHVLLLEEGGLLVGFVCAFGNHNFERGTFIDALHVDNNYRGRGVGKR
FT                   LLSELSKWLQQYYSDSGLYLEVMSENHQAIAFYQAIGGKEELEQVWNAPCGSQVNEKVI
FT                   SWSSPVELEQKTARIVYS"
FT   gene            complement(690130..691161)
FT                   /locus_tag="VS_II0612"
FT   CDS_pept        complement(690130..691161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0612"
FT                   /product="putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26234"
FT                   /db_xref="GOA:B7VRM4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26234.1"
FT                   /translation="MVDSCVSRRYSALHALANPYNVQQIYLSRFISMSIQWFPGHMHKA
FT                   RKEIEEVIPQVDVIIEVLDARIPFSSENPMISSLRGDKPCVKVLNKRDLADPELTERWI
FT                   EHFEKEQGVKAIAITTSAKEEVNHVMELVRKLAPHREQMGKNIRTMIMGIPNVGKSTII
FT                   NCLAGRTIAVTGNQPAVTRRQQRINLQNGVILSDTPGILWPKVENPHSGFRLAATGAVK
FT                   DTAMEYDEVAFYTVEYLAKQYPNLLQERYQIEELPESDIELMEAIGRKRGALRAGGHID
FT                   IHKCSEILLHELRNGTLGKVTLELPEMITQELIEVEEAAALKAEQQIKKKEERRKRYLK
FT                   NKR"
FT   gene            complement(691396..691692)
FT                   /locus_tag="VS_II0613"
FT   CDS_pept        complement(691396..691692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26236"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26236.1"
FT                   /translation="MLPAVRATDMHMRPMQTPDLVPTPHVSGPLLPLSTTVLIGNFPAA
FT                   TLGKICICVGPPDGVVKGSATVLVNNKPAARMGDLTVHVGTIIMGIPTVLIGG"
FT   gene            complement(691693..691758)
FT                   /locus_tag="VS_II0614"
FT   CDS_pept        complement(691693..691758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26238"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26238.1"
FT                   /translation="MGLNIVQGGNRSNTGKQVLES"
FT   gene            complement(691749..691910)
FT                   /locus_tag="VS_II0615"
FT   CDS_pept        complement(691749..691910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26240"
FT                   /db_xref="GOA:B7VRM7"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26240.1"
FT                   /translation="MGRGASMTAPSDPIVPPPQYLYAQAAAAVSTLQLFYLKVNKQNNV
FT                   TSYLSKWV"
FT   gene            complement(691889..692056)
FT                   /locus_tag="VS_II0616"
FT   CDS_pept        complement(691889..692056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26242"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26242.1"
FT                   /translation="MDWNSVENEAIQSAKVWVHVPDETNSPQAGNSAIKAGLDASASGQ
FT                   PKLLWGGVLA"
FT   gene            complement(692592..694097)
FT                   /locus_tag="VS_II0617"
FT   CDS_pept        complement(692592..694097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0617"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26244"
FT                   /db_xref="GOA:B7VRM9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26244.1"
FT                   /translation="MLYAQPGTENSLVDFKPQYQNFIGGAWIAPKQGKYFTNTSPVNHS
FT                   VICEVPASTKEDIDLAVDFAHSAKNDWASTSSTERSNILLKIADRIEQNLEMLAITETW
FT                   DNGKPIRETLAADIPLVVDHFRYFAGCIRAQEGSAAELDSQTITYHFPEPVGVVGQIIP
FT                   WNFPLLMAAWKLAPALAAGCCVVLKPAEQTPASILVLMELIEDLVPAGVINVVNGYGSE
FT                   AGQALATHKKIAKIAFTGSTEVGQHILKCAADNLIPSTVELGGKSPNIFMADIFDHEDN
FT                   YLDKCIEGVLLAFFNQGEVCTCPSRVLIQESIYDRFISRLQARMKTIQQGNPLDTDTQV
FT                   GSQVSREQFDKIRQYIALGHEEGAELLAGGKSYDKNGYFVEPTLFKGTNEMRIFQEEIF
FT                   GPVVAVTTFKDYEEALAIANDTEYGLGAGVWTRDNNLIAHMAKNIQAGRIWVNCYHAYP
FT                   AHAAFGGYKKSGIGRETHKMMLDHYQNTKNIIVSHSVDPLGFF"
FT   gene            694518..694877
FT                   /locus_tag="VS_II0618"
FT   CDS_pept        694518..694877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26246"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26246.1"
FT                   /translation="MYQEVSQLLDDIGYAFDKHELKICTIRAQKNKVIKAMIVKAKELK
FT                   FDISTNLAKSVLSAIVSQEEITEYQAIDTLTKYVLFDSKEQKEMRENLFLAAMRESEEF
FT                   HIVMLLNGEGANRVV"
FT   gene            694834..695124
FT                   /locus_tag="VS_II0619"
FT   CDS_pept        694834..695124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26247"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26247.1"
FT                   /translation="MLCYLMEREQIVLSEEILYERTKEALRCARLLELDTTKQFIKTCL
FT                   SACIADKRIHINNIGEVLSHSIAYPSKLLAGAYETSELHQSITPVLEELSL"
FT   gene            complement(696153..697172)
FT                   /locus_tag="VS_II0620"
FT   CDS_pept        complement(696153..697172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0620"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26248"
FT                   /db_xref="GOA:B7VRN2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26248.1"
FT                   /translation="MLANRTSKRNTVFMINKREPLKITALLLEGSPITAISGPVEMLTI
FT                   ALIQAGFPAPLVSYVSVTGGPTQFLGGLTINCYTHWESVEHTDILLIGACGDVSNESYF
FT                   LLEDVKCWLKKQIIQCEFVLSLCTGAFLLAELGVLNKRSATTHWVYAERFREQFPQVKF
FT                   KPHLKITHEGKYICTSGIKEYFSATIMLIDALLGTRQRIKCEQYLGGDISKIKRICLTN
FT                   FAQYHQHSDGLINRLQEYMHNEDPGRLSVAMCAEKSFLSERQMKRRFKAATGESPMNYI
FT                   QRIRVALAREKLDTTSLNIEQISQQVGYNDTNHFRSLFKKFYEMTPTEYRKMTQVCEI"
FT   gene            complement(697351..697830)
FT                   /locus_tag="VS_II0621"
FT   CDS_pept        complement(697351..697830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26250"
FT                   /db_xref="GOA:B7VRN3"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26250.1"
FT                   /translation="MSNVNKIIILLVLANTLFMTVISWMNNLNNPPFLVGRENTMLFSR
FT                   GRTYTDFEVDSFKEVITVDHKFGGIHDVHSSILSEGETKALNIYYSVNFFGENLFSTAN
FT                   ALRSENYTSSVEPDLVEAHLMEGSSEQFFQTLYQDRYTFCYSSLLTSSVQCITAD"
FT   gene            complement(697814..698611)
FT                   /locus_tag="VS_II0622"
FT   CDS_pept        complement(697814..698611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0622"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26252"
FT                   /db_xref="GOA:B7VRN4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26252.1"
FT                   /translation="MILMTKKSSNIWILNPTLRRQLTNKNDGTSKKLHSTDCKILETLC
FT                   KHKGRTVSKSALTNAAWPGRVVSKASLTQSIAHLRIALGDNGREQNIIKTVPKHGYSLV
FT                   EDLVEIEIPIINTQNNQSTDGPTTTQELLKIEVKEQVFFLKHFQNFTLLVLSCLLLLSI
FT                   SWLTQLIYYNSTTERIEWGQRDYLGVTYFFTNNQNGEDHFKAFKGKYTNNLRMLYLSDN
FT                   PETFYISCTYQLNRSHMRNTMNMSFSQKYSVEQMKEVINEQCQ"
FT   gene            complement(699090..699815)
FT                   /locus_tag="VS_II0623"
FT   CDS_pept        complement(699090..699815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0623"
FT                   /product="Transcription activator ToxR"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26254"
FT                   /db_xref="GOA:B7VRN5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26254.1"
FT                   /translation="MWDFRPQAHSQLRNRISGEEKRLTNTESQLLLLLLSNNHRIVTKA
FT                   EIHNKIWRGKFVSDASITHAIASLRLALHDTVQTQCIIRTAPKVGYFLTKNTITLVSVN
FT                   QIQPQPKFPAKLRLFNLSYFSQTLILLSLVSVNLLLFWFIFVPSQPTHRLNMSKVNDKT
FT                   NTFTIESNDPQSKSLLDRLVSLPELNNSNFYITSNRTRIYVSCIYKENSTSASQSVNFS
FT                   VDIKRPIAKVVNDIVHECQ"
FT   gene            complement(700082..700240)
FT                   /locus_tag="VS_II0624"
FT   CDS_pept        complement(700082..700240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0624"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26255"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26255.1"
FT                   /translation="MTKTLITLLISILLGTIYIGGILESETSVSELTIEQYINNSRYNM
FT                   PLVSLSK"
FT   gene            complement(700294..700908)
FT                   /locus_tag="VS_II0625"
FT   CDS_pept        complement(700294..700908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0625"
FT                   /product="thioredoxin peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26257"
FT                   /db_xref="GOA:B7VRN7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26257.1"
FT                   /translation="MIMRRLLIVATAIYSINTFAKFETTKEDAGFGESQVVTLEKTTKF
FT                   DLVGNPLKVGDLMPSAKLLTSGLEHYDTSAKNQSIKVYSILTSVDTPVCVQQAIELSQY
FT                   INSNKQKLQDIEFYAVSADTAFAQQRFIKQHSLKGVTYLSDSSEHRFGLNTGTQIKQLG
FT                   LLSRSIIVVDVNNQVIFTQRVPELTTIPSLKHAINFALENR"
FT   gene            complement(700905..701402)
FT                   /locus_tag="VS_II0626"
FT   CDS_pept        complement(700905..701402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0626"
FT                   /product="Thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26259"
FT                   /db_xref="GOA:B7VRN8"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26259.1"
FT                   /translation="MSVTFQGVPVSISGKLPKLNQLAPKFTLCDKELNNLTLDSLKGKN
FT                   VLLNIFPSIDTPICAASVRTFNKNAADLNNTVVICISADLPFAMNRFCGAEGIDNVITA
FT                   SFFRESSFTENYGVNLNEGALKGLSARAVVVIDQEGVVKYCELVSEITTEPNYKSALTA
FT                   LL"
FT   gene            701981..702466
FT                   /locus_tag="VS_II0627"
FT   CDS_pept        701981..702466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0627"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26261"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26261.1"
FT                   /translation="MKPYLNGKYDNNEDKALGGLYLDLSAQVFSNVFLEGHADFLTRFS
FT                   SEVDTWQSGGGVIGRFGGAAASSFSCGVINYRADSDYSVSFSEQGGYCKTMVRKQIARH
FT                   WVLGLSYQHDFLERSRDAVKLKNVFQFGSVFGLVADFEYAKRDAVEIGYQLGVQFSF"
FT   gene            702643..702834
FT                   /locus_tag="VS_II0628"
FT   CDS_pept        702643..702834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26262"
FT                   /db_xref="GOA:B7VRP0"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26262.1"
FT                   /translation="MIYGNGNMNPLDYTLYTLNAKQLLIDPESKLPPQRKRGAGTRNYG
FT                   YLVSFTIGILLGQLIKFI"
FT   gene            702952..704613
FT                   /locus_tag="VS_II0629"
FT   CDS_pept        702952..704613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0629"
FT                   /product="ABC type uncharacterized transport system"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26264"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26264.1"
FT                   /translation="MEHLHQLSSSHLKRLRQLERKFNQNLKTEVTITDLAEILFCSERN
FT                   VSKLMVSLESQGILKWLPGRGRGNHSKLTLVKNFEDALFDKIEGMVQGGKMNEAFILAQ
FT                   QFDCVWQFQNHLPQWLDEAKQRLKQQNTLMYVVPYSLPEWRPHLALSTRSILMIESVFD
FT                   TLVRFDSEQQEIKPYLAHQVDVDGLQIRVRIRNNIQLHNGEMLTPEMVKTNFDMRCKTT
FT                   HPYQILFRHLVNIEVEKQWIVFYLDQHDPVFLHLLADIHSAIFDLNSDTPVGSGAYQVE
FT                   RLEPHRWSLIRNTHYFAFGGHIERAEFWSSNELPISAIHVEESCWTYLDPTDSKDIIEH
FT                   SGCTVLQFPHHKNVLSNEELSWIVHYSRAYVNGAEVREANSIMHCHQEKGFHLFNRGMK
FT                   RPSRPVVFEVKDTHRAEIQPLLSALRRNGLDLLIKDKAGFDSPGSTDVFYDCYAFGDDI
FT                   AFQYYEWLLCGDVFTRCLSNDAKKSLLSFVDALMRESISSSEFLQKLHRAEDWLIQNYY
FT                   YCPLWRDHIAYRRADNVYGTDTSSMGVMTLSNMWLE"
FT   gene            704687..705370
FT                   /locus_tag="VS_II0630"
FT   CDS_pept        704687..705370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0630"
FT                   /product="putative aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26266"
FT                   /db_xref="GOA:B7VRP2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26266.1"
FT                   /translation="MHIGIIGGIGPASTEMYYRELVKQYQVVNISLELTIVHADIHELT
FT                   KNLLADDKKKQVNIFLNYINRLVKCGATHVVIPSLAGHFCLTELEIRSPLPIMSALDVL
FT                   KYYVQENAISKVGVLGTLPTMQTGIFGCFDKNCLIVPDPDEQLIVADTYRKFARNGYAS
FT                   AEDKATIFSIGQKLTNDNNVEIVFLAGTDFFLAFDGEDCGFKAIDCAQLHIASIVALAK
FT                   KPQFA"
FT   gene            complement(705792..706475)
FT                   /locus_tag="VS_II0631"
FT   CDS_pept        complement(705792..706475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0631"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26268"
FT                   /db_xref="GOA:B7VRP3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26268.1"
FT                   /translation="MHNSKNNLKHMLLIGDNGINNQFIQREIEKYSDFCFSRECISGIE
FT                   RSNHRKTFDVILISYLLLADIKDVYITLSKVESNKWVIYDVPSDITGQSITVMQLFNMF
FT                   NIKGIIYQDAPVEHLTRCLKTVCDDDLWLPRKLMSHILSNARSQTFKSQVILSTLTKRE
FT                   AQIFKRVIRGDTNLEISSELFISESTVKTHVYNIYKKINVTNRKEAIRKANFINSLETI
FT                   IQPGM"
FT   gene            complement(706571..707458)
FT                   /locus_tag="VS_II0632"
FT   CDS_pept        complement(706571..707458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26270"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26270.1"
FT                   /translation="MCMWIKQLRWGGWFLIAINSVSSVLACEASALTIQPVSSQSQYDV
FT                   FNTGNYATINTYRIDANIIGEDCKLSLVLQLNDTSRTLKGVNQDKLNFEWSGQVGVPIA
FT                   NQWHVSLTDSQPSTTIQMRFPSKQWLASGTYRGVLEVSPSYTSDNQQIEISPRSLPVSV
FT                   TVPPAAKVHFYGLTQQHYDLDLGTLYSNKIIRSAPNLWVQSNTAYTIVLESSHQGMLRH
FT                   ESDETKWDIPYELSLDNDRVNLGQLDAKIQRISATIGQPIPLSFVIGETENKPGGIYED
FT                   TLQISIEPLLSQQP"
FT   gene            complement(707442..709934)
FT                   /locus_tag="VS_II0633"
FT   CDS_pept        complement(707442..709934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0633"
FT                   /product="putative fimbrial Usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26272"
FT                   /db_xref="GOA:B7VRP5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26272.1"
FT                   /translation="MDMKTETSHKMWQVFYVLGLVLFYCAALSPVAWGQDMVLNPTGRD
FT                   IQLTSLLRISDTILGEADIIITANNEILLPKESTLSLLSSVVTQEGIGKLHDTTDDEML
FT                   SQHHFMSVGLGLNFDFSSLECIVTVPPEFSLTQQLSMNGADDFYNYAEPSLLSGYVNVA
FT                   LSANESQYVDQKSSRQDLYRSQFDSALNIGFFNFEYESYLENGSSKKSQYVREGTRLNI
FT                   DFAQQGTRLVLGDMYNSGQSFQDSTDILGIGLTRDFTLIPTRNARPRANQSFTLQRASN
FT                   VDVYIDGIAVQRLTLGAGSYNLSDIPLAQGSNDIVLVITDRSGNEERIEFSIATGNDLL
FT                   NSGEFEYSIMYGAPSELQNGQLEYLTDERIFHGYVDVGINPWLTLGTNFQTREDLYQYG
FT                   TTALIASRWGVTELNASRSEHPVLGNGDAYKFAFDAEFSSKNTLAPQLSVSYEYLSNNF
FT                   TGVAGFDASDKDINLTTHYASAFGSIYLSRSLRAAMTVNYRSGIDKENDYWLISPSLSD
FT                   GLFDTHATWSARVSYQDHASKDDDISTTLTISWPLSRQTRVVGRYSTELREAALDYSYQ
FT                   NNIGNTGGISGFASVITNEETDADMDAGINYTANRYELSATHASRLDDISGDTRNHSTD
FT                   VTISSALAFAGSSVTIGRPVREAFAIVSKHESLAENDVALDPTKDGEYARVYLNGDASA
FT                   MVPDLVAYNSQVIGYEVDNLPPGYDLGDGAFWVKPDYKRGFQLQIGSDAVLTVIGKLYD
FT                   RQSNNPISLVAGVAHYLGEAKQLPIDFFTNRSGIFAISGLKPGKYQLILDTKGQESAVI
FT                   TLSERSDNLIRLGDVYVD"
FT   gene            complement(709918..710604)
FT                   /locus_tag="VS_II0634"
FT   CDS_pept        complement(709918..710604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26274"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26274.1"
FT                   /translation="MRRYIFGGFISCFLCGQALGITLFPTVIELNTDHRATSQLVVTNN
FT                   STRDLPLEANVRRLKFLPDGTFQTIDLSSEVMFVFPPAAMLAPGERQVFRIQWLGNRQL
FT                   ETSQSYFVRFSTLNIGQNNEKMDSPTSLTTGINLQVHYNALLHIHSSSLEPDVNLHIDE
FT                   QGKLTLTNSGSRFTYTSLLHFKGLESQNQKVHEALGEQFIPPRSTITLPSSLNYLPVGT
FT                   YHGYEN"
FT   gene            complement(710607..711347)
FT                   /locus_tag="VS_II0635"
FT   CDS_pept        complement(710607..711347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0635"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26276"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26276.1"
FT                   /translation="MELIAMYKWIMHKWTVLLLLSLTCLSAHAFKVEPMSMEMTPLGKR
FT                   AQMTMRVENSSTEPLTVELSPVFMTMNEYGKETTTPADDELLVIPVTAIIEPGRSQSIM
FT                   VRYLGDPSITESKAFRIAVKQVKVQRASSNQGQVSLLLQFNTLINVRPQNTASQLEIKS
FT                   IEPNNKNNKWVLEVLNSGNSYGRLTNTTWKISDGKKSTYLKGVEIAKRIPGTLVLPYST
FT                   RFFEMQPLENYNVETLSIEIEQDQ"
FT   gene            complement(711447..711944)
FT                   /locus_tag="VS_II0636"
FT   CDS_pept        complement(711447..711944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0636"
FT                   /product="putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26278"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26278.1"
FT                   /translation="MKKLTLYAATVTAIFGAQVQAAPGDVQLVGFVSPVCEVTGLSTQL
FT                   MDFGNVSQIQNLSVSGLNMKCNDVDGATVTLTSAEGGLESDDSEDYALTYEATFNPSGL
FT                   APFTLNAPGGPGLNDVSISNSYGGSGVLATGVAASIDIVTTETSPWAGGYSDTLTVNIT
FT                   SN"
FT   gene            complement(712022..712546)
FT                   /locus_tag="VS_II0637"
FT   CDS_pept        complement(712022..712546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0637"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26279"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26279.1"
FT                   /translation="MRGEMMIRAFVFIHKFIVSTLIFSLSLSFYTSANTLTLGINGQIK
FT                   DRCEINFFSGNVMKFTERRDVQLLPFNMYCNRPLGITINSKYGGLKYQHQGVDIIETYN
FT                   LSLQIDELRLYESRHSSQLTSPVMINSSGVIPFSQQGSLRVALENSLRFAGYYQDVIEI
FT                   EVYPSIHSVTK"
FT   gene            complement(713325..714329)
FT                   /locus_tag="VS_II0638"
FT   CDS_pept        complement(713325..714329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0638"
FT                   /product="Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26281"
FT                   /db_xref="GOA:B7VRQ0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26281.1"
FT                   /translation="MDFRSDTVTKPSQAMRDVMANAEVGDDVYGDDPTVNELEQWAANE
FT                   TGFEAAMFTSSGTQANLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIEN
FT                   NPDGTLDFKKLAAAIKPDDSHFARTKLLSLENTINGKVLPVSYLAEAREFVNQHGLQMH
FT                   LDGARVYNAAAALDVHIKEIAQHFDSMTICLSKGLGAPIGSLLLGSKAYIAKARRLRKM
FT                   VGGGMRQAGILAAAGKMALTENVAQLKVDHENAKKLAIGLSKLEGFSVNPDFIQTNIVF
FT                   AKLDQSIDINRIARELGEQGITMSPGNPVRFVTHRDISSKDIATFLTKLESAL"
FT   gene            complement(714370..714942)
FT                   /locus_tag="VS_II0639"
FT   CDS_pept        complement(714370..714942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0639"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26283"
FT                   /db_xref="GOA:B7VRQ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26283.1"
FT                   /translation="MVVHVFSYKKNWQGKWPDCMSKVIHQWKSISLIEENVTLPTNVVV
FT                   KHTTINHPGAAVILPITSSGKIILINQFRPSLKKWLLELPAGTMEIDETPLQCAQRELE
FT                   EETGYSATYFQSLGQVTPLAGFCDEIQHLFIAKDLSLTTRFECDEDEVIEVIELSLEEL
FT                   QHKIRNDQITDTKTIACLSKAQLCGHL"
FT   gene            715173..716828
FT                   /locus_tag="VS_II0640"
FT   CDS_pept        715173..716828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0640"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26285"
FT                   /db_xref="GOA:B7VRQ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26285.1"
FT                   /translation="MNPSISSHADKALLSERINKLAHALSDGVYEREDTIKLCLLAALA
FT                   GESVFLLGPPGIAKSLIAKRLIQAFDNSSYFEYLMTRFSTPEEVFGPLSIQELKDNGRY
FT                   VRLTEGYLPTAQVVFLDEIWKAGPAILNTLLTVVNEKTFKNGADIERVPMRLLVSASNE
FT                   LPDEDSGLEALYDRMLVRVFVNRIQNKQNFKSMLTTGTSQEAVIPKGLAITDIEYHQWQ
FT                   KELDNLELTDNSFNKLFELKTMLEDTVKKQGSASESDLYVSDRRWKKAVKLLKASAFFS
FT                   GRDSVNPLDIMLLQDCLWHSPESRDVVRSVVKDFALNRAFDQQESKSQIEMSREELEEI
FT                   QDDVESTLSVSLSVESTSGLRRKDVYQHDIKNAKMYSVGSAYNLIKLVMLQSNMSVSES
FT                   EKGDSRWVYVAKDDFDRVLKEGHGDIYGYVNENKNLCRLKLDLDASNQLVIKDIANRSV
FT                   LVSVVTTDGLDQELYNKWLNGAEKALEQLTAAEFKLKRVRTEFHDALPHNYIDPDLPKA
FT                   MESSLQAVTQELETTKVKSSKIAQRIKFMSQYFE"
FT   gene            716841..718286
FT                   /locus_tag="VS_II0641"
FT   CDS_pept        716841..718286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26287"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26287.1"
FT                   /translation="MLGADGLNLALMVADSGIIDTAMNDLIARSQVMMAAENKGVKTSV
FT                   KNHLVKWRGKVKKRVTKVCETDRFQEEIALYQEVIYWDESQFFDEIDRVIKKLEWHSAF
FT                   YLQARRLMENNKGVYNAMFPHYFCDQWYQSLSDAIKQAQVTELETSKEKVLADLYQRME
FT                   TMKNMDKVTESGDEGSVGRLWDMASAKLSKTDLTIMKRHAEFLNKHKGLQEIAEKLGRM
FT                   AGEEDDPSLHKAPVEELQMVEEKSDEAVDDIVGIHESDDLNKMLPNETMFLAYPELEVI
FT                   FYKHLADKRLLSYRSQGKSRTLRKVKAQKPDSKNIDIEKGPFIVCVDASGSMSGFPEQS
FT                   AKAMAYALMQIALAEERDCYVILFSSEQITYELTRQDGLREASDFLSYSFHGGTDLEPV
FT                   LMKSIDLMTGDKYKNADLIVLSDFIAPKQSDEMIAQVEKLKEHKNRFHAVSLSKYGNPQ
FT                   LMTMFDHCWAYHPSLVGRFMKKW"
FT   gene            718483..718556
FT                   /locus_tag="VS_IIt0642"
FT   tRNA            718483..718556
FT                   /locus_tag="VS_IIt0642"
FT                   /product="tRNA-Cys"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            718609..718684
FT                   /locus_tag="VS_IIt0643"
FT   tRNA            718609..718684
FT                   /locus_tag="VS_IIt0643"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            718765..718851
FT                   /locus_tag="VS_IIt0644"
FT   tRNA            718765..718851
FT                   /locus_tag="VS_IIt0644"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            718917..718990
FT                   /locus_tag="VS_IIt0646"
FT   tRNA            718917..718990
FT                   /locus_tag="VS_IIt0646"
FT                   /product="tRNA-Cys"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(719066..719854)
FT                   /locus_tag="VS_II0647"
FT   CDS_pept        complement(719066..719854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0647"
FT                   /product="Lipase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26289"
FT                   /db_xref="GOA:B7VRQ4"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26289.1"
FT                   /translation="MKSLKRYQYERYAVLCNLAYPRVFKQTRYGFDPNGQRIIKNQFGK
FT                   TMIRVLWSSDKDEVVVVIKGSHSISDWLLTFALWTRSCKKIGLNYRVHAGFYHLMFQES
FT                   QPSRNEDKLGHTVIERLEATLLPLLEQGKRISITGHSSGGAIGCVFADYLDQKYPGCVK
FT                   RIVTFGQPAIGDWNFRKHYRLSKKTYRICCDIDIVTFMPPVPLLYWHVGKVLWLYNGRI
FT                   YENTPTFIRLGRSVLSWLIRPFSYHLMSKYIRNKDFFDKH"
FT   gene            720204..720290
FT                   /locus_tag="VS_IIt0648"
FT   tRNA            720204..720290
FT                   /locus_tag="VS_IIt0648"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            720373..720446
FT                   /locus_tag="VS_IIt0649"
FT   tRNA            720373..720446
FT                   /locus_tag="VS_IIt0649"
FT                   /product="tRNA-Cys"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            720493..720568
FT                   /locus_tag="VS_IIt0650"
FT   tRNA            720493..720568
FT                   /locus_tag="VS_IIt0650"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            720649..720735
FT                   /locus_tag="VS_IIt0651"
FT   tRNA            720649..720735
FT                   /locus_tag="VS_IIt0651"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            720801..720874
FT                   /locus_tag="VS_IIt0652"
FT   tRNA            720801..720874
FT                   /locus_tag="VS_IIt0652"
FT                   /product="tRNA-Cys"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(720954..722141)
FT                   /locus_tag="VS_II0653"
FT   CDS_pept        complement(720954..722141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0653"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26291.1"
FT                   /translation="MKTLSLATLATAIFLIGCGSNQSKSLFNQANAAPSVVHGVTIEAV
FT                   PSQFAEYSQAGYNRYVAINAPNGESIHILIMDRLSDYQIVKAVNVLNHYLTPVDGTKYG
FT                   STDSKREIANAMANNGAILKLMNYYDEPRYNDDLPGQPLFEEEIQVEGGEWYVQQDYEE
FT                   HRDASYEEILHLVHDYGIGVFNAPEDAVTALPEFQKEFNAIQRQALHNAYTPPRDILEE
FT                   WQEEVSVDQEYFAAVIDSYYGLWGAYNGKGMWGLYQVKTRDDFSKEDPDAQAIVEQIFS
FT                   PTLTYDAYLADTFTGTFKMRYDPVTSYTHHSQYLTKLTLSGNNDANIEINQHDNRVTGN
FT                   AGVNTVIAHGPKSEYQIHDLGNGKFQLNDTVVSRDGLNVLSSIEKVQFTDQLWTF"
FT   gene            complement(722348..724360)
FT                   /locus_tag="VS_II0654"
FT   CDS_pept        complement(722348..724360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26293"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26293.1"
FT                   /translation="MSLDKSLHKVKHIYLTGNLSEQVLAAQILSRFQNTKYLIIERLAS
FT                   QNPDLVITSLECLALDNAAPIEPILNCYQYWDDSEIKLASLMAIENNQHSLLAVPVLLE
FT                   AVCDENDYWDGGWNDGDDISLIAARILDNHKHQLDHEQSLRLLHRLQNDPEPDLKGKLI
FT                   ALLSRHSPTLLNENNVLKSTADTRIFLRNTQDKVVLYKATQHPDICCQKVAFQRLSEMD
FT                   CREYLQVFLNGLSHSDPSIRKSSVHQLAKWNYLVDIKHLNFELLLSGMSLNSLTGLMSS
FT                   KDKLDVIDQLQEKPNVAYSTTTLLLLICSLESQHKQLQLNHFIPIFYQVFSKLEESEQL
FT                   DSLNHLLTETSEQLSVAFIRQQLQQEACSNSIKRLLIEHLSKNPKTSHQSYLKELTLGT
FT                   SGIIVAASSVKSRTATNIAPINEMISAEIIDANAQPALITSTLDALKQAHSPAISTVAS
FT                   TSTSVKKRSKRSAKIERLENQAIALEFCSNKTWLRSLCSDDKISHLTKAAFYAWIHALC
FT                   RHNIGFSDVQSSRFNQLTLELLLDEQSENIGDILDWLGDDWIQQNRLSLMSSPCLSLRV
FT                   GLIKHINDEQQLLELIKHSYIGIQHAALNQLALDGVCPHKKLIGLLLEEPLLYPQLANF
FT                   EAHTVYEILESEFDHRSSTTLQATLTYLETTSNHP"
FT   gene            complement(724446..724667)
FT                   /locus_tag="VS_II0655"
FT   CDS_pept        complement(724446..724667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26295"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26295.1"
FT                   /translation="MWQLEHDIESSPDKRVSKNSRLPSSAFAVFILIGGRAAYRVAEKR
FT                   AHTPTKLFSAMLIDIPSGLLSSTSIINT"
FT   gene            724495..725568
FT                   /locus_tag="VS_II0656"
FT   CDS_pept        724495..725568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0656"
FT                   /product="putative methylamine utilization protein mauG
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26297"
FT                   /db_xref="GOA:B7VRQ8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26297.1"
FT                   /translation="MSIALKSLVGVCALFSATLYAALPPISINTAKAELGKRLFFDTRL
FT                   SGDDSISCSSCHIPSNGFSYPEPLSPAYTGSDGFRNAPTLINTAYKEVWFHDGRIGTNL
FT                   NDVVRENITEDWLMNMDMRLMQERLKQDPIYVEMFKAANLGEPSNGGVRKALPEYLKTL
FT                   TSKNVPFDKGELSDLASQGEKLFTGKAGCSQCHSGALFSDGKAHNTGVPENHEIFLDPM
FT                   RHQSFLAYNMFMGVQDYLTLKRDVGAHVQTHKADGSDRGKFITPTLRELSQTAPYMHNG
FT                   MLATLEDVVEFYNQGGGEDSNKDSRLTTLSLTDYEKKALVAFLESLSGDALIGEEYEWL
FT                   DYDFGYEYTEDWSNARN"
FT   gene            725555..726721
FT                   /locus_tag="VS_II0657"
FT   CDS_pept        725555..726721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0657"
FT                   /product="Probable cytochrome-c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26299"
FT                   /db_xref="GOA:B7VRQ9"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26299.1"
FT                   /translation="MLVTKRSVLKAALFILIGMTGLPNVVNAKVQLEPLGEVPVPADNK
FT                   QTPEKIELGKILFYDGRLSGDTTSPCAGCHIQSQGWGFPDDLSMGYPGTVHWRNSQTII
FT                   NAAYYDKFFWAGSAMSLEAQAKDAAKGAVAGNGEDDIMEARLALVPEYVERFKRVFGDD
FT                   TPKIHNAWRAIAAFERTMIQRDTPIDNYLLGDKTALSESQLKGKALFEGKANCIACHNG
FT                   ALASDQKFYNIGVRPSPWWNDDGLAQITFRFELYSKGVTEEMYRTTKADPGAYFRAKRK
FT                   EMLGKFRTPSLRYTKYTAPYMHNGTIPTLEAVIDFYDRGGVADDGRTTGYPQTKSALIQ
FT                   PLGLTEQDKKNLLSFIEAFSGEQIFIEEPTIPEYQPLFTKEELAGAEK"
FT   gene            726718..727302
FT                   /locus_tag="VS_II0658"
FT   CDS_pept        726718..727302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0658"
FT                   /product="arsenite-oxidase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26300"
FT                   /db_xref="GOA:B7VRR0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26300.1"
FT                   /translation="MNANSEQNSSKRHNKCMMSRRDFLLYSGAATAVSMVPLTLFAGTD
FT                   SETQVEGRIVGYPRKKIAKLSQLSNHIPVHFQYPDEGKNSIAMLVKSDIECGGGIGLQR
FT                   DIVAYSMTCTHQGGPLTGAYKATGEHRIVGQCPFHLSTFDLRRHGIMVSGQAFESLPQV
FT                   LLELEGDDIYAVGVMGLIFGRMENLIDVEVS"
FT   gene            727303..730047
FT                   /locus_tag="VS_II0659"
FT   CDS_pept        727303..730047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0659"
FT                   /product="Arsenite oxidase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26302"
FT                   /db_xref="GOA:B7VRR1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR014066"
FT                   /db_xref="InterPro:IPR041632"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26302.1"
FT                   /translation="MTQLSFNDKLALNDQSALNSQYLQPTSTLLPPASAEVITTACDYC
FT                   IVACGYKVYRWPVSSPSGGPAASENAFGVDFPVHALQAWVSPQQHNIISHNGKPHHVVV
FT                   VADKDIQVVNKGGDSSVRGGLLARKLYNPETPTKDRLKQPLVRINGQLQPVEWDFALDI
FT                   AAQVGRHVIDTHGSNSYCVKTYSYQYIENTYAITKYALRHVNTANFSFHDTPSDVTATP
FT                   GFRDAGFDNFAPSYDDWGAADTLMICGTDPYETKTIIFTQFIMPAVHRGMKTVILNPRE
FT                   TAGIAWLKAQGGLHLDINPGSDNLVIGAIARVILEQGWQDNEWIENWVNNKWESSSGFG
FT                   QGTRNTPWQWRTTWGKFQTDGFDDYKQWNLGQKEYAPEYAASIAGIDVEKIHKAAEMLA
FT                   MPVNGQRVKASIGIEKGFYWSNNTGNTNAIASLATIIGTGGREGRVIGRFGGHQRGGLA
FT                   GGKLPRNKSPEKVAGRRRRSIDTDRYLYSGHTRMAHVIGTTWIQAMCGSYGLKEKFTDL
FT                   TTRNPHQAMRRDKQHIIDTLKKRADSGGMVVINQDIYLRDPIGKQFADIIFPAATWGEE
FT                   DFMRANGERRLRLYQKFADAPGQAKPDWWIVAQMASRMGYDGFDWQNSNDVAEESSRFS
FT                   RGSRKDFNMIKVAAHAEGKTLHQKLAEFGTEGIQGPVFYNYDTKKLIGTKRLHDTEMSW
FT                   DDLVDKGLQDGPQGANIMRKQLTQFNSQTGKVNLQKHPWDLFSDFHRWLTPKQDELWFS
FT                   NGRINEIWQSGFDDTERRPYITHRWPENWIEVHPEDADKRGIEAGDEILVYSERVANFK
FT                   DTILGVESDDFQFSNLMKNGHIQLDYAEIKAVAIVTSATKKGVLYCNMMDMKNPANALT
FT                   TRVVDQISGNYNYKMGVAKIKKIGESKYKREFEGFSFAPRNIV"
FT   gene            730057..730500
FT                   /locus_tag="VS_II0660"
FT   CDS_pept        730057..730500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26304"
FT                   /db_xref="GOA:B7VRR2"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26304.1"
FT                   /translation="MFGVLLVLHVLAATIWTGGHIILSVVILPKVLKHRSPEMLLEFEQ
FT                   GYEKVGMPALVVQVVTGLMLAYHMLPDVSLWFDMSIPLAHGIAAKLTLLSLTVLLALDA
FT                   RFRVIPKLSKDNLVDMALHIVPVTIISILFVVVGVSFRTGWLV"
FT   gene            complement(730674..731138)
FT                   /locus_tag="VS_II0661"
FT   CDS_pept        complement(730674..731138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0661"
FT                   /product="Azu1 pseudoazurin (blue copper protein)"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26306"
FT                   /db_xref="GOA:B7VRR3"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26306.1"
FT                   /translation="MNTMRLILLILSIIAAPAFAETKVIKQVMDMNSENIDKMYQFIPD
FT                   YVEIEPGDKVLFKGTVGSHTAHSIQGMLPDGAKPLMISGSNAQEVTFDKPGVYGIKCKV
FT                   HHRHGMVALVVVGDPSVNLEEARTAAKKRVSRRAQKKMQSLLDQAEQKVQ"
FT   gene            731582..732379
FT                   /locus_tag="VS_II0662"
FT   CDS_pept        731582..732379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0662"
FT                   /product="Hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26308"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26308.1"
FT                   /translation="MAHDSPNRTQPLGIEDARYQEATKDSFFPKWSIAYDAEARSGKGV
FT                   TPAITDAAVTRQNAIAAETEAANPQTANTNSLASSDATSNIMKTVSELFSSSSKKCFAS
FT                   SIIPDVDKTQSIPLREYGEVAVLTSGKSTDFKKRFSKMTPEQELKILSGTSLVDMTLSD
FT                   LGAWRITHNNEEVLPAWCLLFCASSMKAEHLINREEFNQLSDVNTELKLRLQNDESGKE
FT                   DLIAFSPFMVKSFLLFKQSQIQRVEVRLFKQRFQVALLLSGMV"
FT   gene            732547..733272
FT                   /locus_tag="VS_II0663"
FT   CDS_pept        732547..733272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26310"
FT                   /db_xref="GOA:B7VRR5"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26310.1"
FT                   /translation="MYLVLPKFKEESKIAINPKNMYWPPYNPLAKDGEKEINIEYTQDV
FT                   VKFAVLEPAEWTVFFDTFDKSKTVKDTVTGLYNARETAKSLGGLGVTILVKNIDGVDYV
FT                   ILKNYDKWSQTLLHGGVFKANNAQVIKLGLGALDSVKGMARFVKVSAPMEILVGSAINV
FT                   LQFIVNDAYTLEKLGVDEAKLFVHAFVVAGAALAIGAVIPITLGVSGTLMVLSVSNLIV
FT                   WGVDKVTDFEKKTIQFFIE"
FT   gene            733279..733680
FT                   /locus_tag="VS_II0664"
FT   CDS_pept        733279..733680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0664"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26311"
FT                   /db_xref="GOA:B7VRR6"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26311.1"
FT                   /translation="MSKIILRVVGSVLFALLGLWLGYQFYIEPLFFTPEHVLADPNYIM
FT                   SALFGGAIGFLLTLPVLWILKYAGKDRLAVKSFWFLPLMFSLLGGVANLTILETVIKLN
FT                   GFIQCPAELGYKQNLLRNYVTDVSLCKRL"
FT   gene            733589..733750
FT                   /locus_tag="VS_II0665"
FT   CDS_pept        733589..733750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26313"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26313.1"
FT                   /translation="MALFNAPLSSGINKTCYAIMLQMSRYARGSEVFRYSKHNKMIGLP
FT                   IPNPSIFK"
FT   gene            733844..734338
FT                   /locus_tag="VS_II0666"
FT   CDS_pept        733844..734338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0666"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26315"
FT                   /db_xref="GOA:B7VRR8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26315.1"
FT                   /translation="MQSNREMTPKQFSAYLCNLFPSLVVFEACASSNYWNQVATSLGHT
FT                   SKLISFRLVKAVRQNQKTDKNDALAIIQASQLPEVTFVSGKTNSQQQAQLMLKLREQAA
FT                   KQRTALKNQLIGLMREFNLPVSRSYQGFTQSIELILEDADNDLTDDFRHMLKVSLDLYL
FT                   V"
FT   gene            734620..734799
FT                   /locus_tag="VS_II0667"
FT   CDS_pept        734620..734799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0667"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26317"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26317.1"
FT                   /translation="MSVVQQVVKRDAKTKKEQWLQALVERRGKKCAAVALANKTVRTAF
FT                   AMLKSDTEYRASML"
FT   gene            735583..738141
FT                   /locus_tag="VS_II0668"
FT   CDS_pept        735583..738141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0668"
FT                   /product="Nitrite reductase [NAD(P)H] large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26319"
FT                   /db_xref="GOA:B7VRS0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26319.1"
FT                   /translation="MSKMKLVVIGNGMVGHRYIEDLVEKTDVANMDITVFCEEPRVAYD
FT                   RVHLSSYFSHHTADELSLVKEGFYEKHGINMLIGERAINVNREKKTVYSSTGREIQYDK
FT                   LVLATGSFPFVPPIKGHEGKDCFVYRTIEDLKAIEATAKNSKSGVVVGGGLLGLEAAGA
FT                   LKALGVTTHVVEFAPKLMAEQLDLAGGNQLRQKIERMGVNVHTSKNTLEIAPEGTEARN
FT                   VMRFADGTELETDFIVFSAGIRPQDKLARQMGLGIAPRGGIEINDHCQTTDKDIYAIGE
FT                   CASWNQTFYGLVAPGYKMATVAVDHVVGNESTFEGADMSAKLKLLGVKVGSIGDANGRT
FT                   PGCKSYVYQNEEQEIYKRLIVSEDNKKLLGAVMVGDTSDYGDLLQLMLNEIDLPEHPDA
FT                   LILPAHAGAEKPTLGADSLPESAVICSCFDVTKGKIAQAVAEGHHTIGDIKAVTGAGTG
FT                   CGGCIPLVTSVLNAELAKAGVEVKNDVCEHFAYSRQELFHLIRIEEIKTFDELLEKYGK
FT                   GYGCEVCKPLAGSILASCWGEHILKPELVKLHDTNDNFLGNIQKDGTYSVIPRMAGGEV
FT                   TPQALSVLADVAAEYNLYTKITGAQRIGLFGAQKDDLPAIWKKLVAAGYETGQAYAKAL
FT                   RMAKTCVGSTWCRYGVQDSVGLGVMIENRYKGIRTPHKMKFGVSGCTRECAEAQGKDLG
FT                   IIATDAGWNMYVCGNGGMKPRHADLLASDLDQETLIKYIDRFMMFYIRTAAPLQRTSVW
FT                   MDNLEGGVDYLREVIVDNKLGINDQLEADVAGLVGNFACEWTDTINDEAQLKRFSHFIN
FT                   ADDRDENVVFVDDGREQHRPATFTEKHPEAKGDILHVELV"
FT   gene            738157..738480
FT                   /locus_tag="VS_II0669"
FT   CDS_pept        738157..738480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0669"
FT                   /product="Nitrite reductase (NAD(P)H), small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26321"
FT                   /db_xref="GOA:B7VRS1"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26321.1"
FT                   /translation="MAFTKVCKIEDIIPGTGVCALVGGEQVAIFRPTKAEEVFAISNTD
FT                   PFFQSNVLSRGLTVEHKGELWVASPLKKQRFNLATGVCMEDESFSVKAYKARVTKGAVE
FT                   VSA"
FT   gene            738656..739471
FT                   /locus_tag="VS_II0670"
FT   CDS_pept        738656..739471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0670"
FT                   /product="putative formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26323"
FT                   /db_xref="GOA:B7VRS2"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26323.1"
FT                   /translation="MSTDFKPAEFVQTMIDVGEAKTKTSTRDLLIRSTMAGIILSLAVV
FT                   VAITTIVQTGIGIVGALVFPVGFVILSVMGYDLVTGVFGLAPLAKFDNRPGITWGRILR
FT                   CWGLVGLGNLIGSLIVAVLVAISLTGNFSLEPNAVAQKFIAVSTGRSLGFENMGMDGWI
FT                   TCFVRGIFCNLMVCLGVIGNMTARTVAGRVAMMWFPIFIFFALVFEHTVVNMFLFPLGM
FT                   ILGADFGIATWLNFNLIPTILGNIVGGLLLTCVPLYLTHAKTAPSLGAK"
FT   gene            739788..740564
FT                   /locus_tag="VS_II0671"
FT   CDS_pept        739788..740564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0671"
FT                   /product="Uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26325"
FT                   /db_xref="GOA:B7VRS3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26325.1"
FT                   /translation="MSEVSSSNVKEVSNGFVSLVGAGPGDPDLLTLKAARVIQQADVLV
FT                   YDRLVSKDILAMANPEAEMLYVGKKLDHHCVPQDQINQLLVTKAQENKHVVRLKGGDSF
FT                   IFGRGGEECETLAENDVRFEVIPGITAAAGATAYAGIPLTHRDHAQSVQFITGHLKKDG
FT                   EDIDWRSLAQHNHTIVFYMGLKESPNIQKNLLDNGMREDMPVAIIENGTRQEQKVFRGG
FT                   LRDLADLAGVAKSPALIVVGSVAQLHEKLAWFNKQA"
FT   gene            complement(740597..741193)
FT                   /locus_tag="VS_II0672"
FT   CDS_pept        complement(740597..741193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26327"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26327.1"
FT                   /translation="MQYRQIIRSCLGTDTIDSVLRRCCAAITNAAITKAAITKASGTNV
FT                   ISKPLNALITSTVMFMILSVNSLHAYPAYSHSKALPHRSVIYFAPTEDSIVKEFLNEVL
FT                   INNCQLDERDVVIMVIAESGYTVPAWLVEEFNLDAVTNSYGIPKGSHTAVLIGKDGKEK
FT                   HRWSGKTDWSLITNIIDEMPMRQQEMQRQSSRCSI"
FT   gene            741389..741862
FT                   /locus_tag="VS_II0673"
FT   CDS_pept        741389..741862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0673"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26328"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26328.1"
FT                   /translation="MENIAILVDVQNVYYTTRDKYRSNFDYNQFWYVATEGRNVVEANA
FT                   YAISSQDPKQRQFHHILRGVGFNVKLKPFIQRRDGSAKGDWDVGIALDAIELAETVDTI
FT                   VLVSGDGDFEILVERIKERFGKPVEVYGVPGLTAQNLIDSASKFVPIEKDFLL"
FT   gene            741943..742608
FT                   /locus_tag="VS_II0674"
FT   CDS_pept        741943..742608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0674"
FT                   /product="putative transcriptional regulator CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26330"
FT                   /db_xref="GOA:B7VRS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26330.1"
FT                   /translation="MSRVLVVDDDIQLCELLGEVLENEGYHVDTVHCGESALEFIQSNP
FT                   VDLVLLDVMLPNLSGIQVARRICQRFATPILMLTALNDDASMLDGYQAGADQYIAKPFN
FT                   VPELLTRIKVILRRVGFERQRQSMASSNQGLCEQLTRLPLTGTEKELLDYLIKNNGIVV
FT                   SKSDLQVHVLKKELCPFDRNLDMHISNIRRKLVQAGLSKQHIKTVRGQGYSYLESVGV"
FT   gene            742605..743990
FT                   /locus_tag="VS_II0675"
FT   CDS_pept        742605..743990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0675"
FT                   /product="Probable two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26332"
FT                   /db_xref="GOA:B7VRS7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031930"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038428"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26332.1"
FT                   /translation="MSNWFLRCPDFVIKRKDGLTFQLFSCLTVILVSILILQGVAERAL
FT                   MKALLKVPEPVKAEMLDLAYQANVLIEEGDMDELADWGNAQRYYLFIIDENNRPITHRH
FT                   MHPHFEFKLKYLRTLDHQLSDRVSKPIFGLPLDNGNTLVIQLPGQFHPAKSFAPYSYAL
FT                   KAVIALIVLSLFSIIMAKSLQQPLDRLREASRRLAQGDFSVSVVSELDSTTREFNELAN
FT                   DFDHMTFEIKSLAEKQRRLIRDVSHELRTPLARQNLALHLLRSKVDEKSMGLLERMESE
FT                   TEEMNKLVGEILEFSRLETSRYDSKLTPMHLEQYCSMLIVQMQNDLKPNQTLTGDLEAA
FT                   TSMVNVDERLLLRVISNLVGNAIKYAGGNADIVVKTYGQVNDKRYSVISVEDDGEGIPD
FT                   NKIADIFDPFTRIESARDKQSGGYGLGLAIVKEAMGVMNGHVTAENREGGGLRVNLMFP
FT                   IVD"
FT   gene            complement(744192..745496)
FT                   /locus_tag="VS_II0676"
FT   CDS_pept        complement(744192..745496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0676"
FT                   /product="Na+/H+-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26334"
FT                   /db_xref="GOA:B7VRS8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26334.1"
FT                   /translation="MNTKKPMSLTGRVILGMVVGILTGFAIQSLFADSGFVNNYIVNGL
FT                   FEVGGQIFVASLKMLVVPLVFVSLVCGTSSLKDLSTLGRMGGKTLALYIGTTAVAITLA
FT                   LTIGNLFQPGAGADLTAASSFKSADAPSLGQVIIDMFPTNPIQAMAEGKTLQVIVFAVL
FT                   FGIAISAAGKPGERIAAVFSDLNEVIMKLVALLMNLAPYGVFFLMAKLFSGLGLSAIWN
FT                   LAEYFLVLAGTLLLHGLVTYSAMLKGFTGLSPITFLRKMEDAIMFAFSTASSNATIPVT
FT                   METAKNRMGVDNKVASFTVPLGATVNMDGTAIMQGVATAFIAQAYNIDLTMGDYLMVIL
FT                   TATLASVGTAGVPGVGLVMLAMVLNQVGLPLEGIALIMGVDRLLDMIRTAVNITGDSAV
FT                   TIIVAKSEGSFDEARFNDPAAGEKEEEVKLARQQA"
FT   gene            746055..748184
FT                   /locus_tag="VS_II0677"
FT   CDS_pept        746055..748184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0677"
FT                   /product="Ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26336"
FT                   /db_xref="GOA:B7VRS9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /