(data stored in ACNUC27125 zone)

EMBL: FM992688

ID   FM992688; SV 1; linear; genomic DNA; STD; FUN; 3214061 BP.
XX
AC   FM992688;
XX
PR   Project:PRJEA34697;
XX
DT   16-FEB-2009 (Rel. 99, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Candida dubliniensis CD36 chromosome 1, complete sequence
XX
KW   complete genome.
XX
OS   Candida dubliniensis CD36
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Debaryomycetaceae; Candida/Lodderomyces clade; Candida.
XX
RN   [1]
RP   1-3214061
RA   Gamble J.A.;
RT   ;
RL   Submitted (19-JAN-2009) to the INSDC.
RL   Gamble J.A., Pathogen Sequencing Unit, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1101/gr.097501.109.
RX   PUBMED; 19745113.
RA   Jackson A.P., Gamble J.A., Yeomans T., Moran G.P., Saunders D., Harris D.,
RA   Aslett M., Barrell J.F., Butler G., Citiulo F., Coleman D.C.,
RA   de Groot P.W., Goodwin T.J., Quail M.A., McQuillan J., Munro C.A., Pain A.,
RA   Poulter R.T., Rajandream M.A., Renauld H., Spiering M.J., Tivey A.,
RA   Gow N.A., Barrell B., Sullivan D.J., Berriman M.;
RT   "Comparative genomics of the fungal pathogens Candida dubliniensis and
RT   Candida albicans";
RL   Genome Res. 19(12):2231-2244(2009).
XX
DR   MD5; 885554fe3372edc90efe43e582339ba6.
DR   BioSample; SAMEA2272258.
DR   EnsemblGenomes-Gn; CD36_00010.
DR   EnsemblGenomes-Gn; CD36_00230.
DR   EnsemblGenomes-Gn; CD36_01135.
DR   EnsemblGenomes-Gn; CD36_01600.
DR   EnsemblGenomes-Gn; CD36_01650.
DR   EnsemblGenomes-Gn; CD36_02405.
DR   EnsemblGenomes-Gn; CD36_03620.
DR   EnsemblGenomes-Gn; CD36_04005.
DR   EnsemblGenomes-Gn; CD36_04820.
DR   EnsemblGenomes-Gn; CD36_04885.
DR   EnsemblGenomes-Gn; CD36_05490.
DR   EnsemblGenomes-Gn; CD36_05630.
DR   EnsemblGenomes-Gn; CD36_05805.
DR   EnsemblGenomes-Gn; CD36_05860.
DR   EnsemblGenomes-Gn; CD36_06975.
DR   EnsemblGenomes-Gn; CD36_07240.
DR   EnsemblGenomes-Gn; CD36_07280.
DR   EnsemblGenomes-Gn; CD36_07580.
DR   EnsemblGenomes-Gn; CD36_07800.
DR   EnsemblGenomes-Gn; CD36_08745.
DR   EnsemblGenomes-Gn; CD36_08875.
DR   EnsemblGenomes-Gn; CD36_09765.
DR   EnsemblGenomes-Gn; CD36_10970.
DR   EnsemblGenomes-Gn; CD36_11255.
DR   EnsemblGenomes-Gn; CD36_11535.
DR   EnsemblGenomes-Gn; CD36_12155.
DR   EnsemblGenomes-Gn; CD36_12190.
DR   EnsemblGenomes-Gn; CD36_13335.
DR   EnsemblGenomes-Gn; CD36_13430.
DR   EnsemblGenomes-Gn; CD36_tRNA_0001.
DR   EnsemblGenomes-Gn; CD36_tRNA_0002.
DR   EnsemblGenomes-Gn; CD36_tRNA_0003.
DR   EnsemblGenomes-Gn; CD36_tRNA_0004.
DR   EnsemblGenomes-Gn; CD36_tRNA_0005.
DR   EnsemblGenomes-Gn; CD36_tRNA_0006.
DR   EnsemblGenomes-Gn; CD36_tRNA_0007.
DR   EnsemblGenomes-Gn; CD36_tRNA_0008.
DR   EnsemblGenomes-Gn; CD36_tRNA_0009.
DR   EnsemblGenomes-Gn; CD36_tRNA_0010.
DR   EnsemblGenomes-Gn; CD36_tRNA_0011.
DR   EnsemblGenomes-Gn; CD36_tRNA_0012.
DR   EnsemblGenomes-Gn; CD36_tRNA_0013.
DR   EnsemblGenomes-Gn; CD36_tRNA_0014.
DR   EnsemblGenomes-Gn; CD36_tRNA_0015.
DR   EnsemblGenomes-Gn; CD36_tRNA_0016.
DR   EnsemblGenomes-Gn; CD36_tRNA_0017.
DR   EnsemblGenomes-Gn; CD36_tRNA_0018.
DR   EnsemblGenomes-Gn; CD36_tRNA_0019.
DR   EnsemblGenomes-Gn; ENSRNA049499805.
DR   EnsemblGenomes-Gn; ENSRNA049499831.
DR   EnsemblGenomes-Gn; ENSRNA049499873.
DR   EnsemblGenomes-Gn; ENSRNA049499903.
DR   EnsemblGenomes-Gn; ENSRNA049499925.
DR   EnsemblGenomes-Gn; ENSRNA049499945.
DR   EnsemblGenomes-Gn; ENSRNA049499961.
DR   EnsemblGenomes-Gn; ENSRNA049535660.
DR   EnsemblGenomes-Gn; ENSRNA049535687.
DR   EnsemblGenomes-Gn; ENSRNA049535719.
DR   EnsemblGenomes-Gn; ENSRNA049535748.
DR   EnsemblGenomes-Gn; ENSRNA049535765.
DR   EnsemblGenomes-Gn; ENSRNA049535781.
DR   EnsemblGenomes-Gn; ENSRNA049535797.
DR   EnsemblGenomes-Gn; ENSRNA049535810.
DR   EnsemblGenomes-Gn; ENSRNA049535823.
DR   EnsemblGenomes-Gn; ENSRNA049535842.
DR   EnsemblGenomes-Gn; ENSRNA049535862.
DR   EnsemblGenomes-Gn; ENSRNA049535880.
DR   EnsemblGenomes-Gn; ENSRNA049535929.
DR   EnsemblGenomes-Gn; ENSRNA049535946.
DR   EnsemblGenomes-Gn; ENSRNA049535960.
DR   EnsemblGenomes-Gn; ENSRNA049535982.
DR   EnsemblGenomes-Gn; ENSRNA049536005.
DR   EnsemblGenomes-Gn; ENSRNA049536029.
DR   EnsemblGenomes-Gn; ENSRNA049536056.
DR   EnsemblGenomes-Gn; ENSRNA049536079.
DR   EnsemblGenomes-Gn; ENSRNA049536097.
DR   EnsemblGenomes-Gn; ENSRNA049536151.
DR   EnsemblGenomes-Gn; ENSRNA049536168.
DR   EnsemblGenomes-Tr; CD36_00010.
DR   EnsemblGenomes-Tr; CD36_00230.
DR   EnsemblGenomes-Tr; CD36_01135.
DR   EnsemblGenomes-Tr; CD36_01600.
DR   EnsemblGenomes-Tr; CD36_01650.
DR   EnsemblGenomes-Tr; CD36_02405.
DR   EnsemblGenomes-Tr; CD36_03620.
DR   EnsemblGenomes-Tr; CD36_04005.
DR   EnsemblGenomes-Tr; CD36_04820.
DR   EnsemblGenomes-Tr; CD36_04885.
DR   EnsemblGenomes-Tr; CD36_05490.
DR   EnsemblGenomes-Tr; CD36_05630.
DR   EnsemblGenomes-Tr; CD36_05805.
DR   EnsemblGenomes-Tr; CD36_05860.
DR   EnsemblGenomes-Tr; CD36_06975.
DR   EnsemblGenomes-Tr; CD36_07240.
DR   EnsemblGenomes-Tr; CD36_07280.
DR   EnsemblGenomes-Tr; CD36_07580.
DR   EnsemblGenomes-Tr; CD36_07800.
DR   EnsemblGenomes-Tr; CD36_08745.
DR   EnsemblGenomes-Tr; CD36_08875.
DR   EnsemblGenomes-Tr; CD36_09765.
DR   EnsemblGenomes-Tr; CD36_10970.
DR   EnsemblGenomes-Tr; CD36_11255.
DR   EnsemblGenomes-Tr; CD36_11535.
DR   EnsemblGenomes-Tr; CD36_12155.
DR   EnsemblGenomes-Tr; CD36_12190.
DR   EnsemblGenomes-Tr; CD36_13335.
DR   EnsemblGenomes-Tr; CD36_13430.
DR   EnsemblGenomes-Tr; CD36_tRNA_0001-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0002-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0003-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0004-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0005-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0006-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0007-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0008-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0009-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0010-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0011-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0012-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0013-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0014-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0015-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0016-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0017-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0018-1.
DR   EnsemblGenomes-Tr; CD36_tRNA_0019-1.
DR   EnsemblGenomes-Tr; EFT00001981803.
DR   EnsemblGenomes-Tr; EFT00001981804.
DR   EnsemblGenomes-Tr; EFT00001981805.
DR   EnsemblGenomes-Tr; EFT00001981806.
DR   EnsemblGenomes-Tr; EFT00001981807.
DR   EnsemblGenomes-Tr; EFT00001981808.
DR   EnsemblGenomes-Tr; EFT00001981809.
DR   EnsemblGenomes-Tr; EFT00001981810.
DR   EnsemblGenomes-Tr; EFT00001981811.
DR   EnsemblGenomes-Tr; EFT00001981812.
DR   EnsemblGenomes-Tr; EFT00001981813.
DR   EnsemblGenomes-Tr; EFT00001981814.
DR   EnsemblGenomes-Tr; EFT00001981815.
DR   EnsemblGenomes-Tr; EFT00001981816.
DR   EnsemblGenomes-Tr; EFT00001981817.
DR   EnsemblGenomes-Tr; EFT00001981818.
DR   EnsemblGenomes-Tr; EFT00001981819.
DR   EnsemblGenomes-Tr; EFT00001981820.
DR   EnsemblGenomes-Tr; EFT00001981821.
DR   EnsemblGenomes-Tr; EFT00001981822.
DR   EnsemblGenomes-Tr; EFT00001981823.
DR   EnsemblGenomes-Tr; EFT00001981824.
DR   EnsemblGenomes-Tr; EFT00001981825.
DR   EnsemblGenomes-Tr; EFT00001981826.
DR   EnsemblGenomes-Tr; EFT00001981827.
DR   EnsemblGenomes-Tr; EFT00001981828.
DR   EnsemblGenomes-Tr; EFT00001981829.
DR   EnsemblGenomes-Tr; EFT00001981830.
DR   EnsemblGenomes-Tr; EFT00001981831.
DR   EnsemblGenomes-Tr; EFT00001981832.
DR   EnsemblGenomes-Tr; EFT00001981833.
DR   EuropePMC; PMC2792176; 19745113.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF00530; snoMe28S-Cm2645.
DR   RFAM; RF01177; snR67.
DR   RFAM; RF01214; snR51.
DR   RFAM; RF01218; snR41.
DR   RFAM; RF01248; snR8.
DR   RFAM; RF01252; snR5.
DR   RFAM; RF01256; snR43.
DR   RFAM; RF01258; snR10.
DR   RFAM; RF01262; snR44.
DR   RFAM; RF01265; snR42.
DR   RFAM; RF01846; Fungi_U3.
DR   StrainInfo; 496420; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3214061
FT                   /organism="Candida dubliniensis CD36"
FT                   /chromosome="1"
FT                   /strain="CD36"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:573826"
FT   CDS_pept        complement(join(5827..6128,6109..6666,6638..9718))
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_00010"
FT                   /product="subtelomeric Y'-related helicase, pseudogene,
FT                   putative"
FT                   /product="DNA binding protein, pseudogene, putative"
FT                   /product="DNA helicase, pseudogene, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to C. albicans YRF1, (HPR5)"
FT                   /note="sequence rearrangement"
FT                   /inference="similar to AA sequence:UniProt:Q59KM5"
FT   CDS_pept        12543..13448
FT                   /transl_table=12
FT                   /locus_tag="CD36_00030"
FT                   /product="non-LTR Zorro retrotransposon orf1-like protein,
FT                   putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44265"
FT                   /db_xref="GOA:B9W6G2"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G2"
FT                   /inference="similar to AA sequence:UniProt:Q59KP9"
FT                   /inference="similar to AA sequence:UniProt:Q5AJW0"
FT                   /inference="similar to AA sequence:UniProt:Q5A442"
FT                   /protein_id="CAX44265.1"
FT                   /translation="MDNSFQIQVDDKVEHMYVASFRLPSISLRSCVQYFREFLDPKDEI
FT                   VHARIPVFSHEVMSMNPGYVNAYFILKLKGDKVPPKRKVILERNYSVRILTNLSHCAYC
FT                   HSKSHTRLQCPEAGECNICGKLGHRALNCESRKRRSPAAVPMNGPVKILTKPSVETSQK
FT                   VSGDGQSKEHNDSAPSGFVDTIFDSDGKEIFHIDPNKSWTFHISQLRLKKTVPSNYLVA
FT                   PSEPVAWKRYKDGSILVDVVAIVGHRKVGRGFRLAARHAPTTTHPDGEIVEYIASALSR
FT                   TAPDLVKTYVSAHGLPVTLN"
FT   mobile_element  12547..13148
FT                   /mobile_element_type="LINE:1A, Zorro4"
FT                   /note="partial ORF1 (subtelomeric)"
FT   mobile_element  13149..13702
FT                   /mobile_element_type="retrotransposon:huia C, partial
FT                   Tcd16, LTR"
FT                   /note="subtelomeric"
FT   CDS_pept        join(<13701..14084,14069..14638)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00040"
FT                   /product="polyprotein (fragment), putative"
FT                   /note="transposable element"
FT                   /note="Similar to Debaryomyces hansenii polyprotein Q8TFJ9"
FT                   /note="incomplete ORF; probable pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44266"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="InterPro:IPR039537"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G3"
FT                   /inference="similar to AA sequence:UniProt:Q8TFJ9"
FT                   /protein_id="CAX44266.1"
FT                   /translation="HVLIKNGFERVTAELGIYIKENVYLGLYVDEILIASDSIVEMNNV
FT                   KEMLHKNFKMRDLHSPERFLGLNIKQTDESIIITLHDYIQKMLKDCDMLDANSVNSPAD
FT                   KKDDLEKIDLSPVYAKLTHSKNIIPEEHHMKAAKRVLRYLKGTSKFGITYNNTDGIPAF
FT                   TDSDWGNSIEDRRSISGYLIKLGGGAISWRVKKQPTVALSSTEAEYLGMTEIVKEIMWL
FT                   LQVLEKTDVEVELPLIIYADNQSAIALGKHPVQHARTKHIDIRHHFIREKENAGLIKFV
FT                   YISTHKMEADLLTKVLSSTVFKRLRDMTGLKYQELH"
FT   mobile_element  13703..15131
FT                   /mobile_element_type="retrotransposon:zeta D, Tcd7, LTR"
FT                   /note="RT/RH ORF region, PPT + right LTR (subtelomeric)"
FT   mobile_element  15163..20699
FT                   /mobile_element_type="retrotransposon:solo LTR, vau D"
FT                   /note="truncated (subtelomeric)"
FT   mobile_element  15365..20691
FT                   /mobile_element_type="retrotransposon:san B, Tcd4, LTR"
FT                   /note="subtelomeric"
FT   CDS_pept        15930..16871
FT                   /transl_table=12
FT                   /locus_tag="CD36_00050"
FT                   /product="retroposon Tca gag protein, putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44267"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G4"
FT                   /inference="similar to AA sequence:UniProt:Q5AG25"
FT                   /inference="similar to AA sequence:UniProt:Q59SL7"
FT                   /protein_id="CAX44267.1"
FT                   /translation="MAGFSDDDLRQMMGTLSILVADSKREIGQLHEKLEHNGETKYQSL
FT                   ETYINSKYTTTIKSFEKLKYLDIDDPELVNSWIICFNQVKRLHPQVFDAFMNAKSEDEI
FT                   GIEKLQYTPYTGKQLNDMMRIFYMRISELIERKVDPNVSREIDNGETKFAPNLFKKVYE
FT                   MIISKPDVSAAERIGHALFKLQSKSRELERDSTYLLCQHLQTQEHQHDDLIYKFLIGGV
FT                   SPWYLHSQIYLSSYKLGTSNLFLEVYARHYELYKADPNYKLPDIMTLLNEIRSNRDYSK
FT                   VVNAAKKGSTSQECFREEQQKVTPSLLDQLVD"
FT   CDS_pept        16899..20288
FT                   /transl_table=12
FT                   /locus_tag="CD36_00060"
FT                   /product="retroposon polyprotein, putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44268"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="InterPro:IPR039537"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G5"
FT                   /inference="similar to AA sequence:UniProt:Q5AG24"
FT                   /inference="similar to AA sequence:UniProt:Q5AH82"
FT                   /protein_id="CAX44268.1"
FT                   /translation="MSHMSESNSITYDDTFLSPLDNPNIHTTIHERREDIEHVINENRP
FT                   NATFENHVEPPRTISSSGIIDHTNFRHRADPTWQVIPDAVNHHITTTVQTPDHGVSETM
FT                   ITTPHQLPRSGEGNYPGQQVRTEEIGNSRDRGPINLNTTIDLGVNDESYDNHDTLTNKH
FT                   DSQNSEMITPPSFPNTELEYQHDISSGEMSLLQTNIEADNELNTNEVRLNETMKENNFT
FT                   QQEQFHGKLSDETETEEESSTDEESSEENNQTGINKQFPRQEERIVERVQSENDTQVTQ
FT                   NEEPINNETQSGNKQRMPWYENGNDENLSEDGKYTSHELRMGTFENNGKRKNYPNHNES
FT                   NMETYISSETIMEPKNTEERESHESDNNQSDSHVNQKRLEDDAQMVNYPSTSQRKAKFL
FT                   SPDFNQTHDEIEQFMADINEESLEEYDGISSLENVLADSEDTLDKELEINEDSGRIESI
FT                   ADRVRKRRGIEGAPFDKYLKKDDKSFGSIKSQKKSNAQLDDELGTPVSTLRGIPFRLRD
FT                   GRSSFFPPYKTKFGRNVHPPKRYLNAIVKKIDYNSKEWRQSMKEEIDKFKANNVYTIAK
FT                   TPKDVVPLRTMWVHTYKTNDMKKHHYKSRCVVLGNHMVEHRDYNPFAISSPVVDLTSIR
FT                   LLTIIAVEHNLCIHQLDIASAYLNAHLENGRNLYVQPPRGFELEPGYCWSLNKSVYGLK
FT                   QSAHNWYDHFKTVLLLNGLKQTLHNDGIFWKNCENDGVLYVSVYVDDVFMIGSTDEIIK
FT                   EFVTMLEKYFHLQYFGEATEYLGIQFKRTPDGYTLDQIPFLEKLISTFNIQDSYGKDVP
FT                   IIPKDVNVVKKLRKSNQINDFIKLEKPQRMINSLSKTKYIDDYEMSNRHDFKTSPQAEP
FT                   LSAKGKKLYQSAVGSLLWATLNTRPDLSFSVNRLGSQCANPNVDDWKRLMYCLRYIKKN
FT                   MDLKLEYKRGRLNKNSKDFTIECFSDASFAPDLDRKSITGTSIFINGNLVNWATKKQKI
FT                   ITHSSAACEMLALNYTILKAFELRNTIEDLDLKVRNVHVHEDNQAVITILKNDNFHPHR
FT                   PIDICYKYLRQKLKDGYFSISYVESRDNLADSFTKALGRNQLIEHTKRIKERKDYNDNA
FT                   TSIVDVRTLDEIKINQKLEHHD"
FT   mobile_element  21573..21965
FT                   /mobile_element_type="LINE:1G, Zorro1-like"
FT                   /note="partial ORF2 (subtelomeric)"
FT   CDS_pept        23946..25499
FT                   /transl_table=12
FT                   /locus_tag="CD36_00070"
FT                   /product="transcriptional repressor TUP1-homologue,
FT                   putative"
FT                   /note="Similar to C. albicans TUP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44269"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G6"
FT                   /inference="similar to AA sequence:UniProt:P56093"
FT                   /protein_id="CAX44269.1"
FT                   /translation="MSIYTQRSQHQQRLTELLDAIKTEFDYASSEASSFKKVQEDYDNK
FT                   YQQQTAEMQQIRQTVYELEMAHRKIKEAYEEEILRLKNELDTRDRQMKNGFQHQVTQPP
FT                   PPVAPVAQPPSVAPVSAVVAPPPAPPVPAAPALSIIDKSQYIVNPAQKANHVKEIPPFL
FT                   QDLDIAKANPEFKKQHLEYYVLYNPAFSKDLDIDMVHSLDHSSVVCCVRFSRDGKFIAT
FT                   GCNKTTQVFNVTTGELVAKLIDESSNENKDDSAPASGDLYIRSVCFSPDGNLLATGAED
FT                   KLIRIWDLSTKRIIKILRGHEQDIYSLDFFPDGDRLVSGSGDRSVRIWDLRSSQCSLTL
FT                   SIEDGVTTVAVSPDGKLIAAGSLDRTVRVWDSTTGFLVERLDSGNENGNGHEDSVYSVA
FT                   FSNNGEQIASGSLDRTVKLWHLEGKTDKKSTCDVTYIGHKDFVLSVCCTPDNEYILSGS
FT                   KDRGVIFWDQASGNPLLMLQGHRNSVISVAVSLNSSGTEGIFATGSGDCKARIWKWSKK
FT                   "
FT   CDS_pept        join(25574..25612,25664..26728)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00080"
FT                   /product="diphosphomevalonate decarboxylase, putative"
FT                   /product="mevalonate pyrophosphate decarboxylase, putative"
FT                   /product="mevalonate-5-diphosphate decarboxylase, putative"
FT                   /EC_number="4.1.1.33"
FT                   /note="Similar to S. cerevisiae ERG19 (MPD, MVD1)"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44270"
FT                   /db_xref="GOA:B9W6G7"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G7"
FT                   /protein_id="CAX44270.1"
FT                   /translation="MYSASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTL
FT                   TTASASPSFEKDQLWLNGKLESLDTPRTQACLADLRNLRASIETPDSPKLSQMKLHIVS
FT                   ENNFPTAAGLASSAAGFAALVTAIAKLYQLPQDMSELSKIARKGSGSACRSLFGGFVAW
FT                   EMGTSNDGEDSKAVEIAPLDHWPTLKAVILVVSDDKKDTPSTTGMQATVESSDLFAHRI
FT                   SQVVPRRFDQMKSAILAKDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKQIIKLA
FT                   EEINRDGVICAYTFDAGPNAVIYYDESNQDKVLAHLYKHFGHVPGWKTHYKAETQTTGV
FT                   SRIIQTSIGYGPQQTNISLINDKGLPK"
FT   CDS_pept        complement(26721..27413)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44271"
FT                   /db_xref="GOA:B9W6G8"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G8"
FT                   /inference="similar to AA sequence:UniProt:Q6BY11"
FT                   /protein_id="CAX44271.1"
FT                   /translation="MNFQAPFEQPLFDQAIIRGETGEYIEEDRTKNAGVAFHNPFDVNS
FT                   YPITNPPIFDSTMTVPYTTDGVPRRRRISISNGQIGQIVSHEAYFAEDSSLDVPPEFES
FT                   RPQTSVIESVVEPPAMPTEIAGVPPPNHQLIYNNEVIYNPENGPIPGTAAWKKERLLER
FT                   NRIAASKCRQRKKQEQVQLQNNIAKMEKELKKKDARIDELEYTVELLKASIKSCIEDGN
FT                   TERLKQFI"
FT   CDS_pept        27505..27960
FT                   /transl_table=12
FT                   /locus_tag="CD36_00100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44272"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G9"
FT                   /inference="similar to AA sequence:UniProt:Q6BY10"
FT                   /inference="similar to AA sequence:UniProt:O94611"
FT                   /protein_id="CAX44272.1"
FT                   /translation="MPLEDQLVHQLSEHLRTHSDDFTAITSFNESISHTPYQFDFIVEN
FT                   ERGIKLFGIPLFSHKSLWPIIDPSHYQTITNHHLSIPISLENYPLPDFNWEWVWSHWYV
FT                   FMYNDIDPHGWMYSTVFFQCKKWKGKYYFGNTVRQRVWLRLRRKCYP"
FT   CDS_pept        complement(28474..29160)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00110"
FT                   /product="cardiolipin synthetase, putative"
FT                   /EC_number="2.7.8.-"
FT                   /note="Similar to S. cerevisiae CRD1 (CLS1)"
FT                   /note="Similar to C. albicans CRD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44273"
FT                   /db_xref="GOA:B9W6H0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H0"
FT                   /inference="similar to AA sequence:UniProt:Q07560"
FT                   /protein_id="CAX44273.1"
FT                   /translation="MFSMIRLHPGIKLIRPGISSGAFHFSTRAIRSSLWTIPNVLTYTR
FT                   IVATPFIGYYITTGHSTAALSLFTYSCVTDFVDGYIARKYNMKSIVGSIVDPLADKFLM
FT                   TVCTLSLGYVHAIPPVIASIIIGRDVMLSFMSFYYRYKSLPAPKTFDKFISIGQIPTIS
FT                   VHPNMLGKLNTALQMVYIGSLVYRPILEGVVSAGVYDGMGMVVGATTLLSGANYLFSKS
FT                   SWRYVR"
FT   CDS_pept        29238..30860
FT                   /transl_table=12
FT                   /locus_tag="CD36_00120"
FT                   /product="cytosolic chaperonin t-complex protein 1 subunit
FT                   theta, putative"
FT                   /note="Similar to C. albicans CCT8"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44274"
FT                   /db_xref="GOA:B9W6H1"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H1"
FT                   /inference="similar to AA sequence:UniProt:P47828"
FT                   /protein_id="CAX44274.1"
FT                   /translation="MSLKLPQAPNSGLFKQGYSSFSNADGAIIRNVEAVREIASILLTS
FT                   MGPSGRNKIIVNKLGKKFITNDAATMLNELEIVHPVVKILIQASKQQEFEMGDNTNLVI
FT                   ILAGEFLNVAEKLLTLGLNVSEIIQGFNLANKFVMKTLDELVVEKVESFETDLLKAVKP
FT                   VIAAKQYGVEDTIAKLVVDAVKLVMKNGSFNVDNIRVVKVMGASLSQSQVVKGMVFPRE
FT                   PEGTIKNTSKSKVVVFTNPIDISTTETKGTVLLHNAQEMLDFTKGEEQQLDQLCKEIHD
FT                   SGVRVVVAGSSVGELALHYLNKYGILVLRVPSKFDLRRICQVCGATPLPRLGAPTPDEM
FT                   GEIDIIETKEIGGDRVTIFRQDESSSRTATIVVRGATQNNLDDIERAIDDGVNSIKGLI
FT                   KDNRLLPGAGAVEIELMKRITAYGESTPGLLQLAIKSFAKAFEVIPRVLAETSGHDSSE
FT                   ILSKLHAAHATDAGLTAGIDIDSGEVSDTGVLDILSTKKSAIDLAVDATNTILSIDQII
FT                   MAKRAGGPVMPQQPRPGNWDQDD"
FT   CDS_pept        complement(30857..31525)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00130"
FT                   /product="n-(5'-phosphoribosyl)anthranilate isomerase,
FT                   putative"
FT                   /EC_number="5.3.1.24"
FT                   /note="Similar to C. albicans TRP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44275"
FT                   /db_xref="GOA:B9W6H2"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H2"
FT                   /inference="similar to AA sequence:UniProt:P43073"
FT                   /protein_id="CAX44275.1"
FT                   /translation="MKVVKICGIKSVEAAKVAIDNGANLLGCILVPNRARTIDHEVAKQ
FT                   ISQMMGHRKPPKFDASTPTEHFELVSQWIVENGPFLVGVFRNQPREEVFRIARELGLDF
FT                   IQLHGSEDKLEFVNSEFGIIPRYVVPDEMDLLGEQAPSLMQCVSLPLLDSEAGGEGKVL
FT                   DWTFIERLPTKALLAGGLTPENIPTFQTILGYDVSGGVETNGVKDSSKIIKFIQNGHAA
FT                   "
FT   CDS_pept        complement(31531..33645)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44276"
FT                   /db_xref="GOA:B9W6H3"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H3"
FT                   /inference="similar to AA sequence:UniProt:Q6BY14"
FT                   /protein_id="CAX44276.1"
FT                   /translation="MDSPTYDPTIHLNKIFSSPDTLDELPQLLNHVSEYKRQLTGEINK
FT                   CMGRYEEVDLKDDILNLTTTIGDIKRESTSTKQTISQMTSSIQRLDCTKKNLVVSMTLL
FT                   KRLQMLVNVNNKLSSILPSRNYKEIYSLLGVIKELLQFFQPYKSIDEINQINLMVVHTQ
FT                   NKLIDDIFIDFEEYKSKDEEQLLYGARILELIDIKYKDKLLAWFYNLQLQDLKEIFSGE
FT                   AGSLDNLNRRFIYFKNILKQVQQYKIFPWDVSDAITQEFCKITRQDISKLLYNSKIESK
FT                   TLLDNLTKTLEFEKSLNLHNEISSVFEPYLSIWVHEQDKYLNSKMLEFSAVSQLPPELE
FT                   DLGANVPNIAVSSTELFKIFNRLLSHITKLTNGETIVDLARVFNKYLLEYNRRVLLPIL
FT                   ATDDYSVESLKYFTMLLNTGDYIINNIEELAEKTQKMTKHTIAQFNTDAFYQLINKSIS
FT                   SLLLKMSIDYKPCWREFFNLDWGQLDSVNDISSYMNDLKGKTSDNLKVILPLIIRDSYV
FT                   RNFNDKLVELLVTTIANNLKFVKPMTATSVEQILMDVSSLKESALKFPLYSIKEVSKSY
FT                   QKFVNSHFRELESLLKLLMVPVVPVENVIESYFALIGDKSISNFVKVLNLKRIDKAQQY
FT                   KYVDNFKLQLSVDDGSVTSCGLLQNLEDEEEVSRAATPDVRLNEKFETHVSKINENFKN
FT                   FGKFFRKDDT"
FT   CDS_pept        34077..37121
FT                   /transl_table=12
FT                   /locus_tag="CD36_00150"
FT                   /product="cell fusion/morphology, Kelch domain-containing
FT                   protein, putative"
FT                   /note="In S. cerevisiae: functions in a complex to
FT                   negatively regulate mitotic exit and localizes to regions
FT                   of polarized growth"
FT                   /note="Similar to S. cerevisiae KEL2"
FT                   /note="Similar to C. albicans KEL2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44277"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H4"
FT                   /inference="similar to AA sequence:UniProt:P50090"
FT                   /protein_id="CAX44277.1"
FT                   /translation="MARFKLGGKLKKKDHQSDADTTVSSSSSTNSANRKSISRFSNILH
FT                   HNQKTMPSISTQPTHTSRPPPHANLSVTNPWNRFKLFDSPFPRYRHAAASIASEKNELF
FT                   LMGGLKDGSVFGDTWKIVPQINHEGDIINYVAENIEVVNNNNPPARVGHAAVLCGNAFI
FT                   VYGGDTVDTDTNGFPDNNFYLFNINNHKYTIPSHILNKPNGRYGHTIGVISLNNTSSRL
FT                   YLFGGQLENDVFNDLYYFELNSFKSPKATWQLVEPVNDFKPPPLTNHSMSVYKNKVYVF
FT                   GGVYNNEKVSNDLWVFDAANDTWTQVTTTGDIPPPVNEHSSCVVDDRMYVYGGNDFQGI
FT                   IYSSLYVLDLHTLEWSVLQSSAEKNGPGPRCGHSMTLLPRFNKILIMGGDKNDYVDSDP
FT                   HNFETYESFNGEEVGTMVYELDLNIVDHFLGAPTIIPPVVSYEEELTRPKKAAASARND
FT                   VQGYDRHARSFSGGPEDFATPQASARGSPSPERTQGGDDNFVEVDLPSTTISQVDEDAP
FT                   YDTTSLNQHPLPEQEVANGHVEDEPFRRRSLDPRYDDNSGGVPVPEPVAVAATEPVAEP
FT                   VPHAEPVAEAAPRQDGKVKQIISELTNELVSLKATTKEQMQKATEKIEQLERQNSLLHQ
FT                   SQQRDAESYTKQIEEKDVLINELKSSLDPSAWDPEQPQTATNISELNRYKLERLELNNK
FT                   LLYLEQENLKLKDQFAEFEPFMDHQIGELDKFQKVIKVQEEQIDKLTNQVKDQEALHKE
FT                   IYDWKSKFESLSLEFENYKAIHNDDDLSDGEVELQDDDRSILSSAKSRKDISSQLGNLV
FT                   SLWNQKHSSSSSRDLSAPPPVIRPESHPVVAKLQSQVDDLLKIGKQNEETFSHEIESLR
FT                   KELQEKVATLKTVEENYRESIQSVNNTSKALKLNQEELSSQRILMERLVKENNELKLYK
FT                   KASSKKLGSRDGTPVVNEYQQSEASPGLDELNNEDDDEDVISTAHYNMKIKDLEADLYI
FT                   LKQERDQLKDNVTSLQKQLYLAQNQ"
FT   CDS_pept        complement(37183..39114)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00160"
FT                   /product="pH-response regulator protein, putative"
FT                   /note="Similar to Aspergillus nidulans PALF"
FT                   /note="Similar to C. albicans RIM8"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44278"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H5"
FT                   /inference="similar to AA sequence:UniProt:P78612"
FT                   /inference="similar to AA sequence:UniProt:Q9UW13"
FT                   /protein_id="CAX44278.1"
FT                   /translation="MRRAVSKILPTPKLFNDSAHFHSSFKLEYNSIDDFYVQLDNPHKV
FT                   WLPGEEISGQVVLISKKNLANIVITLSLVGFIKINASSHSKLRPLKHTLFDYTIKIYGK
FT                   DEDEQPDSAEFSNGLLKGEHVFPFIVKLPNKRVFTSIDFGKGSINYTLKAAIGNSSSYV
FT                   IPASPPYNDNASTSSLTKKKILQNPSHTSEKVISLVNPIDVSILPRPKPKRLILKDPRT
FT                   SSSKKLSRTQTSTSTINTTSSNEHDHSLPEGATPEDSDHRSLKSITVPTIKAILEVPQR
FT                   GYLRGESIPIKLSISHLRKIQDFNGIIITFVRVCRLDNGPDGVVESFRKDLQQLILPLY
FT                   VDPVTFQSEINSSLRVPADAFPTIIGCPLVSFQYFVEVLINLSGKSIALDSDVDARAKA
FT                   NPQAAKSSSDKFKFNFDSTQTERSTYINTDSYKRSKKFLQLTTEIYIGTHRSSTQQEEP
FT                   EPVPQLEETASRRSSSMASNSNLSPAIFSTSSPHSPVEHQYGGAINSIPESVAVSNFTP
FT                   PYENVVPSYVPPEFVSHLQTQSELSEKERMRQHESSLLPSAPPGVDDDEPEPMQQQQQQ
FT                   ASSVSPVNMPSTQHGFLFFTYQNASTSPQIPLDDDLYQEPVDSAPNYLTVNNDRLIVPQ
FT                   DNNSNSDS"
FT   CDS_pept        complement(40485..41756)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00170"
FT                   /product="pre-rRNA processing and ribosome biogenesis,
FT                   nuclear localization sequence binding, nucleolar protein,
FT                   putative"
FT                   /note="Similar to S. pombe GAR2"
FT                   /note="Similar to S. cerevisiae NSR1"
FT                   /note="Similar to C. albicans NSR1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44279"
FT                   /db_xref="GOA:B9W6H6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034272"
FT                   /db_xref="InterPro:IPR034276"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H6"
FT                   /inference="similar to AA sequence:UniProt:P27476"
FT                   /inference="similar to AA sequence:UniProt:P41891"
FT                   /protein_id="CAX44279.1"
FT                   /translation="MAKASKVDKKLSKKKEEKPAKKVEEESSSEESSSEESSSEESSSE
FT                   ESSSDDDSDNSSSSSDESSDSDSSDDEEVEKKEEKAASDKEEDEEESSDSSSSESEDEE
FT                   EKAASGEDEKKEEESSSDNESSESSSDSSSSESDSDSDSDSDSDSDSDSDSESESEKEE
FT                   EKSSKKRKAEESKEEVSTPVKKSKPAAVNEEPATLFVGRLSWNIDDSWLKREFEHIGGV
FT                   ISARVIMERATGKSRGYGYVDFETKSAAEKALEEMQGKEIDGRPINLDMSTGKPHASRS
FT                   TNDRAKQYGDSQSALSDTLFVGNLSFNANRDNLFTVFGEYGNVISCRVPTHPDTQQPKG
FT                   FGYVQFSSVDEAKAALEALNGEYIEGRPCRLDFSTPRDNSNTNNNRRGGFGGGRERSAT
FT                   PRSGNSTPRPNRSAEFKGTKKTFD"
FT   CDS_pept        42105..43844
FT                   /transl_table=12
FT                   /locus_tag="CD36_00180"
FT                   /product="2-isopropylmalate synthase, putative"
FT                   /product="alpha-isopropylmalate synthase, putative"
FT                   /EC_number="2.3.3.13"
FT                   /note="Similar to S. cerevisiae LEU4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44280"
FT                   /db_xref="GOA:B9W6H7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H7"
FT                   /inference="similar to AA sequence:UniProt:P06208"
FT                   /protein_id="CAX44280.1"
FT                   /translation="MQKVFQRWVSRIPPVKLQYKNMLRDPSKKYPPPKQINLPNRTWPT
FT                   KVITKAPRWLSTDLRDGNQSLPDPMSVPEKKEYFHKLIDIGFKEIEVSFPSASQTDFDF
FT                   TRYAVENAPDDVTIQVLTQSREPLIRRTVESVKGAKRATIHTYLATSDVFREVVFGMSK
FT                   QDAIDKAIETTKLVRSLTKDDPNMQDTEWNLEFSPECFSDTPGEFAVEICEAVKKVWEP
FT                   TVENPMIFNLPATVEVASPNVYADQIEYFCQNITEREKIIVSTHTHNDRGCGVAATELG
FT                   MLAGADRVEGCVFGNGERTGNVDLVTVALNLYTQGISPNLDFSDIESIIDVSERCNKIP
FT                   VPARSPYGGSLVVCAFSGSHQDAIKKGFAKQKGDRWAIPYLPLDPKDIGRTYEAVIRVN
FT                   SQSGKGGAAWVILRSLGLDLPRHLQVAFSGLVQNTADSLGRELKVEEIVNLFNEQYLVN
FT                   APLSIQDFEITKNKNDEREIVAQLNNGISIKGQGNGPISAFIDALSNKFGVLFEVVNYQ
FT                   EHSLGGGSSSKAATYIELSYVNANGEKVSRWGCGINHDVSQASIEAILSVVNTLINKKE
FT                   LSI"
FT   CDS_pept        44158..44760
FT                   /transl_table=12
FT                   /locus_tag="CD36_00190"
FT                   /product="60S ribosomal protein L16, putative"
FT                   /note="Similar to S. cerevisiae RPL16A (RPL13)"
FT                   /note="Similar to C. albicans RPL16"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44281"
FT                   /db_xref="GOA:B9W6H8"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H8"
FT                   /inference="similar to AA sequence:UniProt:P26784"
FT                   /protein_id="CAX44281.1"
FT                   /translation="MSSFEKVVVIDGKGHLLGRLASIVSKQILNGQKVVVVRCEELNIS
FT                   GEFFRNKLKYHDYLRKATRYNKKKGPFHFRAPSRILYKAIRGMIPHKTARGKAALERLK
FT                   VFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTVGKLSSAVGWKYESVVEKLEEKRKV
FT                   QSAEYYAKKKALTKKLNAAKASTAESEAAQKLAAFGY"
FT   CDS_pept        complement(45033..45680)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44282"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6H9"
FT                   /inference="similar to AA sequence:UniProt:Q6BY22"
FT                   /protein_id="CAX44282.1"
FT                   /translation="MTTPTSILSPCESCLTLSDKPQQYNSQYLMNYLSLRIPEEETEVS
FT                   EITVVYDGNTNINIKLCSIVCLVNIYLHKKITIEDLTMNHLFVYLFYHQRNLFNKEIYI
FT                   DQLKLVHLGKKYQFSTIHSVSSPKLISDLQIERYPTLLLNIKEDNYLPFNLDLGYYLVS
FT                   QQTFVDKSTGDITCLDTLVRTWKRLHNRKKTSNTSSISKRRGFKNFLKRIMV"
FT   CDS_pept        complement(46957..48135)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00210"
FT                   /product="ER integral membrane protein, glucose-dependent
FT                   repression ans hexose transporters secretion modulator,
FT                   putative"
FT                   /note="Similar to S. cerevisiae GSF2"
FT                   /note="Similar to C. albicans GSF2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44283"
FT                   /db_xref="GOA:B9W6I0"
FT                   /db_xref="InterPro:IPR022757"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I0"
FT                   /inference="similar to AA sequence:UniProt:Q04697"
FT                   /protein_id="CAX44283.1"
FT                   /translation="MSGIEKTTGPDSEVGYLDIYLRFNDDMEKDYCFQVKTTTVFKDLY
FT                   QVFRTLPLSLRPSVFYHAQPIGFKKSVSPGYLTQDGHFIFDESSQKQAVPVNDNDLINE
FT                   TVWPGQLVLPVWQFNDFGFYSFLTFLACWLYTDLPDFISPTPGICLTNQVTKLMAWVLL
FT                   QFGKDRFADTLLADLYDTVGVGAQCVFFAFHIIKCLFIFGFLYTGVFNPMRVFRFTPRS
FT                   VKLDVTKEELVKLGWTGTRKATIDEYKEYYREFKINQHGGMIQAHRAGLFNTLRNLGVQ
FT                   LESGEGYNTPLTKENKLRTMKEIVEDAKKPDFKLKLSYEYFAELGYVFAMNAENKEGSE
FT                   LAQLIKQYRRYGLLVSDQRIKTVVNARKGETDEEKPKVEEQPKVEEVVEAKD"
FT   CDS_pept        50081..51751
FT                   /transl_table=12
FT                   /gene="PHR2"
FT                   /locus_tag="CD36_00220"
FT                   /product="pH-regulated protein 2"
FT                   /note="GPI-anchored surface protein essential for hyphal
FT                   development?"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44284"
FT                   /db_xref="GOA:B9W6I1"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I1"
FT                   /inference="similar to AA sequence:UniProt:Q9HG18"
FT                   /protein_id="CAX44284.1"
FT                   /translation="MLLKSLFPSILAAASFVSSVAAEDLPAIEIVGNKFFYSNNGSQFF
FT                   IKGIAYQQNNLDSNDSFVDPLANPEHCKRDIPYLEAVDTNVIRVYALDTSQDHTECMQM
FT                   LQDAGIYVIADLSQPDESINRNDPSWDLDLFERYTSVVDLFHNYTNILGFFAGNEVTNK
FT                   KSNTDASAFVKAAIRDTKAYIKSKGYRKIPVGYSANDDSAIRVSLAEYFACGDDDKAAD
FT                   FFGMNMYEWCGDSSYKASGYESATTDYKNLGIPIFFSEYGCNEVRPRKFTEVGTIFGDQ
FT                   MTPVWSGGIVYMYFEEENKYGLVSVKDNSVSTLQDYANYKSEIKSISPSSAKASAESAS
FT                   SISRTSCPTNTNNWEASTDLPPTPDKDVCECMSASLKCVVDDKVDSDDYADLFDYICAK
FT                   IDCSGINANATKGNYGAYSPCHSKDKLSFVMNLYYEENKESKSACDFGGSASLQSAKTA
FT                   GSCSAYLSSAGSSGLGTVSGTVRTDTSQSTSGSGSGSGSGSGSGSGSGSGSSSSSSSSS
FT                   SSSGSSGKKSAASIVSVNLLTKIATIGISIVVGFGLITM"
FT   CDS_pept        complement(join(51998..52447,52449..52970,52975..53727))
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_00230"
FT                   /product="MNN family member, degenerate pseudogene,
FT                   putative"
FT                   /note="sequence rearrangement"
FT                   /inference="similar to AA sequence:UniProt:Q5A157"
FT   CDS_pept        complement(54737..56023)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44286"
FT                   /db_xref="GOA:B9W6I2"
FT                   /db_xref="InterPro:IPR034586"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I2"
FT                   /inference="similar to AA sequence:UniProt:Q6BYS4"
FT                   /protein_id="CAX44286.1"
FT                   /translation="MVSDKLTLLRQFSEEDELFGDIEGIDYQDGETLKVNKFSLSSSVS
FT                   SPSFAITGQSPNTRTVNGKRITRETLSEYSEENETDLTSEFSDQEFEWEGFNKNQSIYQ
FT                   QMNQRLIATKVAKQREAEREQMELMQKRHKDYDPNQTLRLKDFNKLTNENLTLLDQLDD
FT                   EKTVNYEYVRDDVEDFAQGFDKDFETKLRIQPSMPTLRSNIPTLKKYKSYGEFKCDNRV
FT                   KQKLDRIPSFYNKNQLLSKYKETKSYHPHHKKMGTVRCLNNNSDVPVAYPSISNMKLNK
FT                   EKNRWEGNDIDLIRFEKPSLITHKENKPKKRQGNMIYDEQNLRWINTESEHDVFDDIPD
FT                   LAVKQLQSPVRGLSQFTQRTTSTAATATAPSKTNEAYHSDFEISSKLVEKFQKEQAKIE
FT                   KKISHWFIDTTSEFNTDHYWEIRKMIIEE"
FT   tRNA            complement(56347..56419)
FT                   /gene="tRNA-Thr (AGT)"
FT                   /locus_tag="CD36_tRNA_0001"
FT                   /product="transfer RNA-Thr (AGT)"
FT                   /anticodon="(pos:56384..56386,aa:Thr)"
FT   CDS_pept        57051..58607
FT                   /transl_table=12
FT                   /locus_tag="CD36_00250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44287"
FT                   /db_xref="GOA:B9W6I3"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I3"
FT                   /inference="similar to AA sequence:UniProt:Q6B2U3"
FT                   /protein_id="CAX44287.1"
FT                   /translation="MSDYPPPSYPPPNNPQYQQHQDDTYHVRPDMERQQDFGYYEKPTP
FT                   SQNFDDSFKVEKPKFNDWPFAIFFWLVVAGFIAVAGITLNALRSTYGFQGGSIYGSGNT
FT                   FTLNTNTIILFAFIIVMAFILSAAIIVFARLAPKAFIVTGVILNVVLGIGTAIFYFVEK
FT                   YYSAAIVFLIFALFGAWCYWSSRHRIPLSATILTIVIDVIKMYPSTLIASFIGLIFSAA
FT                   FSALFSVVIVATYVKYDPNSNNEACSVGGGSCSKGKLIGVLVFVFFAGYYISEVIRNVI
FT                   HVVIAGIYGTWYYLANSDQGAPKHPALSSLKRALTYCFGSITFGSLIVSLIQLLRQFIS
FT                   ILRSNFAADGNGWGVCGMIVLDFFVGFIDWLVRYFNKYAYCYVALYGKSYIKSAKDTFD
FT                   LIRFKGMDALINDMFINTALNLYSLFVAYLVALLAFLYLKFTKPDYNSGGAFYAPVIAF
FT                   AFLIAGQINRISLTVIESGTATFFVALAKDPEIFQMTNRNRFDDIFRNYPQVLEKITSD
FT                   H"
FT   CDS_pept        58763..59596
FT                   /transl_table=12
FT                   /locus_tag="CD36_00260"
FT                   /product="endosome-to-Golgi retrograde transport
FT                   membrane-associated retromer complex endosomal subunit,
FT                   putative"
FT                   /note="Similar to S. cerevisiae VPS29 (PEP11)"
FT                   /note="Similar to C. albicans VPS29"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44288"
FT                   /db_xref="GOA:B9W6I4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I4"
FT                   /inference="similar to AA sequence:UniProt:P38759"
FT                   /protein_id="CAX44288.1"
FT                   /translation="MLTLAIGDIFVPERAVDLPSKFRKLLAPQPNNTPSNSKINQVICL
FT                   GNITNSSTILQFLTNISPQFNLVKGEFDNPVVLSQQLSLLNKNSNIPLYNRFVHDNLKI
FT                   GYTNGFQVMPRGDPLALSAFARELDVDVLIWGSTHKVEAYTLDGKFFINPGSATGAFGF
FT                   DWPENDDEEEEEEQEEDTSKDDREKSNKGVEENEDNPENHDSNTKETKDPESKAENDTS
FT                   TSVSDFKQSLQEVSDINSNIPSFCLLDTHGSTCILYIYTQIDGEVKVDKVTYTKD"
FT   CDS_pept        complement(59593..60141)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00270"
FT                   /product="[CCR4-NOT transcription complex] NOT2 family
FT                   component, putative"
FT                   /note="Similar to Mus musculus NOT2"
FT                   /note="Similar to C. albicans CDC36"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44289"
FT                   /db_xref="GOA:B9W6I5"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I5"
FT                   /inference="similar to AA sequence:UniProt:Q5AB95"
FT                   /inference="similar to AA sequence:UniProt:P87240"
FT                   /inference="similar to AA sequence:UniProt:Q4X157"
FT                   /inference="similar to AA sequence:UniProt:Q8C5L3"
FT                   /protein_id="CAX44289.1"
FT                   /translation="MVSSTLPPEEGLGKYGMQGLTSLVKMEQSDITNFALGQDISKCGL
FT                   DLTKDSEILKNLSSPWAETSRSEVEPYYNLPKSIRASSINPPPGPCDGKIQNFTDETLF
FT                   YIFYMKPRDTLQEYAARELVARNWRYHKGIQVWLTKDSNVEPVLINPDVEKGVYIFFDP
FT                   HNWEKIKKEFVLHYSLVQA"
FT   CDS_pept        60331..61056
FT                   /transl_table=12
FT                   /locus_tag="CD36_00280"
FT                   /product="hemoglobin-induced MTL gene expression regulator,
FT                   putative"
FT                   /product="hemoglobin-regulated inhibitor of white-opaque
FT                   switching, putative"
FT                   /product="hemoglobin and proliferation-regulated protein,
FT                   putative"
FT                   /product="oxidative-response transcriptional regulator,
FT                   putative"
FT                   /note="white-opaque transition may affect survival in host
FT                   (shorter of one Met?)"
FT                   /note="Similar to S. cerevisiae FAP7"
FT                   /note="Similar to C. albicans HBR1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44290"
FT                   /db_xref="GOA:B9W6I6"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I6"
FT                   /inference="similar to AA sequence:UniProt:Q8TG40"
FT                   /inference="similar to AA sequence:UniProt:Q12055"
FT                   /protein_id="CAX44290.1"
FT                   /translation="MSRRYTPNIIITGTPGCGKSSHSSSLVSQLNQTLGKETTIDFKHF
FT                   NISEVAKERDCIESYDAKLDTSIVDEDKLLDSLEPDLEKGGVVVDWHCCDIFPERLIDL
FT                   VIVLRTDNSNLFDRLKTRKYNDLKLQENLDCEIMEVILQEAKESYIPDIVIELRSDTAE
FT                   EMDENVDRISSWVEKWIEDHPEGVSNELNKQYNPDNSSDEDEDDSHSDEYELEEEEQEE
FT                   EEQEEETNEEMEHTEDIAQ"
FT   CDS_pept        complement(61120..61995)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00290"
FT                   /product="heme oxygenase, putative"
FT                   /product="ER localized, heme-binding peroxidase involved in
FT                   the degradation of heme, putative"
FT                   /EC_number="1.14.99.3"
FT                   /note="Similar to S. cerevisiae HMX1"
FT                   /note="Similar to Homo sapiens HMOX1"
FT                   /note="Similar to C. albicans HMX1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44291"
FT                   /db_xref="GOA:B9W6I7"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I7"
FT                   /inference="similar to AA sequence:UniProt:P32339"
FT                   /inference="similar to AA sequence:UniProt:Q6FH11"
FT                   /protein_id="CAX44291.1"
FT                   /translation="MQYKSSGATSKLSQVEIIPAKTDVGALANRINLETRSLHDRADKT
FT                   VTLKFAIAIRNYKVYRQGLQAFYHVFASIEKALYRQLEKKDEWSEMLEQVWKPEIARAG
FT                   KAEQDLLFFYDDNKEKFIKPIMPAQIEFCKHILEVTEEKPYLLFAYLHVMYLALFAGGR
FT                   IMRSSVLKATGMYPQRDGLSHEDVVRMGTNFFTFDVPDEDLLRLTYKRDYELVTRNGLT
FT                   EEQKLEIIEESKYIFEHDVKCVAELEKHNMDKLSGSWTYFLVTRGYYAALVLLSLLALL
FT                   YLRRVVNKLT"
FT   CDS_pept        63522..64730
FT                   /transl_table=12
FT                   /locus_tag="CD36_00300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44292"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I8"
FT                   /inference="similar to AA sequence:UniProt:Q6BKT3"
FT                   /protein_id="CAX44292.1"
FT                   /translation="MVPYLTKIKDFSFLESNDDSEKVRFCGLVLRFYPRTREYIGMDVT
FT                   DFTSHRQVCRNQEYYNGGLLLERNEVLTLPVYIEALERIQNSHLDVFGEEYNLKEQYLS
FT                   GGGALDVHDKLLVVVMTLKNRLYQGFLEPYSYDHEVLDYEYLDSKEKLIADDLFRNIMS
FT                   HKEYFSKVSHLAPKIVPQKLLSPADPSSKDTDNTSQVDVESSHIDTKTNNSSPSSKHSH
FT                   PPNPSTTNSSPPLDLVPDIEHDDFDFCNSSTVGSPEEDKIYTIPELKQLDTTLDNKTYM
FT                   VKCKIIGCIPDDWMYLSGKEMDPKSNTPKDPIIRDLEWILADVDADENTVLNSENTLSV
FT                   ISTAQDILKFSPVQSIEEFFINCSRLREHLDAIFDKPTELEIRKVEIPINTNTTTIVWS
FT                   PVE"
FT   CDS_pept        complement(65140..67380)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00310"
FT                   /product="NATB N-terminal acetyltransferase non-catalytic
FT                   subunit, putative"
FT                   /note="the enzyme catalyzes acetylation of the
FT                   amino-terminal methionine residues of all proteins
FT                   beginning with Met-Asp or Met-Glu and of some proteins
FT                   beginning with Met-Asn or Met-Met"
FT                   /note="Similar to C. albicans MDM20 (DEC1)"
FT                   /note="Similar to S. cerevisiae MDM20"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44293"
FT                   /db_xref="GOA:B9W6I9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019183"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6I9"
FT                   /inference="similar to AA sequence:UniProt:Q12387"
FT                   /protein_id="CAX44293.1"
FT                   /translation="MATEGDQEIIDFIDQGNYTYAQSLITKKLAKFPQKLLYHVLQNEI
FT                   HLKIGRRELAINKNLELLNKYPNDPLTIDRLSDFFSRMEMEKESSLVYENAIKKYPIST
FT                   ETLCLSWFEKSIEKCDFKLFNRIFMYLNKTGKSRLHTLWYAFSFHLLLQEGENDKANLY
FT                   TLLGKKLMEGLQPFENTQEIYVCTLFLNFKEIEQVLHGVTMPLDLELKLLYMKVMKENR
FT                   NFEALHAYTEKLLFEEKFDDFDTWKLWILSGKEIGRSFEELDQKITSPTRNISLLKIEL
FT                   DILFSKNIETSVENYYKKFNTKLCCYPDLSQYELPTAFIGGLKNTVSNNDNLITVVNNR
FT                   KFVNQTDNWDIYEKFSAKEGAEYDSNPVNELTLRTIVSDLDSSPQNIIKNIAIIKHLLE
FT                   QDKYNYKLKLWLMKLYSQLNTNDLIFPVYNGLKIRMTQHETLNYYLTTTNPSKINLDAW
FT                   VDIFRFYLTSKQEMKESIIQGFDNGVFNKLQGFINFSKRLQNSVSLNFTIAKILQMSTI
FT                   LGTDGYLNYFIHYLKTNEALVISDYTDNRDFKSEWNGLKKIDSISVPVNDSATKLKLLV
FT                   YSIIFEDQDASKLLKLFNKIISNAKFSAFDSLLYKLYFNLLKIAKTKLNPQETQSLYNY
FT                   LQKNLKVDKLKILVPENLLSGELTRNLANLVEFIKIVKLLAKRHSSSYMNQLVNLVKPL
FT                   AKEFKDLKLVQSQHELIDAMDFDLPFAIDISQAKLEIKNSIEDCTVALLNSL"
FT   CDS_pept        69574..72777
FT                   /transl_table=12
FT                   /locus_tag="CD36_00320"
FT                   /product="pH-response cation (sodium/potassium/calcium)
FT                   P-type ATPase, putative"
FT                   /EC_number="3.6.3.7"
FT                   /note="Similar to S. cerevisiae ENA"
FT                   /note="Similar to Debaryomyces occidentalis NENA2"
FT                   /note="Similar to C. albicans ENA2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44294"
FT                   /db_xref="GOA:B9W6J0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J0"
FT                   /inference="similar to AA sequence:UniProt:O13398"
FT                   /inference="similar to AA sequence:UniProt:Q6VAH6"
FT                   /inference="similar to AA sequence:UniProt:Q12691"
FT                   /protein_id="CAX44294.1"
FT                   /translation="MSSSKENSNYASGDTKEAANSDLSESDRSAPSRDPNASFQAYRLT
FT                   IDEVAQEFDTSIVDGLGTHEAENRIQSYGPNNLGDDDKISYTKILAHQVFNAMILVLII
FT                   SMIIALAIKDWISGGVIAFVVFLNISVGFVQEVKAEKTMGSLKNLSSPTARVTRNGDDF
FT                   TIPAEEVVPGDIVHIKVGDTVPADLRLVDCMNLETDEALLTGESLPVAKNFEVVYSDYS
FT                   VPVPVGDRLNLVYSSSIVSKGRGSGIVFATGLNTEIGAIAQSLKGNSGLIRKVDKSNDR
FT                   KPQKREYGQAAAGTIYDVVGNILGVTVGTPLQRKLSWLAIFLFCVAVVFAIIVMGSQKF
FT                   HVNKEVAIYAICVALSMIPSALILVLTITMAVGAQVMVTKNVIVRKFDSLEALGGINDI
FT                   CSDKTGTLTQGKMIAKKVWLPNVGTLDVQNSNEPYNPTAGDVRFAPYSPKFVKETDEEI
FT                   DFNKPYPDPMPESMHQWLMTATLANIATVNQTKDEDTGELLWKAHGDATEIAIQVFTTR
FT                   LNYGRESAAQEYEHLAEFPFDSSIKRMSAIYKNGDETRVYTKGAVERLLGLCDYWYGER
FT                   TEGNYDSQTLIKLTPDDVKLIEENVAALSSQGLRVLAFATKEPGDADMNDREQVESHLI
FT                   FQGLIGIYDPPREESAQSVKLCHRAGINVHMLTGDHPGTAKAIAQEVGILPHNLYHYSE
FT                   DVVKVMVMSANDFDALSDDEIDNLPVLPLVIARCAPKTKVRMIDALHRRKKFAAMTGDG
FT                   VNDSPSLKKADVGIAMGLNGSDVAKDASDIVLTDDNFASILNAIEEGRRMSANIQKFVL
FT                   QLLAENVAQAFYLMIGLAFLDETGYSVFPLSPVEVLWILVVTSTFPAIGLAQNAASDDI
FT                   LEKPPNNTIFTWEVIIDMFGYGVIMAATCLLSFVIVVYGAGNGDLGVDCNATNADKDLC
FT                   SLVFEGRSTAFASMTWQALILAWECLDPKKSLLLIPFSELWANQFLFWSIVGGFVTVFP
FT                   VIYIPVINTKVFLHKSITWEWGVAVGTTALFLLGAEAWKWGKRVFARSSKAKNPEYELE
FT                   RNDPFQRYASFSRANTMVV"
FT   CDS_pept        73473..74621
FT                   /transl_table=12
FT                   /locus_tag="CD36_00330"
FT                   /product="cell survival pathways (diauxic growth shift;
FT                   apoptosis) effector, SVF-family, putative"
FT                   /product="survival factor [1], putative"
FT                   /note="Similar to S. cerevisiae SVF1"
FT                   /note="Similar to S. pombe SVF1"
FT                   /note="Similar to C. albicans SVF1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44295"
FT                   /db_xref="GOA:B9W6J1"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="InterPro:IPR033394"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J1"
FT                   /inference="similar to AA sequence:UniProt:Q09885"
FT                   /inference="similar to AA sequence:UniProt:Q05515"
FT                   /protein_id="CAX44295.1"
FT                   /translation="MLKWVQSGLSAVAGTVEPEYGPDAIQPITKRIFEINNGTIYRATK
FT                   PEDFEWLSPNYTNVETQTFYFTDLSNGNIGFAQIIHSNVMGLTTTAQFTFRLYNVKDKN
FT                   INLWTSTKLEDFEIKESNFYAKNLSLELTDNKVYKLKSSVNKESIVEFEMERLTDGVIF
FT                   GDDGMSFYGEDPEQPWGSMRHAFWPRCKINGTITTADNKVIEINNGLTMFVMALQGMKP
FT                   HHAAKSWNFMNFQSSNHSAVQMEFTTPKSYGTTKVNIGIVTDNEKVLIASIDNQVVHSD
FT                   TKFDDVGGWDVPQKIEFNFIDGKDKEKQVASVSGNLSQLVERVDVMAEIPQFVKNIVSG
FT                   VAGARPYIYQYANEFTIDINNGNDEKVKEDGVGFTEVTFISD"
FT   CDS_pept        complement(75010..76638)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00340"
FT                   /product="mitochondrial outer-membrane and lipid particles'
FT                   fatty aldehyde dehydrogenase, putative"
FT                   /product="aldehyde dehydrogenase, dimeric NADP-preferring,
FT                   putative"
FT                   /EC_number="1.2.1.5"
FT                   /note="Similar to Homo sapiens ALDH3A1 (ALDH3)"
FT                   /note="Similar to S. cerevisiae HFD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44296"
FT                   /db_xref="GOA:B9W6J2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J2"
FT                   /inference="similar to AA sequence:UniProt:Q04458"
FT                   /inference="similar to AA sequence:UniProt:P30838"
FT                   /protein_id="CAX44296.1"
FT                   /translation="MSPPSKIDESFTDIGNTSTSWYTEIKSIEPGVKHLTDSFFTKQKT
FT                   HDIQFRLNQLRNLYYAVQDNIDPLCEALSKDFNRSASETKNLEIVGGLNELVHTIASLH
FT                   EWVKPEKVTDLPVTLRSNPIYIERIPLGVVLIISPFNYPFFLSFSAVVGAIAGGNAVVL
FT                   KQSELTPNFSRLFSEILTKALDKDIFLAVNGGIPETTELLNQKFDKIMYTGNNTVGTIV
FT                   AKKAAETLTPVILELGGKSPAFILDDVQDKDIEIIARRIAWGRFTNAGQTCVAVDYVLV
FT                   PNKLHDKFIAALKKVLNEEFYPKLDKTDKTYTHVIHDRAFTNLSKIISTTKGKIIVGGE
FT                   TDPESRYIAPTVIDNVSWDDSSMKGEIFGPILPILTYDKLTDSLRDIIRHHDTPLAQYV
FT                   FTSGSTSRKYNRQLDQILTTIRSGGLIVNDVLMHVALVNAPFGGVGQSGYGSYHGKFSF
FT                   RSFTHERTTMEQKLWNDFMVKVRYPPYNSNKDNLVRVSQQGYNGKVWFSRTGDVPVGGP
FT                   GRFFSSWNSFTGVIGLLTEFITNKQ"
FT   CDS_pept        78143..79114
FT                   /transl_table=12
FT                   /locus_tag="CD36_00350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44297"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J3"
FT                   /inference="similar to AA sequence:UniProt:Q6BIL5"
FT                   /protein_id="CAX44297.1"
FT                   /translation="MKEFQFDPDSFSKVTYNIGGILTYVYNSDQLVSYVEKFNKFEHPI
FT                   EAIPINVVYLIHQRCGSHKHTEAIAYNYLKQFYDKKSQDYDIPLICVTFDNPNHGQRLV
FT                   NERSNSGWAKNNETHGADMMSIIEGTIQNIRLIMDYLPSYLNLDYYLTNTFKSINPGTE
FT                   IKFNNILTGYSLGGHVVIRYGIAHPQDVKIIGPVIGCSDLTSLLVTRLKSITNNDKKYF
FT                   YFNYDELDLTDQQKKQYPETLHKRISKQDQAIFENYPMNKIKMFACFGSEDKLVPHSLS
FT                   SVWCDFYMNTNGASSTYVAEGVGHDVTDEMIDKFTTWLVKNI"
FT   CDS_pept        79503..81179
FT                   /transl_table=12
FT                   /locus_tag="CD36_00360"
FT                   /product="autophagy-related protein [18], putative"
FT                   /product="cytoplasm to vacuole targeting protein [18],
FT                   putative"
FT                   /product="phosphatidylinositol 3,5-bisphosphate-binding
FT                   protein, vacuolar membrane protein, putative"
FT                   /note="Similar to S. cerevisiae ATG18"
FT                   /note="Similar to C. albicans ATG18"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44298"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J4"
FT                   /inference="similar to AA sequence:UniProt:P43601"
FT                   /protein_id="CAX44298.1"
FT                   /translation="MLQTSSSSATASLQQQLSKQYANSFSNDGSSFSSRNNQQYSEIVN
FT                   YITFNQDASCITIGLKNGYKIFNCQPNFGRSFQFKNDESTGIVEMLYCTSLLATVAQGE
FT                   EIGSSPRKLKIINTKTKSTICDLIFPSTILQVKLTNTRLIVVLEDQIYLYDITTMKLLH
FT                   TIETSPNLNGLSAISYNDSNSYLAYPSPPKTITHDSLLASGINTNGGSNSTQNNISSVS
FT                   NTPNRVGDVIIFNLTSLQPISVIEAHKSTIASMAFSNSGLFLATASDKGTIVRVFDVAT
FT                   GTKIYQFRRGTYPTKIYSLRFSADDKYVLATSSSLTVHIFRLGEEEALETKHKKKKKPA
FT                   VATILEEETEGSPSNEQNKSTKRNSEEFEEVRDDGDDSDVDDEDEDIDDESIEVIPAKQ
FT                   RKLSQGSTNSYTSVNSEDVQSNSPKTEPLIDQNRLSMARIIRRSSQTLGRKAAQKMGDF
FT                   LPSRFSSILEPTRNFASLKINAHSKDTKSVAVMNNVLQQDLIPQTYLATDNASAKQDLM
FT                   EVSLFHIYVVTTEGMLYIYGLDPERGGDCILLNSHCILDEY"
FT   CDS_pept        join(81337..81349,81416..82839)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00370"
FT                   /product="ubiquitin carboxyl-terminal hydrolase 6,
FT                   putative"
FT                   /product="ubiquitin thiolesterase 6, putative"
FT                   /product="ubiquitin-specific processing protease 6,
FT                   putative"
FT                   /product="deubiquitinating enzyme 6, putative"
FT                   /EC_number="3.1.2.15"
FT                   /note="Similar to S. cerevisiae UBP6"
FT                   /note="Similar to C. albicans UBP6"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44299"
FT                   /db_xref="GOA:B9W6J5"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J5"
FT                   /protein_id="CAX44299.1"
FT                   /translation="MAYTITIKNAGKTYDIELQEEDNGQILKSKIQELTLIPPERQKIL
FT                   IKGGKLTDEVIVSSLNLKSPVMVLGTPDKNLPSKPVEKQVFLEDLNKSQLVKVSNEPSG
FT                   LTNLGNTCYLNSSLQTIFHIEDVNNKLKDYTFGGANQANSAFVLSLKSMFQQMSKKHEV
FT                   ITPSTFLSLFRRSYPQFAEQQNGIYKQQDAEEAFSQIMSSLRSELKIDDVFKITFNTKT
FT                   QCLAIPEDVTEGFEEAFKLNCHIDVKTNFLRDGLLAGLKETIEKHNSTLNADTDYEITK
FT                   TITRLPKYLTVHFIRFFWKRDINKKSKILRKVQFPFELDLAEMLDVSIKPDKVSNRDTI
FT                   RKVEKDNLDLIRDFKKAKKDTNLTPLEQQEEEEMKITSIKSKFREDLNSALPNVDFNAT
FT                   TENPSSVYELNAVITHAGSSADGGHYKAYVKDPTDLDGERWWLFNDDKVSPVNKEKIET
FT                   LAGGGESDSALLLVYKGLGL"
FT   CDS_pept        complement(join(<83000..83347,83447..83548))
FT                   /transl_table=12
FT                   /locus_tag="CD36_00380"
FT                   /product="mitochondrial protein, putative"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44300"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J6"
FT                   /inference="similar to AA sequence:UniProt:Q6BIL9"
FT                   /protein_id="CAX44300.2"
FT                   /translation="MGANGSKPETKVFTPDTPIDFSATFLSQLESSPESDFSRAQYTEK
FT                   YIQDRVAAELAKLEKQTISSFKETTDKALLKDDPEDQKLSVAATNDKITNLTNVLKENA
FT                   LLGKVVIPPNVEESRNAVISCLKENQGKSLNCWEEVETFKKLVKDL"
FT   CDS_pept        83868..84188
FT                   /transl_table=12
FT                   /locus_tag="CD36_00390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44301"
FT                   /db_xref="GOA:B9W6J7"
FT                   /db_xref="InterPro:IPR018450"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J7"
FT                   /inference="similar to AA sequence:UniProt:Q02889"
FT                   /inference="similar to AA sequence:UniProt:P79082"
FT                   /protein_id="CAX44301.1"
FT                   /translation="MPPVQQYQYVGHQPSNWDKFKMGAIMGSTVGVCVGVLFGGFSILQ
FT                   NGAGPNGVMRTLGQYIMGSVGTFGLFMSIGSVIRSESGFQEYEKSMVAMQRAKLRAIYR
FT                   DE"
FT   CDS_pept        complement(84320..85645)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00400"
FT                   /product="N-acyl-phosphatidylethanolamine-hydrolyzing
FT                   phospholipase D, putative"
FT                   /note="Similar to Rattus norvegicus NAPE-PLD"
FT                   /note="Similar to S. cerevisiae FMP30"
FT                   /note="Similar to C. albicans FMP30"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44303"
FT                   /db_xref="GOA:B9W6J8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J8"
FT                   /inference="similar to AA sequence:UniProt:Q02883"
FT                   /inference="similar to AA sequence:UniProt:Q769K2"
FT                   /protein_id="CAX44303.1"
FT                   /translation="MLPSLSIKSKLGLGLLLSYTSYEVYIQVRTQYIIKARKEEFKNLE
FT                   NGTDIDISKFRSTSVAGMFVNPFEEYRPQTAFEFILVRIMQLFESVYGNTIELHKKLPK
FT                   PHDGAVEVEDILKVFKPDLDRFRKNSEVLKKCIENNNFSQLKVKPSWFNSIPLHQQLLF
FT                   TWLGQSCTLFQISGVNFLTDPIISEHLITPSIGPKRLTCSPMDLDQIKFATNDNLNFVL
FT                   VSHDHPDHLELDLAGKIKNTTTWIVPLGLKSKLARKGIYKVIEMDWWDTIDITNYISDN
FT                   LPDKYEIECVPSMHWSGRYVIDSNQSLWCSYVIKRNGESLVYHAGDTGYSKELFDVIGK
FT                   RCGPIKLALLPIGQYCPSWHQKPRHISPEEALRICLQVQASFMKGIHWGTFKLSGEPIL
FT                   EPKNLLTELAQKIGKAETYRVPEFGLTYLFDLQNNTETEIHI"
FT   CDS_pept        complement(85822..88077)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00410"
FT                   /product="ATB-binding cassette protein,
FT                   aminoacid-starvation induced mediator of eIF2 kinase,
FT                   putative"
FT                   /note="Similar to S. cerevisiae GCN20"
FT                   /note="Similar to C. albicans GCN20"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44304"
FT                   /db_xref="GOA:B9W6J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6J9"
FT                   /inference="similar to AA sequence:UniProt:P43535"
FT                   /protein_id="CAX44304.1"
FT                   /translation="MSNVGLQVRQAVPSIDPIVAEYAVGYIQHVSNSTEDSVLAQQVDI
FT                   PQEMEFVNDLLVQAGGSLEKVAALTQGLKKQLSDKLNENMEKLALTGDTSKRLLDINVL
FT                   QNNTKRDINSSLALLNSGNDIAHTGRQMESRVDKKKLEKQERKIAKKVAKRNNKFVKYE
FT                   ASKLLNEKKEEDYDSFFLEINPMEFGSSAGKSKDIKIDTFDLYVGDGQRILSEASLTLA
FT                   YGRRYGLVGQNGIGKSTLLRALSRRELNIPKHISILHVEQEIRGDDTPALQSVLDADVW
FT                   RKSLLQEEQKINERIAEIEKLRSEFDEDSLEVKKLDNERDDLESHLQEVSDKLYEMESD
FT                   KAESRAAGILFGLGFTKETQNIPTKQFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDV
FT                   PSITFLAKYLQTYKSTVLVVSHDRAFLNEVATDIIHQHSERLDYYRGSNFDSFYATREE
FT                   RIKNQRREYESQLAYRKHLQEFIDKFRYNAARAQEAQSRIKKLEKLPVLEPPEDEKTIT
FT                   FKFAEPDSISAPILQLQDVSFGYDTNKMLFKDVNLDVQMDSRIAFCGGNGTGKTTLLKL
FT                   IMDQLSPTSGYVNKNGRLRIGYFAQHHVDAMDLTLSAVSWMSQAFPGKTDEEYRRHLGS
FT                   FGITGSLGLQKMQLLSGGQKSRVAFAALCLNQPHILVLDEPSNHLDTQGLDALADALKN
FT                   FKGGVLMVSHDVSIIDRVCNEIWVAENNTIFKFPGDIYAYKKHILASADIAGVVKQH"
FT   CDS_pept        complement(88248..88607)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00420"
FT                   /product="stress-induced cytoplasmic glutaredoxin,
FT                   thioltransferase, glutathione-dependent disulfide
FT                   oxidoreductase, glutathione peroxidase, putative"
FT                   /note="Similar to S. cerevisiae GRX2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44305"
FT                   /db_xref="GOA:B9W6K0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K0"
FT                   /inference="similar to AA sequence:UniProt:Q6B234"
FT                   /protein_id="CAX44305.1"
FT                   /translation="MFRTLLTKRLFNTSIMVSSQVKNKVEELIKTKPVFIASKSYCPYC
FT                   HATKNTIEAITKDAYILELDEIDDGAEIQEALLEITGQRTVPNVFIGGQHIGGNSDVQA
FT                   LKSSDKLDDKIKAAL"
FT   CDS_pept        complement(88864..89892)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00430"
FT                   /product="glyoxylase I, putative"
FT                   /product="actoylglutathione lyase, putative"
FT                   /product="methylglyoxalase, putative"
FT                   /product="aldoketomutase, putative"
FT                   /product="S-D-lactoylglutathione methylglyoxal lyase,
FT                   putative"
FT                   /product="ketone-aldehyde mutase, putative"
FT                   /EC_number="4.4.1.5"
FT                   /note="Similar to Phaeosphaeria nodorum GLO1"
FT                   /note="Similar to C. albicans GLO1"
FT                   /note="Similar to S. cerevisiae GLO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44306"
FT                   /db_xref="GOA:B9W6K1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K1"
FT                   /inference="similar to AA sequence:UniProt:Q696X2"
FT                   /protein_id="CAX44306.1"
FT                   /translation="MFRRFFSSTPRTFKMATFNKSFLMNHTCLRIKDPKISLPFYTEKF
FT                   GMKLIATFPFADFTLYMLNYETEADKHLNWSAREGVLELCHNHGVENDPNYKLNNGNGE
FT                   KDRGFGHICVSVDNIEAFQNQLLDSDVKFQKKLTDGRQKNIAFALDPDGYWIELIENGI
FT                   NKVANKTDVSSYKLNHTMIRVKDPKKSLEFYRDVLGFKLLSTSVHEGAKFTLYFLGYDH
FT                   DPNFKQDTLARDEQAKRQGVIELTHNWGTESDPEFKGYHNGNSTENGALQGYGHTCVSC
FT                   EDPAKFCQELEEKFGDKLDWSLKWDQGKIKKIAFIRDPDGYAIEILGHNLFADKVKDQA
FT                   SL"
FT   CDS_pept        90343..91272
FT                   /transl_table=12
FT                   /locus_tag="CD36_00440"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase,
FT                   putative"
FT                   /product="ketopantoate hydroxymethyltransferase, putative"
FT                   /EC_number="2.1.2.11"
FT                   /note="Similar to Aspergillus nidulans PANB"
FT                   /note="Similar to C. albicans ECM31"
FT                   /note="Similar to S. cerevisiae ECM31"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44307"
FT                   /db_xref="GOA:B9W6K2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K2"
FT                   /inference="similar to AA sequence:UniProt:Q9Y7B6"
FT                   /protein_id="CAX44307.1"
FT                   /translation="MYRRVFVRSSRLFSTSPYFRSSYANAPRKTIADIHDLYKTGEPIS
FT                   MVTSHDFITSQILEQAKVDINLIGDSLANTTLGYDDTNELTLDEFLYHVKSVQRGNSHS
FT                   LLVADIPFGSFESSIEQATSTAVKLIQKGKIQAVKIEGGNEEIIPTIKKIISIGIPVMG
FT                   HVGLTPQKHNSLGGYKLQGKSADDSLRIFQECLNLQNAGVFAIVLECIPNKLSQYITDK
FT                   LSIPTIGIGAGPYTSGQVLVISDLLGMKDGHVAKFVQQYSDFFQQGVEGVKQYTKDVKS
FT                   KKFPNPDTHGYKMKKEVLDEFKEIAKDL"
FT   CDS_pept        91429..92097
FT                   /transl_table=12
FT                   /locus_tag="CD36_00450"
FT                   /product="phosphoglycerate mutase family protein, putative"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44308"
FT                   /db_xref="GOA:B9W6K3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K3"
FT                   /inference="similar to AA sequence:UniProt:Q8Y237"
FT                   /inference="similar to AA sequence:UniProt:O94461"
FT                   /protein_id="CAX44308.1"
FT                   /translation="MTFEIIENPEPEITRVFIVRHGQTDHNVQKILQGHLDTDINETGK
FT                   EQAEIVGKYLSRIPFDYFVSSDLTRCQQTLLPILSHQQTKTVKYTANLRERDMGKVEGM
FT                   YLKDALEKYGPGFRNLGEKEGALCKRVEKEWNEIIEQGHNNVLVCTHGGVITRFISYLY
FT                   KELGYELNNKLTPDDLKVPFNTSVSVIDVEKKTKKGVIQAFGNTLHLGGNFEVKDQLLR
FT                   "
FT   CDS_pept        complement(92337..94778)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44309"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="InterPro:IPR039634"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K4"
FT                   /inference="similar to AA sequence:UniProt:Q6BSG1"
FT                   /inference="similar to AA sequence:UniProt:P53755"
FT                   /protein_id="CAX44309.1"
FT                   /translation="MDERNKFKLKLSSLSLKNTPSRQASVSSRNQGDEEANELINILPS
FT                   YQMYRSTITKNLTPSVEDLRTAPPSYEVTPDLSTVQLHDYFASVPTSPTLELMPSENLE
FT                   ADPSAIQQDGEQDDETILENAHKLKRLTSTNKEISKSLEVKILLTEHIGKVGEPYTLVD
FT                   PLTLELKQGDYIYGFVLITNKTSNVIPFDMFSVQLEGCSIFGKTNNSTLVEQPSHIDRF
FT                   LNMFDFNASWNDAFLDRLVTEHNDPTNIGTIYDPVDGTYYHLDHRKILEPGITYKKYFT
FT                   FKIPEKLLDSACEHSLIKHLQIPPTFGVCKNEVISSLRHKWKDQQSGAPEDTASRKYKY
FT                   ASLTNDFAFNDTSISYCVSARVIGRASGYQHLFGPLGGVHAINDKNDEYVVATEDYKYL
FT                   RVIPVTKAIVQLNRSMIHQEARLLYTNMVDKIKEKITLGRDIMIANQQQNSLSPVSSTG
FT                   SLRPVSSANSFNQLTATHSLPTSPSSFSVRAALQEGAASSYTNSPLLTPTSSSAQLAKM
FT                   QQSYYSKVNQRNIHVSNESKSEVFHPYKKKNLFGNSKIIGLIAFGTPKKEYFVNYVPFE
FT                   QLSSKSKKVLPSVLNIPFDLTFIFGDEKTGSVSSLPEFKSLSVELIALTVKSKKLPIPV
FT                   VIHPEMMFDNKTKNGGSSNDNFDILTIKKFQKYAIELSKLLKEVGPEPLDVDRDLVQDI
FT                   KCLANLTTKYVHMKIKDVVIKVNEQSYTSIAAVPWQKEVLQSTDNTTGKEQSTVKYSKN
FT                   LNLSINLANVVMKPTNSTDFCLVPDFQTCLLARIYYLKVDLKSHTGEKITLRVPIVLQK
FT                   T"
FT   CDS_pept        complement(95313..97484)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00470"
FT                   /product="RSP3 E3-ubiquitin ligase complex subunit,
FT                   putative"
FT                   /note="heat-shock-element-mediated gene expression, stress,
FT                   intracellular amino acid permease sorting"
FT                   /note="Similar to S. cerevisiae BUL2"
FT                   /note="Similar to C. albicans BUL2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44310"
FT                   /db_xref="GOA:B9W6K5"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="InterPro:IPR039634"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K5"
FT                   /inference="similar to AA sequence:UniProt:Q03758"
FT                   /protein_id="CAX44310.1"
FT                   /translation="MSPNDEPQPPNEDELLNNILPSYHMFQSTVSKNLTPTNENYSIDP
FT                   PTYEMTPITSETPSLLTFSRMQSPVDERLETDNYFAQSDNDSVTYNQESEDMWKNSILA
FT                   NADKLPNLTHRKNSMSECLKIDIQVTEKVCQSGIKPIFMDPSNREFKQGDYLHGYVTIR
FT                   NTSDQSIPFDMVYVVFEGTFTTLDTSSGTISSEVPALRFKFLTMLDLFASWSYANIDRL
FT                   ITDNGDPHDWCNGETDPYDNTLLSIDVKRLFQPNVTYKRFFTFKIPDKLLDSTCDQYNL
FT                   PTHTEIPPTLGIDRNSFPPSFLLANQHLIVKDLSFSDSCLAYRIDARVIGKASDYKYKV
FT                   DKDQYVVSKEASCPIRVIPTPNLEMEYNFQQLKQEAELYYRAFVDSVMVKIDYGNELLN
FT                   NKAGNTSSSRPNLSPMMSNDSVKLRQLYDVADDTFKSNLRSGKSMHDDEDFYQCLIPFK
FT                   KKSITGSSKYLGIISLSTIKEHYKIRYTPPTRFGKAPPPSDTELVIPLELNYFAESSTL
FT                   LKNLPEIKAIDVELVALSIRSKKHPIPIEFTTDMLFAEKEIDIKKSQPANFNSLVIARF
FT                   SNYLNEFHKLIKGVGNEALRLETRLYQNVKCLASLKTKYINLPISNLVFETTSQNGIGT
FT                   TTEVKSLQWQEEQSEKGKLFIKKFSIRMNLNNCSSKSNDHSSKGLDRITLVPSFQTCFA
FT                   SRLYYIKITVRLHHGDSLLVNVPLNIHRY"
FT   CDS_pept        98156..100066
FT                   /transl_table=12
FT                   /locus_tag="CD36_00480"
FT                   /product="gamma glutamyl-transpeptidase, putative"
FT                   /product="gamma glutamyltransferase [contains:
FT                   gamma-glutamyltransferase heavy chain;
FT                   gamma-glutamyltransferase light chain], putative"
FT                   /EC_number="2.3.2.2"
FT                   /note="Similar to S. pombe GGT1"
FT                   /note="Similar to S. cerevisiae ECM38"
FT                   /note="Similar to C. albicans ECM38"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44311"
FT                   /db_xref="GOA:B9W6K6"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K6"
FT                   /inference="similar to AA sequence:UniProt:O14194"
FT                   /inference="similar to AA sequence:UniProt:Q05902"
FT                   /protein_id="CAX44311.1"
FT                   /translation="MKSETHPKNYTNYNYKIPRSTLFISCVLTLLIYSLSTIYQSRGLG
FT                   LPPLSFINQIPENLSRSDPYLTLHIDITDDPLSDKIGQPDLNPSPEHLHVGNKAMVASD
FT                   VPLCSTMGKDILLRGGNAADAAVTVALCIGSVNSHSSGIGGGGFIVSRNNGDAVSIDAR
FT                   EMAPGSAFKEMYGNSLVLSKIGGLSIAVPGELKGLYELFRLHGSGNLSWKQLFEPVIEL
FT                   NRNGFKCSKIFETVLAKEYDLVLSRVPVLKDSWDFIFKPNGGLLKEGDLITRPNYAKTL
FT                   ELIANNGSSSIFYDPNGPIVQSLVSTIQKWGGIVTTEDFSNYKVNLEKPLVSTIKNHTF
FT                   YTSNGISSGLGLLAGLNFFDRVFNESDDDTLFTHKLVESFKWLSSIRTRFGDIDKRQDL
FT                   IDKYTDSTWIDEVLETKKYSDETTFDWKHYDPKYDIAEPQGTSHFSVVDENDNSVAMTT
FT                   TVNLLFGSMIYDRETGIILNDEMDDFALPNVSNAFNLTPSIFNFIYPGKRPLSSTAPTI
FT                   IINDANNATDFVIGAAGGSRITSAILQAIVRTYYRKYDLLSTIAFPRLHHQLIPESIMS
FT                   ENLTIWDQEHPGITSSMKKVGHTFLETGSLTAMNGIKRTKNGKLHGVSDWWRKRGESDG
FT                   Y"
FT   CDS_pept        100375..101547
FT                   /transl_table=12
FT                   /locus_tag="CD36_00490"
FT                   /product="HSP-interacting, SSA1 ATPase
FT                   activity-stimulating, TPR-containing co-chaperone,
FT                   putative"
FT                   /note="Similar to S. cerevisiae CNS1"
FT                   /note="Similar to C. albicans CNS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44312"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K7"
FT                   /inference="similar to AA sequence:UniProt:P33313"
FT                   /protein_id="CAX44312.1"
FT                   /translation="MSKIEPVPEKEEEYVSEWDRRRYVPKAGEPELPPQLSEFSNKTTD
FT                   EVIEELNRLPFFMTKLDETDGDGGENVNLEALKSLAYEGDPDEIASNFKNQGNDCYKVK
FT                   KYNDAIIFYTKGLEINCDVDSINSALYLNRAACNLELKNYRRCIEDCKKVLMLDEKNIK
FT                   ACFRSGKAFYAIEKYDEAIKVLEYGLNVDPENRDLQKLLQQVQKRQETLAQLKAKKVQE
FT                   EEQEKLKNIVLENSIKLRHIEIVKTSSPPEVLKTAKIRLEDPKDYQSQLIFPAMILYPT
FT                   NDEFDFIAEISELTTPLELLEMVLNRPREWFDDPKHKDFSVKKLECFMETDTGGLIKVG
FT                   KKIEINNALMNEKPKAPLFDNALRLYVVPKTDVSKWTSEWNKETALAARK"
FT   CDS_pept        complement(101570..103951)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44313"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K8"
FT                   /inference="similar to AA sequence:UniProt:Q6BSG3"
FT                   /protein_id="CAX44313.1"
FT                   /translation="MSQLWAAAAARKRKNDYTSGSSRWVSNELNNQFMISFHSINQFVE
FT                   ENQVYQEYLGSIMDEIYSGTFDPDTIKKEQVSDVTEPKSTIKETPLRPTSGHLQSSRAP
FT                   STSSAVNTSKTTFENTQSQFSNLHNESHPQPTLKPSSENLDVVVFDKAPSYNNSPNSDS
FT                   SRDNQHRQSDGLDDSFQAISKAIRKSIAGRAGDTLFKQDMNHSDLLPSRSSSKSQHSKS
FT                   DTTIQSIKSEEKTLAPKTPKSRSSMFIALPTREPIVIKSVSRRKSGVSKRRTMENSKSL
FT                   HSGRNSVAVNTNTNSELNNTTVSTKEEKQKFEQMSPVKLPVDKRVFRETVTSLNTSDKD
FT                   DNTEKIVNKLVDATSREKEDRVENVFTLPGVEQETAVVSTTMRAENEELVVQSTEPKNV
FT                   IKETVSPEGIWSTIGKYRSLSPVRKPLFNNTTGASPISIRASTSRSRSRSRSPLRKEVL
FT                   LHRKNSRSPTRELFHGNSPRSPAKSTANGGETDLINRLTAPTSSSAAKTKSQNRKTEGR
FT                   KPERNKFLTATLIPTTDGNNKGKEVSPIKLKSEPYRFPKLERSSIPALKMSMTEKRSET
FT                   TTVRTKQKYIIKPTNSFKRKSELGKERHENSIIPQMTHSSGVQKLDARPQTNLGSTSQD
FT                   RKSEQRIKRIKTANGVSLPEAARGILNKDNANKKSIASVAITPARHEIQVGNNVLPITP
FT                   TRISPRNLPEIDSDEEGSFSKRKILQPWADSPILRRSIAANRNIDPATVIVNNPKIDLQ
FT                   ETFQNAASAKRGQESPAPTPNMRQQEKDMKRYFQQSGYIQ"
FT   CDS_pept        104235..105164
FT                   /transl_table=12
FT                   /locus_tag="CD36_00510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44314"
FT                   /db_xref="GOA:B9W6K9"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6K9"
FT                   /inference="similar to AA sequence:UniProt:O14166"
FT                   /protein_id="CAX44314.1"
FT                   /translation="MIKPMTNRFQLLDIKRRDDGLDNCSVYDGASVINFVFSILISFGI
FT                   IISYIPQYRRIFIKLTSEGLSKNFLLLGSCSSIFTLTNIILVSSKARQCCSIGALDTFN
FT                   CINSQLNLFQIGIQCTCAILILVLVLSVTKDSIKQDKAEYKRIERVGKFVAAHAAVSLL
FT                   EIALGFSTNSTVLYAIANMNGLLSALLTVIKYVPQIYTTFRLKHPGTLSIGMMCIQTPG
FT                   GFVFTATLFFTKGSHWSSWVSYLVAALLQGMLLSLCIYYVYFQGRHVGEESAEELEREA
FT                   IERIVNENRHEELDHTSDVRDPEREQLL"
FT   CDS_pept        105502..106782
FT                   /transl_table=12
FT                   /locus_tag="CD36_00520"
FT                   /product="elongation factor tu, mitochondrial precursor,
FT                   putative"
FT                   /note="Similar to S. cerevisiae TUF1"
FT                   /note="Similar to C. albicans TUF1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44315"
FT                   /db_xref="GOA:B9W6L0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L0"
FT                   /inference="similar to AA sequence:UniProt:P02992"
FT                   /protein_id="CAX44315.1"
FT                   /translation="MLKTLTQTLRLTGKSLPKVRPALIRTYAAFDRSKPHVNIGTIGHV
FT                   DHGKTTLTAAITKVLAEQGGANFLDYGSIDRAPEERARGITISTAHVEYETKNRHYAHV
FT                   DCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQDLVVFVNKVD
FT                   TIDDPEMLELVEMEMRELLSTYGFDGDNTPVIMGSALMALEGKKPEIGKEAILRLLDAV
FT                   DEHIPTPSRDLEQPFLLPVEDVFSISGRGTVVTGRVERGVLKKGEEIEIVGGFDKPYKT
FT                   TVTGIEMFKKELDSAIAGDNCGVLLRGVKRDEIKRGMVLAKPGTATSHKKFLASLYILT
FT                   SEEGGRSTPFGEGYKPQCFFRTNDVTTTFSFPEGEGVDHSQMVMPGDNIEMVGELIKSC
FT                   PLEVNQRFNLREGGKTVGTGLITRIIE"
FT   CDS_pept        107128..111729
FT                   /transl_table=12
FT                   /locus_tag="CD36_00530"
FT                   /product="Anaphase-Promoting Complex/Cyclosome (APC/C)
FT                   largest subunit, putative"
FT                   /product="Anaphase-Promoting Complex/Cyclosome (APC/C)
FT                   ubiquitin-ligase subunit, putative"
FT                   /product="negative regulaator of mitosis, putative"
FT                   /note="Similar to S. cerevisiae APC1"
FT                   /note="Similar to S. pombe CUT4"
FT                   /note="Similar to Aspergillus nidulans BIME"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44316"
FT                   /db_xref="GOA:B9W6L1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L1"
FT                   /inference="similar to AA sequence:UniProt:Q9URV2"
FT                   /inference="similar to AA sequence:UniProt:P53886"
FT                   /inference="similar to AA sequence:UniProt:P24686"
FT                   /protein_id="CAX44316.1"
FT                   /translation="MTSSPDNALLKFPIFGIQEDTDYPVPFQDPYKLALFRQNKRLLIA
FT                   KRKLAVVKGSIITKILTYEEDIVTATYTHFSNSQELEEVLVVSLKKHIHVYYADGKSYV
FT                   CSLPFALKNALPFESGLVLQRDQNESLIPHNGALYSNTSHLNSATILTLVDPMGDFRIV
FT                   ATASTSVISSKEEVITFPRKDMNKVCSLCVTFNASDGSISIYHVKAPSRTTTFGKTQSA
FT                   RNQKRRYGSITTPNPSRILEEDNGPEPLHSISLNMEKKRTSTLLSDISSVGRVSSDCHS
FT                   LSQDFSGFKKDMILSRVETFGSRLQKDQLRIFNIWFEDQEGVVVFNRIKRECAVLIYRN
FT                   PSFSRHSSVFKTPCLDCITLNSAKYEGNLVLLTEDQKFLIVNPFLGMKSTSHTFASKFK
FT                   VCSLIDSYDSNLALKLSDGSNVIIKMVLEPSSELVKMCLSCFQYLSGSNINHIMWMLWR
FT                   SAYLEVKYADEWKAFVIALLSLIFPFKEGVQCVENEITKLLPVAKRVHETSNVNYNLHD
FT                   LIPYITISLHLVREEIRLDSTKAKCLTNMNLLLCQLTTWMGWPAPWVKYYSIKPACIDP
FT                   STRFLSALILETPPNLLRSLASLFTNNIVRYLTFSQLVEETETVDLLVTPRTYYVLKLF
FT                   EVLVSSQYGPSAIVSLMLEFGITKDLLETYPLGISIPLKEALSTCQESPEFEWTSQTLD
FT                   LVGRKDLNKLLSDVDFSADINTDSHTSTQDLSSLLNEVLEDNENFSPWDGQSEAERMNI
FT                   TKLIFEADRRYFEITTLLHQTKTQTAYLKVDENVSEYDLVLQQRDLAVIVALRTLTIPL
FT                   GRAALVYASRRPLLTEKFPIPKFNLNTLILPTMTNIVYSEDRVSKSFSEWGHFHNGVSS
FT                   GLSIGPFAKGISGSWIIFNKPPELNSQHAGFLLGLGLNGHLKRLEEWHIYNYLGPKHPL
FT                   TSIGLLIGMAASLRGTMDNKLTKVLSVHAVALLPQGANDLNVPTMVQTAGLIGIGLLYL
FT                   ESQHRRMSEVLLSQITASVLQNDTEQVHEGYRLAAGIALGFVNLGKGDDLRGLNDTHVI
FT                   DKLMALAIAMKDYQPVQESGKSCCGAIIALAFIYLQTENSNVANKLKLPDTEQMLDYIR
FT                   PDLLFLRCLAKNLIMWNDISCTDTWITTQMPSSVAQKYMWGNESGFEHLDGDQLTYFNV
FT                   LGGACLSMALKFASSHNLEARDTVLKYLDKVMELSSKPALNYDQKIAYKGCINLQNILA
FT                   LCASIIMAASGDLEVFRRLRVLHNDTNKKMGFGCFMAINTALGFLFLGGGQYAFDSSPF
FT                   AIACLVTSLYPIYPTENSEYEIHLQALRHFWALAIQPRCLIVRDISTGRPCKIPISINM
FT                   KNGSVIESISPCLLPDINDILTLKTNSSAHFEVVLDFSLNSEVLEKFMQSLTLYVEKSN
FT                   NYTVLKPNVRSILSNYSRRVKPDEDTTNFSSLQLLGNLEENARAAWYHENTNHVESDLC
FT                   SSSVRSGLSLFNIIDNQLELINNAQTPKSVEDIWNLKLLFEYANDIARNNKLNYISLEF
FT                   IEGLRHKLWRVRN"
FT   CDS_pept        112090..113862
FT                   /transl_table=12
FT                   /locus_tag="CD36_00540"
FT                   /product="phosphatidylserine decarboxylase proenzyme 1,
FT                   mitochondrial precursor [contains: phosphatidylserine
FT                   decarboxylase 1 beta chain; phosphatidylserine
FT                   decarboxylase 1 alpha chain], putative"
FT                   /EC_number="4.1.1.65"
FT                   /note="Similar to S. cerevisiae PSD1"
FT                   /note="Similar to C. albicans PSD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44317"
FT                   /db_xref="GOA:B9W6L2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033661"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L2"
FT                   /inference="similar to AA sequence:UniProt:P39006"
FT                   /protein_id="CAX44317.1"
FT                   /translation="MPLKPISFKWSETSVRSVPNLFMYGRDNINKPLSRASQMAERIHQ
FT                   QTPSSTNYQQKRYFSYYYYQFPKIPRPKRNMLYYSTWSRNPVTNGTNTNKSSKRHMLPF
FT                   GNFKISKRSFANANQKLKTKFKKLKMGKERRRFIRWWTVTSLTIVLGGVYAKIKYERGD
FT                   HEENPYKIRPQSWHLYAYSTLPLKTISRLWGQVNSINLPVWIRSPSYRVYSAIFGVNLD
FT                   EMENPDLSSYKNLSEFFYRDIKPDARPIADGDLVSPADGKVLKFGVVENGEIEQVKGMT
FT                   YSIDALLGIDTGKLAAPTHSLSFDYNSDDETIVKRDEEFAKINGISYSMDDLVGGNSKT
FT                   TYHMNELTYKDEHDGTAAGERASFSKELRVAEELTPNPVEYFRKKNLYFAVIYLAPGDY
FT                   HHFHSPTSWVTTLRRHFIGELFSVAPFFQKTLQGLFVLNERVALLGYWKYGFFSMVPVG
FT                   ATNVGSIVVNFDKDLKTNDIYEHEVYSSASSVNENTPLLDQKDYSANDILTFTNSEYED
FT                   KKRKKLRKNTVYEATYTNASRLLGGYPLSKGQDIGGFKLGSTVVLVFEAPENFKFNLKV
FT                   GEKVKVGQSLGGFV"
FT   CDS_pept        114185..115126
FT                   /transl_table=12
FT                   /locus_tag="CD36_00550"
FT                   /product="RAM signaling network component, putative"
FT                   /product="transcription effector of cell separation genes
FT                   in the daughter cell, putative"
FT                   /note="Similar to S. cerevisiae MOB2"
FT                   /note="Similar to C. albicans MOB2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44318"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L3"
FT                   /inference="similar to AA sequence:UniProt:P43563"
FT                   /protein_id="CAX44318.1"
FT                   /translation="MSFLNTIRGLGRGSKKNKKDLEPSNNSIYSHSNLSGNGLRRTQSP
FT                   TKFSPSKLSSKGTPGSAQYTSSPTKRSRTGQSLQHQDSSSSLQYGHQSGSVSPSKRSSI
FT                   QTTKTTIVNVDPPLFLCEPYVKTALVKGSFKTIVQLPKYVDYCEWLALNIFELFNHLNR
FT                   FYGVIQEYTTPEAYPTMNAGPNTNYLWVNSSGQAVNLPACQYIEYVITWVTNKLNDQSV
FT                   FPTKNGGAFPPNFIKDCKNISRQMFRIFAHIYHNHFDKIIHLSLEAHWNSFFAHFISFV
FT                   KEFNLIDRTEMEPLLPLIENFEQQGKITQVGK"
FT   CDS_pept        115499..117244
FT                   /transl_table=12
FT                   /locus_tag="CD36_00560"
FT                   /product="D-lactate dehydrogenase [cytochrome],
FT                   mitochondrial precursor, putative"
FT                   /product="D-lactate ferricytochrome c oxidoreductase,
FT                   putative"
FT                   /EC_number="1.1.2.4"
FT                   /note="Similar to S. cerevisiae DLD1"
FT                   /note="Similar to Kluyveromyces lactis DLD1"
FT                   /note="Similar to C. albicans DLD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44319"
FT                   /db_xref="GOA:B9W6L4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L4"
FT                   /inference="similar to AA sequence:UniProt:Q12627"
FT                   /inference="similar to AA sequence:UniProt:P32891"
FT                   /protein_id="CAX44319.1"
FT                   /translation="MFTKFRPPVRQLTGVFRSYSVKSKVWLPPKTSRYLIIGVVFLGGG
FT                   IAIGTHNGRSTNGKDFSTTPLSTLDSPVYATEHEFQTGLAKIANLVGADNISRDKRTLQ
FT                   SHNDSFFSTHHPPNPEVQAPGAIIYPNSTNEVSEILKIANKFRIPIVANSGLTSIEGQN
FT                   IHTRGPYSISISFQRMNNILAFHPKDLDVVVQPGVCWQDLNEFLSSNPEGKHLMFGPDP
FT                   GPGANIGGMVGTSASGTNAFKYGTMKENVVNLTVVLADGTVIKTRQRPRKSSAGYDLTR
FT                   LFIGSEGTLGLVTEATVKLHVRPKYELVSVACFSTIKEVAEMASDVIAQGVSPNAMEIL
FT                   DETMIKFVNESTSKKQLESPTLFFKLGGSTKDSILEQSKMIQNIGWKHKMLDFKTSSSE
FT                   EENDELWSARRNGFWSTFEYGKKILHDANDVQGWGTDIAVPISQLAKVISQTNDDLISS
FT                   GFNKKFSIMGHIGDGNCHFLILYNSPDYYKVKVLVDRMVNRAIEASGTCSGEHGIGVGK
FT                   RRYLATELGETAVDLARTIKLSLDPNRILNPDKIFMIDPQDDLDNQLDEGSLLNNTSSG
FT                   CNHQH"
FT   CDS_pept        complement(117433..121335)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00570"
FT                   /product="DNA-directed RNA polymerase, mitochondrial
FT                   precursor, putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to S. cerevisiae RPO41"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44320"
FT                   /db_xref="GOA:B9W6L5"
FT                   /db_xref="InterPro:IPR002092"
FT                   /db_xref="InterPro:IPR029262"
FT                   /db_xref="InterPro:IPR037159"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L5"
FT                   /inference="similar to AA sequence:UniProt:P13433"
FT                   /protein_id="CAX44320.1"
FT                   /translation="MLSAQRSLVKRITGVRLQFRMLHHTTKASSATSQIDKTSVGNFNQ
FT                   SETLSKVMSPLLSINQKKDVPSGLKHDNNKITYRSYLNLDSEKYNLDEEEKIVKYYSSK
FT                   NDGVELQPYAPEIQYLKNILESFSEQKYFDKIDQVLRSLSKLVTTTEFTDICNKYLENI
FT                   LQDDSLSLQDLNNLIGQLQDKCKFKTNTRTEAMILGKMLNDSDNVESSINDFFGNMEKQ
FT                   TIIEILRNMDVIGVDNLYKVFDCDSIDASVIPKELQEIYQEHKLREHDDVIAEDILKLQ
FT                   ENKQINPLDKKNLEELLAVDSFGLKVIRHSLLGLKPDSEAALEFSNQVEKIIEDMDDEA
FT                   LKHDIMNGQMNYFEMYSKLKTDEQRHAFNEALNVYNLDRQKQIEIRGIEGAKEKWKHDF
FT                   EESHKRGDLNLSKGLNAQCYEWLQDMLPVLEKEYKQCEALINGNNAVIEKDDPNAKDRA
FT                   MYAPFLLKLSPDKAIIVTILELFKLHATGGVISGFRAYKAIQSVGKAIEAEYRIGLQAK
FT                   KENKLFSRKHLSPQLQKLMRRTMQKGNESTPEWDDATRARIGGVLVSILMSVAKLKVTR
FT                   ETPQGLIEDSHPAFFHSMQFIGGNRVGVIKVHTEISNILSGTSLTESIQPQALPMLVEP
FT                   KPWNSYYGGGGLYSKTPLVRVRDSPETEAYIKAANERGNLKAVFEGLNVLGKTAWTVNK
FT                   KVFNVISHYWNSGEEFLSIPPVSEEPRLPKDVPDNSDPEVLLNYTMSKFRALDEYMSNK
FT                   SQRCDNNYRLEIARAFIGEKLYFPHNLDFRGRAYPISPHFNHLGGDLTRSLFLFWDGKE
FT                   LGEEGLRWLKIQLANVYGVDKESLTKRVEFVDANLEKVFASAADPLASNAWWQKAEKPW
FT                   QALSVCFELAEAYKLDDPTKFVSHLPVHQDGTCNGLQHYAALGGDVEGANQVNLKPADK
FT                   PQDVYSYVAKLVEARVRADAEKGDEFAIFLQDKIKRKIVKQTVMTNVYGVTFVGAIEQI
FT                   RKQIAHLYPRDADHNMPARYLARQVFASIRELFENAHFIQDWLTESAKRITKSVSLDFG
FT                   ESKYLESELLSTVIWTTALGLPCVQPYRQHKKKQLKTAVQDMHIIVPSNTSAVDSRKQQ
FT                   NGFPPNFIHSLDATHMLMTATKCTENDLQFASVHDSFWTHAADVPQMNKIIRDQFVKLH
FT                   TTNLIELLKEEFTERYKDNYQVLPLPNTHELTRKVKAIKKEWAEALNRPVQIADELYME
FT                   RKRLQMLQSDDPEEVEVAKNMETTISVTMNYKPYEFANRHAANSYQVLVPLQFPEVPRK
FT                   GGFDVNLVKQSQYFFS"
FT   CDS_pept        complement(121883..122569)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00580"
FT                   /product="ESCRT-III (endosomal sorting complex required for
FT                   transport III) subunit, putative"
FT                   /product="vacuolar sorting protein, putative"
FT                   /product="DOA4-independent degradation protein [1],
FT                   putative"
FT                   /product="vacuolar protein sorting-associated protein
FT                   [VPS32], putative"
FT                   /note="Similar to S. cerevisiae SNF7"
FT                   /note="Similar to C. albicans SNF7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44321"
FT                   /db_xref="GOA:B9W6L6"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L6"
FT                   /inference="similar to AA sequence:UniProt:P39929"
FT                   /protein_id="CAX44321.1"
FT                   /translation="MWGYFFGGNSQQKKDLPKKAIVELREHIQTLNKKKNHLQQQMDDQ
FT                   DQLARKYVSSKQTTLAKSALKRKKGYESNLLKVENQIETLETQLISIEGANLNLETMKA
FT                   MKQGAKAMKQIHGEYDVDKVEDTMDEIREQVELADEISEAISRPVGNEFVDEDELDEEL
FT                   KELEAEAKEQEQAQEHKVPAQKAKPQPVSREEELPQFPSVNKKAPVVEEDEDEEALKAL
FT                   QAEMGL"
FT   CDS_pept        complement(123078..124091)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00590"
FT                   /product="ER-Golgi vesicular transport cis-Golgi t-SNARE
FT                   syntaxin, putative"
FT                   /note="Similar to C. albicans SED5"
FT                   /note="Similar to S. cerevisiae SED5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44322"
FT                   /db_xref="GOA:B9W6L7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR021538"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L7"
FT                   /inference="similar to AA sequence:UniProt:Q01590"
FT                   /protein_id="CAX44322.1"
FT                   /translation="MSTSIQNRTIEFQQCVSTYDKINKKQNKHLNNSSALSTPKKSYFS
FT                   QQAGLIAKDISHVTELLSKLAVLAKRKPIFDDKPIEIGELTYVIKQDIFKIETNIQNLQ
FT                   KYLKGDTSVSIDAQTTQFSKNVLTLLNSKMKNVSGEFKNVLEIRQKNEIINKNRTENFL
FT                   SSVSASRSSNNQSPLVDNPNASLSNLSENPFLASSPPEHLPYDPDADPDTSSPYGVSNN
FT                   GEYLSLPSQTQQMLLMEEQQYGNQQYLQQRNRAVESIESTINEVGNLFQQLATMVSEQG
FT                   EQIQRIDANVEDINMNITGAQRELLKYYAHITRNRWLFLKIFGVLIVFFFLWVLVS"
FT   CDS_pept        complement(124577..126319)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00600"
FT                   /product="C6 zinc finger transcription factor, putative"
FT                   /note="Similar to Sordaria macrospora PRO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44323"
FT                   /db_xref="GOA:B9W6L8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L8"
FT                   /inference="similar to AA sequence:UniProt:Q9UVG3"
FT                   /protein_id="CAX44323.1"
FT                   /translation="MFHVFDLASNETIATDDSQVHELQPTPSSDQQQIKLRTILKTSKR
FT                   SRTGCLQCRARKKKCNEEHPVCGSCKRRKVNCSWRVTSRFKILENGTKVNTNSTTPERV
FT                   RESDCTAINHQSIDTNLSDQTSLGECDPESDNTDITNLNRNSSSISPKYLFEPGYDFSD
FT                   LSFLEYCTPSPINSHIFQPFKYLNIQGLYFLDGFIANVAKKFSIGHESSNYILKTFYQL
FT                   SEEHEAVSYALAAWGGVFIEGGFTENVNHFLGEAILKMSQEYPNLNNIAKKDVYILLNY
FT                   YLVYVGLQVCAGDVSQWHQIFHRTIDLVKKQGGLSSIIEMFDCSNEIKWLLSDIQYHDI
FT                   LSSNTFHKGTLLPMEEYNSVFKEAKILELGNYGLDPFQGCIQPIYLVLGEITSQAVELR
FT                   HWQTQIEYKGDMTSRLEFYHKADKCYRDMSCKISDCIPNMEQMKLIKDDRYELELHLTL
FT                   FEIYSLTCQLCLNYLIKKLPANTLDMQLLLLNCLASIDILIGTKMKSALSFSLLVCGIT
FT                   CCSKSDRSNMLQRFETVSNDYKAGNVKLIKNIVEKVWERNQEGQFCIDWLTICQENNWN
FT                   ISFC"
FT   CDS_pept        127747..129870
FT                   /transl_table=12
FT                   /locus_tag="CD36_00610"
FT                   /product="sphingomyelin phosphodiesterase 1 precursor,
FT                   putative"
FT                   /product="acid sphingomyelinase 1, putative"
FT                   /EC_number="3.1.4.12"
FT                   /note="Similar to C. elegans ASM1"
FT                   /note="Similar to C. albicans ASM3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44324"
FT                   /db_xref="GOA:B9W6L9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041805"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6L9"
FT                   /inference="similar to AA sequence:UniProt:Q10916"
FT                   /protein_id="CAX44324.1"
FT                   /translation="MFLPVLYLFAILVLSVQAHTVPGFDSLQIQSSLSKRANLIDSIYN
FT                   DLSDAETDFIGTHLKNLTNYNATKCDQCKYRIKYGKSLIEEYPDKSHLVSLLLFKHCLV
FT                   INNNTESKCDNVDFFVSTDYKNFQKFNDDFDSGIKQVGSVNFFDNDFLHMLKNFNVSSD
FT                   LDLEYYCYFKGKGACKMPATKDVEKLWGISKWWPEKKPEHYSEPQYKNNSEIFNVLHFS
FT                   DIHIQLRYEVGAEANCTTTPCAAPESFNKQLLSNNYNFSSYYKHFSPNATNMEFSFYPD
FT                   AHYDENSQYIKGDYYDFPLYRGWNFKNAPATSFGGYLTDSPTVLMNSSLIHMAEMHKEK
FT                   NFEFAIFTGDVVDHLLLSCTPEYTKEEEIKSFKAMKFFFNNLTVLPALGNHETGEYGQL
FT                   SPIAYDFNGSYSWNQDEMVDLWINNEWFPAKDRYDLKSHYAGFSYVTNRGLKVIGLNSN
FT                   AYYQKNLWSYIDLSTNPDLFGQWEFLVNELIESEKKGQRVWIMAHIPTTDYDTLPLQSR
FT                   IFGKIVERFSPYTIANIFFAHTHMDQTHILYSTNSSKEAEDIINMSWVMQSVTPLANYN
FT                   PSWRYYEVENESFNIINSFNYMTKLNDTFINGGQEPVWEFEYSARDLYDPKKTWPEKAP
FT                   LNATFWHNYVFARLKNESDIEFNQEFSNIRYRFGPGVPDCKNGSVISDTCYNENYCVVG
FT                   SFYSDDYQACLRN"
FT   CDS_pept        130203..133289
FT                   /transl_table=12
FT                   /locus_tag="CD36_00620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44325"
FT                   /db_xref="GOA:B9W6M0"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR040096"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M0"
FT                   /inference="similar to AA sequence:UniProt:Q6BSH6"
FT                   /protein_id="CAX44325.1"
FT                   /translation="MVWVNGCPKFSIDIPINEDIIDIAHIYHTPLLTVLTKSGVFVFHQ
FT                   HTLLPLASHVRNTQSIETNGYNVQMKTKHVSVNTAKLQKLSIVNLFIQSENNFLIIYQI
FT                   SINYSGSLYEIHNKNDELIQNGLPLSSTSSGLFSVTDFFKSATKSIIHGTEEVSVNLEN
FT                   IENINNGTIEDEIGGFEIEPIKLSIFKILKIGIGLQDFWLQENSHTLYIFNNQDEKTPD
FT                   NEDDFFQVINVLNFKNKLFSLSEFTWYDSNSRIKYITYNEYFNYFIFVNKKNEIWIMYL
FT                   ENNQDMGYKIGTGDIDNISFNPQCNLLIAKENNNNNNNNNTSGNSTLNTYMLKKKSLQF
FT                   LKNLNLNGEIKWSPCGQFFTLLEESGSWKLLSKFGSISFDSQEILNEFDESNDANREFL
FT                   KAKTIVISENASILYVVTDKKIFYTPLMRSNGGLLYDHEYISVIQSDKRLLRFPILAKY
FT                   KKIILNRGYFNGKINKNRNLNNQIGELCLDKNRHNQLSISFGDYLAISTPYSQGDSIYH
FT                   ILWFNFKNFFAESLNIIHHFWFQDFLIVVNRRSRHTFEENEDEENEDNGDYLVDEFMVL
FT                   DASKTKYGMGGEEISFTSDSLMWKYDFKSTFIDINLSEPTKGKGQVVILTSDHRLIVLD
FT                   LSTNRLIKSDTDIKHYKIFISVNKTVNLSSINTKIELNEVVQTSMINNRHFLFLLSTGD
FT                   IYLLKNQQSRTTSIRTNPVESMKPSNIYDLVKLHSNIEFFKFKTIKFENEIEFIYLFNG
FT                   QEILVYEVSELIEKSYDNNNNNNNDNNDNGSINKPEDVLEFEEEMGKLLPICIHTDGMQ
FT                   PFEFDAIFNHKSLDLIGLNTLAINKPKSGGLFIRNTISRKLILNNFIEFDLLHKGDLES
FT                   SFKKYANFQNFHYCLELLLFKHLTNDDYLPLKRLFQLIEFTENSEGIYINCLRKIEIGY
FT                   WHRFFNALETTPEKFMKRLIAIDNVELCYNYLIIYLNYKNEGDTETDELNDHDKQVILK
FT                   IIKMLESSSKWDWCFELCRFIKILEPSGDFLRQVKKELE"
FT   CDS_pept        133607..133972
FT                   /transl_table=12
FT                   /locus_tag="CD36_00630"
FT                   /product="NADH-ubiquinone oxidoreductase [14.8 kda]
FT                   subunit, putative"
FT                   /product="complex I subunit, putative"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="Similar to Neurospora crassa NUO-14.8"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44326"
FT                   /db_xref="GOA:B9W6M1"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR016488"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M1"
FT                   /inference="similar to AA sequence:UniProt:P42114"
FT                   /protein_id="CAX44326.1"
FT                   /translation="MTLATQFAETTRYSTSNPELKRRVLHLYRKYIRNAKEFADLYELD
FT                   MPISNIKTKIRQEFERQRFGNDLSVNNVLLMKGQMEFQELINFWKQQCHVMRYFDEQNS
FT                   YNVVDKNDFVKNFLRGN"
FT   CDS_pept        complement(join(134451..135752,135855..135890,
FT                   136201..136212))
FT                   /transl_table=12
FT                   /locus_tag="CD36_00640"
FT                   /product="tubulin beta chain, putative"
FT                   /product="beta tubulin, putative"
FT                   /note="Similar to S. cerevisiae TUB2"
FT                   /note="Similar to C. albicans TUB2"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44327"
FT                   /db_xref="GOA:B9W6M2"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M2"
FT                   /protein_id="CAX44327.1"
FT                   /translation="MREIIHLSTGQCGNQIGAAFWETICGEHGLDNNGTYVGDNELQKS
FT                   KLDVYFNEASSGKYVPRAVLVDLEPGTIDNVKTSQIGNLFRPDNFIFGQSSAGNVWAKG
FT                   HYTEGAELVDSVLDVVRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRM
FT                   MATFSVVPSPKVSDTVIEPYNATLSVHQLVENSDETFCIDNEALYNICQNTLKLPQPSY
FT                   AELNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTSLGSKSF
FT                   RSVTVPELTQQMFDSKNMMAASDPRNGRYLTVAAFFRGKVSVKEVDDEMHKIQTRNSSY
FT                   FVDWIPNNVQTAVCSVPPKDLDMSATFIGNSTSIQELFKRVGDQFSAMFRRKAFLHWYT
FT                   SEGMDEMEFTEAESNMNDLVSEYQQYQEASIDEEELEYADEIPLEDAAME"
FT   tRNA            137133..137224
FT                   /gene="tRNA-Pro (TGG)"
FT                   /locus_tag="CD36_tRNA_0002"
FT                   /product="transfer RNA-Pro (TGG)"
FT                   /anticodon="(pos:137165..137167,aa:Pro)"
FT   CDS_pept        complement(137377..139200)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00650"
FT                   /product="serine/threonine-protein phosphatase 2B catalytic
FT                   subunit A1, putative"
FT                   /product="calcineurin A1, putative"
FT                   /product="calmodulin-binding protein 1, putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="Similar to S. cerevisiae CNA1"
FT                   /note="Similar to C. albicans CNA1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44328"
FT                   /db_xref="GOA:B9W6M3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M3"
FT                   /inference="similar to AA sequence:UniProt:Q12705"
FT                   /inference="similar to AA sequence:UniProt:P23287"
FT                   /inference="similar to AA sequence:UniProt:Q9DEF7"
FT                   /protein_id="CAX44328.1"
FT                   /translation="MSGNTVQRNTEQINNALNAIQHRRTTTGNDLNHTNQRIISQNSIN
FT                   DKDYTIYITDDGEKYSTVERAVKSVDPPVTFKPKDEQVFLSNGKPNHQFLKQHFIHEGR
FT                   LHEHQAIQILKQATHLLSKESNLLNVPAPVTICGDVHGQYYDLMKLFEVGGDPATTKYL
FT                   FLGDYVDRGSFSIECLLYLYSLKINYPDTFWMLRGNHECRHLTEYFTFKNECLHKYSEQ
FT                   LYEECLVSFNALPLAAIMNEQFFCVHGGLSPQLTSLDSLRKLHRFREPPTKGLMCDLLW
FT                   ADPIEEYDEDNIDQEYVTNVVRGCSFAFTYKAACKFLDKTKLLSVIRAHEAQNAGYRMY
FT                   KRTKTMGFPSLLTMFSAPNYLDSYNNKAAVLKYENNVMNIRQFNASPHPYWLPHFMDVF
FT                   TWSLPFVGEKVTDMLVSILNVCTEEELDEDLPFSESEIGVATKTTKTTTPVSPVSPKAH
FT                   PPSTRITSPYKSTKLVESDNNPNTNNDDSEMTLEEKKQALRNKIIAIGKMSRMFQVLRE
FT                   EQENVAHLKELNRGSLPKGSLLHGVDGLKNTINSFEEAKAADRINEALPPSPEDIQRLK
FT                   QEKNTRIRQQIENQEMSGPVFQRLIRRLSQS"
FT   CDS_pept        complement(139826..141310)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00660"
FT                   /product="ornithine decarboxylase, putative"
FT                   /EC_number="4.1.1.17"
FT                   /note="Similar to C. albicans SPE1"
FT                   /note="Similar to S. cerevisiae SPE1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44329"
FT                   /db_xref="GOA:B9W6M4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M4"
FT                   /inference="similar to AA sequence:UniProt:P78599"
FT                   /inference="similar to AA sequence:UniProt:P08432"
FT                   /protein_id="CAX44329.1"
FT                   /translation="MKNTIIENDSEIKLQNDLNHHIGISSSNSVTTTTATNINNNNNNG
FT                   QLIVEKTLKAINLIENSIKNHISKIDYENCLPNDEDSFFVCDLGEIINSVNQWKQQLPM
FT                   IQPYYAVKCNSNFKVLTLLNELGINFDCASKNEIDLILSLNIQQAHQKIIYANPCKTNS
FT                   FIRHAANENVNLTTVDNIYELYKLAKFHPHCKILIRLITDDSTAQCQLSSKFGCELNIA
FT                   IKEILPKAKELGLQIYGVAFHVGSGAKDFNSIYQAIKNSRILFNEMLSLGFQPKLLDIG
FT                   GGFERETFLQSSQMVKFALSKYFPQEFIQSNEIKFIAEPGRFMVANAFTLITHVIARRD
FT                   LSTQTTAAAGAATVMGSNGNDIVPSAMLYINDGVYGNLNCILFDHQNPKVYVLTNQNQL
FT                   FYKQEMMMKSLLIDTSANNNNNNNNKVDGFNFSIWGPTCDGLDCVSSLVKLSKNVQVGD
FT                   WLFFENVGAYTSCASTKFNGLSNGETKTLYVNSNEE"
FT   CDS_pept        complement(142254..144851)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00670"
FT                   /product="endosomal protein, putative"
FT                   /product="vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae VPS27"
FT                   /note="Similar to C. albicans VPS27"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44330"
FT                   /db_xref="GOA:B9W6M5"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017073"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M5"
FT                   /inference="similar to AA sequence:UniProt:P40343"
FT                   /protein_id="CAX44330.1"
FT                   /translation="MSWFGRATSDTPVATISQIELDNKIIEATSESIPNGEIDLSIAFE
FT                   ITDLIRSKKISTKTAMRSLKKRLNLIYLNPNLLLSSLKLIDLCIKNCGFAFLIEISSKE
FT                   FMDYLIDFIFKIHYNTKELTYDSHRSDGGGNGNGGGDVGDVGNKIKIGQTILSYLQNWK
FT                   IIFENQQQLQYVEKKYQELKNQGFEFPNKHTNYNDYDDQIIQLNSKFIVDSEVPPDWVD
FT                   NEECMICYSPFSMLNRKHHCRACGGVFCQNHSSNNIPLVNLGIMEPVRVCDNCFVKYDK
FT                   SKNHLRNENNLSRSIQNDTYGSRRSRNDQVNVVVDDEEEQIRKAIELSLKESSGTESRL
FT                   PPPVENTEPETISNDDDDDEDEDAQMKAAIAASLKEYETEKSRYSQYQQPQSTNQPTQP
FT                   TQPESDLYNISFPTFSSSSNYPQPQFTAPLPPPQNQQQQQQQQISSTGQSVQPQDLSQT
FT                   EEEQINLFITLMNNIKNDSRKQKDIMYDSNLNELYGKVIKFRPKLNKSLRNSIEKYETF
FT                   LEMNNKISTITRLYDQFLEQKLNMAYGNHHINTLPLQQQTENQFTGGQQQQQQQLHLPA
FT                   QGTGYLRYGSDINVPQQQQQAVSPISPNEFYNNLPQHTGFQNYPSYQQNQGPQIDNSYL
FT                   SQQPSGASTKQQQQQQQQQKQQQQKPPTQTYPTQLQPSEPDFEDDRDENENENESVNTP
FT                   RFKVSTSSGGTRPVYPTNDFIPDPYNNKSTTSATITTNGEDNYVAVSLPHYPPPEDLNN
FT                   ELPPQQHYVRRASSSLPANAYEDASLKYPTLENVEYDYNKKKKREEEEEEENQNKNQRQ
FT                   QSDKAKIKENDFPDISKVSQFNRHEEGEERKRSSSSENSNKKYVVEPEPLIEL"
FT   CDS_pept        complement(145718..146500)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00680"
FT                   /product="cell wall function protein, putative"
FT                   /note="Similar to S. cerevisiae ROT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44331"
FT                   /db_xref="GOA:B9W6M6"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M6"
FT                   /inference="similar to AA sequence:UniProt:Q03691"
FT                   /protein_id="CAX44331.1"
FT                   /translation="MIFSRYFIPIIFTLLSSSSIFVYGDPNMEELEGTWSSKSNTVFTG
FT                   PGFYDPVEELLIEPDLPGISYSFTKDGHYEEALYRVKPNPKNHSCAVASVSYQHGKYEL
FT                   LSNGSIILTPIAVDGRQLLSDPCNSDDPNKSTYTRYIQPTWFKTYQVFVDPYHGRWTLQ
FT                   IYQFDGSKMQPLYLAYKPPIMLPTTALNPTDEISETASTLNGISHKIKRNRLKIKRSLE
FT                   NQYRTNAKREIYNEQFDKYWWSSVICLALASSYFFLKR"
FT   CDS_pept        complement(148291..150699)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00690"
FT                   /product="[G1/S-specific] cyclin, putative"
FT                   /note="Similar to S. cerevisiae CLN2"
FT                   /note="Similar to C. albicans CLN3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44332"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M7"
FT                   /inference="similar to AA sequence:UniProt:P20438"
FT                   /protein_id="CAX44332.1"
FT                   /translation="MINITRPLTPKSIGKSISQHPYKSIQTKSNQQNNNNNTTTTTTTS
FT                   SKSFVQEKYPSQLYESEIKIHNQSLAEYDLDIYDIMVDLIETNKPNLTLYKQQPYLTFT
FT                   IRLKLIDFLLKMSIRLKILPFVFFKAVKIFDRYCSKRIVLLDQSQLIITTCLWIASKIM
FT                   GGNNHFVNINNLDKIGHENFRTISDLGYGCGGKYLGPTERFRLPKLHELVKLCGAKCKY
FT                   DQGMFKQMEVHVLNTLDWSLNDPSIEEFIIDSHEFNITNINSHEYENNNITTTTTTTTT
FT                   NTTIESDNNDGNEFFKIKEFLSYAALYSHDLIDTNIIELGQVIMDLINETFQLQPCDNH
FT                   YQTILNCDSQYPIRFDMNRYKYIKKAMIKSVLNASDFMMKIFNSKGPQYIYEQFNLQYK
FT                   LNYHTNSIIGFNNNNNNNNYSTTSSAIATSTSTSTSPATDNINTTPTNSNSNSNSSSGS
FT                   GSGVTTTPISSYIGYSSSRSSSVSSSSSAASSNANTPNSSSCSTTSTTPLGMTPHKRQK
FT                   NYSNSSSTSSTSSSSSSSSSSSGLNNGNSTISPVDSTTNSHMKNLSQSSQNYQYQYQYQ
FT                   YHINNKPSLSVSIPPPQMHSHNHHHHHHSTVYQMVTPPNSANKNSNKQSATNNNNTTTT
FT                   TNGNSQLPAPHQLSYNNYFNSPNMQPPPPMKYTPGRKQQQQQQQLYQSDNSSINSKLNI
FT                   NNNSNNISSSAASIASSISTNNYDNDNDLFSSSRRFMNYSNYSSSTISGSVMSGIIGNG
FT                   NNNNNNNNGGNNNTDNSGVGVGGVGGVGTPISENDSPIYTKTRLCNMIH"
FT   mobile_element  complement(158304..163553)
FT                   /mobile_element_type="retrotransposon:huia D, Tcd16, LTR"
FT   CDS_pept        complement(158571..160565)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00720"
FT                   /product="transposable element gag-pol protein, putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44333"
FT                   /db_xref="GOA:B9W6M8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041373"
FT                   /db_xref="InterPro:IPR041588"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M8"
FT                   /inference="similar to AA sequence:UniProt:Q6RYC6"
FT                   /protein_id="CAX44333.1"
FT                   /translation="MPLLPFNPDADIHLHTDASKFAVAAVLLQRDPTDSSKFRPIEYRS
FT                   QKFRNNQYQWDIHIKEFYAVKWAFAKFRYYLEGRSFKVFVDQKSIPQIFNRYLSATAVN
FT                   SELDPKLQRWISSLFHYKFQMFYQEGASNVLADHLSRNPAFQPLPPSTAGASIELSLTD
FT                   DWLKLFKDAYLADPTFSSLYEQCCQSPAEVPDYNLSADGNLLYYQSKLCIPQRVLPDFL
FT                   WHTHMSPAAGHPGVRRWYQDIRTKFHFPDMYNTVLNYVASCTVCSRTKSNSHAPAGLLQ
FT                   ASHPVAGRWTDIATDIVSGFPTVTHENATVNAILTIVDMFTNRVHLYPISSSFSAEDFV
FT                   TLFMTKYFPYHGLPQSITSDRGPQFGSDFFQSVFKGLNVRSRLTVAMHQQANGRVENRN
FT                   KLIETYLRLYITENSQWPTLIPIAEYVLNSQPSTSLDHKSPFEVDLGYVPKSPVAMLFP
FT                   HNQESLSRQALDITESLARYTNAAVAAHAAAFQLAKKYYDAKHTDVEFEIGSEVFVDNR
FT                   FLNSHPDGHDSVLVPKLRTKFSGPFTILSKSGLVNYTLEMPSSYRGDPTFHISQLRLKK
FT                   TVPSNYLVAPSEPVAWKRYKDGSILVDVVAIVGHRKVGRGFRLAARHAPTTTHPDGEIV
FT                   EYMASALSRTAPDLVKTYVSAHGLPVPLK"
FT   CDS_pept        complement(160655..163426)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00730"
FT                   /product="transposable element polyprotein, putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44334"
FT                   /db_xref="GOA:B9W6M9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6M9"
FT                   /inference="similar to AA sequence:UniProt:Q94LP8"
FT                   /protein_id="CAX44334.1"
FT                   /translation="MEVLLPNHTLGRPQFPVLRVARSSALAFLVWAITTLVWTPQNWLW
FT                   ILKATPLDLNLRFPQWLSEIYFHSTITQFHQSSSPFMSNGVYSIKSPVCKTLDNLEVDD
FT                   LTDNWSLVVNSITVTPNTPQWFQVGIKLLSWVTNQWNFNFGAHTSVAWMFQFFSVLVVA
FT                   ITIFNFLLFFLLLPLRAGSAVFSWFFPKPKSPLLVKVQGLEKLTATINQIASRNKVHQA
FT                   PTRRTTWFQILASFFFSCFARIGYCVLWPFSFFTFFYHRFTPTVDKKHTTVLPSYRFYA
FT                   LDFSSRKNLIGSLIPQLRLGSFNGPLLHKQLMTAASEFHWADADAFRAEHHQFRKFKSH
FT                   REFFSWFLKWNVDPTVLQTYIVDAHDHAMTLVNPATTYYEVVQALRQLDSLPYLHFRFQ
FT                   KVMRYLLHSGVFSTPSIKSQLLALFNTCGSYYDFFAVLDAGLYEILPPLPDKPSERPAK
FT                   VRHYLRNGLPRSVRPPPVVTTLSAAVSSNKRSYFSKILIGSYTTTGFWDQGSTYSFVSA
FT                   ELVKELQLKVTPKQDRLHMTAFSSGPISIFDSTVHLEFTIPGIPTKFTHTFHVLSSQVA
FT                   PVLLGEDFWFKYGVLCQPGKQFKLGRFDIPIVTPDLQFFYSNTDNARVDDDHQDIPEDI
FT                   QTMLHKFQSSSPLLALPPSRESDYQIRIDPQATRPPNRPLPKYSIAAAEFLSQEVARLL
FT                   DLGFIRKFVSQVYAVAQVVPKKVAGQFRMVLDYRAINAITIPIPPHLPAFKNLVPGLHN
FT                   AKIFSTLDMKQGYYQLKIHESTQPHTAFRVPGGTYCFQVLPFGLTDAPQVFGSYVADLL
FT                   QEFAVFTRVYLDDILVFSSSLKEHYQHLFQVISKLHAHSHVLNWDKCVFGQPSVTWIGH
FT                   TISANGIAPTDTSIGQIKSIGIPTTKDDVRAFMGHLAYLQELFPISMLALHH"
FT   CDS_pept        165622..167079
FT                   /transl_table=12
FT                   /locus_tag="CD36_00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44335"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N0"
FT                   /inference="similar to AA sequence:UniProt:Q5ABQ0"
FT                   /protein_id="CAX44335.1"
FT                   /translation="MYMCLVDSFQNSLRAWGDEGEKKKQHKSTQIKTLTIFFKSSFTFH
FT                   SRFQLNSLYSIYNMWKSLLGLDNDDSKLINQPTIDYNTISSPSKQQQQQQQPQQPQQQP
FT                   QQPQQPHNNNPLNNKPNNQTYGTVIDYSDLEDDNDDNDDYEYLDLDNDIKTNTRLINQW
FT                   RNNKIHSNNRTTTTVDAVDNQNGSFNYYHKPTSTSIFTNVSLPDQYPGKFPHLNKHTHN
FT                   DFKKNNSIDLLSLQDSKQQEKQQEKEYESIIDAKIQALQKEIDNNNDNDNDNDNKPFQN
FT                   ITTTNTTSSSSGSASNIIDEINNLQLKITSQTETLREINDLIDIYEYEYEYEIDLSSST
FT                   TSINLQKLIINYKDYQNLKNDYINELNRVKKLYEAYYLLFNRYITLKKDYKKKYHQQHH
FT                   QQDKDKEKEKDKEKVILSKKKKNNDDDDDDDDDKEIGSNNKNGHKYDDGNIILIKEKIN
FT                   QIKFKSNDLSIKNICDELLNDVTKFGK"
FT   CDS_pept        complement(169961..170614)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00750"
FT                   /product="c-8 sterol isomerase, putative"
FT                   /product="delta-8--delta-7 sterol isomerase, putative"
FT                   /note="Similar to S. cerevisiae ERG2"
FT                   /note="Similar to C. albicans ERG2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44336"
FT                   /db_xref="GOA:B9W6N1"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N1"
FT                   /inference="similar to AA sequence:UniProt:P32352"
FT                   /protein_id="CAX44336.1"
FT                   /translation="MKLLLIGIIPIALYAIFNYLFYTWLPTNYLFDKEILQQLVQETLK
FT                   DHSDGNSTAIMIDLTFKIQKQYPNIINDLNFNDWVYNNAGGAMGTMFILHASISEYLIF
FT                   FGTAIGTEGHTGVHFADDYFTILTGEQRAAYSGSLIPEIYLPGDQHHLPKGHVKQYSMP
FT                   GESFALELAQGWIPAMLPFGFLDTLTSTMDFHTFYLTAYFTGKDMIKNLLNGKF"
FT   CDS_pept        171130..171873
FT                   /transl_table=12
FT                   /locus_tag="CD36_00760"
FT                   /product="UDP-n-acetylglucosamine transferase subunit,
FT                   putative"
FT                   /product="asparagine linked glycosylation protein,
FT                   putative"
FT                   /EC_number="2.4.1.-"
FT                   /note="Similar to S. cerevisiae ALG13"
FT                   /note="Similar to C. albicans ALG13"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44337"
FT                   /db_xref="GOA:B9W6N2"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR039042"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N2"
FT                   /inference="similar to AA sequence:UniProt:P53178"
FT                   /protein_id="CAX44337.1"
FT                   /translation="MKSILITTGATITFKSLIEIILSPQFLNNLINLKINKLIIQYGHE
FT                   IKNSINLSEIFFNEIINKYNLINLFNLKRKEISTIGNNDNDNDNDNNDDDNDDEGIQLF
FT                   KNCDIEILAFSYSSNINKYIEKIDLIISHGGTGSIIDSLYLNKPLIIIINDKLMDNHQL
FT                   EIAQQFKKLNYCIYYSIKDLKKYVNVNVNANVNNNDNNDNENMDNNEFWNQLNQLINGN
FT                   LILKKLPQTNGSIIETIICEELDKN"
FT   CDS_pept        172224..173339
FT                   /transl_table=12
FT                   /locus_tag="CD36_00770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44338"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N3"
FT                   /inference="similar to AA sequence:UniProt:Q6BSC8"
FT                   /protein_id="CAX44338.1"
FT                   /translation="MNNHNIILEIINDSSLSKIDKLYQLQNVITTLSKNDLIELNVSSS
FT                   ISINNECFKLIINLLKVELLMINYPKEPLIKTIMEQDLLMNTTGVKLTTTTTHENNFNN
FT                   INDDQLINIFIKTKLNDLQSDYQYLFKELKYDNFIDLINKKMLILNNLNNSNNNNNNNF
FT                   RDLKDKLNLKILQLYLLSNYDFRNDNILNHLINEIHVQQQQQQQQQHSTNTIINNPSIE
FT                   ILKQVQSQPFVSFELFNIIINHNFNNGYYNIINQLMKFDKLYHNIIENNIIKLTNYFIN
FT                   LKIKTIYQLFELSSKSIIDNYPIIDIESIIFDMIIKNKFKNITTIDQLNQTINFNNDLQ
FT                   NKINNNQHDNNNDDDGIKYIGGLVNEAYMKI"
FT   CDS_pept        174712..176514
FT                   /transl_table=12
FT                   /locus_tag="CD36_00780"
FT                   /product="MATE family transporter, multltidrug/sodium
FT                   efflux pump, putative"
FT                   /note="similarity to prokaryotic gene"
FT                   /note="Similar to Acinetobacter baumanii ABEM"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44339"
FT                   /db_xref="GOA:B9W6N4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N4"
FT                   /inference="similar to AA sequence:UniProt:Q5FAM9"
FT                   /protein_id="CAX44339.1"
FT                   /translation="MSDENEITPLLFPFTSHRSRRSSKCSEIDENEIVSYVQQRRQSIA
FT                   SVGHDKIPKSFALPVTTATGATGGGGTTTGGTTTSGVASPRLTRSISRSSLISGKSYSI
FT                   NDIIEIHQQEIDPEPKTTIFNEIKVIIKYSLPLIITFLLQYSLTVASVFSVGRLGSTEL
FT                   AAVSLSSMTANISGYAIIQGVSTCLDTLCAQAFGRKDYNSVGVHFIRCNYLLLLLYIPM
FT                   AIFWVFGTEPLLILIIGEESIAMCKLAGKYLKILTIGLPGFILFENAKHFLQTQGIFHA
FT                   STLVLIICAPLNGLLNYLLVWNKSIGLGFIGAPISVIITNWIMCFMLYGYIFFIDGYQC
FT                   WPQQYQYYKLYHKIFFQHWNKMIKLSIPGVLMVEAEWLAFEIITFQAAKFGTEVLAAQS
FT                   IISTTCVIFYQIPFALSIAAGTRIAWYIGAASKTAAKKSTYAVLYTATFIGFFNCGFML
FT                   TFRHNLASLYSEDNIVIELATKVLIVGSIYQINDCLSCATAGVLRGQGRQMIGGMVNLI
FT                   GYYLIALPFAYTLAFIFQYELLGLWFGMIIALIFVSFIQTYFVITSNWKKIIDDCIEEA
FT                   IIEDGNLNIDAHSILPSMSNSIIV"
FT   CDS_pept        complement(176895..178712)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N5"
FT                   /inference="similar to AA sequence:UniProt:Q6FM94"
FT                   /protein_id="CAX44340.1"
FT                   /translation="MSLTTNRIALSTIKDSHLNSSPSNTPSKDKKRPTLYNTNKPKSKL
FT                   FSPSHMRIRQPDLITKSFSIAHSATSLNKKFSPLRAVSFSDYRSTLSNKPSSSSTSSSS
FT                   PSNLKLQSTDDAFKNDTIGLAATKLKLKLQLALYKVQQNKQTRLKATKYYNNNQNYINS
FT                   YNHKIHKSNGHKSMAIKLNSILGSLESPPTSNRTSPVSAYESPNTTNNNNNNNNNNNNY
FT                   MFKSSTASLPTPPEQITAATTTTTANYYSHSINVNLNATPRFNKTKMLKNKKVGETINS
FT                   ATSTLNKVANSRTKNNKINKSSKLKLFQIKKNSIYYCSNQKKLPLIQNDIIHCNNQLKH
FT                   SNHLDITAAGSQSFNNNMSAPSSQGISGGNNMSFFTYYPHSQEQESSQNSTTTTTTNIG
FT                   ATRLPSITVDRTTSNNNNNKNNNYTQNSYYSGLGATNNALPSINKILKTPIRRANNAMK
FT                   QFSFQRSFNNAAPLVTTTTTTNNNNNNNNSYGNDETTIDEDNEMTIIQNTTINNTTIDQ
FT                   NATIVIDEKTEYDIDQEQIIQKNKHSANKKEEVEEEEEDKNEEENDDINSPSKQQDILT
FT                   SSPLSNQQFTTPNKFSVAKSLLQLGGHRM"
FT   CDS_pept        183032..183751
FT                   /transl_table=12
FT                   /locus_tag="CD36_00800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44341"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N6"
FT                   /inference="similar to AA sequence:UniProt:Q5ABE9"
FT                   /protein_id="CAX44341.1"
FT                   /translation="MSTTTTLSDAELKEICKPIVDVILKTIEEEERYNIRDVNDYIPTL
FT                   TFKNTKNKHVSYFLALGKFFRLKGFEEVFKFIYHPQDPNKFPQESWNERINMLVCNVLF
FT                   STAPDYQHQFHETLTGQQNLYYLMIVTKYVVPEYIARNKFNQLTYSPRMNFLRFQLKVT
FT                   EVTSLARRSGYPVNDRDVVMTIIGNMQKSPKTSVIGQTAYNLKKYESLFEFYDFLNMIR
FT                   EYGTSPLVLRAISLDLA"
FT   CDS_pept        184495..185496
FT                   /transl_table=12
FT                   /locus_tag="CD36_00810"
FT                   /product="autophagy-related E2-like conjugation enzyme,
FT                   putative"
FT                   /product="autophagy-related protein [3], putative"
FT                   /note="Similar to S. cerevisiae ATG3"
FT                   /note="Similar to C. albicans ATG3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44342"
FT                   /db_xref="GOA:B9W6N7"
FT                   /db_xref="InterPro:IPR007134"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="InterPro:IPR019461"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N7"
FT                   /inference="similar to AA sequence:UniProt:P40344"
FT                   /protein_id="CAX44342.1"
FT                   /translation="MSLRSKLSSLREYLTPINHNSNFVTTGEISPEEFVKAGDYLVYKF
FT                   PTWQWGTDCPKNLQKSFLPPDKQYLVTRHVPSYQRASNYLTGEDKKDGNPEEEDEEEDE
FT                   EGWVKSKKIHRVIDDDSYGTQINKSEEINDIDEFIDENAEEQEQEYDESEDHQLEDDDF
FT                   DDLDIINDSKNNKLRRFDLYITYSTSYRVPKLYLVGFDSNGIPLLPQQMFEDINSDYKD
FT                   KTATIENLPVAHNTTSVSIHPCKHSSVMKVLMKHSKLNKKNLQQKDDSLSNGLNKLSVN
FT                   EKGTTKEENSQSHDNEEEDEEGIRVDHYLIIFLKFIASVTPGIEYDYTMDAL"
FT   CDS_pept        186144..188279
FT                   /transl_table=12
FT                   /locus_tag="CD36_00820"
FT                   /product="phospholipid:diacylglycerol acyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.158"
FT                   /note="Similar to S. cerevisiae LRO1"
FT                   /note="Similar to C. albicans LRO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44343"
FT                   /db_xref="GOA:B9W6N8"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N8"
FT                   /inference="similar to AA sequence:UniProt:P40345"
FT                   /protein_id="CAX44343.1"
FT                   /translation="MSSLKNRKSTTDKDQNATTTTTSSSSSSSKVTKNNELKDNVETTS
FT                   FETDDKITKPVLEDEPSKHHHHHHHEHDHEHDHNNNNNDKESTSMSRTNSLQKKHHNKK
FT                   LVKHHSKKKITESRRVMFIFGALIGLILAALFTTNSESFTKDLDKLVNLDQFSDIFDDW
FT                   KDLKNLKGLLPNGIQSLLQDKGVNSQDDGFNGSAESFSVGLRLENSKNFTAEHNVVMVP
FT                   GVISTGLESWGTTTTGDCPSIGHFRKRLWGSFYMLRTMVLDKTCWLRHIMLDTTTGLDP
FT                   PNIKVRAAQGFEAADFFMAGYWIWNKILQNLAVIGYGPNNMLSASYDWRLTYIDLEKRD
FT                   GYFSKLKAQVEIVKQLTGKKSVLVGHSMGSQIIYYFLKWVEANGEYYGNGGPNWVEEYV
FT                   EAFVDISGSSLGTPKAIPALISGEMKDTVQLNALAVYGLEQFFSRRERVDMLRSFGGIA
FT                   SMIPKGGDKIWGNLTYAPDDEIVAFDTEKEDIGEKKRSFGSFIKYKAVNDTSREVTIDQ
FT                   SIEDLLGNSPDWYSKRVRENYSFGIAHTKEELEKNNHDQSKWSNPLEAALPKAPSLKVY
FT                   CFYGVGNPTERAYKYVPADKSTKLDYVIDADSPDGVVLGDGDGTVSLLTHTMCHEWQKG
FT                   DKSRYNPANVNVTIVEIKHEPDRFDLRGGAKTAEHVDILGSAELNELVLTVAAGKGDTI
FT                   QNRYVSNLKKIVENMHL"
FT   CDS_pept        190364..191968
FT                   /transl_table=12
FT                   /locus_tag="CD36_00830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44344"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6N9"
FT                   /inference="similar to AA sequence:UniProt:Q6BSF6"
FT                   /protein_id="CAX44344.1"
FT                   /translation="MMDNLNQDPNSDFTQHNNQHHQIQFSHNHNLHHQHQQQQLHQLSQ
FT                   LPTQPNEIHPQHQLPQMQQQQQHFQNQFQQQLFQPNQKHQLPSQQIPLLNSQSQPQPMV
FT                   RVPSQNPPSIMQSSPDPLIANGATPLSESLSMNRKHNDNSSDSRKICPFCKKHFSHRGS
FT                   LSRHLDLKKGDSLHPSNEVTIIRNQNRRRSSVDVNFSSIEKSESQSGGGTPLMTSESFN
FT                   GTNSISKSGKKRRVNKKSLAVSQISSDSASGQREKSKLRRKLRDRRIKAKILTNDWFHD
FT                   LFAQQPLPQFDNFDSNNNSQSSITSETFCQLVALYLPINDWPMTIPDENCINPTIERMR
FT                   VRESNNLIDLLNESFPIFQELTTLQKKQVWIGESQRILQASIGNFSLCDLYNIKGVIAK
FT                   REQANFEEICRNDKLSAFVEVENSPNQYGGIIGTADDEREADIEEELDDDEEEVNSIQV
FT                   EKVKQLSPQQQQEQKIRLKSNSNSNSNSGQVQSNTQSIPANFQNSSRIPAESYIHEIDE
FT                   VQNNNFDDFGTSFDKFY"
FT   CDS_pept        192200..194350
FT                   /transl_table=12
FT                   /locus_tag="CD36_00840"
FT                   /product="tail-anchored outer mitochondrial membrane
FT                   GTPase, mitrochondrial morphology regulator, putative"
FT                   /note="Similar to S. cerevisiae GEM1 (GON1)"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44345"
FT                   /db_xref="GOA:B9W6P0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013566"
FT                   /db_xref="InterPro:IPR013567"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020860"
FT                   /db_xref="InterPro:IPR021181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P0"
FT                   /inference="similar to AA sequence:UniProt:P39722"
FT                   /protein_id="CAX44345.1"
FT                   /translation="MSPDAIRVVVCGDDAVGKSSLITSLIKETIIEPQTNNVLPPITIS
FT                   RNDYIESSQSQEYLNDQEHHQHQSPISTTRTKRKNNHNHKRERERERESSINNVQPNEI
FT                   SEYIPNITTIIDTTSSDMTNLQKELKRADVIWLVYSDHYTYERISLHWMPLFRSMGVNL
FT                   PIILCANKSDLFSKSSLKSTNSDEFVPLINEFKEIEAGVRCSAKNNYNVVEAFYLCQRA
FT                   VTHPISPIFDAKEGNLKPGAIKPLKRIFCLSDTDQDGYLNFEELSELHKKCFGIEASES
FT                   DYEEIVNMIDQKILPTYNATTMETETVPQHSQPTTVSNGSDGTTTSKGISEDGFILLNK
FT                   IYAESGRHETVWCILRAYHYTNSLSLSDKFLYPRLDVNPHSSVELSPTGYKFFVDLFIK
FT                   FDKDNDGGLNEDELNNLFRSTPGIPNLWVESNFPSSIVCNEEGYITLQGWLAQWNLTTF
FT                   LSYKTTLEYLAYLGFDEGNSTKALKVTKPRKIRQKNGKTYRNAVNDRNVFNCFIVGAPK
FT                   AGKSSLLESFLHGNYSDIYSPTIKPRLVVKDIELRGGKQCYLILEELGELEPAILENKS
FT                   RLDQCDVICYAYDSSDPESFQYLVELREKHGHLLDEVPAVFVALKADLDKQQQRCDVQP
FT                   ENYTRDLFLNSPLHVSLAWNSSLHEMFIQLVDAAKTPSSATPGIELEVTADQEDIKHIV
FT                   MTGAAITVVGLVSIWVLNSLRR"
FT   CDS_pept        194559..195176
FT                   /transl_table=12
FT                   /locus_tag="CD36_00850"
FT                   /product="ribosome biogenesis [nuclear export] protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae RRS1"
FT                   /note="Similar to C. albicans RRS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44346"
FT                   /db_xref="GOA:B9W6P1"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P1"
FT                   /inference="similar to AA sequence:UniProt:Q08746"
FT                   /protein_id="CAX44346.1"
FT                   /translation="MSSEKEYKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESI
FT                   KEDHLQSVTRDNVQLLINQILSLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKP
FT                   IPKAKPLTKWQQFAARKGIKPKTKDGKMVYDENTGEWVPKWGYKGKNKSIDDQWLVEVD
FT                   DKVKNTEDELIDPRTLKRAERKKLIKKNELQHKRNLRNQGAA"
FT   CDS_pept        join(195675..195722,195807..195902,195996..196425,
FT                   196500..196690)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00860"
FT                   /product="RNA polymerase I transcription factor subunit,
FT                   putative"
FT                   /note="Similar to S. pombe SPP27"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44347"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P2"
FT                   /inference="similar to AA sequence:UniProt:O74503"
FT                   /protein_id="CAX44347.1"
FT                   /translation="MANTKFDSEEFLPTIDAILSVANLEEITVKRIRNALQELFEVDLT
FT                   PNKKQINEVILQRYHDLVDRRENDEKWKQEIDRKEMERQDALLAARLSREEMSRFGKRT
FT                   IRKATQAASKSKSSKSKSNTKRSAPNNAFNREMALSPELANVIGVDKCSRPQVVKLLWA
FT                   YIKDHNLQNPQDKRQIECDEKLQKLFKKKSVGAFHMNKILSDHIFKPEDWETSFSSVGF
FT                   GSSMTEEEPQPEPDTTEDFVTSVKEESVSEEE"
FT   CDS_pept        197197..201042
FT                   /transl_table=12
FT                   /locus_tag="CD36_00870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44348"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR014770"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="InterPro:IPR019558"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P3"
FT                   /inference="similar to AA sequence:UniProt:Q08748"
FT                   /protein_id="CAX44348.1"
FT                   /translation="MKSRNSPSVDSPRSRRVVSMASTSTIQITHLGPEPASKEELYKYV
FT                   LKVILLEYSNEARFRTPILESIKQTSRPNSNRSSMVFDQKIPQYALKNLKTQLQLIMTN
FT                   KKQVEENFRRSLLRIYGEVLDPNSENEVRKIDFLIPKFAAFANQELKKVSQMNDDEITD
FT                   TVFEQTRQFVDFLIEIVTAKKDYDPGLISQLKARKDSFQTSNAKLQPESSQNVKYPTKS
FT                   YRISDMNKSFLDLLKKIFDVDDTKLQQDVFKYKDIALAKPLHNDVQELAKIEVNLNNFT
FT                   SDSSLQQWKERQENIRSQVINRYKIPSDLTLLPIPPTPSDEDYYVLPKNGESRMYFSTL
FT                   VKCIVNSRNQMEFSDPNEPFFEKTELDLINICARVWHIDYPTRAVLLYSAAQSAQALVD
FT                   FPLDTGSKKSTPVNIIASEKLFQLCKQMVEDGSLDWDEKTIWSIEDQNEWVNDLSESYS
FT                   QVFTALKENLQLVFNETVKPKFGPYLQFLCDHIESDALFPLMEETNLPKKWEKRLTKSL
FT                   MKVAGGRYGEYLASLPRNGSVNVIHIINVCDSLISDIKKLQKRYKNPLLGFLNVARTVA
FT                   SITTGMFASDAEATLNYIQTILQNNDERIPYADALEVYQLLNEIRDIHNQVTPAGSVFK
FT                   FDLEKFFYPYLEAWVNESNEKIHGIVNEALKKDNYEPIDLDEDEKRSSHTILDIFAIIK
FT                   QYVMTIKKQNWNDENQINNVYTMLLKSISNGALFYSDQVSKRIIQELQPPTPEPTEDEP
FT                   PETKKNWLYEVKNVVSNIQNFKRPEPEVVYNFEATTCVALNNLSAMMNQLTKLEDWIDV
FT                   ETLSATSSSPKQYLSHVFSIRIVHGENLRASKDAMWGKINPYVAVVDLNGKRLLTRTRT
FT                   IDHNPDPEWDEEFEITIPPEQPSLDISVVVWDDRFGQHQLCGKAFLELNPRRFSTSGIP
FT                   EEITLDLDFQGKVILEVAVESEILDAKFVMGRAFRALMRAQERSIKLIVEKFSGFIQSC
FT                   FSRANLKSVCAKGQPSREEFEESIKNLCDYLNMNLSILKEFLMNEIFMKTMVATWKNVV
FT                   SAADELMLPKLSKAKINTESGGTSWQSVSSKLATVSLSSIGILGIDGPLSINEIETVLG
FT                   WLNFLCTFFHHEGNGPPMEDLKTDQYQSLLLVPALYDQTDEYLIEEVERLSTAYVQMLN
FT                   NRNNADLAFHTEHNGNGGNSIKNEKRMNRTGSLLRNNTINANATAKARKQAAKEMKEAK
FT                   SDPIASKTSKEDIILRILIARGKRNYVCQRLNQRAKLAYSMATERMARAAAERRFT"
FT   CDS_pept        complement(join(201337..205012,205200..205543,
FT                   205633..205754,205823..205869,205944..206002))
FT                   /transl_table=12
FT                   /locus_tag="CD36_00880"
FT                   /product="Sin3p-Rpd3p histone-deacetylase complex, DNA
FT                   binding subunit, putative"
FT                   /note="Similar to S. cerevisiae SIN3"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44349"
FT                   /db_xref="GOA:B9W6P4"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P4"
FT                   /inference="similar to AA sequence:UniProt:Q6CUB6"
FT                   /protein_id="CAX44349.1"
FT                   /translation="MSNHQEPWNNQQRPLGQPFNRQHPPVLPPPATLEQGGQAFYPLPS
FT                   LPSLGNGSGHHPHGFNIPSINPASDQIQMGQSSSDQSRQTAELRRPSNVALNPPPSTGS
FT                   THLPPPSSLGHVGNDQGAYPATISQPAPQTSPVIGGVPNRSTTTNVYRPLNVKDALSYL
FT                   DQVKVQFSNQAEVYNNFLDIMKDFKSQSIDTPGVIDRVSTLFRGHPNLIQGFNTFLPPG
FT                   YKIECSLDPSDPNPIRVTTPTGTTTRPNISNATYNQRWGGEESLVISQQEQSSPQTQQP
FT                   QQSQPQQFADPASMEAQNGASGQVGFNHAISYVNKIKTRFASQPDIYKQFLEILQTYQR
FT                   EQKQIAEVYEQVTVLFANSPDLLDDFKQFLPDTSNLNYQQAQAQDGYYVNNGTQLPPVG
FT                   NFQPAGPATNPQYAQLQQSAVQQQSNFPNAASPESVYGTPSNDQVTGKRKSVSEPYQDN
FT                   YNQESQYSNLRTGAVSQRGQKVSSKAQVPAAVAINPTLVPGIPEPVPPSGTVKSTSFSE
FT                   EIGFFDKVKKAIGNKQTYGDFLKLLNLFTQDIIDKDTLVERVQGFIGDTNVELFNWFKM
FT                   FVGYEDKPQNIENITFKKHHLELSLCKAYGPSYRQLPKAETYMPCSGRDEMCWEVLNDE
FT                   WVGHPTWASEDSGFIAHRKNQYEEILFKIEEERLEFDYYMESNLRTIQILETIANRIAN
FT                   MTPEQKATFKLPPGLGHNSSTIYKKIIRKIYDKDRGFEVIDALHENPSIAVPIVLKRLK
FT                   QKDEEWKRAQREWNKVWREMEQKVFYKSLDHVGLTFKQADKKLLTVKQLVSEISTVKVE
FT                   QQNKRLHPLTPKPQEQLNYEFNDNEVLFDILKLAEVFINRSSTYSAHDREKLLQFLQFF
FT                   MSLFFSIPTETIETALAARGRIEKSSEEENDKGDVDIIENGSDSSKKRSRDTDLLKDVL
FT                   KKQSKSKKDDRSGSPGLQSSELAIQEANEELEKSSELWITTANTKFSFNDQNEQRRRDK
FT                   YNLFCNTTIYVFFRHLQILYTRLAEIKSMNEKVGKEIRNRKFPKFAKDLNLLSHQLEDM
FT                   GVEIVGTKDCYKQVLELSEKLIEGEIEHQWFEESLRQGYRNRAYKVYTIDKVVQAMTKH
FT                   MHSMITDAKTSEIMVLFENDRLKPVSSAKEQILYRISVRSFMSPEENMFKISFKEDDDS
FT                   VNIQFISLDDLTINDHENVEEKYNYYVTSYVMSHPTEGVPASKLNMPFSRSFIESVDED
FT                   SVEGRTGSGLKVSVSENSYSLFFESGSHDEFVSKAVYKKQDSNSKREDKLAQLKDLIEG
FT                   ESGWKSSLPEDQNLEVIEERVSVLFDKGGVELKKFEEQLNSSDKQKDSEANETIEEASK
FT                   NAENIDNSKTNQTEQEPEAKSVTTENKQEELVPEENNDTTIQHDVDDTTADETHSTEVL
FT                   GENEKVQSETKSS"
FT   CDS_pept        join(206549..206601,206674..206995)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00890"
FT                   /product="DNA-directed RNA polymerase II [13.6 kda]
FT                   subunit, putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to S. cerevisiae RPB11"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44350"
FT                   /db_xref="GOA:B9W6P5"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P5"
FT                   /protein_id="CAX44350.1"
FT                   /translation="MNAPDRFELFILPDGVDKIKIIPDTKVPNAAIVKIEREDHTLANL
FT                   LRAQLLKDERVLFAAYKVEHPLFANFVLRVQTEDDYSPREALQNACSSLISELDVIKSK
FT                   FNDEWALKALLNNTEDDFEY"
FT   CDS_pept        complement(207275..209236)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00900"
FT                   /product="cell cycle serine/threonine-protein kinase,
FT                   putative"
FT                   /note="deleted EC_number 2.7.1.37"
FT                   /note="Similar to S. cerevisiae CDC5"
FT                   /note="Similar to C. albicans CDC5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44351"
FT                   /db_xref="GOA:B9W6P6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="InterPro:IPR036947"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P6"
FT                   /inference="similar to AA sequence:UniProt:P32562"
FT                   /inference="similar to AA sequence:UniProt:P50528"
FT                   /protein_id="CAX44351.1"
FT                   /translation="MSALRSQPLQPLNSGQLNARANNITPVKSIRRPKENVQPTDQKQK
FT                   KKKEKLSALCKTPPSIVRTRNGRDYRRGNFLGEGGFARCFQMKDASGQIYAAKTVAKAS
FT                   IKNEKTKTKLLSEIKIHKSLRHPNIVNFVDCFEDDVNVYILLEICPNQSLMELLKTRKR
FT                   VSEPEVRFFMVQIVGAIKYLHSRRVIHRDLKLGNIFFDPEMNLKIGDFGLASVLPSTDS
FT                   RKYTICGTPNYIAPEVLGGKNTGHSFEVDIWAIGIMMYALLVGKPPFQAKDVNVIYERI
FT                   KKTEYYFPEDKPISESAKQLIKDLLSLNPLHRPTIDEILSYDWFKGPFPDKTYEVSLQT
FT                   LPPGLDQITRAQSSANFKYAKDSAGIYTPKNKNPVEILRADLHSEQPRTLLPSSLSPND
FT                   TRNKYQEVDPGQLGRPRRVNFSSNFSTAIKRLNQVCFETYQTMRRLEHSRHDEVDASEF
FT                   PNCENPTLISKWVDYSNKYGFSYQLNNDDIGVLFNDENTLLKRHNSDRFLELIYHENEG
FT                   WTCIENSLANPPAQAKRQLEIVDFFAKYMNSNLSKVSEIEERKETVFLRRYTRTPDYIM
FT                   FEMTNGNFQFNFKDHHKICISKTGLAITHISPGRLTQTQPLISVLKQGNFQYEDVPDCI
FT                   EKIMVIKEAIKKKAFKEA"
FT   CDS_pept        complement(210473..213571)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00910"
FT                   /product="histone-lysine n-methyltransferase, h3 lysine-4
FT                   specific, putative"
FT                   /product="COMPASS complex histone methyltransferase
FT                   subunit, putative"
FT                   /EC_number="2.1.1.43"
FT                   /note="Similar to S. cerevisiae SET1"
FT                   /note="Similar to C. albicans SET1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44352"
FT                   /db_xref="GOA:B9W6P7"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="InterPro:IPR024636"
FT                   /db_xref="InterPro:IPR024657"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P7"
FT                   /inference="similar to AA sequence:UniProt:P38827"
FT                   /protein_id="CAX44352.1"
FT                   /translation="MSYNNRGGRGASGGYSRRGYYGSHRGGYRTGRPKYPEDRYSVGGM
FT                   LTLNKGAHYESSDNRYIPNDTGSNSPESRTHRSSIKDGRTPSGLSTPLSSIDKVSTPIS
FT                   IESNNGSDRNTGVNNKDSEFPKLSHHSDFTLSIPFSRSVNPQKNFMVINDSNALKGDKG
FT                   AQSKKIRYNGEGVDHVSDPRIVRSNSNLQKPNKKAKKTPYKQLPQPKFVYNSDSLGPAP
FT                   LSTLVIWDLPISTSEPFLRNFVSRYGNPLEEMTFITDPTTAVPLGIVTFKFQGNHQRAS
FT                   ELAKNFIKTVRQDELKIDGATLKIALNDNESQLLNRKLESAKQKMLQQRLQREQEEEKR
FT                   RQKVLEEQKKQELLKKKEKEHEESIKKEKSVERENTIVSTRDKSLIYRPNSTVLSVRHN
FT                   HKIISSVILPKDLEKYIKSRPYILIRDKYVPTKKISSHDIKRMLKKYDWTRVLSDKSGF
FT                   FIVFNSLNECERCFLNEDTKKFFEYKLVMEMAIPEGFTNNIRENDSKSTNDVLDEATNI
FT                   LIKEFQTFLAKDIRERIIAPNILDLLAHDNYPELVEELKSREQAAKPKVLVSNNQLKQD
FT                   ALSILEKQRQHFQQRLPSFRMPHDRTQEHKPKRRNSIIPMQHALNFDDDSDSHSQSESE
FT                   DEEDETTTSRPLTPVVSTMKRERSSTVTSVDDDIELEEREIKKQKTEVPAAIENELVPE
FT                   SSHEEEGEEVKREIEELDVKYQPTEETPRTVYPEYSFSGDFDLNALQHTIKDSEDLLLA
FT                   QELLSDTTPSGLSHIEYWSWKSKNRKDVQEIREEEEYMEELPESLQSMTGSFKSEGVRK
FT                   IPEIDKIGYLPHRKKTNKPIKTIQYEDEDEEKPNENTNALQSSRVNRANNRRFAADITA
FT                   QIGSESDVLSLNALTKRKKPVTFARSAIHNWGLYAMEPIAAKEMIIEYVGERIRQQVAE
FT                   HREKSYLKTGIGSSYLFRIDENTVIDATKKGGIARFINHCCSPSCTAKIIKVEGKKRIV
FT                   IYALRDIEANEELTYDYKFERETNDEERIRCLCGAPGCKGYLN"
FT   CDS_pept        join(213977..214040,214103..214497)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00920"
FT                   /product="hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44353"
FT                   /db_xref="InterPro:IPR019331"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P8"
FT                   /protein_id="CAX44353.1"
FT                   /translation="MEKEDQKSDRKTLKQQLSENRTRRFHEYQKRLESKNSAYLLDKKS
FT                   TKFYEELRQRDLDEDRRIKQQEAIELQRFKQLQERKKVLSKSTKSTPLGNINKPAILPR
FT                   KNLQKARENTFEGRSVEPSSSKEDKEENNSSNGKNSILVGYESSEEEV"
FT   CDS_pept        214687..214956
FT                   /transl_table=12
FT                   /locus_tag="CD36_00930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44354"
FT                   /db_xref="GOA:B9W6P9"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6P9"
FT                   /inference="similar to AA sequence:UniProt:Q6BKM1"
FT                   /protein_id="CAX44354.1"
FT                   /translation="MFLNIIQSTGRILMGKPSGANLLVQTRNKMKSHKAAANRFIKRAS
FT                   GLKRKQAGVNHGNGRFSYSALKGLRGFVEVSNKGGHLKKFINRV"
FT   CDS_pept        complement(215043..217976)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00940"
FT                   /product="OMI/HTRA2 familyserine protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44355"
FT                   /db_xref="GOA:B9W6Q0"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q0"
FT                   /inference="similar to AA sequence:UniProt:P53920"
FT                   /inference="similar to AA sequence:UniProt:Q9P7S1"
FT                   /protein_id="CAX44355.1"
FT                   /translation="MQDMESLKRDAEVSLGNDNKKKCYKEFEEDESEIEYVSESPHPIF
FT                   DSPLASNNNKWAETITNVVNSVVSIHFSHVAPFDTENAVSSEATGFVVDASRGLILTNR
FT                   HVVGPGPFTGYVVFDNHESVDVKPIFRDPIHDFGILKFNPQDVKYLKLTQLELAPDLAK
FT                   VGTEIRVVGNDAGEKLSILSGFISRLDRNAPDYGSLTYNDFNTEYIQAAAAASGGSSGS
FT                   PVVNEDGKCVALQAGGHTEAATDYFLPVYRPLRALRCIQKNEPITRGDIQVEWELKPFN
FT                   ECVRLGLTAEAEQNARRLFPDKVGLLVAELVLPNGPADSLIKEGDTLISINDEPIATSV
FT                   RVDEILDENVGKELEFVLQRGGCEIRQKIIIGDLHSITPNRFVVVAGASFNDLSYQIAR
FT                   CYGLPVKGVFVNGGTGSFEFSPQDTLGWMIESVDDEIVENLDEFVGVMKKIPDCSRVPV
FT                   TYRHVSDMHSEYVRSIYIDRHWHTSFKMATRNDITGLWDFETLQKEALPPVPLEPQNAK
FT                   YIDIPFGDDSKKGCADLVRSFVQVRTLCPSPIDSHPFRKDICYAVVIDAIHGYVLVSRK
FT                   YVPHYLCDIFIVFAESIEVPGKVVFLHPHLNYAIVKYDPSLVLADVKTPVFGTSPLQRG
FT                   DKSFLIGYNYHLRLVTDDVKVSAVSSLNINASSSSPRYRGTNLECILLDSKIRNECDAG
FT                   VLADNDGTVRGFWLSYLGESDDKTYKMGLDVTDVKEVISQLQQNKVPKNMKILDAEFTS
FT                   LTVLQGRTRGVSSSWIEQLEKEAEDNIKFLAVERITAPSLGTQVVNPLKIGDIVLCVDG
FT                   RPAKSLRDLNSMYTKDILEFKIIRQKKEMTLQVPTNDTRELDTSHVVFWSGALLQTPHY
FT                   GVRQLMKSIPSEVYVVGKSSGCPADQYYIVPNCFITHVNDKETKNLESFVEVVKDLPDK
FT                   TYVKLRLVSFDNIPMAISLKTDYHYFPTIDVRKEIDTNTWVEKKYNE"
FT   CDS_pept        complement(218256..219347)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44356"
FT                   /db_xref="GOA:B9W6Q1"
FT                   /db_xref="InterPro:IPR008721"
FT                   /db_xref="InterPro:IPR016811"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q1"
FT                   /inference="similar to AA sequence:UniProt:Q6BKL9"
FT                   /protein_id="CAX44356.1"
FT                   /translation="MSSTQARKALHDIIPNYSGEYTPKLLDYINSLYQLSLRKQAVLPN
FT                   KSEIARFHLCAVVIVEKYRQSFELPTPDVSRIPAQPKVAAKLLETFRVLIEQVSAASTP
FT                   VSSPKKAKPLSQSPSTPTKSRASKENLKSGSPLKRLRAEISQDEAVNGNTPNGQLKDVE
FT                   SPFNPKKRKESKAGTPTHKVYRYDKKHVSIADFISFCNTFYIPGHITTKMVGTFLMHQH
FT                   KFLKKSDWSLACGMVYAAYVRINNKILSESVGTKSQFMDLLLQYQKGGLSKWAMQSWCG
FT                   IIEEWIQDEPWIQEIEKNYMYGSKTANETKDSLERKAKIGEGWDLMERFGAMIHGDAIS
FT                   LSTHQERYYENWRNEALEKEAQL"
FT   CDS_pept        219650..220120
FT                   /transl_table=12
FT                   /locus_tag="CD36_00960"
FT                   /product="adh-ubiquinone oxidoreductase [21 kda] subunit,
FT                   mitochondrial precursor, putative"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="Similar to Neurospora crassa NUO-21"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44357"
FT                   /db_xref="GOA:B9W6Q2"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q2"
FT                   /inference="similar to AA sequence:UniProt:P25711"
FT                   /protein_id="CAX44357.1"
FT                   /translation="MLSRVSIRSLPLYTRSFATTSILRQSELTTATDSSGKEIVSGAPR
FT                   ELVTERVVRIYQEAKPATQSGHHNGSHWKLDWDVLGKGNRWENDLMGYQGSADYMQGTI
FT                   MKFDTKEAAIKFAENQGWDHYVQEPKKRHFRKKDYSANFFHSAGPLKHIRTK"
FT   tRNA            220665..220737
FT                   /gene="tRNA-Ala (AGC)"
FT                   /locus_tag="CD36_tRNA_0003"
FT                   /product="transfer RNA-Ala (AGC)"
FT                   /anticodon="(pos:220698..220700,aa:Ala)"
FT   CDS_pept        220955..221974
FT                   /transl_table=12
FT                   /locus_tag="CD36_00970"
FT                   /product="HNRNP arginine n-methyltransferase, putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to S. cerevisiae HMT1"
FT                   /note="Similar to C. albicans HMT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44358"
FT                   /db_xref="GOA:B9W6Q3"
FT                   /db_xref="InterPro:IPR025799"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q3"
FT                   /inference="similar to AA sequence:UniProt:P38074"
FT                   /protein_id="CAX44358.1"
FT                   /translation="MSESATDKSQLTKYEQHYFSSYDHFGIHEEMLKDTSRTLSYRNAM
FT                   YRNKDLFKDKIVLDVGCGTGILSMFAVKAGAKHVYSVDMSSIIDKAKEIVELNGFSDKI
FT                   TLLQGKLEDITLPVDKVDIIISEWMGYFLLYESMLDTVLYARDRYLVEGGLIFPDKCQM
FT                   YIAGIEDGQYKDEKIHYWEDVYGFDYTPFIKTAMEEPLVDTVNNQSLITKGTKFFEFDI
FT                   NTVTKEQLSFKKKFELQAIDNDYCHAFIVYWDAIFPGKQKVILPTGPMHQYTHWKQTVF
FT                   YMDQVLDLKKGDVINGEITAVPSKVNPRELDIDISWEVKTQANDKSRELKGEYTYFLR"
FT   CDS_pept        222168..222611
FT                   /transl_table=12
FT                   /locus_tag="CD36_00980"
FT                   /product="methionine sulfoxide, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44359"
FT                   /db_xref="GOA:B9W6Q4"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q4"
FT                   /inference="similar to AA sequence:UniProt:Q9Y7K1"
FT                   /protein_id="CAX44359.1"
FT                   /translation="MFKSPAFRTFVRNMSKSDSEWRAILSPEQFRVLRQGGTEAPYTGE
FT                   YTNTPASDIGYYECAGCKFPLYKANTKFKAHCGWPAFYEALPGAIKIYRDESHGMIREE
FT                   MRCSNCDGHLGHVFKGEGYKTPTDERHCVNSVSIKFNPQDPQT"
FT   CDS_pept        complement(222608..223546)
FT                   /transl_table=12
FT                   /locus_tag="CD36_00990"
FT                   /product="long-chain fatty-acid elongation enoyl reductase,
FT                   putative"
FT                   /note="Similar to S. cerevisiae TSC13"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44360"
FT                   /db_xref="GOA:B9W6Q5"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR039357"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q5"
FT                   /inference="similar to AA sequence:UniProt:Q99190"
FT                   /protein_id="CAX44360.1"
FT                   /translation="MTEIEVKSRSRSIKSFSSNELTPDSSVQELINELSSDNHISEHRL
FT                   RLTKLENGKQVALIAHKTFAENGIPKTASKIELFVKDLGPQISWRTVFLVEYFGPFIFH
FT                   PLFYYVQSLYGSGSFEHTETQKFAFAIVLLHFLKRELETIYVHKFSNATMPAFNIFKNS
FT                   GHYWILSGFNLAYFIYGPSDKSGVLKYFFHVNELPSYVVYGLFGLWVFAELSNLTTHLI
FT                   LSNLRKGDSKVYVIPFGYGFNWVSCPNYFFESLSWLAYALLVGNWSAWIFLLVSSGQMW
FT                   LWAVKKHQRYLKTFGDDYKKLKRKIYIPFVI"
FT   CDS_pept        223984..224439
FT                   /transl_table=12
FT                   /locus_tag="CD36_01000"
FT                   /product="multiprotein-bridging factor [1], putative"
FT                   /product="suppressor of frameshift mutations protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae MBF1"
FT                   /note="Similar to C. albicans MBF1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44361"
FT                   /db_xref="GOA:B9W6Q6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q6"
FT                   /inference="similar to AA sequence:UniProt:O14467"
FT                   /inference="similar to AA sequence:UniProt:O94700"
FT                   /protein_id="CAX44361.1"
FT                   /translation="MSSDWDSVTVIGQKARVGGGGPRENVAKTSSQLNAARRAGLVVGT
FT                   EKKYGTANTKSNPEGQRLTKLDATDDVVAVKKVDVNVGKAIQQARQEKKLTQKELATKV
FT                   NEKPNVINDYEAGRAVPNQQLLAKLERALGVKLRGKNIGEPLFAKKK"
FT   CDS_pept        complement(224773..226197)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01010"
FT                   /product="kinetochore-related protein, putative"
FT                   /note="Similar to S. pombe MIS13"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44362"
FT                   /db_xref="GOA:B9W6Q7"
FT                   /db_xref="InterPro:IPR013218"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q7"
FT                   /inference="similar to AA sequence:UniProt:Q9UUB5"
FT                   /protein_id="CAX44362.1"
FT                   /translation="MRTLGVGKQKAPTRKKTKKQAKLVHDTDDDEQVTPQPSLLSRKNQ
FT                   LSDLFSSQENFNKNPAPKKRQTFEEDGEFVYKRSQSPTQQSRKKRKVNTPVTQLHEEMD
FT                   LMAREDIDSDSSDDIFNLSRKKKKQRAKGQSIKNPTKLRSPLGNGYNSDDYIEQVSRET
FT                   LQLHDNDKTVSNKRRQSYLNRGKRVSSIGNGFVGVPHKEVPVSDYYKLLDTTMPGPDRL
FT                   RQLLIWNMKKQFEKDEEDLKQHESEDQTAPSIARVIKEEIIRDLTEKKISTSWYDNRSN
FT                   NIETISGKVVTVPNPLNITNLKNIDIYTKKLKNLRKQKAEWYKVYKQAIRPLEAMKISL
FT                   PEDKKQLNMYIKDERAGNIKTDAIDNSLVETVEANHAEVKSNITKLEPEVDKLYFTAFQ
FT                   LKRASDLLKSVEQQQLNKKVSQYLQGYSNKSKVEAYRSLPSNSGSNIRWSVPSKNVDTK
FT                   DLLRAICRLETQNKSS"
FT   CDS_pept        226519..228027
FT                   /transl_table=12
FT                   /locus_tag="CD36_01020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44363"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q8"
FT                   /inference="similar to AA sequence:UniProt:Q6BRQ9"
FT                   /protein_id="CAX44363.1"
FT                   /translation="MRPDILAVSLCHKYIARLKHEENKLEILNLPTSTIYRSYNIQTLT
FT                   RSFSQINHTSSYVVSQLQWEHILPDSVSTKLAVVIDNLHIAMIIDFRNEDVEPIFIKQP
FT                   RNEGIESIEWIPPPSLEKDLGAYTNSRQLLIFSKHNLAARVFSLDCTHVLFTIYKPMSS
FT                   FLIRPSHDNRFWSILASTLEYNKPPILYHFYNEGSVSVLIKSIKLPNTLTTEPKLSWSG
FT                   KGTWLQVFSDHETIFGYNLLIYNILGQVSERRKIEPLLDVEIMDNGYNMGSDGHLHFSS
FT                   NQFQSNWVTLSSDREYIAVSDLQGPQLHIQIIEISLLRVIKSVELNLKDKQGWKQSWDK
FT                   FVYGTITLPETLEITKVYSHESEIYICINNTYVIGCHFRLTESDSIEAEIKSIMEVDTF
FT                   VFDFYKIDNKLLLITEKSVVTLNDDNDKPQRIFDTNGTIKNTQPDTDQITIIYSTTQGT
FT                   LWETVFTTNRFTSPRKKRHLLGNTSISLDDITDTFNLKKRIKSK"
FT   CDS_pept        complement(228090..228398)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01030"
FT                   /product="Mitochondrial ribosomal protein of the small
FT                   subunit, putative"
FT                   /note="Similar to S. cerevisiae RSM27"
FT                   /note="Similar to C. albicans RSM27"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44364"
FT                   /db_xref="GOA:B9W6Q9"
FT                   /db_xref="InterPro:IPR013219"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Q9"
FT                   /inference="similar to AA sequence:UniProt:P53305"
FT                   /protein_id="CAX44364.1"
FT                   /translation="MSVLKALPSKARLAEVRKTSFRIFDQFWNPNAKRNPNKILKAPLK
FT                   GPEYVKYYGDNNAVPTFSDFKIWFPQLQLVDPREAHRVFIVADRKRRNKGAPKKKKQ"
FT   CDS_pept        229325..236092
FT                   /transl_table=12
FT                   /locus_tag="CD36_01040"
FT                   /product="calcium channel, putative"
FT                   /note="Similar to S. cerevisiae CCH1"
FT                   /note="Similar to C. albicans CCH1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44365"
FT                   /db_xref="GOA:B9W6R0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R0"
FT                   /inference="similar to AA sequence:UniProt:P50077"
FT                   /inference="similar to AA sequence:UniProt:O14234"
FT                   /protein_id="CAX44365.1"
FT                   /translation="MDNNSNTHSSRGRPGIIINPPTESNLNIQHISEEEQASYDEDYDP
FT                   NKTYISDSQYWQRQSFLHNEDDLASVEIPELHQIQDRAPDSLSIHSDKRSSRSGRDILN
FT                   VLHLSRPSSPRTPNSATSTPSLGHAIEDEDLDELKEGLNYALGTKENEANWFPVNKLSK
FT                   STTQQREETSGDENSSFVNFTTDIPLNDLSPFISNPNTNKNKSDTSSKYVVNSPFETRS
FT                   NLGLPVDPGLLETGSLMSPYPKDGGGSSPRIANAISRISDRIAGAGGSSRRNEENTERL
FT                   SAVESQASLPLPTPMSEHFTFFDESNKSTNKSDKTSVGNTSLRNESDTNLDSNIEGLGL
FT                   YLQQTNKSQISSTGQHEYSREVPVTDYLRLPKKSHQNNRTNFQEFDTMYLFGKSLGIFT
FT                   PESKVRQFCYHVCENKFINTFLLVILILQVCLLTYRQWNPFVLNGYFIKGYNWADYLLM
FT                   VINVIYTAEVIGKIIAYGFYDDHIMFDELGLPYPKNEITKEYFSKNYISKILKSLGIFK
FT                   SRAEKKRQEKFISQENDKRSSSEDSEIREIDLNDSRQDLLGESNRSFGLKDKYHMDSHH
FT                   RNYIPLRSQANDPEDLDKTTPVPKQMLEAKNTFFKPTPNTFEKLNLKRAFFRSSWQRVD
FT                   FISMVCFWISLFLSINHYDADHHIMLFRALSCLRILRLCNLTTGTTTILTACKIAIPQL
FT                   IDVSIFIACFWLFFGIIGVQTFKSSLTRHCVWTNPDDPTDTFVNSDSYCGSYIGLDGAP
FT                   TAYLMRDGSSSNVIKGYRCPMYSQCVSGDNPYNGTLNFDNILQSLEIVFVIMSANTFTD
FT                   IMYYTMDTDNMAACLFFIGCIFVMTVWLINVFIAIIVASFNITRMEVAEEKKKKREGRR
FT                   IFKIFGYADQDVQMHEERLEFLKNQNVFLKWYYNLEFFFVICVIIDLFVQCFRRSDMSD
FT                   RRAHLLYRFEASFTGVFMVEVILRFAFYFPNWRLFFRVKRNCFDLFLAVITTIIIIGPI
FT                   KTALGHAYYWLTVFQVMRAYRVVLWTSITRNLWLKIMRNFKAIFDLALFYFILLFLVSI
FT                   ILARYFEGVVSQDEAGDLDFPMTTLPGVFIALYVITSTENWTEILYGMQQYATTTSSRS
FT                   FGSVFLIGWFMLSNMIILNIFIAVIAKTLEVSEEGKRKQQLLQFIDTMTNKLQDIEQDS
FT                   GLLSKIKKKLFRRKQVKDELEEAVVNLLLSGTAVNDFLENDARNEIDDDDEGEAIRTLP
FT                   TSTWKRWLGVNYWRTLNLFKNNPFYGNKAEGRKVSLENFNPANFARTIVKERKNIVSKQ
FT                   NEFLEANPRYNYVFYVIGPHHPLRRLCQKMVKPSYGERIDGAVPYKPVAEAMVVLMFIA
FT                   TITLVVIACYMTPIFRMDHAGEPWVFWAEFVFVMIFTIEFSIKVIADGFIFTPNAYTRS
FT                   SWNLIDFVVLLSLWIETIAYLKNDGKLSRIVRGLKALRALRLLTVSDTAKANFHNTMIA
FT                   GFWKIINAAVISLCLLLPFSIWGLNIFNGRLGYCVDGESDMSSCYNEYQNSVFNWQIVS
FT                   PNVYTNPQLEFNRFASSFATLFEIVSLEGWVDLLNNVMASTGVGTPKETNATPFNGFFV
FT                   VLFNFVSIIFILTLFVSVIISNYSRSTGRAYMTTDQISWYRVKKILVQVKPSKRKNIDN
FT                   LHVIRRFCYRMTVERNPVWTRTLNCVLVFHVIALLLECFPSYDSLNQFRTSIYMIASSM
FT                   FFVNSIMLFTGQGFSTFMQYKWNIFNLVVSLGAFGTTTGSYFLDPNSPLININKLFLVA
FT                   ILVFVIPRSNRLSQLLRFASASLPSLISLVFTWIIVFLVFAIAMNQIFGMTRLGPNTTG
FT                   NINLRSVPKALIVLFRCSFGEGWNYIMEDFALAQPFCTSENNLDNSDCGNKQYAYILFI
FT                   AWNIISMYIFLNMFISLILDSFDYIGHKESYNQLIQREEIRKFKRTWQKFDPQGTGYIK
FT                   PIELPKLLHSLEGALSFHFYTGSLTIPELCKKWIIRNNPNDPYDVTINYEAIEHTMEQM
FT                   DIPKIRERRKAYEMFIEEALLCMELNNDPGISFTRILLQLPLYTSFDTSNCFNLIDYLD
FT                   RRLLIQKVMKRLHTKRVYETIATYVCRWKFKKDNRLGIKDTNLAFDKRLARNSYLRNDQ
FT                   LLINKNPPTIFVTDEAGKRNSSDINVRDSSSVGTERNSVIYGDHSISSGVYYPSTPVAK
FT                   LNHSQHVKPSHPKLFIEIPSQNPQREFITTEDEVKVSPFMDPEEVNEYESKNSGSLVDV
FT                   GSIEEILESSSWKNAFDDLKSDEKRKK"
FT   CDS_pept        complement(236220..237689)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01050"
FT                   /product="zinc-finger, translation elongation factor
FT                   eEF-1-binding protein, putative"
FT                   /note="Similar to C. albicans ZPR1"
FT                   /note="Similar to S. cerevisiae ZPR1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44366"
FT                   /db_xref="GOA:B9W6R1"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="InterPro:IPR042452"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R1"
FT                   /protein_id="CAX44366.1"
FT                   /translation="MSEETKQQQEIFSSVGEQAQEVDNAIKQTGAADAEGHPVQEVESL
FT                   CMNCHKNGVTRMLLTRIPYFREVIIMSFECPHCGFKNSEIQPAAQIAEKGARYVLKVEN
FT                   KKDFNRQIVKSETATVRFTELDIEIPPKRGQLINVEGILQEMIEDLESDQPQRQTVQPE
FT                   VYEKIEQVINKIKSFINCDPNTVPLTVTVDDPAGNSWIEYVPGEPTHKWAMYEYNRTAE
FT                   QNVFLGLISADDVAQHRQAELANKKQATDSNISSNLNKEQPQSEGEHSNLHTTGFKSDA
FT                   SEIENFSNEVQTFAATCSSCYKPCETHMKTVNIPHFKDVILMSTVCDHCGYKSNEVKTG
FT                   GAIPEKGKRITLKVTDPEDLARDILKSETCGLNIPELNLDLTPGTLGGRFTTIEGLLTQ
FT                   VLEELHSRVFTQTSDSMDDETKTRWTGFFARLQDAIDGKIGFTIVMEDPLASSYIQNVY
FT                   APDNDPNMTIEEFERTFEQNEGLGLNDIKTD"
FT   CDS_pept        239831..241978
FT                   /transl_table=12
FT                   /locus_tag="CD36_01060"
FT                   /product="sulfur metabolism repression control protein,
FT                   putative"
FT                   /note="Similar to Aspergillus nidulans SCONB"
FT                   /note="Similar to C. albicans MET30"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44367"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R2"
FT                   /inference="similar to AA sequence:UniProt:Q00659"
FT                   /protein_id="CAX44367.1"
FT                   /translation="MNLLNNCDEVSSSSSKTTNNFNNLINSTTTEPSQTQSTSSSTTTT
FT                   SVSTTHYLPDTIYSSHTKSTIISKTPSDFIQTQPSSPEATSSIQTISNQITDDLPNQEV
FT                   SVVTPFLVKHISDANMIPKDNFHKYCYRHNPDITCNKHTDEVRMKLIQDQLDKLPNGDQ
FT                   QAITHVWSIFSAAPVQHRQLILQGLLSQCCFPQLSFISQEVSSLIKIDFISTLPQEISL
FT                   KILCYLDCRSLCNAAQVSRKWKSLADDDRVWHYMCQQHIDRKCPNCGWGLPLMHMKRAR
FT                   EMTDDDNIKPIKRNDEQQQQQQQQQPQQGSSQSQVLDAEGQPDKKKLKLDTPEDNHKKT
FT                   IPPSVVVKKRPWKSVYSERFKLEKNWRKGTHTIKTFTGHSDGVTCLQFNRKYLMTGSYD
FT                   TTIKIWKIDSGECVKTLTGHTKGVRALVFDNQKLITGGLDSTIKVWNYHTGQCIATYRG
FT                   HDDAVIAVDFTNKSIVSGSADHTVRVWHVDSRTCYTLRGHTDWVNHVKIHSASNTIFSA
FT                   SDDTTVRMWDMNSNQCIKVFGGMENNGHIGQVQCIIPFTYKEELIEDESESDSENNQHS
FT                   AAATTTTLGNSNISLSNDEATINRTTFTSHNNNTATSTNSYPTHFLTSALDNTIKLWDV
FT                   ATGKCIRTQFGHIEGVWSIAADTFRIISGAHDRLIKVWDLQNGKCLHTFTNNSSVSCVG
FT                   LSDSRFVAGLENGEVKMYCFD"
FT   CDS_pept        complement(242815..244953)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44368"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="InterPro:IPR038175"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R3"
FT                   /inference="similar to AA sequence:UniProt:Q6BRQ2"
FT                   /protein_id="CAX44368.1"
FT                   /translation="METIEKSHNVSVSTEIPLSMRFLHKPRRSEELYIKSNDQTQANSK
FT                   LNARPIRIDDSSDPSPTSLDYFNLDGGITNTKNGTPPVFSPEELSDYKLVRKKSGELVK
FT                   PSLKSPLYYHKKRSLSLPSTPTYKQVHFGGSTDVRYFHKKDRPAAISASNSPKLDPADD
FT                   DDGYDYSDDDDDDGYDNDSCDSDPESIDFNNKSFGFDHHDEEKRQRQRHQGLHSRTDTK
FT                   YPKKLEGLIDWQLKLTNFPPLSYLKKIENGTPVFLEKIFISGDRKYLLGHVAVQNLAFE
FT                   KHITIRYSLDNWMTVIELPTNYIEERPEVLKLNDYDRFGFKIPLKSLFNSLKFSTNSST
FT                   DSLDASSNEDDGTGTHERTYQLCIKYETNNQEYWDNNGSKNYEVKLVRSFKQMPDVTKP
FT                   FIRKNVGVVGTKIQEHARKPRYSNSYLKRVASDSAIATSMNSKSITESTAIEPATSGLE
FT                   SPSETSIVDSSSGSSNFSEISDFVKNNYYLSSPLLSSLHKSPDLSEDYFGQNSIKSPAL
FT                   TPENTSSAKYKTKFKPHLSKLDTSDFNRNFVDESLKSDHGKQPSQLEKEENQGLGIKSQ
FT                   QVNGKSDSHSSKSNKKQDSTGSKKKSSSLGPSFSGLSAANRTKFLNSKSYKELLENYCF
FT                   FSSNTASGVDATITVGSNGQPRTNNNNNNNGGGSRNSSSSSNSSSESNNSKTSTNDGDE
FT                   NVKVARENSFTISSFLGT"
FT   CDS_pept        complement(248118..250187)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01080"
FT                   /product="carboxyl methyl transferase, putative"
FT                   /note="Similar to S. cerevisiae PPM2"
FT                   /note="Similar to C. albicans PPM2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44369"
FT                   /db_xref="GOA:B9W6R4"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R4"
FT                   /inference="similar to AA sequence:UniProt:Q08282"
FT                   /protein_id="CAX44369.1"
FT                   /translation="MTSTPKLDANQLARQRKKLEKDRRKKVYDDQQVQGTNNSSIVSKR
FT                   SVEKLYTQVLQPELGEWFQYFVPKGKRRSPAINRGYWIRMESIRQMVIRIIKANDSNML
FT                   VNVVNLGCGFDPLAFQLLSLFKNQYNLNFIDIDYPDLVKNKYNMIQQSDEIKRLIGDQS
FT                   SKSSDLYVMETDTYQLVGCDLKDLAHYKEILPKLVSRNVESYPISINIFIAEVSLAYMK
FT                   PQFANPVIEVSSQVNNSHFLILEQIMPDGATNAFATKMLYHFQHLRSPIQCVETYPTEQ
FT                   LQVERFKQYYQYVEIKNLYENWKFLIYYQMKKNISTIEEFDEWEEFIMFCQHYVIVHAT
FT                   NMDQLIYKEDINEEQKNKDAVVDMSFDSLVAFSYDDRFNDEQLQLKFPAIAFFKDKIYV
FT                   NGGLKQTRNDENLEVDLQRGEITKLDKPEILPTARMCHTLTNLGQNLILIGGRSRPGVF
FT                   FKDVYLFDTAKKWTRLADLPIGRSRHATVKISDDQVLIFGGLDASSPATEDGLFLLYNI
FT                   NTNSYKTLRPTGDNKDNCIKNLQSACMIYDGKQGYIFGGMEDTNIPIVNSKLYRFELIG
FT                   ENSISINNVFEHGLLKRIGSKAQILGNGDKLLVVGGVSPDQLFTKTTNIVTLDLNNFTF
FT                   KLVEIPIEIREKVPPIFIGFELVQINNKVSYIIGGGAVCYSFGSCYNSVYKLEY"
FT   CDS_pept        complement(250354..251211)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01090"
FT                   /product="exosome complex exonuclease subunit, putative"
FT                   /product="ribosomal RNA processing protein 40 homologue,
FT                   putative"
FT                   /EC_number="3.1.13.-"
FT                   /note="Similar to C. albicans RRP40"
FT                   /note="Similar to S. cerevisiae RRP40"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44370"
FT                   /db_xref="GOA:B9W6R5"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR041054"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R5"
FT                   /inference="similar to AA sequence:UniProt:Q08285"
FT                   /protein_id="CAX44370.1"
FT                   /translation="MSETIILPGDKLPIDEDISTVKTTIGPGIYKKPKTQELIPSTAGI
FT                   LHYERTKSSSSSSQQLIYIESNSKRYIPHTNDYVIGVITGAIGESYKVSLQAYSTPVLL
FT                   SFWAFPNASKKNRPNLKNGQAVYARVSQDIPEIETELECIDPTSGKEGGFGVLDESGYI
FT                   FDVHLNFARELLFNPKTIFLEMLATRCQFEIAIGINGKIWIKCGNGVQKEINDGGNNNN
FT                   NNNNNNNNNKNQDQGEDQEMADASEENLKDLKSTLAAATFLTRCQFVTQDKLKQELNNA
FT                   FRDI"
FT   CDS_pept        complement(251416..253632)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44371"
FT                   /db_xref="GOA:B9W6R6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R6"
FT                   /inference="similar to AA sequence:UniProt:Q5A929"
FT                   /protein_id="CAX44371.1"
FT                   /translation="MVKTTVQRRRHTNSKLGCLNCKRKKVRCDESLPECKNCLKGKKET
FT                   CSYLSLTNQEIQKIKLTHSLRNSQNKLLDQKYRLPASGAATTSSKHSSTSSSNETTGDK
FT                   DSETFSSGDILDFKFELKDLPINIPSIAYPPLQFDNISINDFSGDGVVHNDVNKTSEED
FT                   DDDQEEFEEVNGNGRNHSNLAGLNKFDNGVHSPTTFNCLNRSIFRRVHADSVKTKVPAD
FT                   FSFHVVLGKSNLLDHLSDMMLDTPATTHRNVFSESLLCLGETIILKVFNKRQKILGTYD
FT                   HSELNFISWLNKKCLDRHGFCQEEIKNVITSFHKNLGKVSSWELEKQIHLGAYVSYLLN
FT                   FVVLMLKFGAQAYFDSSKGIFQSFEAFLAYIQKYTNQPSTTVDFLMTNIQYNIMSINVP
FT                   SYPPQFLFEIESNLRSLEFVFVRPTIFQDESINQRFQKIEYHFKSLIKFFSGYVLPIVY
FT                   ASRDENSVSIYPPEAIYEIFQEWHTNVPSETMNHHQSIDTNNFSESEFLNDLSTTLYMY
FT                   YYAVAAALDAVFPGCKYLYGVSFMLPTNKFFHNMKIMTISKDNFYLERLYPFKVDILLQ
FT                   RHVFYASRLFGFFRRRFCFYHNYTDWSSPFDDSLKANRFKSRTIRNSFEAPIHSFNTTL
FT                   IRPEHYPIRDEKVSLESIKGYPIYTREDDTIKQQFYARNIETLDFFNLSQILQYDCESM
FT                   LLLRDYRPFDDQIGLTRSSLGMDVIKDYYNDKTIILDSLFSLNR"
FT   CDS_pept        complement(254415..256427)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01110"
FT                   /product="meiosis-specific HOP1-related protein, putative"
FT                   /note="Similar to S. cerevisiae HOP1"
FT                   /note="Similar to C. albicans HOP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44372"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R7"
FT                   /inference="similar to AA sequence:UniProt:P20050"
FT                   /protein_id="CAX44372.1"
FT                   /translation="MTRCIFATICLHLQLPYFIFTTRIFKCEKQNTNTTLFFAKQETIM
FT                   DQTRSESESHRLIQELIAVSLYCISYLRDLFPEDYYYDCKYYDTAEPSSDSNFILTKKL
FT                   QQKGNNEINMFINYIDKGINEAIKLEYLKGVSFEIFLSKVQPELICESYLFTINYLSQQ
FT                   VSLNDAVSFQATTNTIIQSISGIIKRLILLTQTFDRLPDKKYFAIRLLFNESCPVSYQP
FT                   PYFQDTTYAKPSSITVEQEYSGLEIGQINAYTNCVKMNILVETCKMENCNSIDPFDLVD
FT                   KQKYQCEALSSCDVDLDEYLDHPNTIEVQISEPKTGTFDIVNCRKCNASIYPVAYGYDK
FT                   SFKNSITCFKCLLQNRFDDNLGILMSIRLLWQFYMMNEFPSFEKSKELIQLVHTGSIVH
FT                   VFNKMFSDKLLVVTNKAMFRPNTVDFIAGCGSFIPAMEGIVANDGKQLQKYSEYFVSFV
FT                   PRMCTFPSFFAYDKKLDSLYFPNYLVQRADFVLSNLRKFKAGSPGRHIVRSSSSSVSSQ
FT                   LSKTNSKSGTIRKLKSGCPAPGRGRGRCRGRPSLGWKNNTSVSQNSKTPSSLKPSLYQS
FT                   GSVYSQSNSIIESTNDMTPLQLNEDSSPTTVVECSTQNISETLDDLSFEESLQYLSQSQ
FT                   EVQIVKCKQQQQQEQQYYPQKSYQKKKRARKQTYI"
FT   CDS_pept        complement(256518..257909)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01120"
FT                   /product="flavin-dependent monooxygenase, putative"
FT                   /product="thiol-specific monooxygenase, putative"
FT                   /EC_number="1.14.13.-"
FT                   /note="Similar to S. cerevisiae FMO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44373"
FT                   /db_xref="GOA:B9W6R8"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R8"
FT                   /inference="similar to AA sequence:UniProt:P38866"
FT                   /protein_id="CAX44373.1"
FT                   /translation="MTKEQIDGPRFKRIAVIGGGPTGLAAVKALSLEPAEFSRIDLFER
FT                   RDRLGGLWYHYGDKSLVKPEIPNVSPSQQEITSDNATPADEYFSAIYEYMETNIVHQIM
FT                   EYSGVDFPVNSKKYPTRSQVLEYIDDYIRSIPKGVAKINLNSNVVSLEKVNEIWHIEIE
FT                   DTVKKTCVKLEYDAVIIANGHFSNPYIPDVPGLSSWNEHYPNTITHSKYYESPGKFRNK
FT                   RVLVVGNSASGVDISIQLSVCAKDIFVSIRDQEKPHFEDGFCQYIGLIEEYNYGTRSVR
FT                   TTDGLVVSEIDYVIFFTGYLYAIPFLKSEKTITDGFQVYDLYKQIFNVYDPSLTFLALL
FT                   RDVIPMPISESQAALIARVYSGRYKLPPTREMERDYLSELKEKGKGGKFHNYKYPQDVA
FT                   YCQMLQNLIDEQGVRTPGLVAPIWDESLIKKRSETKAEKNARLENVVEHVKRLRAEGKD
FT                   FSLLE"
FT   CDS_pept        258134..260065
FT                   /transl_table=12
FT                   /locus_tag="CD36_01130"
FT                   /product="multidrug-resistance genes transcriptional
FT                   activator, putative"
FT                   /note="In S. cerevisiae: interacts with a PDRE (pleotropic
FT                   drug resistance element) in vitro"
FT                   /note="Similar to C. albicans STB5"
FT                   /note="Similar to S. cerevisiae STB5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44374"
FT                   /db_xref="GOA:B9W6R9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6R9"
FT                   /inference="similar to AA sequence:UniProt:P38699"
FT                   /protein_id="CAX44374.1"
FT                   /translation="MRPTDSIVSKFRVQKPTSNLANNPAVLRHPENMPKLTSCLRCRKL
FT                   KKKCDKSTPHCVNCENANEECTYVKRKPRQSKNGKVTVSESTLDPPSPMVSETFTGFSY
FT                   LNQSQPNDLFRHIQAASTSTSTTTSAAASAAAVPPPTTNTSESLSSSRSHTPPILNSID
FT                   ARAPNFHSYPKQISKVLISAVGIKTNSNVSIIPPIVDKDLLTSIIGSFMQHNYRICPVI
FT                   HKKEFLENFQKLFKEDGIVDLDSHHDPYELYMVLAVGSTGLERTGIISRDKKLSEYFVS
FT                   MALSHVHNNLSTNSLINVRNLSLLALYSFFNPAEYTSWEIMGKLTRLAIHLGMNHKISD
FT                   QDARNLSAKEIEMRSRLFWSVYNIDRLSSVSLGRPVALQDDDINVPFPQVLEEDETEDI
FT                   AVNRLVINLRRLEGRILRRVHSVNIYKNFINKDKSQEEVCQEILSDLRKEIEDWYYQVK
FT                   SVDNANTSVRQSVSFHLSVPWYTARYNHLLILLYRPSYLNPRPAQDLLDILGKSCLETL
FT                   SYTYKLFKAKLLPLNWTTLYRFLMVCTTILYCLCKWAIDLMESKTEICYCIEIFQAFGS
FT                   DWIVAKKCAEVFRKIENKLLEITLSDGHVSDMDNLSKELLGASSSYHEILNVHSVDLCI
FT                   DTDFMYNF"
FT   CDS_pept        join(260388..260540,260540..260863,260865..260966,
FT                   260965..261639)
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_01135"
FT                   /product="conserved hypothetical protein, pseudogene,
FT                   putative"
FT                   /note="CGD orthologue described as being similar to
FT                   retrotransposon GAG protein, but Fasta hits using this
FT                   sequence do not show this"
FT                   /note="apparent genomic rearrangement; lacks splice
FT                   consensus sites; in-frame stop codons"
FT                   /inference="similar to AA sequence:UniProt:Q5A925"
FT   CDS_pept        complement(261855..262628)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44376"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S0"
FT                   /inference="similar to AA sequence:UniProt:Q6BRP7"
FT                   /protein_id="CAX44376.1"
FT                   /translation="MSHPAASVRSIYSGKVNLDSPDELYNLDSNNNSSAEVSSISQSTS
FT                   STNNQNLPRVQLEEVSSSQSQHRVTSKNLKSLENSTLVKPTSRFDNNNYNGTNSSLVST
FT                   ESEYQNDLIDAESLDTEGDNDIIAAPSPSDYADPFSRPLSRNSTTSCLSTTATKDGIEG
FT                   RRFRRHGPTAYSSHIISGMMQQQQQQQQQQQQKLLNQQNPAKSLLNNEDEHYTLLDSAN
FT                   ASVASLHHTSIYPSTRSSSSSSGSEPTVSSNVKED"
FT   CDS_pept        263609..264658
FT                   /transl_table=12
FT                   /locus_tag="CD36_01150"
FT                   /product="cell surface hydrophobicity-associated protein,
FT                   putative"
FT                   /product="aryl-alcohol dehydrogenase, putative"
FT                   /product="aldo-keto reductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="Similar to Candida dubliniensis CSH1"
FT                   /note="possibly fungus-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44377"
FT                   /db_xref="GOA:B9W6S1"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S1"
FT                   /inference="similar to AA sequence:UniProt:Q7Z8E8"
FT                   /inference="similar to AA sequence:UniProt:Q5A923"
FT                   /inference="similar to AA sequence:UniProt:Q02895"
FT                   /inference="similar to AA sequence:UniProt:Q4WQ19"
FT                   /protein_id="CAX44377.1"
FT                   /translation="MSIEVKYSNLGESGLKISPLIVGCLSFGSKEWAEWVIEDEDEVFT
FT                   ILKKCYDVGLRTFDTADSYSNGKSEELLGKFIKKYNIPRDKIVILSKVYFSVEPNTGRY
FT                   SLADTSGFEDKDYANRNGLSRKHIFDAVEASVKRLGTYLDVFQIHRLDEDTPKKEIMRA
FT                   LNDVVDQGFARYIGASSMRAVDFAQLQFIAEQHGWHKFISMQNYYNLIYREEEREMIPF
FT                   CQTNYLSKVGIIPWSPLARGVLARSLGVVSENSREKLDQQRFKILGLDTLSDADKEIIQ
FT                   RVEKVAKDHNVSMAVVATAWVIGKGFNPIVGLSSVKRVDDILQALKFELTKEEKTFLEE
FT                   PYVPKNVTA"
FT   CDS_pept        265133..267007
FT                   /transl_table=12
FT                   /locus_tag="CD36_01160"
FT                   /product="mitochondrial protein, putative"
FT                   /note="Similar to C. albicans FMP29"
FT                   /note="Similar to S. cerevisiae FMP29"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44378"
FT                   /db_xref="GOA:B9W6S2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W6S2"
FT                   /inference="similar to AA sequence:UniProt:P40053"
FT                   /protein_id="CAX44378.1"
FT                   /translation="MLSRVARYSRTLNQLTRTSQGGLLSAVLRTSIRQNSTDSPPSNSA
FT                   NEIYTKLSDTKDPQRNQFFQYTWGSWLTNDKSKKKQRETTFSIEGLTLFIDRINQLESK
FT                   LGQPKSLEGAFVLTNNKELLGSTKEKVIVRSIASIHEGKHHRVYKITLNTGKDLVLRIP
FT                   YKLDSDAAIASKLKSEVATIDFLKLKLGLNVPRVLAYGVDSNNELKSPFILQEFISGEL
FT                   LMKKWHPLLPDSEETNKNLHEVIDPIAQFQDKILSVTFKKFGSLYFHDDVEGSLQNDVP
FT                   YEGETDSTLSNRWRIGPSVERQFTRNKSKLQQSIIDQYNGPWDASNTTALLESVADIEL
FT                   ENAKSKLALINADAGANENDKVLITKQIKTFENLKKISPQLINDKSKSIMNVQELFKPR
FT                   LYIPDLDPLNVIQHTESENYFIDFEGSTIKPFILTSYPKFVAYQGAKIYNLEEDVPGYK
FT                   EMEELEKQQYDFMYYKTRNERMWELELNKYRHDLIAVASPHIKVLKSPYLQALDIKNGK
FT                   DYLYVEGSIVQLQAMWEAYVANELVNSKDTKFPIEYTAEYLDQHQQELSDYQLETVSSP
FT                   FSATGGWIPQDMFDTLKAQGILVETKDGDYKVETEKVLENPPSPSEEK"
FT   CDS_pept        complement(267077..267529)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01170"
FT                   /product="transport protein particle [20 kda] subunit,
FT                   putative"
FT                   /product="TRAPP [20 kda] subunit, putative"
FT                   /note="Similar to S. cerevisiae TRS20"
FT                   /note="Similar to C. albicans TRS20"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44379"
FT                   /db_xref="GOA:B9W6S3"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S3"
FT                   /inference="similar to AA sequence:UniProt:Q9USZ5"
FT                   /inference="similar to AA sequence:UniProt:P38334"
FT                   /protein_id="CAX44379.1"
FT                   /translation="MSSSYYFSIIGTKDNPLYELEFSSFKSANISTTDNVPGKSQFPQS
FT                   TKELLPFIANSSLDLIDDQAFTNNVLNLGKIDQFYGLSINAYILQSQVKFILCYNSKEE
FT                   SSIKQFFQEVNELYAKCLMNPFYNVDDAIVSPDFDLKIKQLARKYL"
FT   CDS_pept        268206..269480
FT                   /transl_table=12
FT                   /locus_tag="CD36_01180"
FT                   /product="conserved hypothetical protein"
FT                   /note="induced during mating in C. albicans"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44380"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S4"
FT                   /inference="similar to AA sequence:UniProt:Q6BRP4"
FT                   /inference="similar to AA sequence:UniProt:Q5A919"
FT                   /protein_id="CAX44380.1"
FT                   /translation="MSITLISSGLSNGNLWDPIKPNFIFSSNISSKIYNLIHAPRKGNQ
FT                   SPSVIKINIQLNNLVSRNKSMKLSDLQDLINIHSNKHYILRILKQENWEYKPSEEIFIV
FT                   TVKLVLLDCSKDAIEFEHNESYTILKQCQFMDEIESYIKKIYLKYSEEEYSSYDISDST
FT                   IECSESEDNGELFGKCLEPLKSNDTLIDEFKKIFHDISDEEKTFKHNHDFIKNISNLRH
FT                   NDDEDIVEEEEEEEPSSTEEKENSLILPETPSMAKPETGALRLDDLIEVSCENEDDFDL
FT                   QNIPNPSLALPISPSKHGFAEDNEVIKISRQSPFHSPTKTRRANDLSRKPSNTSFSMMS
FT                   DERYGLEYAYNSNHEDVPSFIKENKKFKFIKVGKVQKFVNLFEEQKNQKEPVTPSRPSS
FT                   RISSRVTSRAVSRTVSRSASMEKVI"
FT   CDS_pept        complement(269643..269990)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44381"
FT                   /db_xref="GOA:B9W6S5"
FT                   /db_xref="InterPro:IPR009332"
FT                   /db_xref="InterPro:IPR038427"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S5"
FT                   /inference="similar to AA sequence:UniProt:Q6C265"
FT                   /protein_id="CAX44381.1"
FT                   /translation="MQPKSISLLQKIDSIIETIIVKFTNIFENLQDANKTTEILSMESL
FT                   AMENNCIQIIRLCQDLISISRNLKEIWVLNSIKVTQEKFEWKQEEIDTMFTQFNLLTDK
FT                   IAEFETDMNKE"
FT   CDS_pept        complement(270210..272468)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01200"
FT                   /product="conserved hypothetical protein"
FT                   /note="the distant homologue in S. cerevisiae is required
FT                   for growth at low temperatures"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44382"
FT                   /db_xref="GOA:B9W6S6"
FT                   /db_xref="InterPro:IPR038769"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S6"
FT                   /inference="similar to AA sequence:UniProt:P38335"
FT                   /inference="similar to AA sequence:UniProt:Q6BRP0"
FT                   /protein_id="CAX44382.1"
FT                   /translation="MSRNVSLPSTNESTKNKRVVSSQLRLAKVESIEANNLASSSSPKS
FT                   EAESPKTKLPKTKATARNNNDERTHKSFNDFSLDFSNTFNLMGEETPSYIPRVPTRQRE
FT                   GSKDFAKTQISKEALKKAGELTSIFLDTRKLLNAEYNVIDQKADLAGKTNGNIASKIKI
FT                   SRGTLIRAEKVKTTLAVKYLYIQRIYEWAESHQDNNEHPGVEGVYNPLQILRNRKLRNK
FT                   YNEHPQTIISMQTIPLACNVFSKHNAHSRHDNSAMPGHRKKHWKMMWAIDLNEFVGDSR
FT                   WRVNHWHELRDAKGNLWFSNHVQTPEYSEKDKSKLFVLRNHKHHDKHGEIEVSHKATEK
FT                   EEDEEGIYTTIEPRNHNGLPSNEGSSSDSDFHKFRISRSKSPHKRKIRSKMKKFYIGGP
FT                   GSNSNGNAGDSSSSSNVAHEIASPADTAKSGTVTDPLAKQMFKKLPPLTREDEELDLPA
FT                   SEVSLPKINIEPTSPAPNSKGAFFEDEDKDDIKPSVKEVEFLPFEKRESTSSHSHNRSS
FT                   SDPDGVILEEEDDDNETTNHDKIEEEVDQVKCAAIFDEREVEFQNIVANLEYFHQFMNL
FT                   RTNYLTMEYPRYLELVDQKVQHITKELVYEILLRMSQINDEHLPGYEQLYLGFMEEIKS
FT                   VIHLVNDVYSMKIDTLLSSSDRSISEINASLSLDLRKITEKLDQLDFSLNKNIFKKAIS
FT                   KRRGEQSHNVGLIYKILYSCLENFIVVLLRLIWIVVNIYKILRYIVKLIFGILKFIVW"
FT   CDS_pept        272991..273959
FT                   /transl_table=12
FT                   /locus_tag="CD36_01210"
FT                   /product="HSP70 interacting protein/thioredoxin chimera,
FT                   putative"
FT                   /note="Similar to C. albicans TXL1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44383"
FT                   /db_xref="GOA:B9W6S7"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S7"
FT                   /inference="similar to AA sequence:UniProt:Q93X83"
FT                   /protein_id="CAX44383.1"
FT                   /translation="MPIKFVKSIIDFEGYLKNNRLLVLNFTASWCGPCKAIKHVVDQAY
FT                   GQFQGVEIVRIDLDSQRELASKYSITSVPTFVFIETGKEVDRIQGANPQALISKLQEFN
FT                   TKANGQKRRGNGTTTEELITQNSSLKDIKPLIPENFEVLNATIDFSGYEVLNCLPLYKD
FT                   SKAKHVVSLGGTDASADKSAVISDSDSQLLFYIPFLNISKIYSILVKVKSTKTYKEVEE
FT                   NTLNVDSDDLDEIQPPNLIKVWCNTQSILSFDEASADANAPHVEKLSNNDEDQWFNIKF
FT                   KFVRFQNVQNLTIFVDGEDEDYHTVIEKIVIVGVNSKSEEQ"
FT   CDS_pept        274758..276284
FT                   /transl_table=12
FT                   /locus_tag="CD36_01220"
FT                   /product="mitochondrial inner membrane protein involved in
FT                   potassium ion transport, putative"
FT                   /note="homolog of human Letm1, a protein implicated in
FT                   Wolf-Hirschhorn syndrome"
FT                   /note="Similar to S. cerevisiae YLH47"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44384"
FT                   /db_xref="GOA:B9W6S8"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="InterPro:IPR033122"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S8"
FT                   /inference="similar to AA sequence:UniProt:Q06493"
FT                   /inference="similar to AA sequence:UniProt:O13920"
FT                   /protein_id="CAX44384.1"
FT                   /translation="MNFLIRNTIIGQTCNSKQIFYKHARTLAIKSSLTSSIRYPLQPSL
FT                   HNNLNSNTINFPLVKSFIRHNSTKPEKPSLSSEQIKEKALETLEKSPATELVHKAVEEP
FT                   KKSIWEKVKHEAKHYWHGTKLLGYEIKVSTKLLVKLMAGYELSRRESNQLQRTIVDVVR
FT                   LVPFAMFVIIPFAELLLPIALKIFPNLLPSTYESTVDRQKKLAKLKKTRKAASEFIKNT
FT                   MAESGGLKLSKKITDQERENFVQFFHCISMGKNPDRQQLIQVARLFKNDQVLDNLSRPQ
FT                   LVAMCNYMNLRPFGTDSILRYQIRHRLLNIIKDDKVIDYEGVDSLSMLELQLACSQRGI
FT                   KTSDKSPARLRDDLETWLDLRLRQKIPSTLLILSSAYTYGDKGNSIESYYDALLAVLSS
FT                   IPDEVYNVAKLELSDDSKLKLNILKEQEEMIEEENEREKDTVTKVKDKIKLDDYEETAS
FT                   EGIKIEADDPVEGKNDNETQKQEESSSGKESNQDPVSESKKPIKKEEVKV"
FT   CDS_pept        complement(276480..276959)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01230"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase,
FT                   putative"
FT                   /product="dutp pyrophosphatase, putative"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to C. albicans DUT1"
FT                   /note="Similar to S. cerevisiae DUT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44385"
FT                   /db_xref="GOA:B9W6S9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6S9"
FT                   /inference="similar to AA sequence:UniProt:P33317"
FT                   /inference="similar to AA sequence:UniProt:P43058"
FT                   /protein_id="CAX44385.1"
FT                   /translation="MTSEDQSLKKQKLEASQSLKVYLRSPKGKVPTKGSALAAGYDLYS
FT                   AEAAIIPAHGQGLVSTDISIIVPIGTYGRVAPRSGLAVKHGISTGAGVIDADYRGEVKV
FT                   VLFNHSDKDFEIKEGDRIAQLVLEQIVNADIKEITLEELDNTERGEGGFGSTGKN"
FT   CDS_pept        complement(277323..278189)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44386"
FT                   /db_xref="GOA:B9W6T0"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T0"
FT                   /inference="similar to AA sequence:UniProt:Q6BRN5"
FT                   /protein_id="CAX44386.1"
FT                   /translation="MTTRFSLPGAFPIDDEIPSASTNATFSTVSNTATELIETQQKFQF
FT                   SNNQLIHNKTKYQFDILTQIDALLYIVIFYQFVKYCHSACLIPLILHLILQILLNSKLV
FT                   TQNSQVPNFLSFLSNEDSQDTRERIYETFIHKYCYLLYIKTILVILYHTLFVATWVMYL
FT                   IDTQQLEKLNHGTWWFISFIGEETPVVDKSTPYWLKLFKLGLFQLIFTDVLILFLQLTL
FT                   YQCIYKQSDAFHLDRRLNEKEVYIIRTNADSASGLDDQSVVADSDGVPTVLKVRVFECF
FT                   QSDAYAY"
FT   CDS_pept        complement(278577..279770)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01250"
FT                   /product="eukaryotic initiation factor 4A, putative"
FT                   /product="ATP-dependent RNA helicase eif4A, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to C. albicans TIF1"
FT                   /note="Similar to S. cerevisiae TIF2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44387"
FT                   /db_xref="GOA:B9W6T1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T1"
FT                   /inference="similar to AA sequence:UniProt:P87206"
FT                   /inference="similar to AA sequence:UniProt:P10081"
FT                   /protein_id="CAX44387.1"
FT                   /translation="MASEGITEIDSGLIETNYDNVVYKFDDLNLKPNIVRGIFGYGYET
FT                   PSAIQQRAILPITEGRDVLAQAQSGTGKTATFTISALQRINENEKATQALILAPTRELA
FT                   LQIKNVITAIGLYLKVTVHASIGGTSMSDDIEAFRSGVQIVVGTPGRVLDMIERRYFKT
FT                   DKVKMFILDEADEMLSSGFKEQIYNIFRLLPETTQIVLLSATMPQDVLEVTTKFMNNPV
FT                   RILVKKDELTLEGIKQFYINVELEDYKFDCLCDLYDSISVTQAVIFCNTRSKVEFLTNK
FT                   LREQHFTVSAIHADLPQAERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLP
FT                   ANKENYIHRIGRGGRFGRKGVAINFVTDRDVGMMREIEKFYSTQIEEMPADIGALFA"
FT   CDS_pept        complement(280538..282538)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01260"
FT                   /product="glycogenin (glucosyltransferase), putative"
FT                   /product="(self-glucosylating) initiator of glycogen
FT                   synthesis, putative"
FT                   /product="n-dodecyl-beta-D-maltoside glycosylating enzyme,
FT                   putative"
FT                   /note="Similar to C. albicans GLG21"
FT                   /note="Similar to S. cerevisiae GLG2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44388"
FT                   /db_xref="GOA:B9W6T2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T2"
FT                   /inference="similar to AA sequence:UniProt:P47011"
FT                   /inference="similar to AA sequence:UniProt:Q5KD57"
FT                   /protein_id="CAX44388.1"
FT                   /translation="MTNAVFTLLYNPDYLAGALVLGSVLKKLVSRSDQKYPELKFGILI
FT                   DKSKFSTSQLQLLSKYYDDLVDVSPLRSTIVEKLTFDLKRPELDKTFTKIELWSLIQYD
FT                   KILYLDSDTLPVIPEADNGGTVLDLLALDFPKFKILAAPDSGFPDIFNSGVFVLRPNLD
FT                   DYTKLAALVQESVINPNVSFDGADQGLLNQYFNAQPDWVQALLKKKDIPIDLGTVSYTQ
FT                   DSNWIKIPFLYNVTPSAEYEYLPALKHFQNPPEQPSFLENPVAEAELIDQGAEQPKHDK
FT                   ELWESTFDTLGRYHSTALSYINYKTTQVKVVHFIGKYKPWKSSSNVFGVHRDWWKAWME
FT                   EFGEKSLSDVVHGEKSLEQEPPADYASEPVEQEPPKEEPAEICGEKVEPIPEPPLDTSD
FT                   PQVLLDPANYQRFEDRIQPSIDAMWDPTKEPPPKREDLKEEDRHDFLDKIPKSFTNDWD
FT                   SSTQHHHHHHHPPEERKNIHDTQHPVEHYHHGETQQNDQSTLEEENVQPPNNELPMSPP
FT                   EHPEHDHAFEHTTSNTPPVKPELYGHKFVEPERVFDTTDDYFPTHILQEMEKVDLSNKP
FT                   DTDAEVKPTSSSELATDVTAFNLMNEELSKEGVLEESAFEEIYTEDKEDIDGDISEDDI
FT                   LEEEEEEEVVPKLFPWEFRESGKVIAERVFD"
FT   CDS_pept        complement(join(284471..284710,285072..285095))
FT                   /transl_table=12
FT                   /locus_tag="CD36_01270"
FT                   /product="40S ribosomal protein S21 (S26), putative"
FT                   /note="Similar to C. albicans RPS21"
FT                   /note="Similar to S. cerevisiae RPS21B"
FT                   /note="Similar to S. cerevisiae RPS21A"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44389"
FT                   /db_xref="GOA:B9W6T3"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR018279"
FT                   /db_xref="InterPro:IPR038579"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T3"
FT                   /protein_id="CAX44389.1"
FT                   /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHASVQISIAKVDEEGRA
FT                   IAGDNITYALSGYVRGRGEADDSLNRLAQQDGLLKNVWSYSR"
FT   CDS_pept        complement(285416..287074)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01280"
FT                   /product="tRNA methyltransferase, putative"
FT                   /product="trna(m5u54)methyltransferase, putative"
FT                   /product="trna (uracil-5-)-methyltransferase, putative"
FT                   /EC_number="2.1.1.35"
FT                   /EC_number="3.-.-.-"
FT                   /note="Similar to S. cerevisiae TRM2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44390"
FT                   /db_xref="GOA:B9W6T4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR025795"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T4"
FT                   /inference="similar to AA sequence:UniProt:P33753"
FT                   /inference="similar to AA sequence:UniProt:Q9HGQ5"
FT                   /protein_id="CAX44390.1"
FT                   /translation="MVAEVLEDKKRPNEDPCDVDNSKRTRRGKRKPRLRRYKNKDIDET
FT                   SPLGVLQLEIKDLLEKHDLTKEDVVNDMSAILNDPELLEQYNNRIVSDVKVFALTSNGD
FT                   SLAIIPSVEPEKKQVALIPFGLPDDVVTIKVHKSHPMYVEADLLSIEKSSAMRNNELIN
FT                   CRYFGKCSGCQFQNIDYQQQLAIKKQTIINAYDHFAPKLVSHKLLPEILPTQESPLTYN
FT                   YRTKLTPHFYIPNKKTGKDLPCPPNLGIASKGRPTWRKSDFGPEGTNIDIEECNIGTKI
FT                   INQGLANERRRFNTEYVKYSKGATFLLREDTKVLQEDTVLGEGSVDENGQVSKIEVELE
FT                   DNTKLVKTCVTKTRQIVQEYINGYIFEFSAGEFFQNNNSILPIVIDYVRSNLPLSEDQP
FT                   NYLVDAYCGSGLFSITCSSNVSKVIGVEISADSIRFAKRNAEKNNIKNANFIVGKAEEI
FT                   FASIDTPNNQTSVILDPPRKGCDDVFLNQLSDYNPAKIVYISCNVHSQARDIEWFINNT
FT                   ANGNQYYVESIKGFDFFPQTHHVETVAVLSLKERK"
FT   CDS_pept        complement(287491..289296)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01290"
FT                   /product="osmostress-responsive transcription factor,
FT                   putative"
FT                   /note="Similar to S. cerevisiae HOTY1"
FT                   /note="Similar to C. albicans HOT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44391"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T5"
FT                   /inference="similar to AA sequence:UniProt:Q03213"
FT                   /protein_id="CAX44391.1"
FT                   /translation="MNETYNSQEPNNTMFYNNNSTPSNDAQSHNNNNNNSAGNSSIINA
FT                   SASMHANNGNHNNDNINTNENINENNSNNSNNNSSSSTNNNNKNKNKNKNNSGNSNNHT
FT                   VNELYGLIHNLQNQFANYQNTQFNQLMMKISFLHDSMDHMKSQVNDLSQQVLFLAKNSG
FT                   MRPGTNSNTNSAFNNQFKAFEVFTKHLNELNKEIEEISSSSQGIQNQQQQQQQQQQLHQ
FT                   PHHQAQIPPPPSHPPQQTLQLQSNHSQFQGSSVHLGVPTNNNGQPTTQFDEEVDSITRK
FT                   GLSLRSPANSSPNPTSHYVFDVGPFASRNMNGNNANTLYDKGPTTSVIRPNKKRRKQQK
FT                   NSQEETPANQPESTLQSQRRLPVQQQSRQTIAQSSSAYPNSYILPMPPLLGDDKLGQTP
FT                   SSSTNNDTTQFMLPRDNGTVMTSALRQPPNHTRPPPNSQTSSGFSFDDEIDTMDQLEND
FT                   KQNEGSSSESGKRASKKRKQSESAKMTISVNPLNIPQYKLERSLKSLAEIWKEYAHGLN
FT                   NKPPLKSLETKYGTKWRNETESRTFLRRKKIYEAIEIGISKGYTEDEVIQELEMHRSYN
FT                   KNGVIKRKPLSWLSSNMPEKFNSPT"
FT   CDS_pept        complement(290525..292000)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01300"
FT                   /product="membrane protein involved in sphingolipid
FT                   metabolism (either ong-chain base-1-phosphate phosphatase
FT                   or dihydrosphingosine 1-phosphate phosphatase), putative"
FT                   /note="Similar to S. cerevisiae LBP3"
FT                   /note="Similar to C. albicans LCB3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44392"
FT                   /db_xref="GOA:B9W6T6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T6"
FT                   /inference="similar to AA sequence:UniProt:P47013"
FT                   /protein_id="CAX44392.1"
FT                   /translation="MREGVEFATATSLKSRNKSGNVAAAEPSSLSPQISDHSNDAGNKS
FT                   NNHYKERLSPFRYKLRLLMLPLIRQETIYLAKMQSFLRCSVFDFYFAWTANLASHTFYV
FT                   LMLPPPIWFGGGYLSRDLVYVLGLGIYFTGFLKDFFCLPRPRSPPLHRITMSSYTTQEY
FT                   GFPSSHSANATGVSLLLLIKILSLENVSNITYYLLILGLSLYYISLIFGRLYCGMHGFL
FT                   DVIIGGLVGSFVFLFRHYFGLQWDELLFDNGLGIVGSAVIIIAVFVSLIHFHSEPVDDC
FT                   PCFDDSVAFVGVLIGLDLAHLVAYHTKYFAKMNSTGNPYLIPFDVNRGIIVSSLRFLLG
FT                   VVLVVTWKTLAKPIVFTILPPIYKAVGVYLPRRSYISTAHTQTSTRKIRSTSMSNDSNM
FT                   GIGDINSFIKGVTDHNKKDEVGPETEIDYYEMLSYNQNQSSDSTPIQTPPKYNSGVFKY
FT                   RYDVEIVGRLIIYAGISITAVWTFAFASDYLNL"
FT   CDS_pept        complement(292917..293957)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01310"
FT                   /product="GTP-binding RHO-like protein, putative"
FT                   /note="Similar to C. albicans CRL1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44393"
FT                   /db_xref="GOA:B9W6T7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T7"
FT                   /inference="similar to AA sequence:UniProt:P33153"
FT                   /inference="similar to AA sequence:UniProt:Q00246"
FT                   /protein_id="CAX44393.1"
FT                   /translation="MTPNGNRRHSAYMGSPRSQHSSTVETGYNPYEAVQKKQELYQNNN
FT                   SNSPTVIIEEDPYIPDYKESSLANRKTNYNMKIVVVGDGGCGKTCLLLAYTQNKFPSIY
FT                   VPTVFENYVTAVQSPNGKTVELALWDTAGQEEYDRLRPLSYPDVDILLVCFAVDNEVSL
FT                   ENVKDMWFPEVNHYCPGIPIILVGTKSDLSSDVNHDAAIRVAKEIGAIGLIFTSAKTMF
FT                   NVRTVFNFALNHFQRNMELQEQYEKTLGSRKRISRVLGGSNGGSGNHSRHHSRNYSNVS
FT                   NNRRGHLKNTSYDSTALLDQPLTEDTYVKNPYGNFGYKAGVESPYNQDEFAFTRERKKK
FT                   KKCIIL"
FT   CDS_pept        complement(294931..295329)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01320"
FT                   /product="peroxisomal lipid carrier, putative"
FT                   /product="lipid-transfer protein, putative"
FT                   /product="oleate-induced peroxisomal protein, putative"
FT                   /note="Similar to Candida maltosa POX18"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44394"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T8"
FT                   /inference="similar to AA sequence:UniProt:Q00680"
FT                   /protein_id="CAX44394.1"
FT                   /translation="MSQTVAAPGFQASAYFEYLQECLKEQMIREIAVGTVKAILVVTIK
FT                   NKDNKQQTWVLDFKNKGSVVKAESETTPPKGDVQLILKDADFMKLADGKANGQKLFMSG
FT                   RLKVKGNLLKAVSIESLFKDFGPVPAKL"
FT   CDS_pept        296939..298639
FT                   /transl_table=12
FT                   /locus_tag="CD36_01330"
FT                   /product="mitochondrial chaperonin, required for ubiquinone
FT                   (coenzyme Q) biosynthesis and for respiratory growth,
FT                   putative"
FT                   /note="Similar to C. albicans ABC1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44395"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6T9"
FT                   /protein_id="CAX44395.1"
FT                   /translation="MSISKNIYELAVIASSFGKILEGSTRIAQHEAYQWYKNSFVSKTI
FT                   RDSCDNSQPMYEEMQNISTTIRNQVPISINQKENPFQSQSQKRSYSTKSYSPGDEVELE
FT                   TESTSSTTVPEIKPKLKKTFEMSQSEVPSSRLARIFHYGSLAAGIGLNAATQGLKHYAS
FT                   GNSEPITMKSLVLSPQNIERMARKFSKMRGAALKLGQMLSFQDASILPKEIQQILLRVQ
FT                   NSAHYMPPGQLERVMSKELGLNWRERLFASFDDVPIAAASIGQVHTAVAEDLTPVVVKV
FT                   QYPGVVDSIDSDLNNILMLLTASSLLPPGLFLDKTIANARVELKWECDYIREARNLVRM
FT                   REFLKDDDVFAVPRVFHQLCGEHVLTMERMRGVEIVKGDWDQSTKDWIATNIMRLCLLE
FT                   IKEFKFMQTDPNWANFLYNEKTHKIELLDFGAARDFGDHFIDNYVKVLRAAVKKDRKRV
FT                   EEISKDLGYLTGLESQQMVKAHVDSVMCLGEAFSPVDNNGEPFNFKKQTISDRVRGNVG
FT                   LMLNERLTPPPEETYSLHRKLSGVFLLCARLNATVPCEDLFREIIGYED"
FT   CDS_pept        299153..302131
FT                   /transl_table=12
FT                   /locus_tag="CD36_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44396"
FT                   /db_xref="GOA:B9W6U0"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U0"
FT                   /inference="similar to AA sequence:UniProt:P87136"
FT                   /inference="similar to AA sequence:UniProt:P53120"
FT                   /protein_id="CAX44396.1"
FT                   /translation="MTSDESNYYNDTCDSMDSTDESQLLTSSTGIRSDGSLPRLVIDRQ
FT                   SSVILANTGERVHRSVSFSNSQDTSSETESLFSSNGILYQRLVVPMLRVYHNEVFRNVF
FT                   KCSMAYFLASLGVYYTPFDEFLGSTDSKHVVATVAVYFHPSRTKGSMTQTLMFVVISIV
FT                   YSFTVSLGCRAISAYFYRGGKDEFSHFIDLIISSISLGVISFMKQKVNKLTFNTACSLA
FT                   CISIVACIVKEGSINSDNIPLPRIESTFQVVVSGCIISVACCYFIWPVSAVKKLQKTLN
FT                   DSYDIFSQVISILVRRFVAGEQFTPVDVEMIEKLKTNIKSLSQYLEEAKYELFVIGKEE
FT                   EWMFFEKLVKSTVSLARHLQALSAATRMQWTLLHEENIISDTPSLRSFVTDDIHLSPSV
FT                   LNMTHSMPQPLQDEAHNSLQLFDLFVQHLAPSIKSFVFTIKGVLREVPFENFSEENPSR
FT                   FASTTTLQYSLDSAIRLFEEKQEQSFDKLYGQKIFKQNSDFDFKADQEEVTACCGNFSS
FT                   LLSQFGSELLQFIKLCDRYDDIASSSRTWRWLRFWERTSEPKRSIDNSLHAAVDDLREQ
FT                   YGLGSFKTPERGSFASQLGYSIWKFLKVFKRTDVQFGIRVGLGAACISVFAFIPATKGI
FT                   FNVWRGEWALTIYCIMMNKSLGGTTMTVKWRIIGTFLGAFTSFVVWKITDANVYALCLT
FT                   GVLISIPSFYIIMYWKKNNAFGRFILLTYNLTALYSYSMIQKDSEDDNEGGDDPIIGEI
FT                   AFHRFIAVSVGIMWALTMATWFLPNSARVRLKNGLSALWLRLGVIWNSDPLEFDPDTKQ
FT                   LVGFKAEEGTNKLLAECETLLKQAPVEFRLKGAFPSHIYSKLIKDTSAIIDAFQNLDLL
FT                   IKVDPKLSPSEEFVFKYIEIEREEVEQRIFLVFYMLASAMKLGFPIPSKPASIEHAKDR
FT                   MLYKLSSIRQQQEEELVLKNADFILLYSYILVATTIAEQLDRIMVQLKELLGEISEDIF
FT                   QLV"
FT   CDS_pept        302523..303818
FT                   /transl_table=12
FT                   /locus_tag="CD36_01350"
FT                   /product="nuclear polyadenylated RNA-binding protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae NAB2"
FT                   /note="Similar to C. albicans NAB2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44397"
FT                   /db_xref="GOA:B9W6U1"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U1"
FT                   /inference="similar to AA sequence:UniProt:P32505"
FT                   /protein_id="CAX44397.1"
FT                   /translation="MQFAPDNQIGKELQQNLIQEIQRRFNKAADDAVDIADYIIYLIVA
FT                   KKSEQEIVAEVKDIADISIDVGFIGDVHSEIKKLEEKYNQPSASAVEETPQPPQHPQQS
FT                   QASVVAPQVPTGPKKQLTEEERIALRNQRFGTTPRVSGRGGRGGITKTRTDFRNGHSNK
FT                   NFLDPKKLEQIISGTNNGAIKFVPLPPKGRCPDFPYCKNQNCQKAHPTKNCFNYPNCPN
FT                   PSGTCNYLHPDQDQELIAKLETTKKEFEEKRKNQLMVKQGSCKYGLKCAKENCPFAHPT
FT                   PANPESGKIETLEWCSQGKNCQDRDCTKSHPPPPTANSENLLSAVDLALEQCKFGSQCT
FT                   NVKCPRRHATSTVPCRSGAECRRVDCTFAHPLKEPCRFGIKCTNKVCMYQHPEGRTITS
FT                   HTWTKDAAESNNNTSNRSFAVSEDQIMEQVAQ"
FT   CDS_pept        complement(304154..304903)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01360"
FT                   /product="40s ribosomal protein S2 (S4) (YS5) (RP12),
FT                   putative"
FT                   /product="omnipotent suppressor SUP44-homologue, putative"
FT                   /note="Similar to S. cerevisiae RPS2"
FT                   /note="Similar to C. albicans RPS2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44398"
FT                   /db_xref="GOA:B9W6U2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U2"
FT                   /inference="similar to AA sequence:UniProt:P25443"
FT                   /protein_id="CAX44398.1"
FT                   /translation="MSAEAPKRQFGDRRRGGRRGGRRDGEEKGWTPVTKLGRLVKAGKI
FT                   TSVEQIYLHSLPVKEYQIIDLLLPDLKDDVMKIRSVQKQTRAGQRTRMKAVVVIGDSNG
FT                   HVGLGIKTAKEVASAIKAAIVIAKLSIIPIRRGYWGSNLGQPHSLPCKVTGKCGSVAVR
FT                   LIPAPRGKGIVASPVVKRLMQLAGVEDVYTSSSGSTRTTENTLKAAFAAIGNTYSFLTP
FT                   NLWAETPLAASPLEVYAEEAAAGKKRY"
FT   CDS_pept        306301..306903
FT                   /transl_table=12
FT                   /locus_tag="CD36_01370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44399"
FT                   /db_xref="GOA:B9W6U3"
FT                   /db_xref="InterPro:IPR039454"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U3"
FT                   /inference="similar to AA sequence:UniProt:Q6BYH7"
FT                   /protein_id="CAX44399.1"
FT                   /translation="MSSKAPSNEQIKKDVKKDADNIAKKGKEESEHLKKQGKEAVDEAS
FT                   EKGKEFIDQANKKGKELLDEANDKSKEFLKEARKELNHLEEEGQNLLSQFVAYVKSTAN
FT                   SIGQSLNKAGAELQSATSAAVSRTSVELQNPVVIAQIAVAAGGAAAGYLAYLERYRINT
FT                   DNKYVVGIHASIITGLVVLDGYLFSTYYPKYDKKVAK"
FT   CDS_pept        313884..316040
FT                   /transl_table=12
FT                   /locus_tag="CD36_01380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44400"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U4"
FT                   /inference="similar to AA sequence:UniProt:Q6BYH5"
FT                   /protein_id="CAX44400.1"
FT                   /translation="MFISTSPSIVPSNRFDMLDPTDHNQSLNNTQFPINEYEEQQNFES
FT                   QQPPSPPQQQRESESIFKEDEDSLQQQMQESFPLFQYQQPFMSTTNYLLDESVQENEDN
FT                   YQLLSGGDLDSTSSFTTNSLANINSNSLYGNSINVNLGAVPTNLSNPDTMIAGQLSSSV
FT                   SSSYYNTPFNQQQQTSQSLQSFQPFQLPNDSSTSSSLYSYASASASASAPQPQVHPRQE
FT                   QMNTGSSFGFSSTPTQSTFTHTSANTPLQQQQHDLYPVSNSMNSILDNSNLVYHPAKFE
FT                   VSSNIINPAIQQQSLNLDLTQAYPQPPLSSTSTTFDPITYNSSPTISQPQFTSQSLPNL
FT                   SSANTGKKTTSKRTKSRTPTTTSRSAPSVIKKEETNAFKISTHAIAKQENDSSSLPSGN
FT                   RRYRVIRGISAGGCNTKPPKESMEGKAIYYPMNLNLNGASLKDICYPKWNESEKQDRRR
FT                   IIRIERIQQGPVITANFSIVGAANENPVVLPPSNPIIDVIEVSCLECDVKINNSHVSDG
FT                   SNFYDSQSSDDEITGNQGDASGVGGRKSPNYIKNEFNDDYYQYYITSVEVVEIVELLIG
FT                   NQFRDAAERRKERGRVRSNLVPFWSKKPISSRMSESSTSSSSPQNTSTTPGSSSSLSGT
FT                   TTTTVGGAGSSLTNHDYRVELAKRIMGYEIRKPRGFDKEVRILRWDKLVPALQRALQSY
FT                   YTEIPADDPYAEYYKTHAPQIHNN"
FT   CDS_pept        complement(319635..320339)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01390"
FT                   /product="superoxide dismutase [Mn], mitochondrial
FT                   precursor, putative"
FT                   /EC_number="1.15.1.1"
FT                   /note="Similar to C. albicans SOD2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44401"
FT                   /db_xref="GOA:B9W6U5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U5"
FT                   /inference="similar to AA sequence:UniProt:O13401"
FT                   /protein_id="CAX44401.1"
FT                   /translation="MFSIRSSSRVLLKASSATTRATLNAAASKTFTRSKYSLPELDYEF
FT                   SATEPYISGQINEIHYTKHHQTYVNNLNASIEQAVEAKSKGEVKKLVALQKAINFNGGG
FT                   YLNHCLWWKNLAPVSQGGGQPPSEDSKLGKQIVKQFGSLDKLIEITNGKLAGIQGSGWA
FT                   FIVKNKSNGDTIDVITTANQDTVTDPNLVPLIAIDAWEHAYYLQYQNVKADYFKNLWHV
FT                   INWKEAERRFEF"
FT   CDS_pept        complement(320962..322893)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01400"
FT                   /product="arginyl-trna synthetase, cytoplasmic, putative"
FT                   /product="arginine-trna ligase, putative"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44402"
FT                   /db_xref="GOA:B9W6U6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U6"
FT                   /protein_id="CAX44402.1"
FT                   /translation="MKILQKLFSSTIFYSQRGYKSMSVETISDSLKQLGLSQPAAIEGT
FT                   HPQYNVVDVFRNYIAEELNRISSVDKSIIIQALDTPKVLDQGDIIVPIPKLRLKGINPN
FT                   EKSKEWAESFNKGKFISEIKPQGVFLQFYFAKTLLYNLVIEDVLKRKSDYGYLPLGVGK
FT                   KAIVEFSSPNIAKPFHAGHLRSTIIGGFISNLYEKVGWDVTRINYLGDWGKQFGLLAVG
FT                   FERYGDESKLASDPINHLFEVYVKINQDVAKETSEATGETPGESIDASEQDEKKIQSST
FT                   NEEARKFFRRMEDGDESALKIWARFRDLSIEKYVDTYGRLNIKYDVYSGESQVPQDKMK
FT                   EATKLFEDKGLIDIDRGAKLIDLTKFNKKLGKALVEKSDGTSLYLTRDVGEAIKRYETY
FT                   KFDKMIYVIAAQQDLHCAQFFEILKQMGFEWAHNLEHINFGMVQGMSTRKGTVVFLDNI
FT                   LQETKEKMHEVMQKNEEKYAQIEDPDKIADLIGISAVMIQDMQSKRIHNYEFKWDRMTS
FT                   FEGDTGPYLQYAHSRLCSMQRKSGISIEELEHANFELLVEPCASALARTLAQYPDVIKK
FT                   AVKGLEPSTIVTYLFSVTHIVSQCYDILWVSGQEKEVAIARLALYEAARQVINNGMTLL
FT                   GLTPVNRM"
FT   CDS_pept        323438..325249
FT                   /transl_table=12
FT                   /locus_tag="CD36_01410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44403"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U7"
FT                   /inference="similar to AA sequence:UniProt:Q6FQD1"
FT                   /inference="similar to AA sequence:UniProt:Q6BIU3"
FT                   /protein_id="CAX44403.1"
FT                   /translation="MSDEKIKQLQEMGFSQEQAANALKASNNVLEVAIAHLFGEPVEPS
FT                   QENKENTQLVPYNETDTVPISNPLDIPKFPSYRDTPTSSNGGWSEIQDDELIENYEDDD
FT                   LVDQWTNNSKQTSPETIFDYPLAFTRSKEMPPCVLPKVTGTLQSCLISLVVTLSQIGEL
FT                   RNAFFSEEFDYGFDENWYTPNTELTIDTPEKYKDNSLYRFFVEIQRIFGFLSPASNRSF
FT                   ISGQNLFKSLPDDFADDDDDWEDVIKKVQKYISLGSQSILGRDLAPFFLSQVECNGEET
FT                   TDLTILQIDYEVRGSNLQESLNSLIWNSELNPVFTKLGQLLTIQMFGDDDDGFQAQSFE
FT                   IPEYFYPGIFSATYQEIIEKMNQKKLNATKERSGITTKLLGFSSFEGKKIKKILQSSID
FT                   YLATTDSKEAHDDLKRLSEKVQDESLALNDRLKFVNQEYLKMDVKNPDNILEMIEREGL
FT                   PRPERYYLTGVIISDTEYIYRAKNLTTTDFEKEDWLYIVIDSGQNNKVSEYRTETMSFD
FT                   ALQSFILEETKLNRRQLILNYVAESSLKDSVKLPEKLVEFFDKDNQLLVEQVNEFNESN
FT                   KEHQAEVSNDSSAEESLLVSHTETQSL"
FT   CDS_pept        325513..327072
FT                   /transl_table=12
FT                   /locus_tag="CD36_01420"
FT                   /product="vacuolar protein sorting-associated protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae VPS17"
FT                   /note="Similar to C. albicans VPS17"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44404"
FT                   /db_xref="GOA:B9W6U8"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR014461"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR037907"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U8"
FT                   /inference="similar to AA sequence:UniProt:P32913"
FT                   /protein_id="CAX44404.1"
FT                   /translation="MSSLDYPEDFENNNPFAEPVISDQANGVHSQTENNETQSPPEEHT
FT                   APQSDETSPDPNTEGTLTEDELRKLIPERFTTKYRLSIQLVEIEKNKPGNPILKMNVKV
FT                   KGLPRYRQSIYKDVRRTFNEVVKFNRYLTVSNLEVFVPVIPSAITSYPTGGEDERKKLF
FT                   VEWQEWLDRVTSNPILIRDEEFVYFVENDFGYSVINTNRKTSVASGIMRKTLKQFAVPY
FT                   DPYEELANFRPIIKEAYLTLQKLHKLLDRNSKTEKQVSIHIFDMANKLSQLSEFETTHP
FT                   GMKNMWEKLGKITQKQSDFTLVDSINEMATLGDGTQTLIDDFYEIKEALTNRHLIMREL
FT                   IQAETQTNVKHVQANKIKNKSSLDPIKVDEALRSLEYASKVQESLHLQVKRISGEMMFE
FT                   RKEVIDFTEKRIQRLMKAYTLHKVEHHRKILKHFENIRLDVRSVDDKGGLSRLNRDNLT
FT                   NLKHNLTQSQSSQGDSWSSRTFRSLEKEEEEKEHKKSDANGFESTTVDPRNAASLLGVA
FT                   TF"
FT   CDS_pept        327462..331835
FT                   /transl_table=12
FT                   /locus_tag="CD36_01430"
FT                   /product="E3 SUMO-protein ligase, putative"
FT                   /product="ubiquitin-like protein ligase, putative"
FT                   /product="SAP and Miz-finger domain-containing protein,
FT                   putative"
FT                   /EC_number="6.-.-.-"
FT                   /note="Similar to S. cerevisiae SIZ1 (ULL1)"
FT                   /note="Similar to S. pombe PLI1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44405"
FT                   /db_xref="GOA:B9W6U9"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR023321"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR038654"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6U9"
FT                   /inference="similar to AA sequence:UniProt:Q04195"
FT                   /inference="similar to AA sequence:UniProt:Q5A8Y9"
FT                   /inference="similar to AA sequence:UniProt:Q12216"
FT                   /inference="similar to AA sequence:UniProt:O94451"
FT                   /protein_id="CAX44405.1"
FT                   /translation="MSTIPPFTSEDYKETIKVWRSFKVSQLKDVCRSLDLRLSGRKQDL
FT                   IDRGESCLVSKFRSDDHLALHAIRALIFRCLQGEQLPNYQEMIHAIRTGQYQMTTPTSI
FT                   ARNPPTSRLSGIHISDSVPFKGHTLYFKTTPLYSVSRLIHSTPMLLLSNGNRSFSVCYF
FT                   IFTEDEYKMLQDKTRNYRLYILCGKPNGQRSNSTDNVLIEYPAQTVIYINDHKLSDTYS
FT                   GIAEKIGTAVPADVTDYMNSPPERNEIKFCHSASGAAYLMYLYIVEVKPAETLIQQVRS
FT                   WPAIPKNETIKNIKDMSTYDGIQTTKLTLRDPLSYTKLAIPTKSVSCDHYMCFNGLIFI
FT                   ESQRSVETWSCPVCSKTINFNDLRISEYFEEILKNVDAEVDEIIIMQDGSWKVANGDNT
FT                   NATKKRTESASPEAIVLLSDDEDDISTHEVDANAQLESEEDEEEEENVNNNRVDNISEV
FT                   EISDTEQNNNQEKSIDSENIQNQDEATDKMEDNNTALSAQQSPQAETNKDATSNMETTF
FT                   QEDIMPSLPRSGVQEKDTSSGDGIDTEQNLGECQTVQAVDLADSPISVINVTLDPPNES
FT                   NKERSTESSVPLSNLSSTTRESFPISSSPRSKPPSMITPISPSSAQVASDKSQTSHENS
FT                   IVSNHLSRTSSPDFAASPLSLTSVNNNHDENRTSQSPNVNKADMLNNQDGNNSQAASDS
FT                   ANTPSLSTIAVSAENESGQQDANKIRNKDEEIRRLAQALYYQRQIIHQQLPLIQRQALL
FT                   QQQQQLEQQQQLERQRQQQRLLQQQQQQQRCLLQQQQQQQQQQQPPQQYPHHPQQRPQQ
FT                   QHLSPEDQRQYLQLSQLPQFQRLQQLQARQRQQQQQLQPSSQSRSIPQNGIVQIQLNEQ
FT                   QHVNSLPRPADTRVVLRQNVQRSVMTMPSSVHSGMSTFQQQGSVNSNLLRHVPYQLNVR
FT                   NHSRGLSVDTEPKNISSSDSRLAVVNSVDESDPIEDRPLASLARRSKSTNNMPSNNTNN
FT                   IASSNYQASEKQLHVYRLGNPNNNSTENYKKDNETTTGTSTQQEPSAEGSANKQDLPGS
FT                   NIQNPLSATQTLELNQNHGQASGIQTKNDINNAGVEVNSKLQTNSIHSRSLNEIPQHTT
FT                   SNSPRMEQNITSLVPPGNSLQMVTGRTSGRGEERDKRIDSNQNVSQIENSIVDSVGRDI
FT                   ASPINDMCNSKYIHKMVENINNKKDDIIGRIDAKRNHKRFVLQNFDSKTKSLISDLEKR
FT                   GGSKYDKSKLIQARSGEKSRLAQHLNDEFEKLQLEYSVQLQKLDETLSHLKRKAEVGNA
FT                   THIQVNGRSMDTNSVYNADSRGAQRGETDIAGQTPKRNHSVNITPQTNQMISQNGISQS
FT                   SPELTSQNQDYSNKIHFGPPMQTLQVPSSKRQRITGFLGIQVNEDALNVSNSNHGLQTS
FT                   MTPINNKIKSISLDTSNPNDCKDQLRDLQTQFSLNEYKNSGTMHDPIVLDLSDEE"
FT   CDS_pept        complement(331980..332501)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01440"
FT                   /product="DNA-directed RNA polymerase II 19 kda
FT                   polypeptide, putative"
FT                   /product="DNA-directed RNA polymerase II core complex
FT                   subunit, putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to S. cerevisiae RPB7"
FT                   /note="Similar to C. albicans RPB7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44406"
FT                   /db_xref="GOA:B9W6V0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V0"
FT                   /inference="similar to AA sequence:UniProt:Q9C474"
FT                   /inference="similar to AA sequence:UniProt:O14459"
FT                   /inference="similar to AA sequence:UniProt:P34087"
FT                   /protein_id="CAX44406.1"
FT                   /translation="MFFLKDLSLNLTLHPSFFGPQMDQYLREKLLSDVEGTCTGQFGYI
FT                   VCVLDSMNIDVGKGRIIPSTGMAEFEVKYRAVVWKPFKGEVVDAVVTTVNKMGFFADVG
FT                   PLSVFVSTHLIPSDMKFNPSANPPAYVSPDENIEKGSRVRLKIVGTRTDVNEIYAIGSI
FT                   KEDYLGPSPM"
FT   CDS_pept        332987..333517
FT                   /transl_table=12
FT                   /locus_tag="CD36_01450"
FT                   /product="60S ribosomal protein L23, mitochondrial
FT                   precursor, putative"
FT                   /note="Similar to S. cerevisiae MRPL23"
FT                   /note="Similar to C. albicans MRPL23"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44407"
FT                   /db_xref="GOA:B9W6V1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V1"
FT                   /inference="similar to AA sequence:UniProt:Q12487"
FT                   /protein_id="CAX44407.1"
FT                   /translation="MSQRIGITASALTRVWHHVDVAADNRSLGRLASSIAITLMGKHKP
FT                   TYTPNRDHGDYVVVTNCAHLKVTGNKLKEKTYWSHTTRPGTLKLVPMERMIDNKGYGEI
FT                   IRRAVKGMIPKNKHRLVRMDRLKLFDGDDHPYKDNLIAFADENPDMRNKLAELEKNEKN
FT                   RAELREKYLFHQQ"
FT   CDS_pept        complement(333709..337413)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01460"
FT                   /product="DNA-dependent RNA polymerase II component,
FT                   putative"
FT                   /note="Similar to C. albicans RPB2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44408"
FT                   /db_xref="GOA:B9W6V2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V2"
FT                   /inference="similar to AA sequence:UniProt:Q9UVA1"
FT                   /protein_id="CAX44408.1"
FT                   /translation="MSADESMADPYQYDSIDEPITQEDCWTVITSFFQEKGLVSQQLDS
FT                   FDEFVETSIQELVWEDSHLILDQPAQHTSEKDHENKRYEITFGKIYISKPSQTEGDGST
FT                   HAVFPQEARLRNLTYSSPLYVDMTSKVFKSDDNKRKDNELEWIQEEPDKDTETKVFLGK
FT                   VPIMLRSKFCMLRDLAEHEFYELKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKK
FT                   AAPSPISHVAEIRSAIEKGSRLISSMQIKLYGRDEKGVSGRTIKATLPYIKEDIPIVIV
FT                   FRALGVVPDGDILEHICYDANDWQMLEMLKPCVEEGFVIQEREVALDFIGRRGVLGIRR
FT                   EKRIQYAKDILQKELLPNITQEEGFETRKAFFLGYMVNRLLLCALERKEPDDRDHFGKK
FT                   RLDLAGPLLANLFRILFKKLTKDIYNYMQRCVENGGDFNVTLAVKSQTITDGLRYSLAT
FT                   GNWGEQRKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKIAKPRQLHNTHWGLV
FT                   CPAETPEGQACGLVKNLSLMTCISVGTPSEPILGFLRDYGLEVLEDYVPSNAPDSTRVF
FT                   VNGVWVGVHRDPAALVDFMRELRRSGDLSPEVSIIRDIREKEFKIFTDAGRVYRPLFIV
FT                   DDNPESETKGELKITKEHIKQLLRSDELDEDDEDYDNTRYTWSSLVADGIVEYVDAEEE
FT                   ETIMIAMTPDDVKASKDSVSESEQQKIQLEEQELDPGKRIKPTTSGSTHTYTHCEIHPS
FT                   MILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLGT
FT                   TRSMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDIEK
FT                   RQGMKALETFEKPTRSDTLRLKHGTYEKLDEDGLIAPGVRVSGEDIIIGKTTPIPADAE
FT                   ELGQRTQYHTKRDASTPLRSTESGIVDQVLLTTNGDGAKFVKVRMRTTKVPQIGDKFAS
FT                   RHGQKGTIGVTYRHEDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVSSLSGFE
FT                   GDASPFTDVTTEQISTLLRDHGYQSRGFEVMYNGHTGKKLMAQVFFGPTYYQRLRHMVD
FT                   DKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAGFLKERLMEASDAFR
FT                   VHVCGMCGLMSVIANLKKNQFECRSCKNKTNIYQIHIPYAAKLLFQELMAMNISPRLYT
FT                   ERSVSGIRV"
FT   CDS_pept        337702..338583
FT                   /transl_table=12
FT                   /locus_tag="CD36_01470"
FT                   /product="60S ribosomal protein L41, mitochondrial
FT                   precursor, putative"
FT                   /note="Similar to S. cerevisiae MRP20"
FT                   /note="Similar to C. albicans MRP20"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44409"
FT                   /db_xref="GOA:B9W6V3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V3"
FT                   /inference="similar to AA sequence:UniProt:P32387"
FT                   /protein_id="CAX44409.1"
FT                   /translation="MEGNIRSSRLVASIWKSFTRNLHYKPLPPNKYPKVNVNDVDLNPP
FT                   RYGFRRIRPPIIAQSPTKTLFPSVEIAKKYIEEGKRVPNRFMDQFGSDHARKEFEEFQE
FT                   KLALEEPHFKIGGKQIYFPQGRICLLRSNAKHTPYQAKFLVPKSMNKMDLRDYLWHIYG
FT                   LRALNITVQLQPARWKRSPYGLGRYRSPQLKKMTVDMMEPFIWPEVPQEKLDLLKIQKD
FT                   NSLKTVQQNTAVGSDKFKPLDVYDGMYKEKVQPQRLVSEKFKRKAEKNIKLYNKIVQSR
FT                   SDRKSLEKYLGL"
FT   CDS_pept        complement(join(338935..339811,339989..340011))
FT                   /transl_table=12
FT                   /locus_tag="CD36_01480"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44410"
FT                   /db_xref="GOA:B9W6V4"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V4"
FT                   /inference="similar to AA sequence:UniProt:Q6BIU9"
FT                   /protein_id="CAX44410.1"
FT                   /translation="MGFISTLSVAVATIYPVLASCRAFEDYTRVTNSLASQNLKIGGFT
FT                   VPLNYLYNRNLSGTTNSDLNDKSSSTTTSSSSSSSNISINDERALQIHLISIQKWFIYW
FT                   IVIAIISLLENILFLKYIIPGYSIFRLIFNIWLIIPMISIKQEVDANSTFDNTIEWKKF
FT                   TSNGAGLLYFSYIKPFIEQHIDCIRKFSINPLNFISIERLKYLFNKNNQISPNERNNNN
FT                   NNTTTTNGNNNTDYSNVLDSFVMVMNMKNKFTGGTNNTRDINELDNKTNNADNEFDVVN
FT                   VTPDTDSTQVNKRKGFFW"
FT   CDS_pept        complement(340529..341533)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01490"
FT                   /product="short-chain dehydrogenase/reductase family
FT                   member, putative"
FT                   /note="Similar to Pisum sativum TIC32"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44411"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V5"
FT                   /inference="similar to AA sequence:UniProt:Q08651"
FT                   /inference="similar to AA sequence:UniProt:Q4WCX6"
FT                   /inference="similar to AA sequence:UniProt:Q6RVV4"
FT                   /protein_id="CAX44411.1"
FT                   /translation="MPFVNKSGFFDPSTAPYYDPKETRKVVFITGGNSGIGWYTVLHLY
FT                   LHGYIVYVAGRTESKVLKAIDDIKIEAEKRQSKDKETIKHPLGELNYIHIDLLDLSTVI
FT                   KAVAKFSEKEKILDVLINNAGLMGVPYEITKDDYEIQYQVNFVAHYLLTLKLLPFLQSA
FT                   IKIGVTPRIINLASIGHNFQFKHFTPEQNKLDKFPNSIFTWVRYGIAKSSQIQFAKELA
FT                   NHYPDILSVSVHPGVILGTELYNHWKNIPIIGIGARGIFALSDKLIGVSNEEGSLATLR
FT                   AALDPSLTLKENGEYLVTGGKIDEPSKIASNTQYSKETWDWNYEQLKKRGYDI"
FT   CDS_pept        345521..346204
FT                   /transl_table=12
FT                   /locus_tag="CD36_01500"
FT                   /product="mitochondrial complex I assembly chaperone,
FT                   putative"
FT                   /note="Similar to Neurospora crassa CIA30"
FT                   /note="Similar to C. albicans CIA30"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44412"
FT                   /db_xref="GOA:B9W6V6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V6"
FT                   /inference="similar to AA sequence:UniProt:O42636"
FT                   /protein_id="CAX44412.1"
FT                   /translation="MSMKALGLNATKTIFAKQAELTRPVQSVLNFKREPEKSLDQVLTR
FT                   SDQELGGYSTVNFDIDPKEHCGHFYGNLSLDLPKDNPQVTRSGYAMFRTKDQNQSWLFG
FT                   DSFWDWTNYSSLVLRVKGDRRKYLVNIQANTPLVTDLFQHRLFLNHPGQWETVVIPLND
FT                   FVMTNWGVIQDGSELNKGEVKSVGIGLLDKHYGPYSLKIDWIKVMTGAEVAKVATKSRM
FT                   ERLHS"
FT   CDS_pept        join(346849..346862,347440..348214)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01510"
FT                   /product="40s ribosomal protein S4 (S7), putative"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44413"
FT                   /db_xref="GOA:B9W6V7"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V7"
FT                   /protein_id="CAX44413.1"
FT                   /translation="MARGPKKHLKRLAAPSHWMLDKLSGTYAPRQSAGPHKLRESLPLV
FT                   VFLRNRLKYALNGREVKAIMMQQHVQVDGKVRTDTTYPAGFMDVITLEATNEHFRLVYD
FT                   VKGKFAVHRISAEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPLIRANDTVKID
FT                   LATGKIDDFIKFDTGRLVMVTGGRNLGRVGVIVHREKHEGGFDLVHIKDALENTFVTRL
FT                   SNVFVIGTEAGKPWVSLPKGKGIKLSISEERDRRRAQQGL"
FT   CDS_pept        348809..350218
FT                   /transl_table=12
FT                   /locus_tag="CD36_01520"
FT                   /product="inosine 5'-monophosphate (IMP)-specific
FT                   5'-nucleotidase, putative"
FT                   /EC_number="3.1.3.-"
FT                   /note="Similar to S. cerevisiae ISN1"
FT                   /note="Similar to C. albicans ISN1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44414"
FT                   /db_xref="GOA:B9W6V8"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V8"
FT                   /inference="similar to AA sequence:UniProt:Q99312"
FT                   /protein_id="CAX44414.1"
FT                   /translation="MTSRYRVEYALKSHRRDEFIEWIKGLLATPFVLHADDSHADAQIV
FT                   AENCQSRYYEIFKDVENLVKQTIFLDELNELDPKKKSTSRLRTLVPSLGKFFTELPLAD
FT                   AFLLEDERRAISKRRLVSPSFNDVRMILNTAQIMALTNIYKQTENINNNNNNNNNNNTD
FT                   DGINNKQQQQKLKLITFDGDVTLYEDGKSLDENSEVVQRLVKLLSLGLYVGVVTAAGYP
FT                   RQTGAEKYYERLKGLIDHLNSNHCILKTYQKENLLVMGAESNYLFRYNNEMKGLKFIDD
FT                   EEWFLPQVRNWDIGKINYIMDTLYKHLIYLRNNFNLEDSTTIIKKERSVGIIPNSGCRI
FT                   LREQLEEMVLSCSRKLNTILTSSSNFADSTEALCVDDIKVCAFNGGSDVWVDIGDKALG
FT                   VESLQKYICHDETFDHVCPIGKSESLHIGDQFASLGANDFKARLSACTVWIASPRETVA
FT                   ILDDLIDFIEG"
FT   tRNA            complement(350322..350403)
FT                   /gene="tRNA-Ser (TGA)"
FT                   /locus_tag="CD36_tRNA_0004"
FT                   /product="transfer RNA-Ser (TGA)"
FT                   /anticodon="(pos:350368..350370,aa:Ser)"
FT   CDS_pept        complement(350779..355569)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01530"
FT                   /product="separin, putative"
FT                   /product="separase, putative"
FT                   /EC_number="3.4.22.49"
FT                   /note="Similar to S. cerevisiae ESP1"
FT                   /note="Similar to S. pombe CUT1"
FT                   /note="Similar to Aspergillus nidulans BIMB"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44415"
FT                   /db_xref="GOA:B9W6V9"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="InterPro:IPR030397"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6V9"
FT                   /inference="similar to AA sequence:UniProt:P33144"
FT                   /inference="similar to AA sequence:UniProt:Q03018"
FT                   /inference="similar to AA sequence:UniProt:P18296"
FT                   /protein_id="CAX44415.1"
FT                   /translation="MDNSLDQKLLAFISSQSTLKPLSPSKSNNLPKTDIKSLESLCVAS
FT                   LDTLLNNNGVSNSNSSVLALDSLDAIEIRLRGLYLIYADDPRKSFDILRKHQLFIVKLF
FT                   NLKQIHYVYQNLNVLFDEINKLFMIEPMSKSTIFTGIEFTDFSNWNDETSFFNANRKDI
FT                   SQLIVAFHFLILQWIAQYVSKNLKSILMQKDQVIGLDEFCNIPRMFLNSSNFRKWQLLS
FT                   VNENLVKYNSNNVKLISGFIKVFQSIKASSSLLKYVNLTNCLRLKLCEFTKDKSLLKSI
FT                   GFSSELIPFINDEDININEFIHRHVPEISEVSNELQAQLLESPHLISDSDFLRNLQNDL
FT                   QLSIDKCQIIISAFNTFKYNLKSLSSQQLSILDLITIHLKDSLDESVIPILSQSFQIYN
FT                   HFKLIKRMRNISNLLFNLGNKSNNDIYRNLAVDYECVIFEISPSNDNFKQFYNKLTRTQ
FT                   VATSVFGKVLVCFESYMGLTNNKDYDINGTLTQIICKTLLQISNYTPLNSIKDENFKFN
FT                   VINDIFQFMEKSNNTTEKTKVCNSIIESTTWSNQLIECKIYYQYYNVNGLEKYLDLEEK
FT                   SCDNQLITSGLQFQRLVTFGWNETLLIECLNNLKYGLNDNSAELDLFELKIIKQVLLYI
FT                   KYNGMIDELVVIIEILLVKSIKHEQFEKFLLFEYARALLYQANNSTTNNDKFSQVFNDL
FT                   KKLSQNWKSFDDIIELSLLQLQYFIHTKNSTKAKDRFNGILQTLLKKPQFNISKSKNLP
FT                   IVSKLQNFLILGRFQLLACQINNHIIHNKIDAFNNIKTGIQLLYSIMKKLPTNIDKISW
FT                   QELKWEITRLLFDSYKLAIDSSIDTGISRDIPLFLNEWVKLNNSIGNDIPIVNCINEFE
FT                   IGQYGLLANNEFQKYIEIAENRLKHDLVGKNNTVKQYINRYHDDESKKFERNDIIWKQS
FT                   SSSHQLKSLVRSILNSDNSLSDVSKSVQLLPCVVGESSTLCSKDLLDNLIQLKNETLME
FT                   ITDSGKSRSLSLCQQQELIANMNQTVCLLSSLTSFRGDGLLSEIYYLQDYVRNLPFSNE
FT                   RKLMNSLKNDESNDLLPRALDLSQFDDPSNNNTIKSGGMIDFNVDLQLYLPNNWILVTL
FT                   DICENTGDLLISKLTKGSPSPIFIRLPLSRFPSSLDFKQLMHNFEKIIDESNLSTKKKT
FT                   TSKILTVEDRKQWWRSRFTLDYQLQDILHHVETKWFGGFISGIFTNNNNNNNNIENESN
FT                   NGFIKFKQDLIKVLKDCLTVNDDKFNLEGFLQFNEFIYYCFHSMEEYNYELVDDLIKFI
FT                   ITNMNSHGKIVNSDNNVKINKLHESIKNLIIKNNKNKQNVVNNNCNSQHIVLIPNANCS
FT                   NFPWESMDFLRNKSISRIPSIHMLLDLVKSKTNSKNKSMTVDKSNLYYLINPSGDLIRS
FT                   ENRFKKIFESNYLWRGKIGQLSTNRNENYQDLILCEILKSHLFVYIGHGGCDQYIKVSK
FT                   LLKKCGNDQDSQNKLPPSLLLGCSSVKLDNCNYNYNSSKLQPSGNIYNWLNCKSAMILG
FT                   NLWDVTDKDIDIFTISLLQKWGLINDSTNNNSNNNNNHGMKKLDLTNSVVQSRGKCTLK
FT                   YLNGSAPVVYGLPMYLN"
FT   CDS_pept        complement(355988..356506)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01540"
FT                   /product="conserved hypothetical protein"
FT                   /note="In S. cerevisiae: required for survival upon
FT                   exposure to K1 killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44416"
FT                   /db_xref="InterPro:IPR019083"
FT                   /db_xref="InterPro:IPR039603"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W0"
FT                   /inference="similar to AA sequence:UniProt:Q6BIH5"
FT                   /inference="similar to AA sequence:UniProt:P38783"
FT                   /protein_id="CAX44416.1"
FT                   /translation="MLRTFLLPTVRSIQLKSVISPVSTTTTLPSITCISFASNFSTSSI
FT                   NYKTNTSTRTKENVHDLSTFLTLIGRNSIEYKDLFEDDLNKFLSTTSAQMKNMGIDTRP
FT                   RRYLLRWRHKFINDLEPLREHKLGKKRNGGERKAKTVIAKRQALERLEEKEKWAQEELE
FT                   AEKRGERLF"
FT   CDS_pept        complement(357000..357971)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01550"
FT                   /product="succinyl-coa ligase [GDP-forming] alpha-chain,
FT                   mitochondrial precursor, putative"
FT                   /product="succinyl-coa synthetase, alpha chain, putative"
FT                   /EC_number="6.2.1.4"
FT                   /note="Similar to Rattus norvegicus SUCLG1"
FT                   /note="Similar to S. cerevisiae LSC1"
FT                   /note="Similar to C. albicans LSC1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44417"
FT                   /db_xref="GOA:B9W6W1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W1"
FT                   /inference="similar to AA sequence:UniProt:O13750"
FT                   /inference="similar to AA sequence:UniProt:P13086"
FT                   /inference="similar to AA sequence:UniProt:P53598"
FT                   /protein_id="CAX44417.1"
FT                   /translation="MYRQFTRGFSSSLPARNYASTIKNLKVTKDTRVIYQGFTGKQATF
FT                   HAEQAIAYGTNVVGGINPRKAGTTHLDRPVFGTVAEAIKEAGASATGIFVPPPLAAAAI
FT                   EEAIAAEIPLAVAITEGIPQKDMVRIAQILKTQDKTRLVGPNCPGLIAPDQCKIGIMPS
FT                   SIHKRGKVGVISKSGTLTYEAVAQTTAVGLGQSLVIGMGGDPFPGTNFIDALTLYLNDP
FT                   ETEGIIMIGEIGGSAEEEASEFLKQHNLTRPEGPKPVVGFIAGVSAPPGRRMGHAGAIV
FT                   AGGKGDAKSKIAALESAGVVVEKSPARLGNSLLAEFKNKNLL"
FT   mobile_element  359549..359851
FT                   /mobile_element_type="retrotransposon:solo LTR, kahu D"
FT                   /note="truncated"
FT   CDS_pept        360358..363522
FT                   /transl_table=12
FT                   /locus_tag="CD36_01560"
FT                   /product="Nuclear actin-related protein, subunit of
FT                   chromatin-remodeling enzyme complexes, putative"
FT                   /note="Similar to S. cerevisiae ARP8"
FT                   /note="Similar to S. pombe ARP8"
FT                   /note="Similar to C. albicans ARP8"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44418"
FT                   /db_xref="GOA:B9W6W2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR027668"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W2"
FT                   /inference="similar to AA sequence:UniProt:Q9US07"
FT                   /inference="similar to AA sequence:UniProt:Q12386"
FT                   /protein_id="CAX44418.1"
FT                   /translation="MSDAINPPTSPYSVDNDIIDDSRAATPILSSQADEIILPSEDPES
FT                   PTNPNAPGSSSSTATKTNTGGTATTTKSSSSSSASGDLETSAQKRHKPGPVAGKRPSAE
FT                   TLQRRKEGRIKAAATLAQNLAKTGIGRFENENGFSLTSIKPISVINQKNYFTDYLKKDE
FT                   QVSFIRNWRQERALQQKMKKLKQQQQNNNQQQQQQQQQQLDNGEKKEIRNFDDFNLNDI
FT                   ELEMKKEMAVGGGSGSGGGATTGGGGGDDDEEVEDEENETEEVRQEKAKIGEDVIVLQP
FT                   GSRYIRIGKATDAVPLVIPNVIAVKKNITNIINPQYDEDSEIKYPRRKLKQPKSNSNNK
FT                   NDQRSRQEEGEEGEEEDLEYYIDEDFDEQKAIVTKDFRARMRYYKRRILPNSRETVINF
FT                   NKRQVSEKIEDHNDPNKKEWINPDKQENKNKRYYVGEDALNLAINRNGHTNADSQWILR
FT                   YPMINGNFNENSYYYESREEILGDICNIIIDSLKQLEITTDVNKYKVMLLIPDLYDKAY
FT                   VEIWCQLLLKFIGFGKVGIIQESIATTFGATMSTACVVDVGAQTTKISCVDEGMIISDS
FT                   RILLNYGGDNITETFVKLLIEDQFPYRNINLINAIDWELAQNLKEKYITFQDADIAIQL
FT                   YEFYKRKPFESTEKFTFKIFDEVMLAPMGLFFPKLFQITANKSNLQNNNNNNNNHHHHH
FT                   HPSIPSYYTSKNPTRSTIENLFSKSLDQYNNKSNNPKSKSQDQLKSKNQLNYCDLTDED
FT                   LLLKLINQNDNENESTEKDEDHHHHHQHNHGQVNGTTTTDTTNSKNNEDQLLSSNFDIE
FT                   DERLVDVPLEKAIIESITNAGLSSDLTKLKKFYDNIIIVGGGLSKINGYDLILNDRLNI
FT                   WRPRILSTSAIDLVIKYLNEEVKKNLLKKENLIEIEQERIKQEMESATNNNTTNTNTNT
FT                   TTNNNNSNNNNQEETTTAQNNNNNNNNNVNVGEIEIPDEIMDRINNETELKLDLDYIEE
FT                   LIEENGHFLTMNIVPTPREFDPSMVNWKGGSVYSRLKVVNEMWITQNDWDLLGSRSLYY
FT                   KSIFNY"
FT   CDS_pept        365890..367893
FT                   /transl_table=12
FT                   /locus_tag="CD36_01570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44419"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W3"
FT                   /inference="similar to AA sequence:UniProt:Q5A8X4"
FT                   /protein_id="CAX44419.1"
FT                   /translation="MSITSATTSSNAGNILIADLPPPLHSSSSSTSSPNIALSIKLNQD
FT                   FIHQLKSYIAKTPSSGNKIKLVVKNGQVSIKLNDEIQYPCLKFPENLPIDVYSNNNYDG
FT                   RIINKLTVVTDSKKIKHYNTSNRVSNDVEKDRDVHSSIITPIGTPKDLNNTTIIPSNNN
FT                   RKEKQLSPQKQKSIIDVYGGDSRNPYKVLDEGNNYEALDTTTTIFKKFLHLLALGPITL
FT                   PHIITILNYDEEELYNWLNVYGQLYNPKDQFIQQDKFPYSDYDYDNDNNSKPVKSNNTG
FT                   MEKCFILKDKSYKELLPWKWQYNDYERSLVLNNVNNALTRIGFSLTHPLRKKIINNDYN
FT                   NESRHHNNSNNNNTSTNNGEEKTNSHLGGGLLVSKKKFPTRPPVASTPPPPPPQQQQQQ
FT                   HTSISTTTSPSVSSASTNPIEVKKNGNRITKSISKSPTGINTPSSSDVSSKSSKSRKRK
FT                   LSSSSSSSNSSLSDDNLTSNIGTTNATSYKSNYNSPPSEQEFDDHYYSSSSSSSSSNTT
FT                   FGLSNQDQQNLPPSLSSKMDYYTNLANKFRIKYKEYSQLYNHLLQNSSTSSNSNNSSYK
FT                   KNLMKLFELHQLLSQWKKLLWDFDKDLKLKQNLTQLHVQKRNEKTVNVGNTTTTTSTTT
FT                   TSIKNSNIASGGGGGGGNNKSPLKKRKLIMDY"
FT   mobile_element  complement(368532..368781)
FT                   /mobile_element_type="retrotransposon:solo LTR, kahu E"
FT                   /note="partial"
FT   mobile_element  complement(369494..369797)
FT                   /mobile_element_type="retrotransposon:solo LTR, beta B"
FT                   /note="truncated"
FT   tRNA            369812..369884
FT                   /gene="tRNA-Ala (AGC)"
FT                   /locus_tag="CD36_tRNA_0005"
FT                   /product="transfer RNA-Ala (AGC)"
FT                   /anticodon="(pos:369845..369847,aa:Ala)"
FT   CDS_pept        372888..375299
FT                   /transl_table=12
FT                   /locus_tag="CD36_01580"
FT                   /product="mitochondrial carnitine O-acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.7"
FT                   /note="Similar to S. cerevisiae YAT1"
FT                   /note="Similar to C. albicans YAT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44420"
FT                   /db_xref="GOA:B9W6W4"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W4"
FT                   /inference="similar to AA sequence:UniProt:P80235"
FT                   /protein_id="CAX44420.1"
FT                   /translation="MSTYRFQETLEKLPIPDLVQTCNSYLEALKPLQTEQEHENTKIAV
FT                   DKFLNGGNSKTNNGETTGSGIGHYLDRELRQYAKTRPSYIEQFWYDSYLNYDSPVVLNL
FT                   NPFFLLEDDPFTNESSSINPQVKRATNLTLSSLKFIQALKNETLTVDTLKNGKPLCMYQ
FT                   YTKLFGASRIPTQEGCMMQSDPLSNHIVVMSKSQFYWFDVLDSHNNLILNEAELNINFN
FT                   SIIRDSLTTPSDEIAKSSFGVLTTENRRVWANVRNNLIGNNTINHEVLSIIDSALFILC
FT                   FDDIVIDDLSELSKNMLCGLSILDNGIQVGTCTNRWYDKLQIIVTKNAKAGINFEHTGV
FT                   DGHTVLRFVSDIYTDSILSFANSINNNAPSLWKSTTKNDAADYELEEDLITIPRKLEWD
FT                   LTPDLSLVLRFGETRLSDLINQNEFRHLEFKNYGSSQIKKMKFSPDAFVQMAFQATYYA
FT                   LYGKVECTYEPAMTKQYYHGRTEAIRTVSQESNLFVRKFFDSTVSMKEKLQYLSDACKK
FT                   HSQKTRMSSMGQGVDRYLYAMFCIWKRYLQDYEEEQQQQQQQQQQQQYIQEGSGDGEQQ
FT                   LEAVGLSRDDTIVVQMDGEHDHDDDSTTVVGTNGSKNLHASGSHGNNDIYDSYDLLKIV
FT                   PEIFADSGWDKLNNTIISTSNCGNPSLRLFGFGPVSANGFGIGYILKDDSISICASSKH
FT                   RQTQRFLVTLNSYLLEIQSIWKQVETMNKLSDELALKIDINKKQKEAAEEEEARPKHNI
FT                   NALLGGYGYFDMGEEDIKSRGQSPEPPFLNRANSSFSVREIGKKLRLSEY"
FT   CDS_pept        376366..378267
FT                   /transl_table=12
FT                   /locus_tag="CD36_01590"
FT                   /product="(defense-inducible) major facilitator superfamily
FT                   member, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44421"
FT                   /db_xref="GOA:B9W6W5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W5"
FT                   /inference="similar to AA sequence:UniProt:P25351"
FT                   /inference="similar to AA sequence:UniProt:Q8H6D5"
FT                   /protein_id="CAX44421.1"
FT                   /translation="MNKKMANISFREQMQGFPLWQMFVISCIRFSEPIAFTSLFPYVYF
FT                   MIRDFNIAPHSTDIAKYSGYLSASFAFCQFFCCVQWGKASDKYGRKRILLMGLLGTAIS
FT                   MIIFGFSPNFWVAMFARSLMGCLNGNIAVLRTAIGEIATHKNHQSIAFSTLPLLWNFGA
FT                   VIGPIIGGSKYFTRPKQRNDIDNYQSGELSNLGRIFMFMAQDPQSPSSGDNNSLYNRFM
FT                   NKYPYALSNIVIAGILMFSFVMGFLFLEETHSRTKNKRDIGLEIGDFILNKLGYDTPIR
FT                   SWQRTKHSRIEPIVEQSQSTQDSSDTISSLSSDDDNSNPEIERLIVAPQPLYNSVDDNN
FT                   EDVHESDQTSNDEEDNKYIGPMPRRYSDALVRRYSSAQLGPVLSHTISNTSVISTNVEQ
FT                   KFTRDIFTPSVVSAMTVNFFLSFHTVVYSEFLPVMLAGELKPEKSKLPFKLVGGFGYDS
FT                   DTIGNLLSFTGLIGTLSVMFVFPFLDRHYRPITSLRASQIIFPILYPILPYLVFTHHVY
FT                   NSANPPWLTKTLLYVLCCILTGSNAVGFPNIIVLIHRSSPEQHRAFINGTSLSLNSLAR
FT                   FLGPMLWGYVMTISEVLEIGELSWILLGGLSLICCTYAFMMKDTDEDEEDPIAEDNV"
FT   mobile_element  complement(378605..378814)
FT                   /mobile_element_type="retrotransposon:solo LTR, gamma A"
FT                   /note="truncated"
FT   CDS_pept        379048..381129
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_01600"
FT                   /product="LPF/IFA family member, pseudogene, putative"
FT                   /note="Similar to C. albicans LPF31"
FT                   /note="Similar to Candida dubliniensis IFA8"
FT                   /note="in-frame stop codons"
FT                   /inference="similar to AA sequence:UniProt:Q6KC96"
FT                   /inference="similar to AA sequence:UniProt:Q59T82"
FT   CDS_pept        381616..382737
FT                   /transl_table=12
FT                   /locus_tag="CD36_01610"
FT                   /product="protein involved in the structural stability of
FT                   L-A double-stranded RNA-containing particles, putative"
FT                   /note="Similar to S. cerevisiae MAK32"
FT                   /note="Similar to C. albicans MAK32"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44423"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034094"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W6"
FT                   /inference="similar to AA sequence:UniProt:P23060"
FT                   /protein_id="CAX44423.1"
FT                   /translation="MSIFTTLGMFIVDENRYVDSNSNPLPPPPSSSSSSLQQTNIIGGA
FT                   GTYAIMGARIICDGRQDLVDQISGIIDMGSDFPFEIKQELNTWKTRGVIYRENPRRLTT
FT                   RGVNIYQYTDSNTKSSKGSIDNELEQDAIRYFEYVTPKLRIEINDILKYPNLKQSSNFH
FT                   LICSIKRCKLLIDSINQFNPTAKFIYEPLPDDCIFENLEFLQNEILPKIHVFTPNLNEA
FT                   KLLLGLTDNKDETSNNDDNEDLQEISQQFTNHLQLSNSGTALRCGAQGCYINTKSGDKF
FT                   QLPAYHQDQNKVVDVTGGGNSFCGGFMMAYHLSDGDWLTSGVAGIISSGCIIEKLGMPT
FT                   VTDNSKFNNKSLKDRLDTYLNENPTLKVNFKWI"
FT   CDS_pept        complement(382807..384687)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01620"
FT                   /product="transporter, major facilitator superfamily,
FT                   putative"
FT                   /product="ion transporter, putative"
FT                   /note="Similar to S. cerevisiae HOL1"
FT                   /note="Similar to C. albicans HOL4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44424"
FT                   /db_xref="GOA:B9W6W7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W7"
FT                   /inference="similar to AA sequence:UniProt:P53389"
FT                   /protein_id="CAX44424.1"
FT                   /translation="MSTTTTHTHPKSRLGIQQPSAKEVTGTIIMMDDPEDHDEDNESMK
FT                   KSATGIILSPQPHDSPNDPLNWPVWKRDICLLIIGFQSFIGGGMSPLLAAGMNTLVTEF
FT                   DRPLTTISYLVGGFMLSLGCGSVIASPTAVLFGKRLVYIGGIFIFMMGAIWGGAAKDFG
FT                   NLMGARVITGFGASPTECLPSSTIAEIYFAHERAYRVGLYTMLMLGGKNIIPLLSGLVF
FT                   QSLDRHWLFWILAMFLGFNLIATFLFVPDTFWDRSPTPSKRSLEETKMAQSVATYHPPS
FT                   QRPNAFALHRPSQMNITDVQSLSSSINESAEKQQEVGQTPVGITDPNDVSHQHQHQQAT
FT                   PHTKNSYWKEIRLYQGRFTKDSWWMVALRPFVLYCYPSVLFGSLTYALAVVWLIVISET
FT                   IGEIFRHPPYGYNQQTVGLFYISPFIGGILGSLTCGLLSDRIVRYLVSKNKGVYEPEFR
FT                   LVMIIPSTFFIAIGLMGYGWSSQVHNPWIAPVIFFGAMSFGSSMASTTAITFAVDSYKV
FT                   FAAESLVSFNFLKNLLGFCFSLFNNKYADREGYRAAYVTYGGIQIFVSLFAIPLYIYGK
FT                   KLRRWTDEKEFMRSLYHEDNVPPSVAPSKSRLSEEFLHSGTTSNENTITK"
FT   CDS_pept        join(387075..387116,387272..390301)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01630"
FT                   /product="transcriptional SBF complex/cell-cycle-box DNA
FT                   binding subunit, putative"
FT                   /note="Similar to S. cerevisiae SWI4"
FT                   /note="Similar to C. albicans SWI4"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44425"
FT                   /db_xref="GOA:B9W6W8"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR029792"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W8"
FT                   /protein_id="CAX44425.1"
FT                   /translation="MSEPPQVFRATYSNTEVYECIMNDYSIMRRCKDDWVNATQILKCC
FT                   NFPKAKRTKILEKGVQQGLHEKVQGGFGRFQGTWIPLEDARRLAESYGVTQELAPVLFL
FT                   DFSDPNLIIPRKEKPASKEPAAAKRKYMKKAKQPGDPPRRYKTGKKAALQAAEEAAAAA
FT                   AAAAAAAAGVTGPGNTLPITTSASGIVSQLPATNPPGVAIQGNPQIQTGQIHNVISSQD
FT                   TFNSISRQNSYIQPAAQQLPHMYNMSQSTPVSSQQVIENGNTLMGTSNGGFGQPEFQPV
FT                   GNNNMPAYPNDIQNFQMFQRMQQQQQQQQMPTQQRFFQNGSAPNPIPQQILHQGKVSSS
FT                   QSSNDSNWSFSNTQKDSDTSINSTSEEPRKMQLQEPSPQADNGYAAQLLRFFSEDNVDI
FT                   PYFVIYPPADFNINDPIDDEGHTPLHWAASIGNFEMIHLLLSKGANPLVVNNFGLNPLS
FT                   KLISFNNCFELKNFPTVLDDLELCLINTDINGRTPLHYLCQFAKSKTKNDSLVYYLKVI
FT                   LNKLTILSNQSQVRQINLMKNVLDHQDVHGDTCLHIAVRSGNINIVKILLQYGAMDDLE
FT                   NINRETARQLITQCNLIPNYTQVDAAQMAYQNQMQLGMGNYSNYNVNNNAMNNNDSNNN
FT                   IPVVPGLATPIQSTFTKVETPDTQRTTVQEDDMDDDNESVVARVDKKHLEALTDNKENI
FT                   FTEKHFDNISTPINKKQNHINLHHPLAVISEVETATTSNSVSETPVPLQDGKNQRKQQQ
FT                   QQQETPLPLPLSLPLPLPKQRQEEGEVSSDGSTPHFYHPHPPKLNDEGKIEDSEDNVEP
FT                   KLPMSDLSSMISGMINSLSHTYSDDSAKLDLEISKLKESINLKQQENQESLTRVQKLLI
FT                   NSGIQEPQIESIEQGQGLIIETIEVCERTIKEKEQELLKVLQHNQSIELAKLVEQQESK
FT                   YLEEDKKNHFENSHNRDDDLIDQSRIDDAIELSRLQLERNRLVNEIVIHTKSFGIDDKM
FT                   YKYRKLLSLSCGVKVEEIDSLIDGIAESLTEGMT"
FT   CDS_pept        390747..391427
FT                   /transl_table=12
FT                   /locus_tag="CD36_01640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44426"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6W9"
FT                   /inference="similar to AA sequence:UniProt:Q6BX24"
FT                   /protein_id="CAX44426.1"
FT                   /translation="MVKTSSYKKQKLSSRSRNINQEEPLFPPTKYEKSKATLKHFPSSI
FT                   VNGITAEGGLYSLTFKSINCASFVENNELMKSVFKVPKLELSKLTDNDDVAKLKNWKQT
FT                   LENDINELKKSNSTVAYKDIVSDLQNELQIDLENNGNGLTQFGEKLIDRFAVNLITNNG
FT                   SYKIVPDVILPGLQVDKFEDVTNPDLSMYEKKTVPDTPNEEKEETGNKQDTEVKKDAET
FT                   EQKD"
FT   CDS_pept        complement(391552..393081)
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_01650"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+],
FT                   pseudogene, putative"
FT                   /EC_number="1.2.1.16"
FT                   /note="succinate-semialdehyde dehydrogenase [NADP+], point
FT                   mutated pseudogene, putative"
FT                   /note="Similar to S. cerevisiae UGA2"
FT                   /note="in-frame stop codon"
FT                   /inference="similar to AA sequence:UniProt:Q9US47"
FT   CDS_pept        complement(393344..394537)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01660"
FT                   /product="cyclin, putative"
FT                   /note="Similar to S. cerevisiae CCL1"
FT                   /note="Similar to S. pombe MCS2"
FT                   /note="Similar to C. albicans CCL1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44428"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR031658"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X0"
FT                   /inference="similar to AA sequence:UniProt:P37366"
FT                   /inference="similar to AA sequence:UniProt:P36613"
FT                   /protein_id="CAX44428.1"
FT                   /translation="MSEVKNELETEATPVPIKKQRLSNDDLYRNSTQYELWSFTQETLQ
FT                   DAKREANEKGVKISKERFKFAFENAKKEHPDVFEQYPDELNENMVSLLTLEEESTYLDF
FT                   YIQNITTTCNFFKMPTQVRLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFI
FT                   SIESYVKALKGTNTSHILDLEFIVLQSLKFTLLVHHPIRALYGFFLDFQAVLLHPEQVM
FT                   YDVSVDTLGNMYNQAKEWLNKYFMVSDVAFLFTPPQIALAAMYDTDKRITDKYLKRKYL
FT                   SNEDKLDPIKEQENEPEIEKQNGEDKSAITSEEQSKNVVKEKTKSTNRQQYETLVTLMR
FT                   KCVKLAKQSQVADREASKEIDKKCFFALNPKKLIDKRIKRLASGNQDIAKEGTVEPS"
FT   CDS_pept        complement(395062..395634)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01670"
FT                   /product="ubiquitin-conjugating enzyme E2-24 kda, putative"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /product="ubiquitin carrier protein, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="Similar to S. cerevisiae UBC8"
FT                   /note="Similar to C. albicans UBC8"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44429"
FT                   /db_xref="GOA:B9W6X1"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X1"
FT                   /inference="similar to AA sequence:UniProt:Q9P7R4"
FT                   /inference="similar to AA sequence:UniProt:P28263"
FT                   /protein_id="CAX44429.1"
FT                   /translation="MTSPKRRIEKDVMELMMSDHDVTLIDDSIQQFFVIFHGPPDTPYE
FT                   GGVWKIRVELPDQYPIKSPSIGFTNKIYHPNIDEGSGSVCLDVINQTWSPMFGLLNIFE
FT                   NFLPHLLRYANPSDPLNTEASNLMTKDEAKYNDTVKKYVQQYAKNNFDISGKDDDEDND
FT                   DDDDELSDVGSLSSDDDNEDVAGSMEV"
FT   CDS_pept        complement(396389..396943)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44430"
FT                   /db_xref="GOA:B9W6X2"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024792"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X2"
FT                   /inference="similar to AA sequence:UniProt:Q6BX28"
FT                   /protein_id="CAX44430.1"
FT                   /translation="MSSTLQNSVTVVPVGKKTKEEVLAEFENDLVRFESMTLKLYGHDQ
FT                   PLQFSRNMDPFPQRLHFRLPEYSIYLLTIRFKVKQRPLRNLTYHQTVKKKRIPVDDRNL
FT                   EMKEVASVNNIDDTGDYHEVTFAPSGVPGGTFLRGKYKAKSSVKENGVLIWSYKWTLEV
FT                   IEKGSAPEIGGFGDEEEEPDE"
FT   CDS_pept        complement(397618..398340)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01690"
FT                   /product="cleavage and polyadenylation factor I (CF I)
FT                   component, putative"
FT                   /note="Similar to S. cerevisiae RNA15"
FT                   /note="Similar to C. albicans RNA15"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44431"
FT                   /db_xref="GOA:B9W6X3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X3"
FT                   /inference="similar to AA sequence:UniProt:P25299"
FT                   /protein_id="CAX44431.1"
FT                   /translation="MDSKSTCVSIGKFPFDYTEEQVRDIARSVGPVLDVKLLFDELTGK
FT                   SKGYAIINYGDNETASSAVRNLNYMTLPNGRFLKCSFVTDYDMSSKESVKLPPLPLGIQ
FT                   IHPNQNASQVISTILSNIDPNSALQILKEIKIMSIDNPKSTKVLLERFPQLSLALVELG
FT                   LLSNTTNQELIELTLNKKPVDLTELSLDHVRLLQSVEKLTDEEIDELDESQQEIVRKVK
FT                   EEIAKGTYGEVSAVKESA"
FT   CDS_pept        398617..399528
FT                   /transl_table=12
FT                   /locus_tag="CD36_01700"
FT                   /product="transcription elongation factor SII, putative"
FT                   /product="DNA strand transfer protein alpha, putative"
FT                   /product="pyrimidine pathway regulatory protein 2,
FT                   putative"
FT                   /product="dna strand transferase 1, putative"
FT                   /note="Similar to S. cerevisiae DST1"
FT                   /note="Similar to C. albicans DST1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44432"
FT                   /db_xref="GOA:B9W6X4"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035100"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X4"
FT                   /inference="similar to AA sequence:UniProt:P07273"
FT                   /protein_id="CAX44432.1"
FT                   /translation="MDTKEIRSTVSNLEKAIDDTTILKLLNILNDGVKPTEKLLRETKV
FT                   GVAVNKFRSHDSAEINGLVKKMIRNWRDAVQAEKNNKKKLATAAGTGAPSSSAISPSSS
FT                   ASGSTTPKPSETSTPAAVRKGPRNPKTDGVNTQLYENDTRNASVSALYTSLAVDRDDSP
FT                   KHILRIAIEIESEVYKNEYSKISDSYRNKLRSFTMNLRNKKNPELRERILSKQILPAEF
FT                   IKMSPNEMAPEALKKEIEKLHKQNLFDAQGATEKRAVTDRFTCGKCKHKKVSYYQMQTR
FT                   SADEPLTTFCTCENCGNRWKFS"
FT   CDS_pept        complement(399656..401146)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01710"
FT                   /product="cystathionine beta-synthase, putative"
FT                   /product="serine sulfhydrase, putative"
FT                   /product="beta-thionase, putative"
FT                   /EC_number="4.2.1.22"
FT                   /note="Similar to Rattus norvegicus CBS"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44433"
FT                   /db_xref="GOA:B9W6X5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X5"
FT                   /inference="similar to AA sequence:UniProt:Q8NJZ9"
FT                   /inference="similar to AA sequence:UniProt:P32232"
FT                   /protein_id="CAX44433.1"
FT                   /translation="MTSTNKLPALKEDILELIGNTPLVKLNKIPQSLGIKAKVYAKVEL
FT                   FNAGGSIKDRIAKNMVLEAEKQGRIKPGYTLIEPTSGNTGIGLALVGAVRGYRTIITLP
FT                   EKMSNEKVSVLKALGAEIIRTPTEAAWDSPESHIGVAKKLEKEIPNSVILDQYGNPANP
FT                   DAHYYGTGYEIWEQTEGKITHLIAGAGTGGTITGISKYLKEKNSKIHVTGADPKGSVLA
FT                   QPESLNTSTEGYLVEGIGYDFIPDVLNRKYVDDWIKTDDAESFKLARRIIREEGILVGG
FT                   SSGSALQAALQVAKDLTEDDVVVVVFPDSIRSYLSKFADDEWLISNGFEVEDSPAANKT
FT                   DEFLNGKTIKDLVAGKAPVVTVTLSDTVSKTFDLLQSNGFDQLPVLNNSGRLVGLITLS
FT                   KILKSLSTKKIQMTNSISSIIIDFRKLADFEKSFTITKKSGFTKRGYEPIKLETPLATL
FT                   NKFFETHSNAIITDDELKPVQIVTKVDLLSYLTKNASF"
FT   CDS_pept        complement(401473..403815)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01720"
FT                   /product="plasma membrane amino acid sensor system
FT                   component, putative"
FT                   /note="Similar to S. cerevisiae PTR3"
FT                   /note="Similar to C. albicans PTR3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44434"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X6"
FT                   /inference="similar to AA sequence:UniProt:P43606"
FT                   /protein_id="CAX44434.1"
FT                   /translation="MEKLSSLEDLLRIPGHNSSVISDISVLSCGCLTSESLFNESNGPK
FT                   ICPTCQKQNVSILAPVKPLRDLYGIISNQQSQTSLERRRPSSSKKSVKAISDENYKPKA
FT                   RDETTGNTEPMSLLSLFYKFAKEEQFERTDSKEVPHSYQQQQQQQQQQQQVKDNQQIQN
FT                   TLQKQQSNRSSITKTQPIDISNKKANVDLSRSYPSSVSMNSTSISPQNQRAFVESTISG
FT                   IARTNTETDFNNSTDNNIIPSSFEKNLLESLSENKEFNFAKCFPFHRKLSTFPTQQLKL
FT                   NLSSIVPFKSSNYSIKRASSTSIHSYLDYNSSMEITRFVLISNKRWEVYEYIVPMGHTG
FT                   SSSIKPQLICCGKSTGEYGENLNNLSMPDADSDGPKEIIVRNDFGAKDNNSNTNDSDIK
FT                   KRLNSWDQMYCKLTRNYLVISGTKGIMRIFNLNKASPYKFGQPMYTFITNFPIRCIAIS
FT                   PNGSLVACGITAKERILGKEQPFVILHRLVMSEYGSLESADPLTITIPYRDPIKIMNFN
FT                   ESSTHLIIATSWETRYLIIRLTSNRQNDNYQKPRLVWSEIVYKSNRRFKSDFDDENSAG
FT                   AIYEERAEAENDLMLSKEGITDVKFGTMNSNLVIITSCSLRSRPPLIIKLEGGQIDSTK
FT                   NVVNNNDMKSVSSADESEKYSSVESAETFMRINEIGSLIHRIAVSPRGDGVVFLDKDGK
FT                   LFLVASANFYPGRRISSTDSKNKKIVVQLGDVANAERFSESASVVFSADGGKVFALDRK
FT                   GVFSVFDFTKGIPGEDPDVIKCKIISL"
FT   CDS_pept        complement(404129..405658)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01730"
FT                   /product="UBX-domain (ubiquitin-regulatory domain) protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae UBX7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44435"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X7"
FT                   /inference="similar to AA sequence:UniProt:P38349"
FT                   /protein_id="CAX44435.1"
FT                   /translation="MSDNIQRSFITSVEQAVSSTISKQKPLFVYLVTSGYTENTDTFLP
FT                   KFIDEQTSAIIKSNFILLKLTQNTVEFGYFSQLFKDLIVPSFYIVNEGKIEAVISNDTT
FT                   KEEFIKIIGKLTKHTPSINNTSSHESRHTENNVVVESSRRNHSKPSSDHDKSVRKYQEG
FT                   VARMRQEKIEEKKRLRALLEADQKERKLKEQENAIAESETSTKSPSTKQTSPSSTNSCV
FT                   LSIKLFDGSTMKREFKAHDTLVDVRKWLDSEVEIIPPAKSMPSFATTAYPYPTGYAFHR
FT                   PALPRVTYSEEQESNTLADLDLTPRSALILKPTYNEVDSDKPDNDIGKTGIFRSLLNVL
FT                   FTLGATIFSVFSYGVNAPHNQERRDSSPRNDHNETENLQSSEDDQSVNIHRPSIAGHPG
FT                   SLMFESTSASSLFLNIEPDVEETSGDVLRPHSPPVPIESHFNQYSQQAYSTASNINSRP
FT                   TTPGSRSLRQMPTVHGESKETSSKKEQTHNVDSYNGNSINVHERDDETPKD"
FT   CDS_pept        complement(406117..407628)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44436"
FT                   /db_xref="GOA:B9W6X8"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR039757"
FT                   /db_xref="InterPro:IPR039759"
FT                   /db_xref="InterPro:IPR041366"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X8"
FT                   /inference="similar to AA sequence:UniProt:Q04600"
FT                   /protein_id="CAX44436.1"
FT                   /translation="MFKKPAQIKPSSNIKSSERKRLLSCIADSHSLPLEELTKEEIERI
FT                   LPSVIKKASFVSFEKVSGSIYFDENEVPVWFHTRDSDIYPTIFTLMKYPTILPTIATHP
FT                   HVLGVLAKGADLMLPGTVPPFDKRAVKGAIVGVVSHDNPEKVTAIGHCKLNMTQFDSVV
FT                   GRSGVAVEIIHHLNDTLLEKKELIIPVEEPVEATSNEVIPETKPAKEEKHELPELTTEE
FT                   IDNLFIKSIKSVNNIELPTPASTFMSYVNKNVPSSITMKKTSWKKASKFLKEMAKQNYI
FT                   KVKGKDEDLSVIQLNTSNGESNVTPKAKPKPTSNGSSNTLKVIPLYKPTKNLRLFFNKL
FT                   DAEYDEYFTAPAARSLLESYIKKFSLVADDPKLIKPDAELGTKTEMPRDQLLKHFLTKF
FT                   SPYYQINNSAVYKGTPPKIEIVTELKIGRKVVTRVSNYEKFEIKTETLAKELRNKCSGS
FT                   STIVDNDVQVQGPHGKLIIDILKEKGVPVSYINFEDKTKKKKNKK"
FT   CDS_pept        408211..409215
FT                   /transl_table=12
FT                   /locus_tag="CD36_01750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44437"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6X9"
FT                   /inference="similar to AA sequence:UniProt:Q6BVH8"
FT                   /protein_id="CAX44437.1"
FT                   /translation="MSVSKKIKLDKMVKICTHSGSFHADESLAVYLLKLLPKYSQAELV
FT                   RSRSPEDWESSDIVVDVSGKYDGVKYFDHHQREFDTTFNEHYKTKLSSAGLVYKHFGRE
FT                   IIKEVLKLEDGNPNIELLYDKIYKEFIESLDANDNGINNYPKDVSPKFTDKNITLPSIV
FT                   SRLNPSWNESCTDADYDRQFLKSSELMGTVFVSLLEGYGKSWLPAKSIVAKAFDDRFEV
FT                   DKSGEILVLDQFCPWKEHLYNIEKENNAEGLIKFVLFKDSSGKWRVSTVSVTSTSFEFR
FT                   LGLPQELRGLRDQELSEKSGVDGCIFIHAAGFIGGANTKEAVLQLARLSLNTK"
FT   CDS_pept        410396..414220
FT                   /transl_table=12
FT                   /locus_tag="CD36_01760"
FT                   /product="ATP-dependent (ABC) transporter, putative"
FT                   /note="Similar to Rattus norvegicus ABCG5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44438"
FT                   /db_xref="GOA:B9W6Y0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y0"
FT                   /inference="similar to AA sequence:UniProt:Q08234"
FT                   /inference="similar to AA sequence:UniProt:Q99PE7"
FT                   /protein_id="CAX44438.1"
FT                   /translation="MKEGASVLSISRENQVGVKVRNLTVSVKSQQQKSSKHTSDQEAQY
FT                   EQGTSKILNNLSFDIECGQLVAIMGGSGSGKTTLLNTLSQRTNINNKNLGFSGSVTYET
FT                   SSSNKHIKHAYLLQTDIFLPGLTVWETLSTQADLRLPSHVTKQEKAELIEYILDVLELS
FT                   HLKDTYVASFSSNSSTLSGGEQRRVSLAIQMLSKPAILFLDEPTTGLDTSSSLKLVHVL
FT                   KKLASPEYGITIILSIHQPRPEIGQLFDKICLLTRGGRLIYYGNLANAEIYFNNLNFLG
FT                   RDADDQSKHILEYIMDLSVKDTTSVEKEQQTVGRINKLVQTWSNNHQFLQQLDKEKLSN
FT                   ESHQFKKNLTLFSKPKADKISFLQEVTVLTKRTFKLTFRDYKRLIVFNMGIVIIGVTVG
FT                   WMFYRPKHDLAGIRSLTSTLYVAMEIMGFVPMYFEIERLWETDGVFFYREYSEDQVSIP
FT                   GFLISRRLGKLFLEDLPMSLLFSIITFFMWGLRLGDGSHFGIYFVVVFLIELCCMGTAM
FT                   FSFAIAPSYPISALLINLIYQIQNSACGYFVNAATMPVYVKWTKYLAYFWYAFGALTNN
FT                   QFSGWHGQCPYNDINDPRCQEFSGDYQIKILGFPVGWVGAPIGYLVLWTVGFFVLSGIL
FT                   FYFKSHDVSMAKTKKNTIGEGEEEHETLHQKKTEREQDYITDKHDLEININNIHLDVTK
FT                   SNIFGRTKTTKTLLDNVTASFQANKVNVIMGPSGSGKTTLLNYLSNRLSRNSKFVSSGS
FT                   IRLNGMQDISRDQLSRISAYVTQHDSSLIEQLTVRETLYYQAKLRLPLDKHKSIPTIIN
FT                   KLIRQTGLLDCADTLIGSEYVKGISGGEKRRVSIAIQLLSRPKVLFLDEPTSGLDSSTA
FT                   ETILTLLDELAKENNTTIILTIHQPSEQMFYKFGSLLLLGRGGKVIYDGTSIGIVDYLE
FT                   SLGYDNPEGHNVADYILDLISRGMNEDKIQSERRVAELISHWQANSIKKMASTATFSHE
FT                   IIDLPQYYYQRLPIFITFPTIFRRQLLTSYRAKDVVINRAGQTIFLAIVHTLYFTPLRN
FT                   TQEGISNRLGLVQEVLNLYFAGLINNITLYPFERNLFYQEYRDGIYGVTEFGFSYLLNE
FT                   LPTEVVPCFFFAALIVFACGLPRTPQMFFAMFGTGFVSINCGESLGIFVNSIFTHMGVA
FT                   TNVLSTFVSMAIFMGGTMSLHMPGFFKGVNYISPMKYAVAICANLGFQNQSFECNSGAA
FT                   ECLLTTGEDVLSYYNMKQNLGPMVGGLIGCLVIYRAVAILSIYVRVKWF"
FT   CDS_pept        join(415425..415453,415700..416759)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01770"
FT                   /product="cruciform-DNA binding protein, putative"
FT                   /note="Similar to S. cerevisiae CRP1"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44439"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y1"
FT                   /protein_id="CAX44439.1"
FT                   /translation="MTLYTYTVRWPLKDENIHSIQITGNFDNWSRSLPTIKPTKEYLQE
FT                   IKLETRQDVVFKFIINDDQWIVNDQFKVTHDEHGNSNNIIYADELVEEVDEKDVKNVTA
FT                   TSGLKGKEILPESGTSGTTNVSKPEAEAESAPKPIVNQKNNLAKDLPEPTLQEEQPQIL
FT                   EESGIEDHESFVEPVVSSKSPSKSIITEEDIISDIDSPGDNAPKKSSDLPQPSSNHQTL
FT                   NQVLTPSSSFAAVSSPPLSSDYEHLDLKRDDQETEYNTAANSGISTETKENEIVSTFQE
FT                   NKPVKPVLLPHDSESTLERSGSENNANNNNSPRIPGHYPSSPEHKSSSTASLQSGNNVG
FT                   ENDSQYTGKRESLISRLRNLFR"
FT   CDS_pept        complement(417056..417568)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44440"
FT                   /db_xref="GOA:B9W6Y2"
FT                   /db_xref="InterPro:IPR039432"
FT                   /db_xref="InterPro:IPR039914"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y2"
FT                   /inference="similar to AA sequence:UniProt:Q6BST6"
FT                   /protein_id="CAX44440.1"
FT                   /translation="MPKVSSVDRFIELSTDLLANYPTTTTLSTTYTNISKKSKKSTPAS
FT                   ASTATTKPKSNKISTHAVSFKLYEPNSGKCIKYTTTKSKELSRLLNFIGPKGLSNDNLH
FT                   VVGLASLMTNVKYEKPVEPSLENTPVPESENLVTKEIEQNKPNAKEEKTTTSTSSKKKN
FT                   KKKKKKN"
FT   CDS_pept        complement(417925..418470)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44441"
FT                   /db_xref="GOA:B9W6Y3"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y3"
FT                   /inference="similar to AA sequence:UniProt:Q99382"
FT                   /protein_id="CAX44441.1"
FT                   /translation="MASASAKKLAVSNTNILNQLLIISASINIIVLLVISIFHRPSSYK
FT                   PWIIFSIPSILLQYSLEKFGRPKYANGNSLVSSGEDIRLSGSLYEYYFDVIYLTWGFDI
FT                   LMIIFGSNKVWYGYLIIPGFAIYKLSNFILPFIKKNKSNGSTTEVQQAETKQTNSATSK
FT                   RQQKLQARREKGPAVRYR"
FT   CDS_pept        complement(418763..419176)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01810"
FT                   /product="late Golgi vesicule protein, putative"
FT                   /note="Similar to S. cerevisiae TVP15"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44442"
FT                   /db_xref="GOA:B9W6Y4"
FT                   /db_xref="InterPro:IPR013714"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y4"
FT                   /inference="similar to AA sequence:UniProt:Q03860"
FT                   /protein_id="CAX44442.1"
FT                   /translation="MNFDGQDLTGVFKITNLVVSGLCVVGGLSQLFYSFHSFVSGLYII
FT                   AFGAVIGALEFRVPAEAYAYASFLFSFIGRGIFYTFLGVSLSGGSFFRVFAALVLFTIG
FT                   LAYVVLETIPSISPPENMNPDGAVIGLNDEEGV"
FT   CDS_pept        420721..421056
FT                   /transl_table=12
FT                   /locus_tag="CD36_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44443"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y5"
FT                   /protein_id="CAX44443.1"
FT                   /translation="MCYSFLYCIRIFLFHIQCIFQSTLTPRKCAFRIILQLVIFPIHRF
FT                   KYLLQLFARIGKSLGLGATTLKVGKVQLRHEKFFLAILDCYVKLNNLMKLFDHDFCFND
FT                   SNFIVQG"
FT   CDS_pept        421693..423330
FT                   /transl_table=12
FT                   /locus_tag="CD36_01840"
FT                   /product="high-affinity glucose transporter, putative"
FT                   /note="Similar to C. albicans HGT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44444"
FT                   /db_xref="GOA:B9W6Y6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y6"
FT                   /inference="similar to AA sequence:UniProt:O74713"
FT                   /protein_id="CAX44444.1"
FT                   /translation="MSSKIERIFSGPALKINTYLDKLPKIYNVFFIASISTIAGMMFGF
FT                   DISSMSAFIGADHYMRYFNSPGSDIQGFITSSMALGSFFGSIASSFVSEPFGRRLSLLT
FT                   CAFFWMVGAAIQSSVQNRAQLIIGRIISGVGVGFGSAVAPVYGAELAPRKIRGLIGGMF
FT                   QFFVTLGIMIMFYLSFGLGHINGVASFRIAWGLQIVPGLCLFLGCFFIPESPRWLAKQG
FT                   QWEAAEEIVAKIQAHGDRENPDVLIEISEIKDQLLLEQSSKHIGYATLFTKKYLYRTFT
FT                   AIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGNSNLVASSIQYVINTCVTVPALYFIDKV
FT                   GRRPLLIGGATMMMAFQFGLAGILGQYSIPWPDSGNDSVNIRIPDDSKSASKGAIACCY
FT                   LFVASFAFTWGVGIWVYCAEIWGDNRVAQRGNAVSTAANWILNFAIAMYTPTGFKNISW
FT                   KTYIIYGVFCFAMATHVYFGFPETKGKRLEEIGQMWEEHVPAWRSRSWQPTVPIASDAE
FT                   LVRKMEIEHQEDKLMNEDSNSESRENQV"
FT   CDS_pept        426455..427483
FT                   /transl_table=12
FT                   /locus_tag="CD36_01850"
FT                   /product="30-kda heat shock protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44445"
FT                   /db_xref="GOA:B9W6Y7"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y7"
FT                   /inference="similar to AA sequence:UniProt:P25619"
FT                   /protein_id="CAX44445.1"
FT                   /translation="MSAAVSTLSDILKRNDAVNVNPPNPIIDLHITEHGSDWLWAVFSV
FT                   FALFAIVHGFIYSFTDVRKSGLKRALLTIPLFNSAVFAFAYYTYASNLGYTWILAEFNH
FT                   AGTGFRQIFYAKFVAWFLGWPLVLAIFQIVTNTSFTTTEDESDLLKKFISLFEALFTRV
FT                   LAIEVFVLGLLIGALIESTYKWGYFTFAVVFQLFAIYLVINDVVVSFGSSSHSVFGNAL
FT                   ILAFVVVWILYPVAWGLSEGGNVIQPDSEAVFYGILDLITFGVIPIILTWIAINNVDEE
FT                   FFTKVWHFHLKPENEHAPTATEDVEKAVGETPRHSGDTAVAPSGVPDTGAAQAQAEAEE
FT                   RI"
FT   CDS_pept        428082..428933
FT                   /transl_table=12
FT                   /locus_tag="CD36_01860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44446"
FT                   /db_xref="GOA:B9W6Y8"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y8"
FT                   /inference="similar to AA sequence:UniProt:Q12144"
FT                   /inference="similar to AA sequence:UniProt:Q9Y7Z5"
FT                   /protein_id="CAX44446.1"
FT                   /translation="MPSTQPTPTNSANLRYRTPLQQLVTLAKTQQFYWFLGHVFAVLFF
FT                   ILSTLTGFWNRHSSLKYYRFALLSIILTYLIVIRQIHFKSNFKLSSINIRLLRDENVQY
FT                   LLLAVVFYVSSFIIGQTGSSLYSFTIFAVFHVLTYFQNHLLSVFIGDIATQSRISSMIS
FT                   SFTNKFNQPALIAASSAEIVLLVVSGFQLIPSALLLLFRRNIVEVTVQVLVFVAIVVFN
FT                   KLRFDSNQYTKVVVEQMDLKLNQTLAQINYPQLSQLYQNARSGALKYLSLIKLPKESGK
FT                   KK"
FT   CDS_pept        complement(join(429197..431243,431325..431383))
FT                   /transl_table=12
FT                   /locus_tag="CD36_01870"
FT                   /product="proline-induction transcriptional activator,
FT                   putative"
FT                   /note="Similar to Aspergillus nidulans PRNA"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44447"
FT                   /db_xref="GOA:B9W6Y9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Y9"
FT                   /inference="similar to AA sequence:UniProt:O42805"
FT                   /protein_id="CAX44447.1"
FT                   /translation="MPMRNRKIKSFEERKRVTVACNRCRSKKTKCDGGFPCLKCMKSNQ
FT                   ECTISAPEKPSNPTDFKEKYTKNRAYTCKLERIIQYLFPDIDLKYLRENTDTFEREVCI
FT                   NKSKLPRAGVPITSTKPPESEDSESKLNSLKNFNRTYVSPTDQSFIRFIDNSKHQRFME
FT                   RNTLAASVFANSNIYAKHNLQVLIQNALEVFPDDNKIRKLVGIFLNICETNYFYVHHGK
FT                   FYKQVDQLLSKRQENDMGYLVNNWTTVSIVSVMLALSSGFEFIADNSPMPKVTPNTTPG
FT                   LMYYYAALPFAGFLIDLKSVESIQCLLIFGVFMTTNKLENFQSIDGGYTFMNLALEIAI
FT                   ANKLHLKEPFVNYPDEDREVLKRLWWTCYTMERRHGVNIGRVETIAPEDITVELPVDIR
FT                   GLYSNLGLSNHLSQISIIQMNYIFRDIMDLFYSKSKSHKDQSISIDPKIIRKFVEDLEE
FT                   CKLNFPNYTKIDNLDPSSTRYRACIHLNLTYYLAKIYIGKPFLLYKVENYKRLNENNGY
FT                   EAAFVDHLSSICIDAAFCSVELLSELQKYNKLGLFSCTDINVCNIALFAILVFLKIDRS
FT                   ETTLLFLRKGLSILKIMSDGSASAKSALQRLRKLDKLVCDLTELDDMEKDLNPHNVLGH
FT                   ESASKAFPIDSSNQDAVLEFGSLPYVDSSTNLGGYMNTQQYFFDDMDNILMSVDDDIFN
FT                   LQKWSDI"
FT   CDS_pept        431568..432194
FT                   /transl_table=12
FT                   /locus_tag="CD36_01880"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase, putative"
FT                   /product="5,10-methenyl-tetrahydrofolate synthetase,
FT                   putative"
FT                   /EC_number="6.3.3.2"
FT                   /note="Similar to S. cerevisiae FAU1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44448"
FT                   /db_xref="GOA:B9W6Z0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z0"
FT                   /inference="similar to AA sequence:UniProt:P40099"
FT                   /protein_id="CAX44448.1"
FT                   /translation="MMTNLPLKEVKRQLRKKLKSNLKTVSQDSLIKQSHLIHQNLLNHE
FT                   YFKTASNIAVFMNMPDSEVKTMEIIESCFTLDKSVYLPRCNYVSSPGRKSNYMSLLKMT
FT                   SIEAVHQLQPQGKYQLLEPVSGVDVMETGNLDLVIVPGVGFDKNKNRMGHGAGFYDEFI
FT                   TTFHNKFNKKPYLLGVALQEQIIDCIPTEPHDWKLDSIVTSTNVY"
FT   CDS_pept        complement(432191..432736)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44449"
FT                   /db_xref="GOA:B9W6Z1"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z1"
FT                   /inference="similar to AA sequence:UniProt:Q6BSV5"
FT                   /inference="similar to AA sequence:UniProt:Q4WHX3"
FT                   /protein_id="CAX44449.1"
FT                   /translation="MISRLDELNKKLQQTSNQGLASSSSSLKPPSTSLRPPAPTMGSNR
FT                   GLFPAVNSAQRAAGSAVNQRKKVVLQPGHSPLDWAHLNRTQPRHKLRGVPPNTPPPQFV
FT                   RISKQELQKHKSLQDCWTCINGKVYNITPYINFHPGGVDEIMKCAGKDGTSLFNKYHSW
FT                   VNVDRMLENCIVGVFHKD"
FT   CDS_pept        complement(433075..435546)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01900"
FT                   /product="ubiquitin carboxyl-terminal hydrolase 16,
FT                   putative"
FT                   /product="ubiquitin thiolesterase 16, putative"
FT                   /product="ubiquitin-specific processing protease 16,
FT                   putative"
FT                   /product="deubiquitinating enzyme 16, putative"
FT                   /EC_number="3.1.2.15"
FT                   /note="Similar to S. cerevisiae UBP16"
FT                   /note="Similar to C. albicans UBP16"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44450"
FT                   /db_xref="GOA:B9W6Z2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z2"
FT                   /inference="similar to AA sequence:UniProt:Q02863"
FT                   /protein_id="CAX44450.1"
FT                   /translation="MSEIWSQLKCLITNQDLNTVKHFPQHTTTQQVDCLSILNYSFIPT
FT                   SLLDYWNRKTYSEKKFLLLQISLILSVSLYIITPSLPFYKQKPMFSKRPDKHTTGLINL
FT                   RNDCFANSSLQAYSSVPSLTDYLNKFITSYRQLVEFVKSNNIDIQELINLRLELNKNLQ
FT                   NSKFKHSNSTFEVPLHIAMASMVKKLQETEMTTRTISVWTFLHELEKIFNAKMSRSQHD
FT                   AHELTQLINETLENENLKFKSFVRFITLNLHTILKRIPDAQDYSRLDKIVVPEFPFDGL
FT                   ILSQMTCLTCHGVSQPNFTPFVILTLPVPLTNTTNLETLLEQNESEQIEGYQCIKCRVS
FT                   KIALNEEHLKRQIPSEDVEYINKIIELNNNPNLCINEDLPEDLESFIKNYNVEGIDASR
FT                   ITSTVQKKSQILKPPKIFGLHLSRSSFDGQVVTRNSCRVKFSDKMTLSIGKEFHDKLKQ
FT                   FQTMVQKEDEKLREKYTSNVLTTDENDMEDEDVQREDIDEKGEEEEDDEDDEEDVTTDD
FT                   GTATENGTDDLDDETDEEEEDDTSSVMSRETETQSVTTSSTIRPNSGPTGSSQEYSINS
FT                   APISHKQTDNLKELFKRFKFNDNDLYKYRLRAVIKHMGSHTQGHYECYKHKPLYVKDKN
FT                   GNIFKLSPEIKDEVTGEIHCEATPVERNPTQTNGGNGTTSMRSSSNSSSENDEGFRHKF
FT                   STMMGRRPSVFQANPTGVEEILSSGLQTPAEILVDDPNQNNFDNAFATHNFKDAFNNNN
FT                   DKDTPANKKQEEEKKVKMKKIPSIISKPYWRISDANVTEVSKASVLAEETTVYMLYYER
FT                   VDRKQIKRHHS"
FT   CDS_pept        complement(436321..438909)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01910"
FT                   /product="constitutive low-affinity phosphate transporter,
FT                   putative"
FT                   /note="Similar to S. cerevisiae PHO91"
FT                   /note="Similar to C. albicans PHO91"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44451"
FT                   /db_xref="GOA:B9W6Z3"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z3"
FT                   /inference="similar to AA sequence:UniProt:O59712"
FT                   /inference="similar to AA sequence:UniProt:P27514"
FT                   /protein_id="CAX44451.1"
FT                   /translation="MKFSHSLQFNAVPEWSSKYIAYTTLKKLIYSLQRDNLRRSYQQDD
FT                   EEATLEGSHLIGANYASTGQTHDESASAVFIAALDAELKKIDTFYQQQEGFIFSNMNDL
FT                   MNDIDDFEKEVDESLTLPGTNKNFQGVIKQTRRTSGSSQDNYITNTTDPDTEFTQPEDD
FT                   DDDEDDDDENALTSAFQENRGRRRGGSVPELHGNEHQLRHTRSIDDYVTKSPKIWNDLN
FT                   NATLSNNVPAQLLLLSENRIILRKRVIGLYTTLSELKSFIELNYTGFKKALKKFDKSLN
FT                   TNIKDTYLENLPNNSYIFKKSTMKKVDEHLDSLVKLYALICNHGDDLEAAKQELSIHLR
FT                   EHVVWERNTVWRDMIGLERKSYAANSKLINRSDGNNDEKEDGSGNMKLMSKFNISLKNP
FT                   VVIKLILIFAVTVFLLNVSPFDDSAQKNCFALLICASLLWATEAIPLFVTSLVIPLLIV
FT                   VLNVVKNDDGSIMETVDASKFILSTMWNSVILLLLGGFTLAAALSKYHIAKLISTWILS
FT                   KAGTNPAIVLLTIMGVALFASMWISNVAAPVLCFSLIQPLIRTLPKGSKFINALIMGIA
FT                   LASNVGGMASPIASPQNMIAIGAMEPQPSWGEWFVIALPICVLALLLIWVFLLITFNCN
FT                   SRNTHLVAIRTIDDKFSGIQWYIITVSFGTILLWCLASRLTGVFGEMGIIALIPVILFF
FT                   GSGLLTTEDFNNYPWNIVILAMGGTALGKAVASSGLLNTIAITIQRQVEGFSLFGVILT
FT                   IGIFVLTIATFISHTVSALILIPLVSELGHNMPDPHPRMLILSTALLCSAAMGLPTSGF
FT                   PNVTAICMTDEFGKPYLTVGTFIKIGVPASVIAYAIIVTVGHATMKIINF"
FT   CDS_pept        join(441014..441041,441407..441645)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01920"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44452"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z4"
FT                   /inference="similar to AA sequence:UniProt:Q3E756"
FT                   /protein_id="CAX44452.1"
FT                   /translation="MDFCFFLIGFKEFNKPLPDIGNIPCYCGHCHNQSAFAVRTINCVT
FT                   LFFIPVLPFYYQKRLKCNICGTTGGLDATAIDRMKSGQPVAIG"
FT   CDS_pept        442887..443876
FT                   /transl_table=12
FT                   /locus_tag="CD36_01930"
FT                   /product="30 kda heat shock protein"
FT                   /note="Similar to S. cerevisiae HSP30"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44453"
FT                   /db_xref="GOA:B9W6Z5"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z5"
FT                   /inference="similar to AA sequence:UniProt:P25619"
FT                   /protein_id="CAX44453.1"
FT                   /translation="MAVASTFIHNNLELMNRNTATSVNPTNKLVNMHITAHGSDWLWAA
FT                   FSVFLLLTIIHLLLFLYGLLKRPGLKNSLLVLPLFTNAVFSVGYFTYASNLGYAWQAVE
FT                   FHHAGTGLRQIFYAKFIAWFVGWPAVLALYEIVTSTVLDRIEENPNIFKKFFLIFQTWL
FT                   VKFIFVEIYVLGLLIGSIIFSTYKFGYFTFAVFFQLLLMVWVGRDLHKSFRSPSHSNIA
FT                   NFFLIFYYLVWILYPVAWGLSEGGNVIQPDSEAVFYGILDLITFGLMPTILIFFAMKGC
FT                   DEEFFSKLWQYHVKAESEAIQENEKIVAETPSTEAGVVDAEVENEAHV"
FT   CDS_pept        444445..445581
FT                   /transl_table=12
FT                   /locus_tag="CD36_01940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44454"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z6"
FT                   /inference="similar to AA sequence:UniProt:Q6FK12"
FT                   /inference="similar to AA sequence:UniProt:Q12529"
FT                   /protein_id="CAX44454.1"
FT                   /translation="MTASEESTLVDEYPIKSILNQISPWFIVDETKYGGRGCFATKFIP
FT                   QHTVIHQCQSPIGSTICKPFKKEVCSQCYTYNYGAVMKFKISKTEGKHVYSLFFCSEQC
FT                   KSTFIHQDINHVLTENLLAVEKNYLAGLSKPEIEPLEPENFADDYVKEWDNVALWETKL
FT                   ESLKPSKRQNQIFQIDDNEYLEIKYVIGVLFNMYKVHCNNHISHYDYPSLDKGEANKVE
FT                   LLLFDLLYSSEFEKVKRYPYLLYSYINIYKFIKLTCTPELQTFIDSTTIRSIIGKNLSN
FT                   AFGIWSEVTNPSEDKEFLGFGVYPSASFFNHSCSPNIVKTRNNTEMVFTTSKDIEVGEE
FT                   LCINYGNYTDEPVELRQQQLKEWFFDCACTKCQTELKI"
FT   CDS_pept        complement(445583..447073)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44455"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR040194"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z7"
FT                   /inference="similar to AA sequence:UniProt:P53255"
FT                   /protein_id="CAX44455.1"
FT                   /translation="MSDKVKFLILNPSPDNLNKILEKSNTQYTKNGPFEATILLGDVLP
FT                   EGYGLPNVKPLGVTYFSKGENGISEVIKAKEGSTQSSIDVATNFTFVKPPFSVIRTTSG
FT                   ITIMIVSKLYTNNDSQEKTLDLPEVKIDILITYEWPQVIGRLCKLTTVGNDEITELVTK
FT                   LKPRYHFAVGNEIGKFFELEPFAWSTGEITRFISLAQEGGSKDKWFYAFSIGLEQDTNT
FT                   KVIENPFTASTKRSRGENNNEGEGEGKSTTKEVKKPKVVAPEQCFFCLSNPNTETHMIV
FT                   SIGTCSYLTIAKGPLTRSNKNLQFSGHGILIPIEHTPTIKRESLVSEELLKYQNSLVAA
FT                   FDEQKPNLKLVFWEINRDTNIHYHTQFLPVEEESLLNKFSKSLDMRVKLNNEKFKKNQK
FT                   LDFTKFSDIQDPEFVKILDTSNYIMFTVCKSKTERDYYIAPLLPEKPIDIQFPRRVLAH
FT                   LLNLPDRIHWDKCQQPKLKEMADCENFKSFYQKFDFTL"
FT   CDS_pept        447327..448937
FT                   /transl_table=12
FT                   /locus_tag="CD36_01960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44456"
FT                   /db_xref="GOA:B9W6Z8"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z8"
FT                   /inference="similar to AA sequence:UniProt:Q6BTZ9"
FT                   /protein_id="CAX44456.1"
FT                   /translation="MSNNIKVSVRVRPLLPRELKTKPSDGGSTPVSLVSMPPSDPHKVL
FT                   LTNPKEQFKNNISADNKTKSFLFDECIWSFNKTDSNYTDNFKYYEKTGPQLLSHFFEGY
FT                   NVCLLAYGQTGSGKTYTMMGDKTESPGIIPLLIKDILKQMEISVNEKINCELKFSYIEI
FT                   YNEQVKDLLTGDTKNGNGNSTHISQKCKVREHPVTGPYVENVKEHNIENYTQFLKLLAK
FT                   GNSNRSTASTSMNDKSSRSHAIITLTLKQTKFEKYNGSSSDSDETNSIGDASEEMVSNI
FT                   KLVDLAGSERLQKTKLYGQHERIKEGTLINKSLAVLGRCINLLSSNPSALVPYRESILT
FT                   YLLKENLGGNSKTCMIFCVSPVDYEETHQTLNYANEVKKIKTLAKANKTKLSNVPIDWQ
FT                   QLQSTDKTIIQSLKNEIDVLTNKLNQMQQLNEPKSHPPQSINNIIEYLDKETNKVKFEN
FT                   KYLKQMMNTKNNHIKELNNHIDFISNEYQSLYNDYEELKRSSLLNRKQELLKECESNKG
FT                   HMDMELREFEQFLVNAVGN"
FT   CDS_pept        complement(449493..451130)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01970"
FT                   /product="high-affinity glucose transporter, putative"
FT                   /note="Similar to C. albicans HGT2"
FT                   /note="Similar to C. albicans HGT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44457"
FT                   /db_xref="GOA:B9W6Z9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6Z9"
FT                   /inference="similar to AA sequence:UniProt:O74713"
FT                   /protein_id="CAX44457.1"
FT                   /translation="MSSKIERIFSGPALKINAYLDKLPKIYNVFFIASISTIAGMMFGF
FT                   DISSMSAFIGSGPYMRFFDSPGSDIQGFITSSMALGSFFGSIASSFVSEPFGRRLSLLI
FT                   CAFFWMVGAAIQSSVQNRAQLIIGRIISGIGVGFGSAVAPVYGAELAPRKIRGFIGGMF
FT                   QFFVTLGILIMFYISFGLGHINGVASFRIAWGIQIVPGLCLFLGCFFIPESPRWLAKQG
FT                   QWEAAEEIVAKIQAHGDRENPDVLIEISEIKDQLLLEQSSKHIGYATLFTKKYLYRTFT
FT                   AIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGNSNLVASSIQYVINTCVTAPALYFIDKI
FT                   GRRPLLIGGATMMMAFQFGLAGILGKYSVAWPDSGNDSVNIRIPLDNKSASKGAIACCY
FT                   LFVASFAFTWGVGIWVYCAEIWGDNRVSQRGNAISTAANWILNFAIAMYTPSGFKNISW
FT                   KTYIIYGVFCLAMGTHVYFGFPETKGKRLEEIGQMWEENIPAWRTRSWQPTIPIASDAE
FT                   LARKMEVEHQEDKLMNDDSNSESKENQV"
FT   CDS_pept        complement(458139..459959)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01980"
FT                   /product="serine/threonine-protein kinase, putative"
FT                   /note="deleted EC_number 2.7.1.37"
FT                   /note="Similar to S. cerevisiae SKS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44458"
FT                   /db_xref="GOA:B9W700"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B9W700"
FT                   /inference="similar to AA sequence:UniProt:Q12505"
FT                   /protein_id="CAX44458.1"
FT                   /translation="MTLDILPIFDTHTKRHYISSGATNTSNNTTTFTSATIYQPPQTTT
FT                   NTNKPNVNCLLDGYMLNHELRFIRKIGAGTYGLIYLVENIYTKQQFAAKMVLEQPLLKQ
FT                   KQQQQQQQQQQQQGHRAHKGESSMNKQIISQEFYQYFLNNSMPQPQNLDLNYIRDSGHD
FT                   CPFLTEISLHLKVHQHPNIATIHQVLNIENFAIIILMDHFEQGDLFANIIDRQIFTDNR
FT                   HRKVPRTDFETQLLMKNAILQLIEAIEYCHENNIYHCDLKPENIMVRYNPYYVRPTINN
FT                   NKDNNDDDDNICYANSIIDYNELHLVLIDFGLAMDSATICCNSCRGSSFYMAPERTTNY
FT                   NTHRLINQLIDMNQFESIEMNGTTITKSNCKYLPTLPGDIWSLGVLFINITCSRNPWPI
FT                   ASFDNNENNEVFKNYMLNNNKAVLSKILPISSQFNRLLDRIFKLNPNDRIDLPTLYKEI
FT                   IRCDFFKDDHYYYSQHQHQHHHSHINNAYNHYHKQQNQARPTANQQLYTPPETTTYNSY
FT                   ASDMEEDEISDDEFYSDEDDEDIEEYEEEEEEYVGNSEQQQQQQVTTVNSNFGQVKGTC
FT                   YYDTKTRTTTYIKPPAAYTLETPSQSVEYC"
FT   CDS_pept        complement(465047..466597)
FT                   /transl_table=12
FT                   /locus_tag="CD36_01990"
FT                   /product="galactokinase, putative"
FT                   /EC_number="2.7.1.6"
FT                   /note="Similar to S. cerevisiae GAL3"
FT                   /note="Similar to S. pombe GAL1"
FT                   /note="Similar to C. albicans GAL1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44459"
FT                   /db_xref="GOA:B9W701"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B9W701"
FT                   /inference="similar to AA sequence:UniProt:P56091"
FT                   /protein_id="CAX44459.1"
FT                   /translation="MSVPTFDDLSFYSNDQELTKSRYLKLVEIFQSNFPNASIDFFARS
FT                   PGRVNLIGDHIDYNFFPVLPMAISNDVIVAVNINDESEIVITNTDSKNFAKETIALTNN
FT                   NDGFEIDSQHHSWANYFKCALIVANNYLTEQKMNGQLKGMKLTFDGNVPTGGGLSSSAA
FT                   FCVASTLAILHANGVKDISKADLTRITVVCEHYVGVNTGGMDQCASVYGEPDKALLIQF
FT                   KPQLIGKPFKFPVENLTFVITNSLQVSNKHETAPIHYNLRVVEMAIAADVLAKKLKLGS
FT                   LVPQDSNIGTSSLRGVMDAVFNTHRWDGNDIDVGIEQLKKMIDIVETLLNNNQEGYTID
FT                   QCLSLLDLSLDQFKSKYLQAYPVKFDVLKLYQRAKHVYQESLRVLETLKLLSSTQSSSN
FT                   NTKDDEESFLIKFGELMNQSQSDLDKLNESSNEKLNEICSIALQNGSYGSRITGAGWGG
FT                   SIVHLTTLDKSKQLIQGLIENYYQLEFPDIKLDELMNDAIIDSKPSMGSCIVTTKFLQ"
FT   CDS_pept        468003..470030
FT                   /transl_table=12
FT                   /locus_tag="CD36_02000"
FT                   /product="GAL10 bifunctional protein [includes: UDP-glucose
FT                   4-epimerase (galactowaldenase); aldose 1-epimerase
FT                   (mutarotase)], putative"
FT                   /EC_number="5.1.3.2"
FT                   /EC_number="5.1.3.3"
FT                   /note="Similar to S. cerevisiae GAL10"
FT                   /note="Similar to S. pombe GAL10"
FT                   /note="Similar to C. albicans GAL10"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44460"
FT                   /db_xref="GOA:B9W702"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W702"
FT                   /inference="similar to AA sequence:UniProt:Q9HDU3"
FT                   /inference="similar to AA sequence:UniProt:P04397"
FT                   /protein_id="CAX44460.1"
FT                   /translation="MPNEYILVTGGAGYIGSHTVIELINNGYQVVIVDNLSNSSYDAVA
FT                   RIEFIVKQHVPFYNVDIRNYEQLNKVFQDYKISGVIHFAALKAVGESTKIPLEYYDNNV
FT                   SGTVNLLEVCKANDVKTIVFSSSATVYGDVTRFGDNSMIPIPEHCPMDPTNPYGRTKFI
FT                   IESILKDIYNSDDAWKVAILRYFNPIGAHPSGLLGEDPLGIPNNLLPYLAQVAIGRREK
FT                   LSIFGNDYNSRDGTPIRDYIHVVDLAKGHIAALAYLKNLQSEGLYREWNLGTGKGSTVF
FT                   EVYHAFSKVVGRELPHEVVGRRAGDVLDLTAKPDRANKELQWKTELTIDDACKDLWKWT
FT                   TENPFGFNIENYSWKEFDGFNNRLHSFVAGDLKVNLANRGALIQAITLNGSNMVKAYDN
FT                   AEGFKSETNPFFGTTVGRYANRISNGEFELNGKVYKLTKNEGANNLHGGANGFDKQDFF
FT                   GPVVKSRDGKFFVDFLLVDKDGNDGFPGELEAIVHYTIDNSSVQIEYECQLLSGEATIV
FT                   NMTNHSYFNVSNSDTIEGIEVKLATDKMLEVDSQLLPTGKIIKNEKVANPIVLSENDVF
FT                   DNCFIVDEQCGIDTRDKPLKQIFEATSSVTNNKLKISSTEPAFQFYTGDGVNTKGFGKR
FT                   CGFCVEPSRFINAINHKEWSNQVILKKGEVYGSKIKYDFQ"
FT   CDS_pept        470228..470743
FT                   /transl_table=12
FT                   /locus_tag="CD36_02010"
FT                   /product="trafficking protein particle complex subunit,
FT                   putative"
FT                   /product="synbindin, putative"
FT                   /note="Similar to Mus musculus TRAPPC4"
FT                   /note="Similar to C. albicans TRS23"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44461"
FT                   /db_xref="GOA:B9W703"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B9W703"
FT                   /inference="similar to AA sequence:UniProt:Q9ES56"
FT                   /protein_id="CAX44461.1"
FT                   /translation="MKVYSILILNKAGGLIYQNELVPGLSKLSANDYLVLAGTLHGVHA
FT                   IGSKLSSTINSNNNNNIPNGEELNAAHNATILSTGKAGSANSNRTGLQKIETDMFNLYI
FT                   FQTVSGLKFIMITAPNVANSESVTDELFRHLYILYSDYVMKDPFYSLDMPIKSSLFDGE
FT                   VKRLFAQS"
FT   CDS_pept        complement(470702..471661)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02020"
FT                   /product="dTDP-glucose 4,6-dehydratase, putative"
FT                   /EC_number="4.2.1.46"
FT                   /note="similar to prokaryotic gene"
FT                   /note="Similar to Aneurinibacillus thermoaerophilus RMLB"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44462"
FT                   /db_xref="GOA:B9W704"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W704"
FT                   /inference="similar to AA sequence:UniProt:Q93F85"
FT                   /protein_id="CAX44462.1"
FT                   /translation="MTISFDKRIVVTGGAGFIGIHFLYYMVKKYPNIHFTCIDKLNYAS
FT                   NVSEIEKLKEYSNFEFIHLDLSDNLDNLLKITKNTTDIINFAAESSVDRSFEDPVYFTK
FT                   NNILATQNLLECHRLNPGIGYFLHISTDEVYGDVYEGTNKENAAMNPTNPYSASKAAID
FT                   LIIKSYQYSYKLPITVLRPNNVYGPLQYPEKIIPLTIQCINEKTPIPVHGKGTNKRKYL
FT                   YVLDLVQAIETVWIKTPLTVNQIYNIGGTDELDNISLIKLIMEIFGPGEIQFIKDRNYN
FT                   DTNYSIDTTKIYNLGWSPKISIVQGLRLCKQPLDFPIE"
FT   CDS_pept        472588..473748
FT                   /transl_table=12
FT                   /locus_tag="CD36_02030"
FT                   /product="galactose-1-phosphate uridylyltransferase,
FT                   putative"
FT                   /product="gal-1-P uridylyltransferase, putative"
FT                   /product="UDP-glucose-hexose-1-phosphate
FT                   uridylyltransferase, putative"
FT                   /EC_number="2.7.7.12"
FT                   /note="Similar to Cryptococcus neoformans GAL7"
FT                   /note="Similar to S. pombe GAL7"
FT                   /note="Similar to S. cerevisiae GAL7"
FT                   /note="Similar to C. albicans GAL7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44463"
FT                   /db_xref="GOA:B9W705"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B9W705"
FT                   /inference="similar to AA sequence:UniProt:Q9HDU5"
FT                   /inference="similar to AA sequence:UniProt:P08431"
FT                   /inference="similar to AA sequence:UniProt:P40908"
FT                   /protein_id="CAX44463.1"
FT                   /translation="MSLNHLLNPLTSTPTYIKMTQEFDFTNHSHRRLNLLTNKFVLCSP
FT                   HRAKRPWQGAKEEIKKSALPEYDPKCYLCPGNVRATGDINPKYKATYIFTNDYPAVRLD
FT                   QPEYKEDEQDKQNSLKSRLLQTQGVRGKCFVICFSPKHNLTLPLMKDEEINNVVNAWQK
FT                   LYGNLIQESNQGTAPYKYLQIFENKGAAMGCSNPHPHGQAWCLDVIPTEVKDELDNMSE
FT                   YYKKYNSHLLGDYVELELQEKKRIVAENDSFIVVVPYWALWPFETLLISKTHLKSIQEF
FT                   NDKQKLDLAAILKVLTTKYDNLFNTSFPYSMGIHQAPFQCTHEQNECSWFHMHFYPPLL
FT                   RSATVKKFCVGFEMLGEPQRDLTSEQAAARLQELDGDVHYMNKSKA"
FT   CDS_pept        474149..475087
FT                   /transl_table=12
FT                   /locus_tag="CD36_02040"
FT                   /product="methyltransferase-like protein, putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Drosophila melanogaster METL"
FT                   /note="Similar to C. albicans ABP140"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44464"
FT                   /db_xref="GOA:B9W706"
FT                   /db_xref="InterPro:IPR026113"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9W706"
FT                   /inference="similar to AA sequence:UniProt:Q86BS6"
FT                   /protein_id="CAX44464.1"
FT                   /translation="MSKETKPPLDSRIGKDSPFTFGQRYLESEEDVFNHNAWDHVEWGE
FT                   EQIQQAQELISKQYDHPVKEFDKNLYNSNPAKYWDLFYKHNRENFFKDRKWLQIEFPSL
FT                   FKVTNKDYQQSTTILEIGCGAGNTFFPILNQNENENLKIFGCDYSKVAVDLVKSNETFI
FT                   NNHEKGVAYSSVWDLANPEGEIPEDLTPNSVDIVIMVFVFSALHPNQWKQAVANLSKVL
FT                   KPGGEILFRDYGRYDLAQVRFKKGRLLDDNFYIRGDGTRVYFFTEEELEEIFCIVGPFQ
FT                   KEKIATDRRLLVNRKKQLKMYRNWLQAVFRG"
FT   CDS_pept        complement(475077..475898)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02050"
FT                   /product="autophagy protein (5), putative"
FT                   /note="Similar to S. cerevisiae ATG5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44465"
FT                   /db_xref="GOA:B9W707"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="InterPro:IPR042526"
FT                   /db_xref="InterPro:IPR042527"
FT                   /db_xref="UniProtKB/TrEMBL:B9W707"
FT                   /inference="similar to AA sequence:UniProt:Q12380"
FT                   /protein_id="CAX44465.1"
FT                   /translation="MEDIDNLAEIKKKLWNGSINVKILLKFEDQTIEYLLIIPRNSYFP
FT                   MVFPQIIRYFENFITSIELNKIPVWLEFEKVPLKWNLPVGVLYDYLYLPALLNGHDLGC
FT                   WTISMKYEPVYPMEHIIPFDEKLPDGQIDYMKTMNRVLMNQLKQSCFVLNGTAKPIMQL
FT                   SEDNSNKLWKSLISRNLGDFNVLNKKIIKTIDKIPVKIYIPGSSTVVQAPISKNQTLQE
FT                   ILSLHTPTLSSITRPYIQGIDVTSLMNQSIREIWQLFKHLDNFLYITLIIL"
FT   CDS_pept        476828..478498
FT                   /transl_table=12
FT                   /locus_tag="CD36_02060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44466"
FT                   /db_xref="UniProtKB/TrEMBL:B9W708"
FT                   /inference="similar to AA sequence:UniProt:Q59VY0"
FT                   /protein_id="CAX44466.1"
FT                   /translation="MKKPNTKQLLTTLDLPPVIPASIPTLDFEHAVNSYQPGNYKPEDL
FT                   PDKIPIINESTGSFRRFIRRAKSRRVRKNDRRRIVSAPPGTYAEKELPGIPSSVPTSPI
FT                   ASTGITIIPENTTTSKPLFTQAHKTVSFINENIHYPMLTNPNYNPHQIVIIEEPHLKLE
FT                   PKLTNDSETNSIGTDSILSTKSIDVPVVIHDDNNEVKEMIIHNSDNDSLVDSLFSEKEK
FT                   RGEEDQIDPVTSHEEHEMDPSMLVLPKMRKKSPNKGVSLAKLNSHQVNSNSLGYCLDTP
FT                   NVYKESRFPSVPSHIKIPKQMNEFANNDSTNTNEKQKTDNRRSLSDFTHMKHALIKSDY
FT                   QDNNNVQEKHRSLISFSQLKLLGSKEEINKKTDKKSDKRRSWVVDFIHHGNTNRESIKQ
FT                   QKHRSISNIVVSKTKQPEPVTITTVPDKYNRKTRLSYSDFIRPQVRSISTPDVTRINKT
FT                   LPPLPQNNIHDNHIKQTNAVEPSSYYNDTFIKPRRNKYTNINTAPITSTSHINNHSYPS
FT                   KPTTGKSLPPIPPPSPPKINGEYYRTNRFGDRSYYVASM"
FT   CDS_pept        complement(478527..479297)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02070"
FT                   /note="ApoA-I binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44467"
FT                   /db_xref="GOA:B9W709"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR032976"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:B9W709"
FT                   /inference="similar to AA sequence:UniProt:Q8K4Z3"
FT                   /protein_id="CAX44467.1"
FT                   /translation="MSASAPFKTLSAKSAFQLDQELMSTGEFSIDQLMELAGLAVAKTI
FT                   FKEYPPDETTTGKSNFHPSKVLVLVGPGNNGGDGLVAARHLKLWNYDPIIYYPKRPSSN
FT                   QLYSRLVKQLQDLDVQELTTLTEVKHLLDSRDSKIKIIIDSLFGFSFKPPLREPFKDLI
FT                   NYLGQNHDHLPPIVSVDIPSGWDVDEGPTETDIQASCLISLTAPKPCAKLFVNSGPDKI
FT                   HYLGGRFINPRIAKEYGIEDIVNKYQGDELIVKL"
FT   CDS_pept        481413..483170
FT                   /transl_table=12
FT                   /locus_tag="CD36_02080"
FT                   /product="septin, putative"
FT                   /note="at least 2 different gene models possible, one
FT                   septin (favoured) and the other one with a 5' extension,
FT                   related to a homologue of septin"
FT                   /note="Similar to C. albicans SEP7"
FT                   /note="Similar to C. albicans CDC11"
FT                   /note="Similar to S. cerevisiae SHS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44468"
FT                   /db_xref="GOA:B9W710"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:B9W710"
FT                   /inference="similar to AA sequence:UniProt:Q8NJ83"
FT                   /inference="similar to AA sequence:UniProt:Q8NJ85"
FT                   /protein_id="CAX44468.1"
FT                   /translation="MFTSAKSVALPNTSILTKNEFNPRTINEEPGIALTETHIEIIDDD
FT                   NQKLLLNIIDTPGFGENLNNELCFIEIENYLKQQFDLVLAEETRIKRNPRFVDTRVHVM
FT                   LYFITPTGHGLREIDIQCMKRLSKYVNIIPVIGKADSFTLNELQHFKQQIRIDIQKFNV
FT                   PTFQFDNSLNDYDEDEDYDLIQECKFLTNLQPFAVVTSEDVFEVRESTKGGGNNDKPKI
FT                   IRARKYPWGLVDINDTRYSDFPILKSVLLGSHLQDLKDLTHDFLYETYRTERLTKVTGN
FT                   GQAFDDEENEDAEFHDTVEHQLNDSSRGGVSGGVNDTNNNSTIPSMSNLAQLTNSTNDH
FT                   DPNHIDNNSITSTSSSIKKSTSMLIDDHQSSSPKLKNISSFTSSTSTVSLEGGEKEGSS
FT                   GQHHHERGANNNAFKRLSIGPQRNQLRQISETVPYVLRHERILERQQKLEEMEQASARE
FT                   LANRAALLEKKAAQLKAKEKALRQLELNRQQKQDSATSSLHRKESDISTSSNIHQGGGD
FT                   VDGYGKSDSVKNNANGNKNGRQGHDQGHGQDYDNSEYHHHDDSTPNYETSRLQKDETLT
FT                   DLHSIVSNH"
FT   CDS_pept        484532..487156
FT                   /transl_table=12
FT                   /locus_tag="CD36_02090"
FT                   /product="importin beta-1 subunit, putative"
FT                   /product="karyopherin beta-1 subunit, putative"
FT                   /product="nuclear factor p97-homologue, putative"
FT                   /product="pore targeting complex 97-kda subunit homologue,
FT                   putative"
FT                   /note="Similar to Mus musculus KPNB1"
FT                   /note="Similar to S. pombe KAP95"
FT                   /note="Similar to C. albicans KAP95"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44469"
FT                   /db_xref="GOA:B9W711"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:B9W711"
FT                   /inference="similar to AA sequence:UniProt:O13864"
FT                   /inference="similar to AA sequence:UniProt:Q6GTI5"
FT                   /protein_id="CAX44469.1"
FT                   /translation="MDILQILEAALGTADPNQRTQAEIQLNEAANNHFPEYLQLLIEAL
FT                   VNEDAKTEVRMLAGLALKNQLVAKENKTKLAQQERWLKLDGELKSKIKQTSLQALNIID
FT                   QKVANTAAQLVAAIADIELPRAEWPELIPTIMENTKTDNPENVKRSSLLAIGYICESAD
FT                   PNNPNILSQASGILIAVVQGAQSSEPSKQVRLTALNALVNSLEFIKFNFENEGERNYIM
FT                   QVVCEATQADDSELQASAFGCLARIMSLYYRFMSLYMEKALYGLTISGMQSADEKVSCM
FT                   AVEFWSTVCEEELEIALQKHELGLDSLQASQNPDLITFNFALIASGEVLPTLLTLLTRQ
FT                   NEDPEDDDWSVAMAAGACLQLFAQNIGNYVVEPTIHFVGSNLADKDNWRAREAAVMAFG
FT                   SILDGPDHEQLKHIIGEALQPILLLIKDSNLQVKETVAWCLGRIADMVVDAIDIETQLP
FT                   NLLMALVDGLQDHAKVATNCCWTLINLVEQLCTDYYEKDSTIMSPYYSTIIPILIQTSA
FT                   RNDNEYNARASSYEALSTFVTYSAQDTMPIVQNIATEVLGRLESSIILQSQVSTTEDKG
FT                   NLEELQSNILSLLTNVIRRLNSEVIIAADNLMDRFIKLLDAQEQNSLIEEDIFIAVSAL
FT                   SSAIGGEFIKYLDAFLPYLRKALQNVESPTCITAVGLVADLAQSIGSQMGNYWENLLQL
FT                   LGNALTNNDSKKELKPAVVSAFGDIATAIGPDFAPYLEFVLRTCTEAGNLQPQDGSLET
FT                   LDFIFIVRESVLDCFVGIVGGFINQPQALAPAIVTILQYLQKVTLDPQMSTSESVARSA
FT                   AGLLGDIAAMYPNGEFKQVFAEEWVTDFIKRTRSNPLFDNKTKDAARWARDQQKRQQQL
FT                   FGQ"
FT   CDS_pept        490012..490722
FT                   /transl_table=12
FT                   /locus_tag="CD36_02100"
FT                   /product="dolichyldiphosphatase, putative"
FT                   /product="dolichyl pyrophosphate phosphatase, putative"
FT                   /EC_number="3.6.1.43"
FT                   /note="Similar to S. cerevisiae CAX4"
FT                   /note="Similar to C. albicans CAX4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44470"
FT                   /db_xref="GOA:B9W712"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="InterPro:IPR039666"
FT                   /db_xref="InterPro:IPR039667"
FT                   /db_xref="UniProtKB/TrEMBL:B9W712"
FT                   /inference="similar to AA sequence:UniProt:P53223"
FT                   /protein_id="CAX44470.1"
FT                   /translation="MLDYNPVPFDHTYILYDPNDIIAKICVQFSLLPIYLMVFYTSWFL
FT                   ITREIEPIIIVAGHLINELINKIIKVSIKSPRPDFHKNFGRDSGSYSMTYGFPSAHSQF
FT                   MGFFAGYYICVILLKVPMPKSSKKPICLFAGLSMIGVAFSRVYLLYHSNVQVIAGLITG
FT                   ITLGITYFIITSIARDIGLVEWILNWPIVKFFYIKDTYYHIYQTFAEEYQVYLQLRREK
FT                   KGLLSSLALGDEKN"
FT   CDS_pept        complement(490933..492039)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02110"
FT                   /product="ADP-ribosylation factor GTPase-activating
FT                   protein, putative"
FT                   /note="Similar to S. cerevisiae GCS1"
FT                   /note="Similar to C. albicans GCS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44471"
FT                   /db_xref="GOA:B9W713"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:B9W713"
FT                   /inference="similar to AA sequence:UniProt:P35197"
FT                   /protein_id="CAX44471.1"
FT                   /translation="MSIDPETRRKLLNLQKTGENKKCFDCSAPNPQWASPKFGIFICLE
FT                   CAGVHRGLGVHISFVRSITMDQFKPEETLRMEIGGNARLKKYFNDNGVGLTLSPKQKYD
FT                   NYVAEDYKEMLTCEVEGKEFVAKDHSGEKLPDINSDTNTNTSTSTTNTPGISRGRPGPL
FT                   TNEQKQKNEAYFADLGAKNDQRPDHLPPSQGGKYGGFGNTPTPTTTTNNNNNNTNNTSS
FT                   LSSFTLDNFQNDPLGTFTKGWGLFSSSVVKSVQEVNNSVIKPSIDQIQSSEITGQAKTA
FT                   MAQFGQKMQETGKYGQETFQTFTKDINENGLNKTLDNTFGGFFGHKNNQDKEFPQAFGF
FT                   KKPDNGIKYESLSGGSKKNDEDDKWDDF"
FT   CDS_pept        complement(492277..493155)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02120"
FT                   /product="peroxisomal 2,4-dienoyl-coA reductase, putative"
FT                   /EC_number="1.3.1.34"
FT                   /note="sporulation-specific in S. cerevisiae"
FT                   /note="Similar to S. cerevisiae SPS19"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44472"
FT                   /db_xref="GOA:B9W714"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W714"
FT                   /inference="similar to AA sequence:UniProt:P32573"
FT                   /protein_id="CAX44472.1"
FT                   /translation="MPNTLNQSYVEKGAWKQDLFKGKVVFITGGAGSICRVQAEALVLL
FT                   GANAAIIGRNQDKTEIAAKEIASLRTNSKVIGIGNIDVRKIDNLKQAVDKTVKELGRID
FT                   FVIAGAAGNFLCDFNHLSSNAFKSIVDIDLLGSFNTVKATFEQLRTNKGAILFVSATLH
FT                   YYGVPFQIGVGAAKAGVDALSNALAVELGPLGIRSNAIAPGPIDGTEGMSRLSRSSKDE
FT                   TIKNVPLQRLGTTQDIADGTVYLFSPAASYVTGDVLVVDGGNWQVSSGVGAKDYPVTLL
FT                   NAINAPKGGKL"
FT   CDS_pept        complement(493568..496588)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44473"
FT                   /db_xref="InterPro:IPR006887"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:B9W715"
FT                   /inference="similar to AA sequence:UniProt:P40164"
FT                   /protein_id="CAX44473.1"
FT                   /translation="MSSVKDNNNNNNNQILEVCKLSKSKQEELKALDNAGKTPRRVKVY
FT                   LLNGDDWIDNGTGFCVGEIDKETNLPYFLVRNETDNNNIILKSYLEGSIQYQRQQETLI
FT                   VWTDSNGSDLALSFQETEGCGDLCDFIIRVQQGNISPGISLYYVIPNINEGDDITELIT
FT                   GPIRYPPQHPNLENLEIILETINQGINSQFTRTNISEFLIENDYFNKLIKIFHQAEINE
FT                   NIDILYNISDIIKSLFLYNESSIIEYLLSSEEKIFGLVGILEYDSEYPNYKACHRNFLI
FT                   NQSYIKVIPVENIEIFKRDFYLNYLKDVVLARFLDDSTFNLITSLIYSNHLEIFNYIKD
FT                   SKILEHLFNIYDDNDNDNDDNNDDNNDDDNDNDDKIKMKRRDGVKMLHQYVLIAKSSRK
FT                   HDFFASLVKHGLLKMINFALNDKEDQIRVLGTELIVIIIEQDVSLVNSIDHEETTIDNS
FT                   DPPILEELIHNNNNNNSNNNNNNNNDNNNDKNKIDNEDISIPTTPKEGKLRLSDDMTLI
FT                   SILSKLLVEDKNIGLKMQAFEALKILLDPNIVATTSANGLSPTIGTNNPNISNSSLFNS
FT                   SNSMNKSLSKIIDTNNKNNNNKKDNEEFKFTNEEFQEINTNTYFKAFYDQVAPKLFEKL
FT                   SILANLDLDLDSDLDSDQQQQQQQQQQQQQQHLKVNNSKHEELLYQLLCELITFCTFEH
FT                   KLISSSRSFFIENHILLGISKILIINYKLIIKLTSIRCLKNLILLNDEFFTRYFINYDL
FT                   LIYFFKFFNDIINKNNLANSTCLDFMEIIIKGCNDGGIGNNNNNNNNNTNTINKKSNYI
FT                   LLAKYIYKKYGEFIKEKLNYVDTGKRLIDLVTHTLNGSSSKNNRLNGVQTFNDSYDEEQ
FT                   QEENDNDDDEYNDSDENIGTKTDDLGLSEDEMLPHNASTPINEEDEEEEEEEEDTRGLY
FT                   TDVVTEELIINEKKRPREESNNIKETSIINNSNNNNNNNNSNQIDGSLNKTTKPNDNDS
FT                   FNGTKKIALTTTSDNQS"
FT   CDS_pept        complement(497402..498472)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02140"
FT                   /product="mitochondrial molecular chaperone, putative"
FT                   /note="Similar to S. cerevisiae ATP12"
FT                   /note="Similar to C. albicans ATP12"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44474"
FT                   /db_xref="GOA:B9W716"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:B9W716"
FT                   /inference="similar to AA sequence:UniProt:P22135"
FT                   /protein_id="CAX44474.1"
FT                   /translation="MIRFTRIKNHNLSFIPITIIQYRQFTYSTIYYQSPILTNNSPSFS
FT                   GIDNSIESNILSETNKLSKIGKRFWKNGQVKFNKQTEKYEIQLDGKTLRTPLGYPLELP
FT                   KNKKQLAYLIAHEWTHLPDIKVKSSTLPLTSLVTRAIDLSNQENVKEKMLELQDIKLQM
FT                   LKYLDTDTCLIFATNKECDGKLRKRQEEIYRPLIKEFNEFFTMYGHKKNLIPINQSIEL
FT                   KYLDCEIDGLKGNKQSKIIQEIVLNWLNQLPIYDLISLEKTILITKSFLCGIILLRSNV
FT                   NNEFFLKNLYQFNKNSINNNKKDYYYKSLEELIELGNLETIYQTKQWGEVEDTHDVDKL
FT                   DWLRNLASAALVCHDN"
FT   CDS_pept        498704..499102
FT                   /transl_table=12
FT                   /locus_tag="CD36_02150"
FT                   /product="prefoldin subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44475"
FT                   /db_xref="UniProtKB/TrEMBL:B9W717"
FT                   /inference="similar to AA sequence:UniProt:P46988"
FT                   /inference="similar to AA sequence:UniProt:Q6Q5A0"
FT                   /inference="similar to AA sequence:UniProt:Q6CXQ9"
FT                   /protein_id="CAX44475.1"
FT                   /translation="MNQEALQKVLIEMDNQLNKSQSELSMINLQLERINHNLKIIDTTK
FT                   NKLNNIIIGDNDNNGDNNHYHYQSNEKIWQNCGKAFISTNFKTYLNQLNKDNKNYQDIK
FT                   KSLIIKQDYLKTTVEKTIEGMTNIVGKK"
FT   CDS_pept        complement(499353..499727)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44476"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniProtKB/TrEMBL:B9W718"
FT                   /inference="similar to AA sequence:UniProt:P46984"
FT                   /protein_id="CAX44476.1"
FT                   /translation="MKLTPTAIYIAPDIKSPKHFYSINNEIHSTNGKTTQISDIVIKAG
FT                   GEDRDKPSDHNDTLLGNLRAELTTLQDNLNIFLTERMKLDENKFDEQQQDLERRILDEG
FT                   IEEKEEKEEKEEEEEEEEIE"
FT   CDS_pept        complement(500056..501726)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02170"
FT                   /product="6-phosphofructo-2-kinase I-related protein,
FT                   putative"
FT                   /EC_number="2.7.1.105"
FT                   /note="Similar to S. cerevisiae PFK26"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44477"
FT                   /db_xref="GOA:B9W719"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9W719"
FT                   /inference="similar to AA sequence:UniProt:P40433"
FT                   /inference="similar to AA sequence:UniProt:Q9UTE1"
FT                   /protein_id="CAX44477.1"
FT                   /translation="MSDSSFIPNTETATATATESESEILNGFGSEPISNNNNNNNNQLR
FT                   TTKRWSFNSKTKFNMGDLIENGPSPTNYVPKRRMSDITGIDAIHNQRNCLNSLGGAQLY
FT                   STESGRLFHAGEIIIILTGIPGRGKTHLSVSLTRYLRWLGVNTHSFHLGNYRRANAEDD
FT                   ITHDLFIPSPQSIKANNLRQKMVNDCLEDILNFFQNNGGQVAIYDATNALPEYRLELHK
FT                   KFRELNIQVIFIESIVTNESIVMNNIEQAAKSSPDYYKWDYEKAYKDYSERIKILTPHY
FT                   IEIGGPKEQDLSFIKFINFGERIELHNSNYGYLINKVVFYLMNGKIKSGKSLYLARCYK
FT                   NSVDYNQDPPLDKQGLKYAKNLTLTLFDHLKKSQKSFCDNDNNNNNNNNNNNNSNSLEI
FT                   WTSVKKRTIETTQFFNNKNISIKHRVQLSQKNPGIIGTLIDEEEIRKKFPFEYNQYYYN
FT                   PYHYRYPRAESYHDLAIKIEPLILEMERMTNDLLIIADETVLQVFYGYLMSCSCDEIPN
FT                   LNFKSNEIIEVKFNAYSNSAKRIPIKNFDNNNDHNNNDH"
FT   CDS_pept        complement(join(502601..502965,503445..503463))
FT                   /transl_table=12
FT                   /locus_tag="CD36_02180"
FT                   /product="60S ribosomal protein L26, putative"
FT                   /note="Similar to S. cerevisiae RPL26"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44478"
FT                   /db_xref="GOA:B9W720"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:B9W720"
FT                   /protein_id="CAX44478.1"
FT                   /translation="MAKISQDVSSSRSKARKAYFTASSVERRVLLSAPLSKELRQQYNV
FT                   KSLPIRQNDEVLIVRGSKKGSEGKVNSVYRLKFAIQVDKLQKEKSNGASVPINIHPSKV
FT                   VITKLHLDKDRKALIQRKGGKAE"
FT   mobile_element  503795..503921
FT                   /mobile_element_type="retrotransposon:solo LTR, huia B"
FT   CDS_pept        504780..505583
FT                   /transl_table=12
FT                   /locus_tag="CD36_02190"
FT                   /product="import inner membrane translocase subunit,
FT                   mitochondrial precursor, putative"
FT                   /note="Similar to S. cerevisiae TIM21"
FT                   /note="Similar to C. albicans TIM21"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44479"
FT                   /db_xref="GOA:B9W721"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="InterPro:IPR038552"
FT                   /db_xref="UniProtKB/TrEMBL:B9W721"
FT                   /inference="similar to AA sequence:UniProt:P53220"
FT                   /protein_id="CAX44479.1"
FT                   /translation="MIQRATGIGLRMLRSNIGSGFGSGFGSIRSIILPILSIKPTYINS
FT                   QLNSSKLLLINFHHHHHNYSTKTAPPPPPPPPPTGDKNAKGKKILNRISRAFTFSLSTL
FT                   LVIGAGGISILVVSLILSELFLPTGDTRTFNKAVKLIEKNQQAQKILEFSSGERLKAYG
FT                   INSSSSSEKWIRNRSIQSIKFKKKIDNKDHLLMKFQVESNNGKYGIVSLEQIDNSMWNT
FT                   EFEYISLDVPGYKRIYIIEPPKNQLIPKIGGGSGFLGLNWGPKKD"
FT   CDS_pept        complement(505753..507726)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02200"
FT                   /product="pH-regulated cell-wall GPI-anchored
FT                   1,3-beta-glucanosyltransferase, putative"
FT                   /note="Similar to S. cerevisiae GAS2"
FT                   /note="Similar to Pneumocystis carinii PHR1"
FT                   /note="Similar to Candida dubliniensis PHR2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44480"
FT                   /db_xref="GOA:B9W722"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9W722"
FT                   /inference="similar to AA sequence:UniProt:Q9UVL7"
FT                   /inference="similar to AA sequence:UniProt:Q06135"
FT                   /inference="similar to AA sequence:UniProt:Q9HG18"
FT                   /inference="similar to AA sequence:UniProt:Q5AB91"
FT                   /protein_id="CAX44480.1"
FT                   /translation="MITLSIWLFLITIIFQLVVISSNVTTISETSTTTSTTTTTIVDNE
FT                   DDIDNSLEEPQIETIKVIGNKFFECESGNQFFIKGIAYQKTRQEGEIYDTNKEPNYIDP
FT                   LANPFTCLRDLDYLKELGINLVRVYQIHPNANHDICMNAFAKAGIYVLADLSEPTLSIR
FT                   RDYPHWDTELFNRYKQVIDSMNKYKNLLGFFAGNEVTNCQLNIDASPFVRAAIRDCKNY
FT                   INQQGYRKIPIGYASNDDANIRKNLANYFICQLDEDEDKNNDNINNINNSQADFFAINV
FT                   YEWCGYSTYTTSGYRDLTTTFKDYPIPIFFSEFGCNIITPRPFTEVEAIYGNTMNKIWS
FT                   GGIVYEYFEEINHYGILLTKKDGSITKLPDFDTLKMRFNAVNPIGITIDEATIYEPRIS
FT                   CQDIFGDSSSSSSSSLSSSSSWDVALTLPPTPNEAKCECLWKSLSCVVSDDAIFDEEVA
FT                   LRELCFKVDCEDINANGRSGKYGRYSDCNPTIRTSYALNKYYQQCGKKQEICDFQGRGE
FT                   LFPNRDLEDLGNKFSNDGKNCQSLLEGKEEEEEEGEEVVKPGLPGSNKGKEIGNIPKGK
FT                   SKGKGKGKLIEEGETEEQEQEEEGKKSKSKSNKTPSGKTPLENPSKTSESIAGGNTIIF
FT                   KNDSIWKTFIEILFTCSAAILI"
FT   CDS_pept        complement(508037..511801)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44481"
FT                   /db_xref="UniProtKB/TrEMBL:B9W723"
FT                   /inference="similar to AA sequence:UniProt:Q6BVK2"
FT                   /protein_id="CAX44481.1"
FT                   /translation="MIMTMDIIGCHKLLEQLYHDTINQNTNLMEILAIIKSSTTTTTNK
FT                   TSSSLPTIARGLQTKHSKLLSLINQTLKDLQSHPSNEKDIFKSFINEFIIWIDDNTLTL
FT                   FIKYSNELKYRKLCDSITESIINSPINNLINFITFIHSCQPHLRNPFVLDKLININKKL
FT                   QEIINNHNNDIYYKKLNNILFSNVKSFNSNISMINRNDNELVSSYFTIDQIIDRTADAA
FT                   LYMDNTNKPIELMLLDLAGTGIYNSLAILSIDYDDDNDDEISRSLMYPPFRINELSLSN
FT                   TSNSIILKSIDFLSSPTRTTTRTTTTTTTNKENTIIINCDDSELLQIWVSNLSKIFPTQ
FT                   RCNNNNNNNDSSSSSSSNGDKFLIDSHHSSLTKMSGLGINVISDSEHKQILLSQEEEEE
FT                   EENISTPSISKRNTTPFKELIDNPTPTPFKKDKSSSNDDDINNEMVENSGSNTCNSSIT
FT                   SNEDNNHIKLQSQYDRTVPLIKKTLSYNHQLEDKVGNENENENENEDTNNDNDEKYFQI
FT                   INRKKVSEEFSQDDNENRPKSSRGEVIAYNETSPLGNESSYEDNDDDNDDEEEEDEGDE
FT                   DLISTKEIELIEPNVPYHKPLLETNSAPNLMVSSNNISNNNNNNNNTKLYQLSSGSAVD
FT                   INNFGKNYKPSFIIPNHNNHNPNNNNNNNNNSTNSIISNNKTNKQRKRRSFFDLFKKMS
FT                   SKSNLVEDTPGFESVILDPSINTITTTTSDVVVVPEKNEIINNTVIKEETEAEEEVEEE
FT                   EKVSKPTNKSSSSLPSPFALPSSTSTYFFKQYKENGSTSSLNKTRSTTTATTSSSLVSP
FT                   EPQQPQQPQEEEELIIPQDLKDTINQESTIDFFISQSSSSSPSSSSSSSFSSSSSSSSP
FT                   KFLKISKWKHKYGKWEMITISKKIFIKIVINYQLKKCWFIIFKEEFDEKFKEEIDKPIL
FT                   LLDILMNSTKIRKSSPLDLQIFSKNSITNEKILIMIRCNSNDLINDIINNVENALGALS
FT                   STTTTSTTSTTSTIGASSGTMNNHNNNNNNNSYGSLNSSKLLNSDNTLASSMMDLNNLS
FT                   TSHSSTYTSFSSFGVQQTKQPPPTVPPTVPPVPKKSLLLLSSSLSSSLNANEIYNANII
FT                   NNPNTIYINKINQMQIRLQKFSINSNDYKEEQQQKQLIYNPSSWKILSMYKLNIDQLID
FT                   DLTQRSFYYFKLTNDENPEKPEEKEEKEEFRWLISNEMKFVVLEKIGKAGLLVKHNDGY
FT                   GINHDNNLGEIYMIECRGKKEFKTLYEIF"
FT   CDS_pept        complement(514223..514783)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02220"
FT                   /product="GTP-binding protein, putative"
FT                   /note="Similar to S. cerevisiae CIN4"
FT                   /note="Similar to C. albicans CIN4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44482"
FT                   /db_xref="GOA:B9W724"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W724"
FT                   /inference="similar to AA sequence:UniProt:Q8X1K1"
FT                   /inference="similar to AA sequence:UniProt:P39110"
FT                   /protein_id="CAX44482.1"
FT                   /translation="MGLLTIIKKQKLKDNEIRILTLGLDNSGKTTIIKKMLNQDITTIS
FT                   PTMGFQINTLIYNNQYTLNIWDIGGQTSLRLFWGNYFDKTNVVIWVIDGLSLERLNESY
FT                   QELKQKIILQDRLIGIYLMIIINKIDLIISKSDLSNLKEKVIDLLQLNNHISQRNKWQV
FT                   ELVSGKTGQGIDKVLQWIVTREY"
FT   CDS_pept        515078..517660
FT                   /transl_table=12
FT                   /locus_tag="CD36_02230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44483"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9W725"
FT                   /inference="similar to AA sequence:UniProt:Q6BVK4"
FT                   /protein_id="CAX44483.1"
FT                   /translation="MTRIKKESTEVKQKQQRSILDFTTQKQQQQQQQQQQQQANKSSEV
FT                   VSIKSETRTSTTTTTTTTSIEDTSIVYCPICNEGITHLDLRERTDHVDTCLVRVTFVEN
FT                   TATRTTTNTTTSKMMEMKSQDSISTAIMMPKQENNQLFSSTEKKETSIKKKRKIDIDNK
FT                   SKYINTTTSTTTTTTTMNQPKVIKPPTSIKHVKKKPIPSLKIMTFPIIQDINNNNNNNN
FT                   QQSFPSLKYQVAVDAFSFAPHDTINQYFLTHFHADHYGGISKKWPYERVFGNEDIYNES
FT                   NLNLNLNFNDDKIYKKIIYCTNITGKLLTLRYSIDSRFIKQLELNIKYKIKNYIYNDSI
FT                   KKDFGYKTNNNNNNNNNNNIDMTPGLYVTPIMANHCPGAAMFFFESIGIDKKIYRILHC
FT                   GDFRVNMEILQHPILKPFSLNNHNNDSNNNNGKNNNGKNDLSLYIDKVYLDTTYMSPKH
FT                   NLPKQELVCETLADLFHDLIQQQEKDKPSNSSNGGGGGGETNGGGGGGTNGDNLFSNWF
FT                   GNFTQSRITDFCIIPTSKNKLIQPLLFKKKKKFLIVIGTYVIGKEKLAISISKRLNCLI
FT                   YLSNIGSRKDKFEIFKTFKNDYLQSIITIDKEFGNTTTTSNSGDDCVIHLVPMTIVANN
FT                   EELSKYFNHNKYYQFFERCIGICPTGWSYNKNITSTTTTTTTKQKSNSNFSNSNNNSNR
FT                   DEFVSELEQTINMMENQPSFNYIDDILSQIPLTTITNNNNNNKKKKKKKGKGKIDIDLY
FT                   RLYSIPYSEHSSFRELAYFIIFFKFKKIIPTVNYEIESKLIEMEKIIQNWEKIRQIILS
FT                   SKNKHNNNNNNKEKDVDVDVDVDIDIDIPDYIPDDLLQRIQRLSLNDF"
FT   CDS_pept        complement(517888..519228)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02240"
FT                   /product="alpha-1,6-mannosyltransferase, putative"
FT                   /product="mannan polymerase II complex subunit, putative"
FT                   /EC_number="2.4.1.-"
FT                   /note="Similar to S. cerevisiae MNN11"
FT                   /note="Similar to C. albicans MNN11"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44484"
FT                   /db_xref="GOA:B9W726"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="UniProtKB/TrEMBL:B9W726"
FT                   /inference="similar to AA sequence:UniProt:P46985"
FT                   /protein_id="CAX44484.1"
FT                   /translation="MFGVGKSGTFKPKYGKSNYPSSSSSSSSFLPLPATFHQINRKKRL
FT                   PLILIILLFIWYICFNSFLSPFPYLFSKSITKKNYPRAHPLTSTQFIETSSKYIYPPIE
FT                   HAPLLKQLTTRKLFIEHTFKENGIDKTGIKSLNFLDDPHENLQKIKEKEENDNSPLNAA
FT                   KNYFKNQDKIVFKPKKSSSSSNKYPEIVIVTAVDFNKYSLDGLTKIVQNRVDYAHLQNY
FT                   GVYVRWSEEFLPILNNFQYLDDKERIKWIRVYCMKAAMFAFPKTKWFWYLDQDGLIMNM
FT                   NINIYDYILNPEILNSIMLRDLPLIPPDGIIKTYKNAQANSIRFLLIQSNQKIETNSFL
FT                   MKNDFIGKSMIDIWGDNLYFQYPNFPYGPDSALTHILQWHPFILSKTTIIPAKTIGSSH
FT                   NFNDNSPKNLIYEDGDFVAQWSNCKNPTDCENILNIYYKKLKKDLKT"
FT   CDS_pept        complement(520188..521249)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44485"
FT                   /db_xref="GOA:B9W727"
FT                   /db_xref="InterPro:IPR013861"
FT                   /db_xref="UniProtKB/TrEMBL:B9W727"
FT                   /inference="similar to AA sequence:UniProt:Q6BVK6"
FT                   /protein_id="CAX44485.1"
FT                   /translation="MSILRGHKLTKSSKILLGLLTGISSLLLILKYQQFRFSEDTKFHD
FT                   VKIPYIQLIPRSTIYNPWVIISSIFAEISIISFIFSFGVLYVGSKFVERFWGNYLEVIK
FT                   FVIIVGGITNLITVIIAIISNIIRQDGKNMDQPLGGGISYYFGFLVVCKQLIPEHNIVL
FT                   FQGLINFRVKNVPFALIIFLGLWSIIITRSLYPAIPSIGSFFVSYFYLRFFQSLNIEPT
FT                   LPIATTSTTTNTTTSSNGPSIDTQNSSIMIGDASDTFQLIDFFPQMIRPVLIPIFQHGY
FT                   DISVFLGIITPFNDEIVEQSNLRAQKRQEQTNQTQKNVAKSVAERRRQVALQVIEDRIN
FT                   KETAANNTESNQS"
FT   CDS_pept        521423..521776
FT                   /transl_table=12
FT                   /locus_tag="CD36_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44486"
FT                   /db_xref="GOA:B9W728"
FT                   /db_xref="UniProtKB/TrEMBL:B9W728"
FT                   /protein_id="CAX44486.1"
FT                   /translation="MFMLMLMFVMIYILVVEVVYLVLSCLTGLFFSSQISCFLSCLIVQ
FT                   LFIVQMEKLSRLCYSSSSSSSSSFSSFLSSPNYQSDHQESTNRYQIHKKKSYIYIYIYR
FT                   LIITSNIFIKTIV"
FT   CDS_pept        complement(522074..527767)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02270"
FT                   /product="beta-1,3-glucan synthase catalytic subunit 1,
FT                   putative"
FT                   /product="1,3-beta-D-glucan-UDP glucosyltransferase,
FT                   putative"
FT                   /EC_number="2.4.1.34"
FT                   /note="papulacandin B sensitivity"
FT                   /note="Similar to C. albicans GSC1"
FT                   /note="Similar to S. cerevisiae GLS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44487"
FT                   /db_xref="GOA:B9W729"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:B9W729"
FT                   /inference="similar to AA sequence:UniProt:O13428"
FT                   /inference="similar to AA sequence:UniProt:Q53YZ4"
FT                   /inference="similar to AA sequence:UniProt:P38631"
FT                   /protein_id="CAX44487.1"
FT                   /translation="MSYNDNNNHYYDPNQQGGMPPHQGGEGYYQQQYDDMGQQPHQQDY
FT                   YDPNAQYQQQPYDMDGYQDQANYGGQPMNAQGYNADPEAFSDFSYGGQTPGTPGYDQYG
FT                   TQYTPSQMSYGGDPRSSGASTPIYGGQGQGYDPTQFNMSSNLPYPAWSADPQAPIKIEH
FT                   IEDIFIDLANKFGFQRDSMRNMFDYFMTLLDSRSSRMSPAQALLSLHADYIGGDNANYR
FT                   KWFFSSQQDLDDSLGFANMTLGKIGRKARKASKKSKKARKAAEEHGQDVDALANELEGD
FT                   YSLEAAEIRWKAKMNSLTPEERVRDLALYLLIWGEANQVRFTPECLCYIYKAATDYLNS
FT                   PLCQQRQEPVLEGDYLNRVITPLYRFIRSQVYEIYDGRFVKREKDHNKVIGYDDVNQLF
FT                   WYPEGISRIIFEDGTRLVDIPQEERFLKLGEVEWKNVFFKTYKEIRTWLHFVTNFNRIW
FT                   IIHGTIYWMYTAYNSPTLYTKHYVQTMNQQPLASSRWAACAIGGVLAAFIQILATLFEW
FT                   IFVPREWAGAQHLSRRMVFLVLIFFLNLVPPVYTFQITKLVIYSKSAYAVSVVGFFIAV
FT                   ATLVFFAVMPLGGLFTSYMNKRSRRYIASQTFTANYIKLKGLDMWMSYLLWFLVFLAKL
FT                   VESYFFLTLSLRDPIRNLSTMSMRCVGEVWYKDIVCKNQAKIVLGLMYLVDLLLFFLDT
FT                   YMWYIICNCIFSIGRSFYLGISILTPWRNIFTRLPKRIYSKILATTEMEIKYKPKVLIS
FT                   QIWNAIVISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFP
FT                   RNSEAERRISFFAQSLATPMPEPLPVDNMPTFTVFTPHYSEKILLSLREIIREDDQFSR
FT                   VTLLEYLKQLHPVEWDCFVKDTKILAEETAAYENGDDSEKLSEDGLKSKIDDLPFYCIG
FT                   FKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENPELVQYFGGDPEGL
FT                   ELALERMARRKFRFLVSMQRLSKFKDDEMENAEFLLRAYPDLQIAYLDEEPALNEDEEP
FT                   RVYSALIDGHCEMLENGRRRPKFRVQLSGNPILGDGKSDNQNHAVIFHRGEYIQLIDAN
FT                   QDNYLEECLKIRSVLAEFEEMNVEHVNPYAPNLKSEDNSTKKDPVAFLGAREYIFSENS
FT                   GVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFLNATFMLTRGGVSKAQKGLHLNE
FT                   DIYAGMNAMMRGGKIKHCEYYQCGKGRDLGFGSILNFTTKIGAGMGEQMLSREYFYLGT
FT                   QLPLDRFLSFYYGHPGFHINNLFIQLSLQVFILVLANLNSLAHEAIMCSYNKDVPVTDV
FT                   LYPFGCYNIAPAVDWIRRYTLSIFIVFFISFIPLVVQELIERGVWKAFQRFVRHFISMS
FT                   PFFEVFVAQIYSSSVFTDLTVGGARYISTGRGFATSRIPFSILYSRFADSSIYMGARLM
FT                   LILLFGTVSHWQAPLLWFWASLSALMFSPFIFNPHQFAWEDFFLDYRDFIRWLSRGNTK
FT                   WHRNSWIGYVRLSRSRITGFKRKLTGDVSEKAAGDASRAHRSNVLFADFLPTLIYTAGL
FT                   YVAYTFINAQTGVTSYPYEILGSTDPQPVNSTLRLIICSLAPVVIDMGCLGVCLAMACC
FT                   AGPMLGLCCKKTGAVIAGVAHGVAVIVHIIFFIVMWVTEGFNFARLMLGIATMIYVQRL
FT                   LFKFLTLCFLTREFKNDKANTAFWTGKWYNTGMGWMAFTQPAREFVAKIIEMSEFAGDF
FT                   VLAHIILFCQLPFLFIPLVDRWHSMMLFWLKPSRLIRPPIYSLKQARLRKRMVRKYCVL
FT                   YFAVLILFIVIIVAPAVASGQIAVDQFANIGGSGSIANGLFQPRNVSNNDTGNHRPKSY
FT                   SWTYLSTRFTGSTTHYSTNPFRI"
FT   CDS_pept        complement(join(531737..533631,533738..533762))
FT                   /transl_table=12
FT                   /locus_tag="CD36_02290"
FT                   /product="eukaryotic translation initiation factor eIF-2A,
FT                   putative"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44488"
FT                   /db_xref="GOA:B9W730"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W730"
FT                   /inference="similar to AA sequence:UniProt:O74965"
FT                   /inference="similar to AA sequence:UniProt:Q4WWI2"
FT                   /protein_id="CAX44488.1"
FT                   /translation="MSKTTEIFCRLPKSVELIQDFKDITPSPKANGECRAALYSKNGDF
FT                   FAYTQPQEVVILDTTGEAKVYHRIEIPEVFDIYFSPEGTYLCLWCKPIQLNKENGTWNN
FT                   NLKIFNIKTKTIIAEWSAKHQNAWKPQFTSEENLFARSINQKEIHFFELDPTSDSIVNI
FT                   NQPSFKYKVNDPKATLQAFQISPGRNPSVAIFIPEKSGKPANVSIYNIPNFNQPICFKN
FT                   FFKAEKCQLKWNSLGTALLALASTDHDTTNKSYYGETNLYLLGIAGSYDSRIDLKREGP
FT                   IHDITWSPTAREFAVSYGYMPSETTFFDSRGNAIHSLPTAPRNTILYSPHAKFVLVAGF
FT                   GNLQGTVDVYDRQNKFSKVITFEASNTSVCEWSPCGRFILTATTSPRLRVDNGCKIWHA
FT                   SGKLIYLKEFPELFSIGWKPQALDCFPPIRNLEPAPQAHESTKEYLEKRQALASAAAKK
FT                   PAGAYRPPHARGAGGAGNGSGSGANVAASSLYQKELQNNLRSNGSSPSPPPGLSRAAGN
FT                   IPRVRTVVGAPPPVEKESKAAAKNRKKREAKKQAQEKSNSPAPAAAAGEAATTPTPAAT
FT                   AGVIGGVASLEEKKIRSLLKKLRAIEQLKMKQAAGETLEDTQVIKISKEDEIRSELQTL
FT                   GWNE"
FT   CDS_pept        complement(534444..535451)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44489"
FT                   /db_xref="GOA:B9W731"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039138"
FT                   /db_xref="UniProtKB/TrEMBL:B9W731"
FT                   /inference="similar to AA sequence:UniProt:Q5B7N1"
FT                   /inference="similar to AA sequence:UniProt:Q4WWE5"
FT                   /inference="similar to AA sequence:UniProt:O13974"
FT                   /protein_id="CAX44489.1"
FT                   /translation="MRLKLKSTNGVSTITLDDPKKLFKDFLIDIQQDTKLHQDISENVS
FT                   TIKLGFPPKPIDLSYGLDTTLKDKDIKDGDQLLIEFTSFKRKTDSDPPLSPQPSEKKPN
FT                   LRDDIPSTFIESLNKYLILRNIPDDNSCLFNSISYAISGYDSYNNISPPEELRKVVVNY
FT                   IEKDPELYSELILGRPREEYCQWIQKKDSWGGAIELGILADWFNVRIVCIDIESGNFIR
FT                   FENEKDHPNKFIILIYSGIHYDVLAINDELSMDNKDTDIAQWSTEDIHEEEDILAASQK
FT                   LCKLLQSKDYATNTTTFRVRCLDCYSVLVGEMGASKHAEETGHLNFGEVKVKKS"
FT   CDS_pept        complement(536345..536878)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02310"
FT                   /product="filmanetation/polarity protein, putative"
FT                   /note="Similar to S. cerevisiae BUD20"
FT                   /note="Similar to C. albicans BUD20"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44490"
FT                   /db_xref="GOA:B9W732"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B9W732"
FT                   /inference="similar to AA sequence:UniProt:Q08004"
FT                   /protein_id="CAX44490.1"
FT                   /translation="MGRYSVKRYKTKRRTRDLDLIYNDLSNPDSINKLKNQPLDELKPG
FT                   LGQYYCIQCAKYFENQISLDRHTKSKIHKRRVKLLKERPYTPLEAEAAAGINMEKFINS
FT                   VEKYKQLENHKQENKQEYDNLINQKKDNLDAIITGIPSEEFQQQQQQQQQVQESQNANQ
FT                   GTVSNDQEEVMMTD"
FT   CDS_pept        537633..538295
FT                   /transl_table=12
FT                   /locus_tag="CD36_02320"
FT                   /product="60S ribosomal protein L10, putative"
FT                   /product="ubiquinol-cytochrome c reductase complex subunit
FT                   VI requiring protein, putative"
FT                   /note="Similar to S. cerevisiae RPL10"
FT                   /note="Similar to C. albicans RPL10"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44491"
FT                   /db_xref="GOA:B9W733"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:B9W733"
FT                   /inference="similar to AA sequence:UniProt:P41805"
FT                   /protein_id="CAX44491.1"
FT                   /translation="MARRPARCYRYCKNKPYPKSRYNRAVPDAKIRIYDLGRKKATVDE
FT                   FPLCIHLVSNELEQLSSEALEAARICANKYITKISGRDSFHLRVRVHPFHVLRINKMLS
FT                   CAGADRLQQGMRGAWGKPHGLAARVSIGQIIMSARTKDSNKDVVIEGLRRARYKFPGQQ
FT                   KIIISKKWGFTPLNRDEYIAKKTNGEVIDDGAYVKFLSRKGNLEANLQQFPNYQYSA"
FT   CDS_pept        538942..539442
FT                   /transl_table=12
FT                   /locus_tag="CD36_02330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44492"
FT                   /db_xref="GOA:B9W734"
FT                   /db_xref="UniProtKB/TrEMBL:B9W734"
FT                   /inference="similar to AA sequence:UniProt:Q5AIB7"
FT                   /protein_id="CAX44492.1"
FT                   /translation="MDQDNEIDRLHETELWNNNNNSNNDHNDLTLPSSITAFDPIQQQE
FT                   LEQLQALLDPTSTSLQNHNEQEGEEQELKNNDTSQCWIRTLIFIGYCISTVFFSIHLWI
FT                   QYFFIKYTYDDQTAVNMLNYVTAAQEQAIDEYSRKTKRRTSSNSSMRRRMRRRSSRESD
FT                   LHP"
FT   CDS_pept        540406..541164
FT                   /transl_table=12
FT                   /locus_tag="CD36_02340"
FT                   /product="phosphomannomutase, putative"
FT                   /EC_number="5.4.2.8"
FT                   /note="Similar to C. albicans PMM1"
FT                   /note="Similar to S. cerevisiae SEC53"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44493"
FT                   /db_xref="GOA:B9W735"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9W735"
FT                   /inference="similar to AA sequence:UniProt:P31353"
FT                   /inference="similar to AA sequence:UniProt:P07283"
FT                   /protein_id="CAX44493.1"
FT                   /translation="MSFANKQDPKTLVLFDVDGTLTPARLTISEEMKKTLEKLREKVVI
FT                   GFVGGSDLSKQVEQLGPNVLNDFDYCFSENGLTAYKLGKELASQSFINWIGNEKYNKLV
FT                   KFILKYLSELDLPIRRGTFVEFRNGMINVSPIGRNASTQERNDYEKFDKQHHIREQMVD
FT                   ALKKEFPDFGLTYSIGGQISFDVFPTGWDKTYCLQHVEDEHFENIHFFGDKSYKGGNDY
FT                   EIYNDPRTIGHAVNSPDDTIKILNETFKLQ"
FT   CDS_pept        complement(541312..543324)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02350"
FT                   /product="mitochondrial protein, putative"
FT                   /note="Similar to C. albicans FMP25"
FT                   /note="Similar to S. cerevisiae FMP25"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44494"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:B9W736"
FT                   /inference="similar to AA sequence:UniProt:Q6BVM2"
FT                   /inference="similar to AA sequence:UniProt:Q08023"
FT                   /protein_id="CAX44494.1"
FT                   /translation="MIIRTRPLIQVLPRYNYFYRLNSSKNKFSSIENFNKNKTTYNFGY
FT                   NFHDLKDLDNKINPQPKESRKDIGTNSKPNDYGNDNDKPIDINALLENDPRLLKLKPGT
FT                   AEYRDELKKLHQEFESNQKKQRSRHEFNQRIKGMVFGLLALIGIVSTHQLLTNYESIKN
FT                   RLLSNYNYSDLNEDNINIKSTNKKNVKSTKYMLEKLAKELNDENLNQIQDSKTVSGVYI
FT                   FGNNDGNDDGNDGCKIPLRIPFFNNMYLKDAYIEKGHLIVINDQGKVYEWNKDWSNVKL
FT                   INLPFKIEKITPTKDYFYFLTNKGEIVYIPRIKSNSEFIPLQRRNWFGILTTQIYNKLN
FT                   IKDIKSFSSGDDHLLLLNKSGKVFVVNCSNNPINRGQYGPSYSPFTKENKIPVNQPIDL
FT                   TLLNNRIIQTENKQGKAVVPRVFNYISSGKYFNIVCDDNGNIWTWGDNSCGQCGDINTT
FT                   DLKPVPKIVFTKSDFKRVLRNVLPPRIQEEYIHIKKISTGDDSSYVLINYLDKDVLISF
FT                   GNGINGQLGGGRYMQVCCWPEIVKSLIGLNEFDESLNSVKPIKIKDINVGNKHLFITLD
FT                   NVGHNKDVYALGENEFGQQGNGKKNKSCKPMKIPKLIEPEDGKDKLQLVKNLNDVNTKR
FT                   LSLLNEWKISKNVVVDQVIMAGNDASIIYYKKVQK"
FT   CDS_pept        543632..544258
FT                   /transl_table=12
FT                   /locus_tag="CD36_02360"
FT                   /product="mitochondrial protein, putative"
FT                   /note="Similar to S. cerevisiae FMP32"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44495"
FT                   /db_xref="GOA:B9W737"
FT                   /db_xref="InterPro:IPR024461"
FT                   /db_xref="UniProtKB/TrEMBL:B9W737"
FT                   /inference="similar to AA sequence:UniProt:P43557"
FT                   /protein_id="CAX44495.1"
FT                   /translation="MFTPISLYRSTVRTPFIIPTINSRSLSGITKFDTRKFVQTLQDKG
FT                   GFSEKQAEVAVNVVNAAINDGIYSITNNLVKKESLSSIAYQQKVNFAKLKGELQTMDKS
FT                   EFTSLKKEQEKLRTDLTNLKNRLKEEITKNQASVRLDLNLEKGRIREESSQHELRIEDT
FT                   YSRIDEEVSNMKMQIKTVKTQVLQWLMGVSTGTLALLLTFVRFYF"
FT   CDS_pept        544619..545344
FT                   /transl_table=12
FT                   /locus_tag="CD36_02370"
FT                   /product="vesicular transport protein, putative"
FT                   /note="Similar to S. cerevisiae BOS1"
FT                   /note="Similar to C. albicans BOS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44496"
FT                   /db_xref="GOA:B9W738"
FT                   /db_xref="InterPro:IPR027027"
FT                   /db_xref="UniProtKB/TrEMBL:B9W738"
FT                   /inference="similar to AA sequence:UniProt:P25385"
FT                   /protein_id="CAX44496.1"
FT                   /translation="MNSIYNHGLKQTQTITKDLTQFEKNLSTSPLSLQGAITTSLTAFR
FT                   KTIKEYNDLLEKNVNDTSYTKHENRLNKFNQDLNEFTLKFDNLKKQRDIQVQESNKQEL
FT                   LGRRHISTTGAASASASASASSDNPYDSNSTQQQLQEDQNTMSYREGLYHEKNSLERGS
FT                   EQLDRILEMGQQAFEDIVEQNEILRKVQTKFEESLITLGVSQGTIRSVERRAKQDKWLF
FT                   WFCVVIMLVMFYYIVKLFR"
FT   CDS_pept        546793..548517
FT                   /transl_table=12
FT                   /locus_tag="CD36_02380"
FT                   /product="SCW/CMP-family cell wall glucosidase precursor,
FT                   putative"
FT                   /EC_number="3.2.1.-"
FT                   /note="Similar to S. cerevisiae SCW4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44497"
FT                   /db_xref="GOA:B9W739"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9W739"
FT                   /inference="similar to AA sequence:UniProt:P53334"
FT                   /protein_id="CAX44497.1"
FT                   /translation="MKLDYILASLVIASITEAAPIKRGLFEDLFGTSSSNTAPAPAPAA
FT                   APAPAPAPAAAAQQAVNVNTPPAAAPAAAPATTTAASSSKGFWAGLFGGDSTNTASTAA
FT                   AAAAPAPASASVASAPAAVAPVAAPAASTPQSTSSSSSFGGFFSNLYNDFFGSSSANAN
FT                   PQPQAPAQAQAPVQATKPTSAAPVVVTSAQIYTSVVTSAAPAAAAASPVAANGNSGSDD
FT                   YSAEGLFAFLFGGGKASATASSASASSNPIYGSGSDSGSGSGSGNSAGNTGSSSGTTLG
FT                   VGYQGGSPGKNTASINTATATAINGGSAAGATAAAGSLGITYSPYTKSDGCKSASQIAQ
FT                   DIAKLSNYEVIRLYSTDCSGIENVLSAMGSNQKLFLGVWNIDSPQGELQDIVNAVKQSS
FT                   SGWNVVHTIAIGNERVNAGAASVAQVQQAVDLSKKYLKSQGYNGPIVTVDTLVAYVGNP
FT                   QLCEMSDYLAVNSHPYWDGGVQPENSGQWLLQQIAHLQSVCGSSKDVLITETGWPTQGD
FT                   AYGQCVPSVQNQVAAVKSIVKSLSDKVIMFTMFNDYWKDPGAYNVEQHWGLYGDPSS"
FT   CDS_pept        complement(549003..550763)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02390"
FT                   /product="dicarboxylic amino acid permease, putative"
FT                   /product="L-glutamate and L-aspartate high-affinity and
FT                   high-capacity transport, mediator, putative"
FT                   /product="Gln, Asn, Ser, Ala, and Gly transporter,
FT                   putative"
FT                   /note="Similar to S. cerevisiae DIP5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44498"
FT                   /db_xref="GOA:B9W740"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B9W740"
FT                   /inference="similar to AA sequence:UniProt:P53388"
FT                   /protein_id="CAX44498.1"
FT                   /translation="MVFGYNSDKGLSNEEKRSSTADLESVITQHTTNYDLYIARSNPSA
FT                   HNAEEGHQLRQELHARHVSLIAIGGALGTGLLIGTGSALKTAGPGAILVAYGAIGFVVY
FT                   MVMTALGEIASFIPLPGFANYGKRYADEALGFACGIVYLIKYLVLPANQLTAGALTMQY
FT                   WVSRDRVNPGVWITVFLVVITFINFLGVKVFGEIEFWMSILKVLTCLGLILLLWIIALG
FT                   GGPTHERLGFRYWKNPGAFIHYSNSAQNVAIGGSKGRFVAFVSVLVTAVFAYLGSELVA
FT                   VTFSETRNPRRAIPKAIKLTLYRILVFYILSILFVGMCVSSKDPLLLGAKGTNAGASPF
FT                   VIAIKNAKINGLDHLINACILLFVISASNSDMYVCSRSVYSLSVDGYLPKFFSKTNKMG
FT                   VPYYGVLLSFLFCLLAYMNVSSGSAEVFTYFVNVVSLTGLIAWACILTFHIRFMKALKA
FT                   QGLDRYKDLVYRSPLQPYGSYISLAICILIIFIKNFTVFLGDKFDYKNFITGYIVLPVF
FT                   LIFFFGYKIIYKTKWLKPEEVDLDTYRDVIDAEFEKFEAEAAEKKAIREAEGKRFDGQW
FT                   FYDKILGWIF"
FT   tRNA            complement(553346..553418)
FT                   /gene="tRNA-Arg (TCT)"
FT                   /locus_tag="CD36_tRNA_0006"
FT                   /product="transfer RNA-Arg (TCT)"
FT                   /anticodon="(pos:553383..553385,aa:Arg)"
FT   CDS_pept        complement(553758..555452)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02400"
FT                   /product="proline-specific permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44499"
FT                   /db_xref="GOA:B9W741"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B9W741"
FT                   /protein_id="CAX44499.1"
FT                   /translation="MSKKNDNITYDVEKISIENPLPAKEFNDFHDNLDIEKYGETKRKL
FT                   NSRHVNLLMIGQSIGSALFVSIKNPLHNSGSLSFFLAFAIWACLVIYPLMQAIGEMCSY
FT                   LPIKGSFFHFSARYVDPALGFASSLIYTYTALMFVCIEATACAGLISFWTDINPGIFIT
FT                   IALVLFFLINLFGAQFYGEFESIFSSFKVILILGLMIFSLISMCGGNPQHNAYGFQHWK
FT                   EGGLFKPYLVGGTTGKFLGTYNCLIWAGFAAGGPDVLALIAAEVKMPRKNIGIVAKRSY
FT                   IRIYLFYLGGIFFLNCLIASNDPSLVESLKSSTVSPWTLGIQNVGVRGLGSVVNGAVLT
FT                   SAFSCGNAFFFLGTRSLYSASLAGYVPRFFSKCLKSGVPINCVIFTGVISLISYLNINQ
FT                   STGVVFNWFVNLATTGLLCSYICMWLSYFKFRKAYEVQTGKQMKKGQYGYYLAPKFIHP
FT                   YFTYFGFFLNVVVLIFNGFWIFFPGQFSVSNLFTSYFAPVFFICLFVFWKVFKKTHWRN
FT                   AMEADITTGKQYIDEEEEKDIEFELNRERRQGWVFVAWRKASDFCFS"
FT   CDS_pept        join(556411..556479,556536..556604,556642..556830,
FT                   556812..556919)
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_02405"
FT                   /product="choline and nitrogen mustard permease,
FT                   pseudogene, putative"
FT                   /note="Similar to C. albicans HNM4"
FT                   /note="rearranged pseudogene"
FT                   /note="possibly fungal-specific"
FT                   /inference="similar to AA sequence:UniProt:Q5AIA7"
FT   CDS_pept        complement(557148..558026)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02410"
FT                   /product="pyridoxin biosynthesis protein, putative"
FT                   /note="Similar to S. cerevisiae SNZ1"
FT                   /note="Similar to C. albicans SNZ99"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44501"
FT                   /db_xref="GOA:B9W742"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:B9W742"
FT                   /inference="similar to AA sequence:UniProt:Q03148"
FT                   /protein_id="CAX44501.1"
FT                   /translation="MSDFKVKAGLAQMLKGGVIMDVVNADQAKIAEAAGACAVMALERI
FT                   PAEMRKSNQVCRMSDPKMIKDIMETVKIPVMAKCRIGHFTESQILEALGVDYIDESEVL
FT                   TPADTVYHIDKTKFKVPFVCGARNLGEALRRIHEGAAMIRCKGEAGTGDVSSAVDHIRT
FT                   IKKDIEEASKLKSETEIVELARKLRVPTELLIKVIEAKKLPVVLFCAGGVSTPADAALL
FT                   MQLGCDGVFVGSGIFKSKNPEKLAKAIVNATTHYNDPVKLLQYSTDLGELMGGIAIDSI
FT                   KEDEKLEKRGW"
FT   CDS_pept        559513..560262
FT                   /transl_table=12
FT                   /locus_tag="CD36_02420"
FT                   /product="SNO-family glutamine amidotransferase, putative"
FT                   /EC_number="2.6.-.-"
FT                   /note="Similar to S. cerevisiae SNO1"
FT                   /note="Similar to C. albicans SNO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44502"
FT                   /db_xref="GOA:B9W743"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9W743"
FT                   /inference="similar to AA sequence:UniProt:Q03144"
FT                   /protein_id="CAX44502.1"
FT                   /translation="MTIERSVTIGVLALQGAFREHIAYFNHVIESNPDQYSEYDIRLKE
FT                   VKTKQDLEQCDSLVIPGGESSSISYIAERTELLPHLYEFVSDKSKSIWGTCAGLIFLSK
FT                   QLVNGIENQQILGALDIEVSRNAFGRQIDSFEQSLDFSSFIPGCTDFPTVFIRAPVVTK
FT                   ILIQRECLKEEVIRSNNSYQNPAPVKVLYSLKNYDGKDHELIVAVKQGHILGTSFHPEL
FT                   ADDYRFHKWFLDEFVIKKLKQYTGRET"
FT   CDS_pept        560449..564882
FT                   /transl_table=12
FT                   /locus_tag="CD36_02430"
FT                   /product="vaculoar membrame protein, putative"
FT                   /note="Similar to C. albicans IML1"
FT                   /note="Similar to S. cerevisiae IML1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44503"
FT                   /db_xref="GOA:B9W744"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR027244"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9W744"
FT                   /inference="similar to AA sequence:UniProt:P47170"
FT                   /protein_id="CAX44503.1"
FT                   /translation="MQHPRMFNQASTNTRKPNGLDSSIKAPNVSNQRQMSANHASLTIG
FT                   GSRNTINQRRSMSAKNIGSTLIVSRRNNHYLDVKEEEDSKENLTKTISNGQNEEDTEVS
FT                   VKVSVWFHELRDFIEDIIIDENVIPTGIQVGQVFELRSLDDGPTKKLVFTVQKRNLRSA
FT                   AAATTTTTTAAAAAANDADYTEASKPKLQISLMSNPFQKLLDLAPRRQVQLKRLVKLEP
FT                   VTVDSVEIFIKDVNLSRDAMWNFSASMIGNCVYIDQRLLYLGSRVGITKHIYKNGKNVI
FT                   SGYVDKNTKIIYRSESAKITLFVQLSREMWHFEEDGEIMFHKLINNLFPKIFRRWRETN
FT                   THHSITIVLFTSIDLTDIPWTNLGPGQRPPQRRDFFRVVVDQVNSMHWDRIMEDLRLEF
FT                   ANFKRDTMLNLDDDGKFIIENGTLPAIKGNLLEAVNLGLTSLNNRFQNTDLKHSITHIM
FT                   LITPGTGLFDVEYDLLLETSKKMSSVDSSLDIICLSQPPLHVTPLFRYIKEGKVCHCVP
FT                   LWCDISFFIDKVQQESQWIPRCKIYELQMMGVMENEASDARIPRLHLNSHGKTLVDIME
FT                   EYDNAVFKPIKRIPKPTQIDFKQVKPKFQAPVLKNATATLSLMFENKPLLQPSNSSTTS
FT                   LATGTVANPSKDVSALSSLYYINKNSEDIKSPAPSIRSVIPISTIGTIDSYRKSAGSPR
FT                   LIRGETMFKRKDEIENSEQPSSLNETKAVSTRKKSSILTEPEQEISTGSLWIEILNPSQ
FT                   ETTTNVLQRSQSSRWSNIFPNKIQRKLIKWRSFQAPASLPTITGVFPSTNQLQTDYTFQ
FT                   IYTVFLNSDNYWELKSTHSLMREMIQLRLMLGFQVCYGERVDKAEAERKPSGNVDAIIK
FT                   YFPDEHNYLGSRIYLGFDDEIHRIFCDYNGNINVQLYRKITDIDEKKITLGQTKLKPYF
FT                   PLIRTRYTDEYTPARIDAIANNPQKFNWNQFDQLLAGFDDAMPEEKKQFHKMKFVVMPT
FT                   EIPKNAYFVSNEKLTPEEIRVEGLRKLIGVIERGKYQHDSSQTKKSRRGSDVIFYTGNL
FT                   YDFLNEEAQNYDITGTQPALMIPESSRFNKTIKLPELAQELQDRNTGLTLVDRTWHFKR
FT                   HLHCFVGSELVSWLVDCFEDIETREEATAYGQNLMNKGLFQHVESRHGLLDGHFFYEFS
FT                   DEYVDKTDREKPSWFGSKRIDGASTPQSNSSPRIAGQNDLQKIISASNLRSETSSTADS
FT                   TGKKRKKFILSRSVKFDVDPLKKSFRPEFVTVHYDRVHNPEHCYHIRLQWLNTTNKFIE
FT                   DTITAWTRLCERHGLKLVETPWNELCSLPKLSPFHSFVDIKLSVNPWTDSDLCDDRILS
FT                   SNRYYYHSYFLKQMGYYLDNRSTSFFSRENIDIGYSWGKPSFRYAQFIHKTGFYIVELR
FT                   DNGDFFLAPNNMHLTRVRSSTTLVGDYENYSKGVLADSQTVMLNFRAACQNKEFLKETF
FT                   TLAKSNWKDDYFSPII"
FT   CDS_pept        complement(564978..566057)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02440"
FT                   /product="homoserine dehydrogenase, putative"
FT                   /EC_number="1.1.1.3"
FT                   /note="Similar to S. cerevisiae HOM6"
FT                   /note="Similar to C. albicans HOM6"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44504"
FT                   /db_xref="GOA:B9W745"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W745"
FT                   /inference="similar to AA sequence:UniProt:P31116"
FT                   /protein_id="CAX44504.1"
FT                   /translation="MSKSVNVAIIGSGVVGSSYLNQLKNLKSNIAFNVIYLAKTSEEAL
FT                   YSKDYKPVDLATYETAPTQPTLSLDDLVQFIKGSKKPSVLVDNTSSPEIANYYPTFIKE
FT                   GISIATPNKKAFSSDLKAWKEILQTTELPGAGLVYHECTVGAALPIISPLKDLIATGDK
FT                   VDKIEGIFSGTLSYIFNEFSKTEKSDVKFSDVVKKAKELGYTEPDPRDDLNGLDVARKV
FT                   TILARISGLEVESPTSFPVESLIPKELEGVESVAEFLEKLPNYDADIQKVKDEAFAENK
FT                   VLRFVGKVDINTNKVSVEIGKYGFDHPFASLKGSDNVVSIKTGRYPNPLIVQGAGAGAE
FT                   ITAHGVLADTIKIAERIAN"
FT   CDS_pept        complement(566419..567855)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02450"
FT                   /product="glucan 1,3-beta-glucosidase 2 precursor,
FT                   putative"
FT                   /product="exo-1,3-beta-glucanase 2, putative"
FT                   /EC_number="3.2.1.58"
FT                   /note="Similar to S. cerevisiae EXG2"
FT                   /note="Similar to C. albicans EXG2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44505"
FT                   /db_xref="GOA:B9W746"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:B9W746"
FT                   /inference="similar to AA sequence:UniProt:P52911"
FT                   /protein_id="CAX44505.1"
FT                   /translation="MLFLIPLAALCCMFVAEVACKQFNSTSNSSSVQSSLTDFQYKGVS
FT                   IGGWLVLEPYITPSLFNATISSDETWNDIPVDEYHFCEKLGAKEAEKRLTDYWESMYNE
FT                   SDFKQIKEAGLNMVRIPIGYWSFEKLEGDPYVSGAQDYLDKAIEWSHANDLKVMIDLHG
FT                   APNTQNGFDNSGLRNLGYPGWQNKTEYVNHTYKVLQQMFQKYGTGKYASDYKDTIIGIE
FT                   VLNEPLNPNLDKLKEFYIESYNDGREIQIINNTIFFQEAFQPIGYWDSFLEKGEIKITE
FT                   TSNGTNHTVTKKANFKNIIIDHHHYEVFTESQVASNVSTHLENIKNYASAIGKEKAKAI
FT                   VGEWSAALTDCAPWLNGIGLGSRYEGTAPYTNDRVGSCAEFNKSPDKWSKQQKKDYRRF
FT                   VEMQLYEYSTNSQGWIFWCWKTEGATEWDFRALVKNGIMPQPLDNYKYVRNGTDTSSAS
FT                   VFALNKMTLLLAYLLAVLVI"
FT   CDS_pept        complement(568361..568876)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02460"
FT                   /product="mitochondrial import receptor subunit, putative"
FT                   /product="outer-membrane translocase subunit, putative"
FT                   /note="Similar to S. cerevisiae TOM20"
FT                   /note="Similar to C. albicans TOM20"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44506"
FT                   /db_xref="GOA:B9W747"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="InterPro:IPR023392"
FT                   /db_xref="UniProtKB/TrEMBL:B9W747"
FT                   /inference="similar to AA sequence:UniProt:P35180"
FT                   /protein_id="CAX44506.1"
FT                   /translation="MNKGLTITAIAAAAIAGYAVYFDYQRRNSAEFRKSLKKREVKQKK
FT                   LKAKKEAESKQNKLEAVKKALLEDLAQHPIPTDLTEREAFFMEQVAVGEQKAKVDAIEA
FT                   AICFYKALAVYPNPTDILGIYQKTVPEEVYELVVMMIAVYPPASVSSILSKGAPTVKDL
FT                   KPTEEDLD"
FT   CDS_pept        569259..569861
FT                   /transl_table=12
FT                   /locus_tag="CD36_02470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44507"
FT                   /db_xref="UniProtKB/TrEMBL:B9W748"
FT                   /inference="similar to AA sequence:UniProt:Q6BN04"
FT                   /protein_id="CAX44507.1"
FT                   /translation="MPDTVEVAEVTPLPDSSYKYPNPLANFTKGIGYPEWHPIDTKKEV
FT                   GQIFRFGFYSTVGAYAWLYFWKRTTFKLELPLSVIGFFSIAKGVQDSVANIREINDCWN
FT                   TFWGLTAANTVVLSAGFRSMPPKHKIITGALGTSIATILDRAYWAQSTSSPRLDAKYEL
FT                   ANTNENLPKQQFWDVWQRRPITQTVEELGVGRGIFKP"
FT   CDS_pept        complement(570061..570879)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02480"
FT                   /product="mitochondrial-genome maintenance, protein"
FT                   /product="mitochondrial nucleoid component, putative"
FT                   /product="repair of oxidative mtDNA damage protein,
FT                   putative"
FT                   /note="Similar to S. cerevisiae MGM101"
FT                   /note="Similar to C. albicans MGM101"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44508"
FT                   /db_xref="GOA:B9W749"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniProtKB/TrEMBL:B9W749"
FT                   /inference="similar to AA sequence:UniProt:O14354"
FT                   /inference="similar to AA sequence:UniProt:P32787"
FT                   /protein_id="CAX44508.1"
FT                   /translation="MFNSIRLGLARNSVIRCYSNTAVNQAKVYSRTYKRAGPVTKSSTT
FT                   STSRSTSTDASPATSSPKESVSDVEPNSEVPAKSNTSYILHDAPLEATSGETINWSDSF
FT                   HGLGSQPFSREIAEILLAPVSEEDIEIKPDGLLYLPEIKYRRVLNRAFGPGGWGLAPRT
FT                   ESLVTSGQISREYGLICHGRLVSIARGEQDYFGGEEKLTTALEGCKSNALMRCCKDLGI
FT                   ASELWDPSFIRRWKKKYCEEIFVEHVNTKKKKKIWKLKSIKTVDYPYRMT"
FT   mobile_element  complement(570958..575791)
FT                   /mobile_element_type="retrotransposon:kappa E, Tcd6, LTR"
FT   CDS_pept        complement(575983..578409)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02490"
FT                   /product="mannosylphosphorylation of N-linked
FT                   oligosaccharides effector, putative"
FT                   /note="Similar to S. cerevisiae MNN4"
FT                   /note="Similar to C. albicans MNN4"
FT                   /note="Similar to Pichia pastoris PNO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44509"
FT                   /db_xref="GOA:B9W750"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:B9W750"
FT                   /inference="similar to AA sequence:UniProt:Q76I27"
FT                   /inference="similar to AA sequence:UniProt:Q8TG35"
FT                   /inference="similar to AA sequence:UniProt:P36044"
FT                   /protein_id="CAX44509.1"
FT                   /translation="MADFRQVRNVFLVVLFFNICYFLKIYRNNKIQTEILNFRHSYYNY
FT                   YNDDQISIGYLKEEDSLPEEQKLLQLLHDVKRNENNTYWLANATMEYPSIMLNAADFLP
FT                   PPATNPQSITWYNNPKLYYEPRLTLAIYLDELKHQLKLHNPHNSKAQDHLIKLPFSWSD
FT                   WVDLTMLNTEIIKPVGLRNNCEWLQKDANKRTRFPDFCKNLVDLSDEEINEIGLSKDQL
FT                   PGFIVKSSPMNKAPHMEVMMQGKSYLYAQQENPLTLVFLTSNGTYEAQVTEKREKLLQT
FT                   DLLQRFLKRRKIDIKQIHGVVPVEFNPQSEFQKLLSTIPPRTLDPSDDLHGISKITSNK
FT                   GDRNILRQLNLDPSTFHYTQQNVEQQIAGYETRLNRIEKAITDELNYDLNVLETNRLTR
FT                   HELNHYRGLKHANSFSVDVEPTYYKLATLKKTQYNLDSGWHYEWRFFNGAMRYLKDDTW
FT                   SYEQMEVREQIILDRLLRNWFKFAEAKGIVSWIAHGPLLSWYWDGLMFPFDIDIDLQMP
FT                   SSELNRLAANYNMTLVIEDLNEGYGKYLIDCSTFIHHRNVAGRDNHIDARFIDVDTGTY
FT                   IDITGMGLNDEKPPSHYDNYIKEKTAANESVELYMDRRKHWLNYEKINPLRYSMLGGVP
FT                   VFVPNDIMSMLNQEYPKGTKSYYYDGYYYVPLLRLWLQESKILAAFKPEQYEAVTDEAR
FT                   QENILELIKTLRHEDAFQLLKSNKDMLTEYYLTQKYTGLHQREKQLMMDEAAERSVLDL
FT                   EHNEQYNRLTSNFYIGPPLRKCLFDFEYYGRFKHMPKQIVPTIVENDQVDKPQVY"
FT   CDS_pept        complement(579253..581784)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02500"
FT                   /product="mannosylphosphorylation of N-linked
FT                   oligosaccharides effector, putative"
FT                   /note="Similar to Pichia pastoris PNO1"
FT                   /note="Similar to S. cerevisiae MNN4"
FT                   /note="Similar to C. albicans MNN44"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44510"
FT                   /db_xref="GOA:B9W751"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:B9W751"
FT                   /inference="similar to AA sequence:UniProt:Q5AI95"
FT                   /inference="similar to AA sequence:UniProt:Q76I27"
FT                   /inference="similar to AA sequence:UniProt:P36044"
FT                   /protein_id="CAX44510.1"
FT                   /translation="MKWLLVARGVSFVMHFKVLQLLVAGIVGFNIYLAATNVVNNDISN
FT                   HETIKLPVQSTQSDVSSLFTTDKSNSNFENKEQISTNSGFILPTLITIPTNNRHKPSSK
FT                   PKYLVPNSPYDKLSFKDKILFKLNEVGFNKDKYQLTSSESMGRHKIEVRVNEFTREMWD
FT                   NNPGIFFDPRFTLSVYLAEIKRQLRENALTRPNHGIVLPFSWTDWVDLTMLNDELMKPE
FT                   GQRMSCEDLKAAHDSSSKYPYYCINNEDIDDQELEIIGLPSTNYVPGYAVRKSPTNKAS
FT                   NVVRMLEGKSHLLTYADIPTKLVFLNKQGGIYMAEINKKQRIIESGLFNNFVKFNYAGS
FT                   GIPETIILDPIKEFETLLEMNEPQKWSGAYDRQNSTCSITSTDYEVPAMVFDYPQNEFL
FT                   DDIRKYGDRLDSLHDLTTNELRFDSHEISNLRLNRNEMRYYESLQYANVRKNMQEPVYF
FT                   RHARLITKIEENKRDSGWNYDWRFFNGALDYLKQGWTEEQLMTRRQIILDRLLRNWTRF
FT                   VNEGGFIWWISQSSLMSWYWNGQLSPFLQKVEIQMPIKDLLRLALTYNQTMVVEDVTEG
FT                   FGKYFVDCSTFVHYRGSAKSGNRIDAKFIDVDTGLSIEIGGVSTSFDAAPERSTNTVTE
FT                   SQQHGQSTQVYNTRHPRFYSSDEISPLRKSMFAGTPVYVPNNISAILNREYHKKLIPFN
FT                   AYSYYFVTQLNLWIHHSKLKMLFEKSENTSLTLENNKINATEFCELTATIDDEQIVELL
FT                   TRHEDILLEYYLTKDLGDLHKKELACLLEHQNEIDNARVCDKMANIRESKHRAVVVSDP
FT                   EYRELVASFSFQTPKRVSLFDYEQLERSEIT"
FT   CDS_pept        585930..587420
FT                   /transl_table=12
FT                   /locus_tag="CD36_02510"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain,
FT                   putative"
FT                   /product="phenylalanine-tRNA ligase alpha chain, putative"
FT                   /EC_number="6.1.1.20"
FT                   /note="Similar to S. cerevisiae FRS2"
FT                   /note="Similar to C. albicans FRS2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44511"
FT                   /db_xref="GOA:B9W752"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR040725"
FT                   /db_xref="UniProtKB/TrEMBL:B9W752"
FT                   /inference="similar to AA sequence:UniProt:P15625"
FT                   /protein_id="CAX44511.1"
FT                   /translation="MSELHLQILKLVDDNNGVIENTLKSPELSKIDVNTLQANLTSLWA
FT                   KEMIVFSKIETDKWILTKEAEQYLKAGATPEVKVVDEVLKALEGLTISQLKEKLGPMGA
FT                   VGQGKAFKNKWLSKDGDKLIAQVDKLPEDVVLNELKTISETGTLNDKKELTELKKRKLI
FT                   TLTKIVGYKIEKGPKFALEIVNLETDITSDMVLNHTWKDAQFKPYNFNSEGVYPNSGAL
FT                   HPLNKVREEFRQIFFSMGFTEMPSNQYVETGFWNFDTLFVPQQHPARDLQDTFYLKDPK
FT                   KAGEPEDKQYWENIKQVHQEGKYGSIGYRYPWKAEESLRMVLRTHTTAISAAMLHKLAQ
FT                   DPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLAGYDITLGDLIGFMEDFFGKMGVDN
FT                   LRFKAAYNPYTEPSLEIFAYHKGLKKWVEIGNSGMFRPEMLESMGLPKNLRVLGWGLSL
FT                   ERPTMIKYGVSNIRELLGHKVSLDFIESNPAARLDELL"
FT   CDS_pept        587676..588857
FT                   /transl_table=12
FT                   /locus_tag="CD36_02520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44512"
FT                   /db_xref="GOA:B9W753"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B9W753"
FT                   /inference="similar to AA sequence:UniProt:Q9UTM0"
FT                   /protein_id="CAX44512.1"
FT                   /translation="MSNQSESAQQTQPEINDTNHSVKLEVPQTTSTEFICRWSDCTENT
FT                   YSNLTSLVNHLNSKHIGQLPPGSNTKYICYWENCTRYGLDQPSRFALISHCRTHTGEKP
FT                   YFCPVPECEKHFTRSDALTKHVKGVHDLHSVKDQLILLKDKSKKGQIDLGVNVEDLCEE
FT                   DYLRIIEQDHEIQKPWWFTNEFLNVLKVGSTEKDKENQDDLIKQIETLPFDMKQFQLAN
FT                   SRYKQFINSSTRANNEIDEEEELDGLVPKSDDNNSVINVVRKQLQHENPNKKYPRIMSN
FT                   PVLERLSNNTKKLAHDYIRHDNNTNDDDIDRISDLETLKTLHDKLANQLNTAYKINKVL
FT                   ANQLTSNIKMKRKLWAYSQLLIDANIQVGLPPEATSIAQRVMQDEYDEQLLRG"
FT   mobile_element  590071..590373
FT                   /mobile_element_type="retrotransposon:solo LTR, vau C"
FT   CDS_pept        594813..595688
FT                   /transl_table=12
FT                   /locus_tag="CD36_02530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44513"
FT                   /db_xref="UniProtKB/TrEMBL:B9W754"
FT                   /inference="similar to AA sequence:UniProt:Q5AI91"
FT                   /protein_id="CAX44513.1"
FT                   /translation="MIHQTSSMTTTAVFEEISTEFDNSLMELLYSTTSEDALPDMIENS
FT                   PTTITIVAIEIPSLFSYSTNEFDSELDYESSDWGDITEPLPQNIPKDESEPITKNPTNV
FT                   LTSPLQAFADFNSGSSTEFVTKQQKFFNYNNTINRSFKNNDYTTNKATTTPKCRISKPC
FT                   EKSPLMKPSVTIASIDTIAKLKSKSKNNYKSSSISKTKVGNPFYKPFISSSSIPSKTAM
FT                   KNAKVVNFRDVNNNTNNTSLNFTDIDNKLTYDLLTETTNCSVPQTVLETQFKNFDDSLI
FT                   FDSFFDINQI"
FT   CDS_pept        complement(596065..596985)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02540"
FT                   /product="NAD-dependent histone deacetylase sirtuin-family
FT                   memeber, putative"
FT                   /product="NAD-dependent histone deacetylase SIR2-like,
FT                   putative"
FT                   /EC_number="3.5.1.-"
FT                   /note="Similar to Homo sapiens SIRT5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44514"
FT                   /db_xref="GOA:B9W755"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B9W755"
FT                   /inference="similar to AA sequence:UniProt:Q9NXA8"
FT                   /protein_id="CAX44514.1"
FT                   /translation="MNKQLKEFQEYLPKCRKIIALVGAGLSVSSGLPTFRGSQGLWKNF
FT                   NMIDLATPDAFYIDPGLVWQFYSWRRYGALRAKPNKGHYALNKLSQKFNSDEYITITQN
FT                   VDGLSSRSGHNLDSLYEIHGSLFDLKCTSFMCNYVDHNNFKQPLTKALEDTEFEYSNLN
FT                   PRKRPLNDNDSNSSVDISLSPQFNQVKTISEKDLPLCPVCHDLLRPGVVWFGESLPLNL
FT                   ITEIDNFVESDPSVDLILVIGTSGTVYPANSYVERVRLKGGKVAIFNTDIEENILNSKV
FT                   KDTWGFKGDAAELLPIALKPLIGDI"
FT   CDS_pept        complement(597284..599668)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02550"
FT                   /product="chromatin structure remodeling complex subunit,
FT                   putative"
FT                   /note="Similar to S. cerevisiae RSC1"
FT                   /note="Similar to C. albicans RSC2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44515"
FT                   /db_xref="GOA:B9W756"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR027180"
FT                   /db_xref="InterPro:IPR035700"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037382"
FT                   /db_xref="UniProtKB/TrEMBL:B9W756"
FT                   /inference="similar to AA sequence:UniProt:Q06488"
FT                   /protein_id="CAX44515.1"
FT                   /translation="MSEREKKKLSTKLQSLFNGIYKIEDNGYLIHPTFQTLPLRSGTDY
FT                   YKVVQNPLSLHAVGRKLKNLKYTDAQEFINDLALISWNARFYNHSKSVIYRQAQILKQY
FT                   ITDVVIPKLKSDKAISNGHSLIYPHIGDLPDDRDSDELSGFSFDKGDSTPGISGTSNAG
FT                   SRRDEFEMSATPQADSMVALSKPLVSTGYTRSSFTTPTRPTRQKHKDNQIESGIRRGRP
FT                   PIIDKPFETRIKLILKGFKKLRDNNGQPLTKHFEKLPEIKTHADYYERIAAPISLNEIR
FT                   IKVRSRKYSSVELFINDLDLMFANAQLYYESDPYSEEFLDSQQFKKEAHLVIQTELSKS
FT                   DKEIILATSSSSDGVLRYPLEVLDIGGYTYKIGNWVLVKNPADPERPIVGQIFRMWSTE
FT                   DGKRYVNMCWYYRPEQTCHAVDRLFFLNEVCKTGQYRDHLVDDIVGPCYVIFLTRYQKG
FT                   DLPEGVIPESAPWFICEFRYNENTHVFNRIRTWKACLPDEVREDPEQPLIPLKETRKLI
FT                   KYESPIKGLLAPDAYKGMDIPDAIPGTANSPPVSGSVYIGAPLPNDDLGQYISSQNVVA
FT                   VPEHDETKSGRRAFLFTPISQLKGGGGSTNTVYATGPAVPHGTISHVPAKPIADIPGLT
FT                   PSVARNTNILMNREEKHQLPGSYKSLQEQIQENQAKKQQEQQLQQLQQQQHQQLYKKTS
FT                   TPTPTSIAPTGTTFHTSMSTYSNLLVGGTLAYGLNENIGELGQFVNKKRKINNGRQDEE
FT                   ILFYRAPPLKLVGNKIITNSNFELGHSATYLAWKLKQNKST"
FT   CDS_pept        600363..601415
FT                   /transl_table=12
FT                   /locus_tag="CD36_02560"
FT                   /product="GAT complex ATPase subunit, involved in
FT                   resistance to heat and metal stress, putative"
FT                   /product="arsenical pump-driving ATPase, putative"
FT                   /product="arsenite-translocating ATPase, putative"
FT                   /product="arsenical resistance ATPase, putative"
FT                   /product="arsenite-transporting ATPase, putative"
FT                   /EC_number="3.6.3.16"
FT                   /note="Similar to S. cerevisiae GET3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44516"
FT                   /db_xref="GOA:B9W757"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027542"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W757"
FT                   /inference="similar to AA sequence:UniProt:Q12154"
FT                   /protein_id="CAX44516.1"
FT                   /translation="MDFDLEPSLEELIKQDTLKWIFVGGKGGVGKTTTSSSIAVQLALQ
FT                   HPNDEFLLISTDPAHNLSDAFCQKFGKDARKVEGLSNLSCMEIDPEAAMSDLQQQAQQY
FT                   NNDPNDPLKSIMNDMTGSIPGIDEALSFMEVLKHIKNQKVNESDDSTDKISYRTIIFDT
FT                   APTGHTLRFLQLPSTLQKLLGKFQQLSGKLGPMMSMLGGGGQGQQDMFAKLNEVQKNVE
FT                   EVNEQFTNPDLTTFVCVCISEFLSLYETERMIQELMSYQMDVNSIVVNQLLFADDDENP
FT                   CKRCVARWKMQKKYLDQMAELYEDYHLVKMPLLGSEIRGVENLKRFSKFLIKPYDPKVD
FT                   RAIITEMKEQ"
FT   CDS_pept        join(601835..601976,602082..602131)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02570"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44517"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniProtKB/TrEMBL:B9W758"
FT                   /inference="similar to AA sequence:UniProt:Q6FL16"
FT                   /inference="similar to AA sequence:UniProt:Q9UTF0"
FT                   /inference="similar to AA sequence:UniProt:Q3E7B7"
FT                   /protein_id="CAX44517.1"
FT                   /translation="MARGNQRELARAKNLKKQQEAQKAQKQGDKNKRMETDAEKMRAKQ
FT                   AAADARKAAEALAKAQKK"
FT   CDS_pept        602403..603212
FT                   /transl_table=12
FT                   /locus_tag="CD36_02580"
FT                   /product="carboxymethylenebutenolidase, putative"
FT                   /product="dienelactone hydrolase, putative"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44518"
FT                   /db_xref="GOA:B9W759"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9W759"
FT                   /inference="similar to AA sequence:UniProt:Q07505"
FT                   /inference="similar to AA sequence:UniProt:Q8ZAL4"
FT                   /protein_id="CAX44518.1"
FT                   /translation="MLIEESFHDVKTADGTTMRIYVYHPKIPNYPKVKFPGVLVYSEIY
FT                   QVTGPVSRFAKDIAGQGFIVACPSSYHNFVGPEPLAYDVEGTDIGNQYKIEKELKSYDE
FT                   DTNLTIEYLLSLPTCNDKLGATGMCLGGHLAYRAALDPRVQATVCFFATDIHSKSLGKG
FT                   KNDDSLERCGEIKGEIILIFGCKDNHVPLEGRDLIRSELRKKNVEMTFIEINDAQHAFV
FT                   RDEFSKGRYDPATTKLCSEWLFELFNRKLKLDYGDHDGKDVVIENVC"
FT   CDS_pept        603483..604535
FT                   /transl_table=12
FT                   /locus_tag="CD36_02590"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit, putative"
FT                   /note="Similar to S. cerevisiae TIF34"
FT                   /note="Similar to C. albicans TIF34"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44519"
FT                   /db_xref="GOA:B9W760"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W760"
FT                   /inference="similar to AA sequence:UniProt:P40217"
FT                   /protein_id="CAX44519.1"
FT                   /translation="MRPIKLMGHERSLTQVKYNREGDLLFSVAKDNAASIWYSSNGERL
FT                   GTLEGHQGVIWSIDVDPETHLCATGGGDLAIKLWKVENGQCVYTWDAPSPVRRVAFSPD
FT                   GKKLLAIADQVMGHIGTVSVFDINDDDATISQQNPEPSLVIETEPEGSKATVAGWSGDG
FT                   DYIIVGHDNGYVSKYDAKTGKLVTSLQAHGIHNEEKNVSITDIQFAPEDRSYFITSSKD
FT                   KTATLIDVDTFEILKVYKADAPMNTAAITPVKDFVILGGGQEARNVTTTAESQGKFEAR
FT                   FYHKIFEEEIGRVKGHFGPLNTVAVHPDGTGYSSGGEDGFIRVHTFDKSYQDFLFDAER
FT                   TERAAAAGTI"
FT   CDS_pept        604950..605531
FT                   /transl_table=12
FT                   /locus_tag="CD36_02600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44520"
FT                   /db_xref="UniProtKB/TrEMBL:B9W761"
FT                   /inference="similar to AA sequence:UniProt:Q5AI85"
FT                   /inference="similar to AA sequence:UniProt:Q5AJ15"
FT                   /protein_id="CAX44520.1"
FT                   /translation="MVNLFNNSNNAYDAVFNNIGTFAQNSPRGNNRNSNRNGVKVKELN
FT                   KNNQHEIQVFNRNGYQNFKIEIVRQGDHLYLQIQSQVDRFERYFKLNTATEDINNVKSY
FT                   IENDWLIVVIPFINKGSKSPPPKNVPEHPSKKQNKQQKQQKQQKPQKESKSAKNKKVFE
FT                   KKKTDNNHPPSLLDAARRKPFLEEVPDPGI"
FT   CDS_pept        606346..608886
FT                   /transl_table=12
FT                   /locus_tag="CD36_02610"
FT                   /product="RAD family ATP-dependent helicase, putative"
FT                   /product="DNA repair protein RAD16-homologue, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to S. cerevisiae RAD16"
FT                   /note="Similar to C. albicans RAD16"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44521"
FT                   /db_xref="GOA:B9W762"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B9W762"
FT                   /inference="similar to AA sequence:UniProt:P31244"
FT                   /protein_id="CAX44521.1"
FT                   /translation="MAPSRNNLAENESSSDSETSNIGGGFIIDDISETRAKRPRRAAAN
FT                   SSYAELSDDQESDSIDSDTFANVSAPVKKRKTRASTRVQSKEKKKKKKKKIAKRSPSPD
FT                   DDEDQEFTLSLDDEKESDATDDEVEYIGSNKIEQNGSSTTSAIDLDDDLDIDNDPEENM
FT                   PLASRKAPKKRGKGGKRTKKEPKPKMSYYERTTNRLFENHPNLKEVFPYLKNTPKITPE
FT                   RAEHPPGMTIKLLPFQLEGLNWLIKQEDGEFNGGILADEMGMGKTIQTIGLFMHDRSKG
FT                   PNLVVGPTVALMQWKNEIEKHTEPGMLKVLLYHGANRSNSIEELSQYDVILTSYSVLES
FT                   VYRKQNYGFRRKNGLVKEKSAIHNIEFYRVILDEAHNIKDRNSNTSRAAGKLNTKKRWC
FT                   LTGTPLQNRIGEMYSLIRYMKLDPFHSYFCTKCDCKSEDWKFSDGRRCDFCQHPPMLHT
FT                   NFFNHFMLKNIQKYGIAGLGLEGFNNLRSLLDHIMLRRTKIERADDLGLPPRVVEIRRD
FT                   YFNEEEKDLYQSLYSDSKRKFNDYVAEGVVLNNYANIFTLITRMRQLADHPDLVLKRIG
FT                   SNAISNEIDGVIMCQLCDDEAEEPIESKCHHRFCRMCIQEYMESFMGASNKLECPVCHI
FT                   GLSIDLEQPAIEVDEELFTKASIVNRIKSGSHGGEWRSSTKIEALVEELYKLRSDRHTI
FT                   KSIVFSQFTSMLDLIEWRLKRAGFNTVKLSGSMSPQQRDNTIKHFMENTEVEVFLVSLK
FT                   AGGVALNLCEASQVFLMDPWWNPSVEWQSMDRVHRIGQKRPIRITRFCIEDSIESKIIE
FT                   LQEKKANMIHATINNDDAAINRLTPDDLQFLFMN"
FT   CDS_pept        609309..613523
FT                   /transl_table=12
FT                   /locus_tag="CD36_02620"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase large
FT                   subunit, putative"
FT                   /product="alpha-aminoadipate reductase, putative"
FT                   /EC_number="1.2.1.31"
FT                   /note="Similar to C. albicans LYS2"
FT                   /note="Similar to S. cerevisiae LYS2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44522"
FT                   /db_xref="GOA:B9W763"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014397"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9W763"
FT                   /inference="similar to AA sequence:UniProt:Q12572"
FT                   /inference="similar to AA sequence:UniProt:P40976"
FT                   /inference="similar to AA sequence:UniProt:P07702"
FT                   /protein_id="CAX44522.1"
FT                   /translation="MTDFWLNYLDNPTLSVLPHDFLKPANNKSVEGTYAFNIDNNNADF
FT                   KFGLAVFAALVYRLTGDEDIVIATDESANTPEFIVRLNLTPELTFQELVHKITKEYENN
FT                   ISEINYKSLAEVSHRIKEAKRLDENPGLFRLSYQHAHSNQQLNTTVEGSIRDLAIYTDG
FT                   TKFTIYYNALLYSHERIVIFGEQFAQYLSTVSKDTNTVITKVNLITESQKKNLPDPTID
FT                   LDWSGYRGAIQDIFMDNANKHPDRTCVVETESFMDSNSKTRSFTYQQINQASNVVGNYL
FT                   KETGIKKGDIVMIYAYRGVDLMIAVMGVLKAGATFSVIDPAYPPARQNIYLSVAKPKGL
FT                   IGLEKAGTLDQLVVDYINNELDVISTIPQLKVQDNGILVGGKIEGADNDCLDDYQKFKD
FT                   HPTGVIVGPDSNPTLSFTSGSEGIPKGVLGRHYSLAYYFPWMAKRFGLSDKDKFTMLSG
FT                   IAHDPIQRDMFTPLFLGAQLLVPTADDIGTPGKLADWMAKYGATVTHLTPAMGQLLSAQ
FT                   ATTAIPSLHHAFFVGDILTKRDCLRLQSLAENVFIVNMYGTTETQRSVSYFEIKSRKAD
FT                   PTYLKNLKDVMPAGTGMQNVQLLVVNRNDRSQTCGVGEVGEIYVRAAGLAEGYRGLPDL
FT                   NAAKFITNWYVNPEKWIEQDEANKKPNETWRQHGWLKPRDRMYRSGDLGRYLPDGNVEC
FT                   CGRADDQVKIRGFRIELGEIDTHLSQHPLVRENVTLVRRDKNEEPTLISYIVPKDSPEL
FT                   KTFKADVDDSIEEANDPIVKGLVAYRELIKDIKGYLKKKLASYAIPTIIVPLVKLPLNP
FT                   NGKVDKPKLPFPDTAQLAAVAKLSVSGHDAKVAEEENLTKLEEQIRDLWLDVLPNRPAT
FT                   ISKDDSFFDLGGHSILGTRMIFELRKKLNVEIPLGVIFKNPTVEQFAKEVEKIIKGGQD
FT                   FQLADEGKTIQEEKKDVADSQNENLNYAEDAKELSKSALLESYSSLKQLPTGSINVFVT
FT                   GATGFLGSFIVRDLLTARSKNLDIKVYAHVRASSKEAGLQRLRQTGTTYGIWDENWTEK
FT                   IEIVLGDLSKEKFGLDNSQWSDLTNSIDVIIHNGAFVHWVYPYSQLRDANVIGTINVLN
FT                   MAGEGKAKFFSFVSSTSALDTDYFVNLSDELLAQGKNGISEADDLQGSARGLGNGYGQS
FT                   KWAAEYIIRRAGERGLKGCITRPGYVTGFSKTGASNTDDFLLRMLKGSAELGLYPDITN
FT                   NVNMVPVDHVARVVTATALNPPSSEQLTVAHVTGHPRIQFNDFLGCLKAYGYDINPADY
FT                   PVWTSALEKFVVEESKESALFPLLHFVLDNLPQDTKAPELDDSNAAKSLKQDSKYTGED
FT                   LSGGKGVDLDQTGVYISYLIKIGFLPKPTGTGDKKLPEVEISDESLKLISGGAGARGSA
FT                   AK"
FT   CDS_pept        614110..615873
FT                   /transl_table=12
FT                   /locus_tag="CD36_02630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44523"
FT                   /db_xref="GOA:B9W764"
FT                   /db_xref="UniProtKB/TrEMBL:B9W764"
FT                   /inference="similar to AA sequence:UniProt:Q5AJ12"
FT                   /inference="similar to AA sequence:UniProt:Q5AI82"
FT                   /protein_id="CAX44523.1"
FT                   /translation="MFSPHLPSLSSQHEKLRKISLEEEEGEEELTTYDEFEHNKKPETS
FT                   FSLRQQYELDNKNSLLDREKHMHVLSSLSGDNFLRRQLDYEEDYGNNSNTEQDEMVTQY
FT                   SNNNNNNNTVDSSKNILSNRKLYDDISQCNQPKSDSTDSLCLEVNNNNKKNNGHFLSGT
FT                   STPPDTMYNYNGLPTVYSSLENNNNKLPRKQFNLHSQQVPPQLQVQLTQSHNLQRSLLA
FT                   NSSATNLNAYLRGNRRYSSSGNSNPINDLLTSPKFIKSNRFNSPIPPSTPTTTAQTSPI
FT                   TNGNPTIDQKNRLVDQFYNSGRITSPGSRVDLSNMHKETSLISPTQQSFSKVSTPKSER
FT                   KFNWKEDSLEPRDDLTDFSPTPPLEKNHNLNDEIMDDILNKGGFKFKYDANQLVQDKEL
FT                   VNYLLNIDNILDHNENTHDMKNRKDTSLSELNKAMSNLYDTTLLKSKKILIPHKNDHFD
FT                   SLTELNHLKRYLEELHNSIDSLGRSLGANRNKVRESYKDKIDDNIARLNLVSKELETLE
FT                   TKANLFRDKISQQKSNTTNQMMETITILTDVNNKMKKYSIIKRNRIIVEVNVVLGLLVL
FT                   IVSIYYGYKNK"
FT   CDS_pept        618537..620222
FT                   /transl_table=12
FT                   /locus_tag="CD36_02640"
FT                   /product="high-affinity cAMP phosphodiesterase, putative"
FT                   /product="3',5'-cyclic-nucleotide phosphodiesterase 2,
FT                   putative"
FT                   /EC_number="3.1.4.17"
FT                   /note="Similar to S. cerevisiae PDE2"
FT                   /note="Similar to C. albicans PDE2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44524"
FT                   /db_xref="GOA:B9W765"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:B9W765"
FT                   /inference="similar to AA sequence:UniProt:P06776"
FT                   /inference="similar to AA sequence:UniProt:Q8NJP9"
FT                   /protein_id="CAX44524.1"
FT                   /translation="MAEVLSLVDLEIPRVTDKYYKFDTFKHLICYLFKKTSTETDSNVP
FT                   IVIIFPTNNDSSTKKTRSTNNNKLDNLPFSDKLLLIQFFFTHLNILTIQGESSDEEKLY
FT                   QEIRDAKELLTNRISRVGNWTGTTHFRYCRHDNDCGLLNQHSKIAGIIPTMTYILNCNA
FT                   TRSDIATKQLIYLYQLMIDEINFIDLLQDASTTRLSQLCYAVGHWSFPAHNLSNDDLVY
FT                   CVYLMIDYAIKQIEGFDNIPLNELLAFIFIVRDTYKNGNPFHNFRHAVDVLQACFHFLI
FT                   RLGSLPKFKQFVEDPKLDFKEAHDEHTVLISSQRNSTEEEASLNPIQTLGLLVAALGHD
FT                   VGHPGTTNDFMIKFSAPTALLYNDRSVLESYHASLFINKVLRICWPDLLTCTIEEKSEL
FT                   TIRSLIISSILATDMGEHNEYVNRLKSFKTHNEILNHDNTVKLISALLIKCADISNVTR
FT                   PLRVSAQWAMVLSREFAEVELLKSVIKKDIDLDFTKDLTYDHVPCELHEILEIQPDIHK
FT                   GQIFFINLFAENLFNNVSDLLPQLQYTCDIILENKLFWLNRAKK"
FT   CDS_pept        621134..623185
FT                   /transl_table=12
FT                   /locus_tag="CD36_02650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44525"
FT                   /db_xref="GOA:B9W766"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR037635"
FT                   /db_xref="UniProtKB/TrEMBL:B9W766"
FT                   /inference="similar to AA sequence:UniProt:Q08831"
FT                   /protein_id="CAX44525.1"
FT                   /translation="MEQSQGNIANSPPTSEIPQRPIILSPPPLDQNSFNQSLNDLSISV
FT                   PQGHANRQQSVGYNLQHEFETLTANLDLDLTSSMRNITQSAPPNQQQQAQLQSHTHTNS
FT                   QLLTTTDSNTKPAHSVKPTLVAPAASRYSSNLGSDLLGKSTSSLLGDNNPVSPIQKFSS
FT                   INTQLDSLLNNNISGTKSKTGTNSPFLSNTGLSNRPQSVNDFTSIFNRQDQQPQQSFSS
FT                   FTAQQQQNQNQNQNQKQNQSNFYSDLIVFSNWIENLNPQDNLTMIDYLCSNLPLDILLT
FT                   FKSKLDLHLQGGSAQKQQQQQQQQQQQQQLLPQFVMSPYSQYDQQLYGDMDKLNIQDDN
FT                   FKSKHGNSSFRTNQLANLIDKVERPKSADPFVNNNKHGQYQHQTYNQNLYQQQQQQQNS
FT                   LVDRAKSPTSHLYEKTNFLQLAAANSNNVGGNYNQYMSSLSSSLGQTNPNNTSTRDDMD
FT                   LKLGALATINSRVALDSNRKHPHIATPGSTWNNQNHSHSQISPPHHQMHSSVRNVSNFE
FT                   ESINRSLNSSSVPASMHKANYSSSHSNNNNNNNNNNNGNVNSNQSKGNHKKKINSPTSA
FT                   VSMQQNPTSVNSTTGGNSGANGNTTTTSSSSSSMPIEVSSLELLNNIPAWLKLLRLHKY
FT                   TECLKDIPWKELIELDNDQLESKGVAALGARRKLLKAFDVVKNNLPVV"
FT   CDS_pept        complement(623610..624212)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02660"
FT                   /product="synaptobrevin homologue, putative"
FT                   /product="vesicle membrane protein (v-SNARE) with
FT                   acyltransferase activity involved in trafficking to and
FT                   within the Golgi, endocytic trafficking to the vacuole, and
FT                   vacuolar fusion, putative"
FT                   /note="Similar to S. cerevisiae YKT6"
FT                   /note="Similar to C. albicans YKT6"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44526"
FT                   /db_xref="GOA:B9W767"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B9W767"
FT                   /protein_id="CAX44526.1"
FT                   /translation="MKIYYIGILRSTGDKAVELTSARDLSQFSFFERNGVSQFMTFFAE
FT                   TVSQRTQPGQRQSVEEGNYIGHTYTRSEGISGIIITDKDYPVRPAYSLINKILEEYLSL
FT                   HPKSDWENIDKTNETLQYGQLEAYLKKYQDPTQADSIMKVQQELDDTKVVLHKTIEGVL
FT                   QRGEKLDSLVDKSEALSSSSRMFYKQAKKTNSCCVIM"
FT   CDS_pept        625218..626087
FT                   /transl_table=12
FT                   /locus_tag="CD36_02670"
FT                   /product="Rab-family GTP-binding protein, putative"
FT                   /note="Similar to S. cerevisiae YPT7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44527"
FT                   /db_xref="GOA:B9W768"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W768"
FT                   /inference="similar to AA sequence:UniProt:P32939"
FT                   /protein_id="CAX44527.1"
FT                   /translation="MSKHRLINNNKNNTNGITQPSLNPVSMENSSSSNPKIGPTPTLKV
FT                   VLLGDSGVGKTCLRSQFVHHVFTNAYKATIGGDYLTTSVILPQQIQQSQLSSSTSSVDT
FT                   KSNFATARLPNTSTKVNLQIWDTAGQERFNSISQAFYRGTDVCVLVYDVTDYESVLSIR
FT                   DWFNRFMEHCHVEFPGIVIVGNKSDKSNDRCVDLNEIKDIVTTNTTFANLGDYIDDWDN
FT                   SLMEISAKRLELVEELFLRVARIGVDLLMGNKGDNKRRLQQFDKIDLRETHNRMDSNAT
FT                   SSSSSCAC"
FT   CDS_pept        complement(626278..627039)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02680"
FT                   /product="mitochondrial protein, involved in the import and
FT                   assembly of intermembrane space proteins, putative"
FT                   /note="Similar to S. cerevisiae MIA40"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44528"
FT                   /db_xref="GOA:B9W769"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="InterPro:IPR039289"
FT                   /db_xref="UniProtKB/TrEMBL:B9W769"
FT                   /inference="similar to AA sequence:UniProt:P36046"
FT                   /inference="similar to AA sequence:UniProt:P87059"
FT                   /protein_id="CAX44528.1"
FT                   /translation="MYRAISRSSSGLIRQATTRVTRQLSTTRTRPSNHTSRLLLGVVGT
FT                   GALAFGYFSQQSSLIQNASTADNIEKAFQEGDAVAKEAQESLDSRQEKVVTENEEKTKK
FT                   AKDTKSSESKTSVDDKKANSQSDGQPEGEGEGKQEAAFNPDTGEINWDCPCLGGMAHGP
FT                   CGEEFKEAFSCFVFSETEPKGIDCIKKFENMRSCFKRYPEHYKDELYDDGEEEASTEVV
FT                   EHVVLETTEPAIEQIEQGINEDKIKPNTKSD"
FT   CDS_pept        complement(627715..628089)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44529"
FT                   /db_xref="GOA:B9W770"
FT                   /db_xref="UniProtKB/TrEMBL:B9W770"
FT                   /inference="similar to AA sequence:UniProt:Q6BSK7"
FT                   /protein_id="CAX44529.1"
FT                   /translation="MLRTVLGTSKHSRAFRRAMALELRPLRSYSVEQPPPQPITETKFA
FT                   AVKEYMKRVQTEDTHESEKVLKLFRKMGAISIVVVLASIGYAAYDQSYNGNTQIVEEQQ
FT                   VIKLPDLTQDIRYQKRGDEK"
FT   CDS_pept        complement(628342..630498)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02700"
FT                   /product="spliceosome (dis)assembly complex subunit,
FT                   putative"
FT                   /note="Similar to S. cerevisiae NTR1"
FT                   /note="Similar to C. albicans TIF39"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44530"
FT                   /db_xref="GOA:B9W771"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:B9W771"
FT                   /inference="similar to AA sequence:UniProt:Q06411"
FT                   /inference="similar to AA sequence:UniProt:Q9UTK6"
FT                   /protein_id="CAX44530.1"
FT                   /translation="MPGNVQNTGLLFKKSDTTSESDIQTTMSRGSMMMAAIHDEYSDLE
FT                   EEEEENQKPIDQPLYGEELNSDRSDNFQKYGIGAKLLMKMGYQKGKGLGVNQEGIINPI
FT                   ETKLRPKGLGVGAVKEKVQSNYSDSDEDELGIDFKNKSVKVTASSLSDKLYDTIMKFEK
FT                   LNINLPSHIRIFLDQRLSLSDELFISKAEAVLASLNDIYGEVTKIIDRENIVEYSIGEL
FT                   EKANESTTIENLQKIKQILKNASSNEITSEEASKALLTNFPSEASAALAYLSLKRDQLE
FT                   RLTDASFFDLSYQKEKAIPTLHSIRNEFSQFGAESSTAHLDKYLYNKYSKIIKKILYYD
FT                   SVDEEEEDKHKDISNHEVLLSVLSSWASNPIFVFQEKRMTQLATNIIVPYLRSEFNIID
FT                   NENRSICNLPEYLLDFIAIFCNDELGIFEQVFLEYVDRYQNFLDFEVHGSLWDFSTSKR
FT                   QMEQAISIINEFNNNWAPTVTKFLPRKVETFYNTFFRSFTKWLEVLSFDGANDIARIDN
FT                   AFLLFKYVEGKDLLFLLQFRIFNPWLQRLLQTFVNEPQSVPKWYSFWYSYFANKLQECN
FT                   NVTSETINWYLNKALDMIEAKFDSAVCESVPKLNGSMLPDCEVLISNSRNVKVNVNGIP
FT                   SYQLSTSFKDVVAQFCLQNNILMKPLKNELSLQKGFPVYQFNQNDLSNKKIYGYIDDDV
FT                   LWVGKVDDEEFVPINLENLTSCIQ"
FT   CDS_pept        complement(630731..632161)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44531"
FT                   /db_xref="GOA:B9W772"
FT                   /db_xref="InterPro:IPR007240"
FT                   /db_xref="UniProtKB/TrEMBL:B9W772"
FT                   /inference="similar to AA sequence:UniProt:Q6BSK5"
FT                   /protein_id="CAX44531.1"
FT                   /translation="MTNEQGLTAVTQEEVIKWSREAQSTLEKTQKICTDAQSSMQKTAQ
FT                   ELTILIPDKLQAIEFLFKSYTEQYDSILKQIETTKKYLYANIDKVFNDIKDLLDPSLAR
FT                   LDKILLELKKTQVPSIVVEGTSGNKTLFDFTSIQSINLLKKNIGIFKSNCGKIKNLIDD
FT                   EVKEKLNIEQDRMTSRWNKLVKMYDLITPLQMELRALTHGASNESNSFMGTILRENQAL
FT                   ENELVSILEMQTNHFDQCMKAVELVSSGNGCDMNLDVLKNDAQELPEVFKELTTIYDII
FT                   LRNEERSKKFLSTHMLNIENISDIVKEELTVFRKFKTEEIPKYIFLIAECENKLKECSM
FT                   PVKSNQSPSEVYAHTLQELTEHYVKFINIYKTKYLAELHHQQFTYPRKFLRKLTEFLNE
FT                   DIYRIQIEESERRRQWTSRYGDFIPSEFKLPGEHELPVIVQIITEGLEYIQKEDGQEEE
FT                   PNIGNEKELMDMIRGSRN"
FT   CDS_pept        632447..633559
FT                   /transl_table=12
FT                   /locus_tag="CD36_02720"
FT                   /product="RNA polymerase II elongation accessory factor,
FT                   CDC73 family, putative"
FT                   /note="Similar to S. cerevisiae CDC73"
FT                   /note="Similar to C. albicans CDC73"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44532"
FT                   /db_xref="GOA:B9W773"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="InterPro:IPR031336"
FT                   /db_xref="InterPro:IPR038103"
FT                   /db_xref="UniProtKB/TrEMBL:B9W773"
FT                   /inference="similar to AA sequence:UniProt:Q9UUE7"
FT                   /inference="similar to AA sequence:UniProt:Q06697"
FT                   /protein_id="CAX44532.1"
FT                   /translation="MSSSSPLKAFRKAVIKEEKIEFFKNGEKTDSINDATEVQFGTDKN
FT                   KYSLDMVTNFYNDEKLTEAQSLRSVVFCYLHEKDSITDYKVAGENLNIPVFSFLVKTEL
FT                   STWLHGNSDSCMFIKREAEDKTSKSVKSTDSSSQVTSKKHKLDDPQLERISKFERESVD
FT                   HNAALRGTKNIDFGYLVSDAKKFMHELKRTKHMPGTNTHGNRGPKKQPIILVSPATTAL
FT                   LSLSNIKGFLEDGVFTEPVPGNRPNGGLVIVNHPSDKLISTGQKIMVVDNIENFNKMEY
FT                   WDRVIAIFTTGQTWQFSRYIHPEPEVLFQKYRGFYFGYQGEIAPPQIKDWNVSEIRVDR
FT                   DKRFKDKVIVRDFWAEIERILVNKGYGKSY"
FT   CDS_pept        complement(633609..634976)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02730"
FT                   /product="threonyl-trna synthetase, mitochondrial
FT                   precursor, putative"
FT                   /EC_number="6.1.1.3"
FT                   /note="Similar to S. cerevisiae MST1"
FT                   /note="Similar to C. albicans MST1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44533"
FT                   /db_xref="GOA:B9W774"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B9W774"
FT                   /inference="similar to AA sequence:UniProt:O13969"
FT                   /inference="similar to AA sequence:UniProt:P07236"
FT                   /protein_id="CAX44533.1"
FT                   /translation="MLIPRRGPRLLSQGIYRFLSTKTKEAESSTQSNHVISSKQLLYTT
FT                   DPTSPGSIFFLPHGTRILNKLIQFMKNQQTKYGFQEVVTPLIFKTKLWKKSGHWDNYKD
FT                   DMFKVVGNDITKEEHTDNIEEHEYGLKPMNCPSHCMIFAKFDRSYQELPVRYSDFSSLH
FT                   RNEASGALSGLTRVRRFHQDDGHIFCSMDQIDGEIKNTLDLIKDTYNVFGINEIEFYLS
FT                   TRPEDKFIGNIDTWDIAELQLKNVLNATAGEGNWSIREGDGAFYGPKIDVLLKDAFNKK
FT                   HQVGTIQLDFQLPNRFELKYVGEDGKRDHQPILVHRAVFGSLERFFAILLDHYQGKWPF
FT                   WINPRQALIVPINESHVPVAEELQKKLSGDIISCDKSIAPLTGFNFHVDVDKRGETVGA
FT                   RTKDAIQKGYSYLIMIGDKDIANGTFAVRSRDDRKIRNMTSDDIYKMFIALEQSYK"
FT   CDS_pept        complement(635214..635720)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44534"
FT                   /db_xref="GOA:B9W775"
FT                   /db_xref="InterPro:IPR013175"
FT                   /db_xref="UniProtKB/TrEMBL:B9W775"
FT                   /inference="similar to AA sequence:UniProt:Q6BSK2"
FT                   /protein_id="CAX44534.1"
FT                   /translation="MAPPKRFWARLKLSPKFLGTLPEFPAYISKSRLKKLAQEERRSGT
FT                   TSMNTSQRSSPAPEGGASTTGTTISNYKVNVGLKEGSTSGLTINSITSGQYSLDKSGRP
FT                   AKRWVKKPRSFKTFTGFKVTCVTYKPEHSAETKETQKIEQKELISNSSTNGTTTPGNTS
FT                   ATNSK"
FT   CDS_pept        635967..636347
FT                   /transl_table=12
FT                   /locus_tag="CD36_02750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44535"
FT                   /db_xref="GOA:B9W776"
FT                   /db_xref="UniProtKB/TrEMBL:B9W776"
FT                   /inference="similar to AA sequence:UniProt:Q6BSK1"
FT                   /protein_id="CAX44535.1"
FT                   /translation="MTEPAPFIRNRLPSRMDLFATNLKQDIRAHQRTYEGAYTRTAIGC
FT                   LSFSILIIKLFSKEFLPIGTIYTIYGCLLYFLGVFKSSRVDVYYNPDKDMEMFTTSGDF
FT                   VLFLTILSLCCYIALLVLLLRM"
FT   CDS_pept        complement(636441..638228)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02760"
FT                   /product="mitochondrial distribution and morphology factor,
FT                   mitochondrial precursor, putative"
FT                   /note="Similar to S. cerevisiae MDM31"
FT                   /note="Similar to C. albicans MDM31"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44536"
FT                   /db_xref="GOA:B9W777"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniProtKB/TrEMBL:B9W777"
FT                   /inference="similar to AA sequence:UniProt:P38880"
FT                   /protein_id="CAX44536.1"
FT                   /translation="MSLRNLLGLSKRLNRQTLLFSKIQQKSSIGPTVISAIQPHRRFSP
FT                   SLIASHRKQANQFDKQQKPILKEQLGDSIKHETELIPTKEQLLAKANSMYSRLKIRLKW
FT                   LLKKSNRPFNTDDYSAFFSWLVVGNVFLFFVATTTFVSIVIFTANTMFAQEFVARKLGE
FT                   FITKNSNLTVTFENAIVPGWSDGKISFRKCFVSRRPKRVEKFIKGSQQEAYEESLQNEG
FT                   TNEDEEDIFEDDGNYTQFDLTIEEVNISLSLNKWVNGTGMIETLELKGMRGVVDRTHVH
FT                   WKPDDDATNYKNIHQPGDFEFESFKMEDVLFTLMQPNGFRKFNVAIYNCELSKLRKHWL
FT                   FYDFLNANVMSGAYDNSLFTIHKKQRLNDFDEYASANGNLQKWKRVTRMRVDSLSIDHL
FT                   NTGLEGPFGWITSGRVDMIGDVMVPQENNEMNVSELVSMITDAIKKEASRYKNPEVQEK
FT                   HPNLRTRLTADDYRDISKYFVLDLTLRLNNVRAKVPFKSPELSYINYALIRPIVAYINS
FT                   KNNFIEIHNRIVKNLQDFSGSWTIYDSLLMDDISEEVYDNFAEYVADEEARLIRLKRIG
FT                   FWSLQLLVQLVLFGVGAVA"
FT   CDS_pept        638874..640139
FT                   /transl_table=12
FT                   /locus_tag="CD36_02770"
FT                   /product="peptide epimerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44537"
FT                   /db_xref="GOA:B9W778"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9W778"
FT                   /inference="similar to AA sequence:UniProt:O94431"
FT                   /protein_id="CAX44537.1"
FT                   /translation="MSVPIVPFGKQFRAKYFTNMDDDVFPINHGSYGLTPTPVHKKYLE
FT                   LIVQNASYTDKFMKYDIKDIYIESLKALAKVLKCDYHHLAFVDNATSGVNTILRSYPFK
FT                   KGDKLVIQSTVYGACGNTVKFLHDRYGVEFIVVNLNYPITDEEILSKFERMFVEEKPKL
FT                   CLFDTISSMPGVVFPHERLAKLCNKYSVLSLIDGAHGIGCIPQDLGDLKPDFYVTNLHK
FT                   WFYVPFGCAVLYIDPKHHNVVHTLPISHSYLEDHVKLSDKDQKNRLIDRFFFYGTKNYA
FT                   SIQVIPEAIKFRTEVCGGETKIYDYCHGLAKQVGELVSRKWGTSYLDQKGSTLISTMVT
FT                   VEVPTKDYPEIVKNWSVIDDHVYNKMFDRKAYTPCIAHNGKLFARFSCQVYNELSDYDY
FT                   ASDVVIQTLREVASEQYKKYKL"
FT   CDS_pept        640547..641575
FT                   /transl_table=12
FT                   /locus_tag="CD36_02780"
FT                   /product="glyoxylate reductase, putative"
FT                   /product="hydroxyisocaproate dehydrogenase, putative"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44538"
FT                   /db_xref="GOA:B9W779"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W779"
FT                   /inference="similar to AA sequence:UniProt:P53839"
FT                   /inference="similar to AA sequence:UniProt:Q9C4M5"
FT                   /protein_id="CAX44538.1"
FT                   /translation="MTTGTSKPKVLLVGEFIYSKQKWSELEGIAKVVQCESTTREQFIQ
FT                   DLQTKYNDITSIARTFYSVNETGRFDADLAQHMPKTLKSISHCGAGYDQVDVEPFTRLR
FT                   VQVSNVTEPVERPTADVAVFLVLACMRNFLQGRQILMNGEWPLNGDQEAGGAPLGHTPQ
FT                   GKVVGILGMGGIGRAIRDRLKPFGFDRIVYYNRKQLSPELEKGAEYVTMDELFKQSDVI
FT                   IIGVPLNAKTRHLINKDAIQKMKDGVVLVNIARGAIIDEKQLPGLIKSGKIGAFGADVF
FT                   EHEPEVSSELVNLPNVIALPHMGTHSVEALTNMEEWVVSNVETFIKTGKLKTIVPEQQG
FT                   IF"
FT   CDS_pept        complement(642668..643984)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02790"
FT                   /product="glucan 1,3-beta-glucosidase I/II precursor,
FT                   putative"
FT                   /product="exo-1,3-beta-glucanase I/II, putative"
FT                   /EC_number="3.2.1.58"
FT                   /note="Similar to S. cerevisiae EXG1"
FT                   /note="Similar to C. albicans XOG1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44539"
FT                   /db_xref="GOA:B9W780"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:B9W780"
FT                   /inference="similar to AA sequence:UniProt:P29717"
FT                   /inference="similar to AA sequence:UniProt:P23776"
FT                   /protein_id="CAX44539.1"
FT                   /translation="MQLSFILTSSVFILLLEFVKASVISNPFKPNGNLKFKRGGGHNVA
FT                   WDYDKDVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKDAAQSI
FT                   LQQHWSTWITEQDFKQISDLGLNFVRIPIGYWAFQLLDNDPYVQGQVEYLEKALGWARN
FT                   HNIKVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTKVTLNVLNTIFKKYGGNNYSDVV
FT                   IGIELLNEPLGPVLNMDNLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWDQFLTVAE
FT                   GQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAK
FT                   WLNGVNRGARYEGAYDNAPYIGSCQPFLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWV
FT                   FWSWKTESAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH"
FT   CDS_pept        648482..650242
FT                   /transl_table=12
FT                   /locus_tag="CD36_02800"
FT                   /product="major-facilitator-like ion transporter, putative"
FT                   /note="Similar to S. cerevisiae HOL1"
FT                   /note="Similar to C. albicans HOL"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44540"
FT                   /db_xref="GOA:B9W781"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W781"
FT                   /inference="similar to AA sequence:UniProt:O94019"
FT                   /inference="similar to AA sequence:UniProt:O94343"
FT                   /inference="similar to AA sequence:UniProt:P53389"
FT                   /protein_id="CAX44540.1"
FT                   /translation="MTDLDFVVSPVQTKVEINDSHNEDFIPGTLNIYSLEVDSEEENVY
FT                   HCDAASRPKVKTRGNIILFPQPSNSCNDPLNWSKWRKLSNFIIVIFITAFTAATSNDAG
FT                   SIQDSLNEKYGISYDAMNTGAGVLFLGIGWGTFFLTPASSLYGRKITYFICIFLGLLGA
FT                   VWFALVKSTSDSIWSQLFVGISESCAEAQVQLSLSELYFAHNLGSVLTSYIVATSVGTY
FT                   LGPLIAAFIVQNIGFRWVGWIAAIISGALLLVIVFCLDETYFDRAKFTKPFITGISPFD
FT                   SNYSKDKSDSKNSIPEKQNDFNIESNVKSKEVEQSDDDLVNEGENDPPISYWKRTAMIT
FT                   PATNLKGTGFKQYMNQLRLLLKVFLYPPVIYSGFCWGIQNALLTFYLTVEDDQYYDPPY
FT                   NYGNIAVGLMNIPCLIGAIIGCFFAGTLSDYFTMYLAKRNNGIQEAEYRLWFLLPPAII
FT                   APIGLILFAVGTDQVWSWVPTYIGLGFIGFGYGCAGDVSMSYLMDSYPNAVIETMTVVA
FT                   VINNCIGCVFTFACSPFINALGNTKTFIILAVIEFVIMASASFFIYYGKRIRVWTKDWY
FT                   LEFCEARDGL"
FT   CDS_pept        650638..650958
FT                   /transl_table=12
FT                   /locus_tag="CD36_02810"
FT                   /product="60S acidic ribosomal protein P1-a homologue,
FT                   putative"
FT                   /note="Similar to C. albicans RPP1A"
FT                   /note="Similar to S. cerevisiae RPP1A"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44541"
FT                   /db_xref="GOA:B9W782"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:B9W782"
FT                   /inference="similar to AA sequence:UniProt:Q9HFQ7"
FT                   /inference="similar to AA sequence:UniProt:P05318"
FT                   /protein_id="CAX44541.1"
FT                   /translation="MSTESALSYAALILADAEVEITSEKLLALTNKANVEVEGIWADLF
FT                   AKALEGKDLKEFFFNFSAAPAAAAAGGAATGGAAAEEAAEEEKEEEAKEESDDDMGFGL
FT                   FD"
FT   CDS_pept        complement(651463..652071)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02820"
FT                   /product="60S ribosomal protein L13, putative"
FT                   /note="Similar to C. albicans RPL13"
FT                   /note="Similar to S. cerevisiae RPL13"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44542"
FT                   /db_xref="GOA:B9W783"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/TrEMBL:B9W783"
FT                   /inference="similar to AA sequence:UniProt:O59931"
FT                   /inference="similar to AA sequence:UniProt:Q12690"
FT                   /protein_id="CAX44542.1"
FT                   /translation="MAISKNLPLLNNHFRKHWQERVKVHFDQAGKKASRRQSRLRKAAK
FT                   IAPRPIDALRPIVRAPTVKYNRKVRAGRGFTLAELKAVGITPKYARTIGIAVDHRRQNR
FT                   SQETFDANVARLQEYKSKLVIFDKKTKASEVASFEQVAVSATFPVEQPAPESGLRAVEV
FT                   PEQTAYRTLRLARNEKKYKGIREKRAKEKAEAEAEKAKK"
FT   CDS_pept        join(652540..652560,652892..653299)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02830"
FT                   /product="40S ribosomal protein S16, putative"
FT                   /note="Similar to C. albicans RPS16"
FT                   /note="Similar to S. cerevisiae RPS16"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44543"
FT                   /db_xref="GOA:B9W784"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:B9W784"
FT                   /protein_id="CAX44543.1"
FT                   /translation="MSTQSVQTFGKKKTATAVAHVKAGKGLIKINGSPITLVQPEILRF
FT                   KVYEPLTLVGLDKFQGIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEASKNEL
FT                   KKIFASYDKTLLVADSRRMEPKKFGGRGARARFQKSYR"
FT   CDS_pept        654196..654951
FT                   /transl_table=12
FT                   /locus_tag="CD36_02840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44544"
FT                   /db_xref="InterPro:IPR039924"
FT                   /db_xref="UniProtKB/TrEMBL:B9W785"
FT                   /inference="similar to AA sequence:UniProt:Q6BSD9"
FT                   /protein_id="CAX44544.1"
FT                   /translation="MNQLVKLIHESPNIENTIPHTLYQASSPKLNLAEEDKFIIYAGGE
FT                   NFSLLTNTDLSDLNPVSVSLFVLNTSFIIWFNLNNVGIEIAYPAIVFHGLNEDSVYLNI
FT                   EDNQIIGTYLTIRYNTESQNNSNPLFSTIHSKITNVYEAISYVSEFHTVSSDDDYDEGE
FT                   VTGLPTLEVSHTSSELESSALNSFNNSGQADDLDDDIIDDDDCTHNVAGMHVEVGFASI
FT                   AGVKTRRNELEDYDGLTTNLNSNKRNKLH"
FT   CDS_pept        655563..658706
FT                   /transl_table=12
FT                   /locus_tag="CD36_02850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44545"
FT                   /db_xref="InterPro:IPR026705"
FT                   /db_xref="UniProtKB/TrEMBL:B9W786"
FT                   /inference="similar to AA sequence:UniProt:Q6BSE0"
FT                   /inference="similar to AA sequence:UniProt:Q5ASC1"
FT                   /protein_id="CAX44545.1"
FT                   /translation="MKTTEEKAKFRNQFLKLGQGHIISTDESNNIFWSSFWTMPTCAND
FT                   VYELITVADIKKVRQQNLMNIVQLIRQLCLKIISTVKECKEFCINKKEIIELLNCVRFL
FT                   IKVLPFIFEMADYSNELEREIFWNNDFDPMRLLQRIDNSKEEEEEEESDKNRNWERLLS
FT                   PDQVANSIAVNLISSLVDLLFIRNFTVPSTASGKENKLLHVWEPGIGGTSKYQQPNVVI
FT                   DSNRTEILKLLLTLCSNSLYQQVSCVTTHGSKFLTLLVTVTPKIELLTLVSSLLNITCR
FT                   SSKSTASENGLVFEKPEYSEIRHLCVTYAIQLLTLMVVYPLPQKSELKFLIEGGLCSKP
FT                   YNMARVYVGKIHKENELLFIASSLIEFLKVPLINAKDQETDTFSLLRSGSNYKRPSLWS
FT                   LEAVMLIWELLQSNRNFVSIVGEKYISELMIILLYYVFAYHSQKSSKNLIFLCAYLLLY
FT                   LSSAQQNRFLEPLFVPLNSSASLHEFYNCLPSNYKLSITPINTRDFLVTHICTILINNQ
FT                   VNVSSSNYLSSSSPLSDLLIKTLIEILYNLISRVSSEEAMGFKTETSKKLNNPNPRGGL
FT                   SYQSSSSITQLVSVLSNKRFLLEKSFHPDLVALLIRAICAAVTKFPVPSRMLLFCILKN
FT                   EKVYDELWNTIFSFSGVFFRGNSLTRIEDESDESPSENTEADTSIASYDSTKDEVLGST
FT                   VKPIPIPIPIPTNKYEDDGTVKSASVETENIEASLRPNLPTGMSFNAREKLKKDTPLNK
FT                   TWAGNDALAVILTIVIPHLKVVLNEVWSRVEGSSVDSYELVQRIEKAGFDKVFEANKSQ
FT                   LCYDLLPNTPLDQLRFNWSHLSLGWYISLLYGQIYNSGAQVQSYSGNSIRNYKIVKTFS
FT                   SGMSRLTSNWTSFLKQDSQSEPSSSETTLPKIDENLEWVNNALSNINTWSGSEIKLFDV
FT                   ETTEDGFFANLNSRIMANYTKNGNTAQNPGHGYAAPSTPGGLTDVSRRFSDFRINNGSN
FT                   PSIRSIGNSPVPSALSTPVEEKELYFPKRSFRNSVTSLHSLNNLNRSRSNTPRNSISQ"
FT   CDS_pept        complement(658783..659400)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02860"
FT                   /product="pre-rRNA processing protein, putative"
FT                   /note="Similar to S. cerevisiae TSR2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44546"
FT                   /db_xref="InterPro:IPR019398"
FT                   /db_xref="UniProtKB/TrEMBL:B9W787"
FT                   /inference="similar to AA sequence:UniProt:Q06672"
FT                   /protein_id="CAX44546.1"
FT                   /translation="MATTIDPTDYVEVENGTLSFADPKQQAKFELGVCMAIYKWEELTT
FT                   AVDNLWGGPKSAEKRDWISGIIIDLFGESNIVDIQLIEETLLYAMVDEFDTQIDNDSAL
FT                   EIGNLIIKLYRDAAQEKYGLIDEMYEKWQAKQNIKNPHKVHIEDDPNNPDVSSEEEEEE
FT                   ENEEIQDDNRMEIDEPEQVRQQNAPIVDDDGFELVQSKGRRR"
FT   CDS_pept        complement(659570..661990)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02870"
FT                   /product="origin recognition complex subunit 1, putative"
FT                   /note="possible genus-specific N-terminal extension?"
FT                   /note="Similar to S. cerevisiae ORC1"
FT                   /note="Similar to C. albicans ORC1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44547"
FT                   /db_xref="GOA:B9W788"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041083"
FT                   /db_xref="UniProtKB/TrEMBL:B9W788"
FT                   /inference="similar to AA sequence:UniProt:O74270"
FT                   /inference="similar to AA sequence:UniProt:P54789"
FT                   /inference="similar to AA sequence:UniProt:P54784"
FT                   /protein_id="CAX44547.1"
FT                   /translation="MNKLPKGWNFTIVDNDVESNDSENIQGKRPRRSRNTTQTSEGGTP
FT                   TIQNNIVLTRTDDNEEFKVGDTIEITQGKRPEDSTTDYGLITDIKFGISEFIQVIVAWF
FT                   IRSSEIEGMPDKFFTDNELLLTPFRSEVKFVDFIRHINVLSESQFADVVIDESNSHTTF
FT                   LVKRATDNEGNFSSTFDYKEFSSKVLENPKKCTTQVKELIFTTVEEVVSKNSSNKKGER
FT                   QENKVSEIDRTTRSSKGKENLSAKASKPENKQNMRIIDHHDNLSNKYEEESEESDYQEA
FT                   EDANSASESEEENISQDSEDSEVEYSKKKKLKTKKSMRRSKVAMTPSPKRKIQKKDIAE
FT                   IYSVVTPTKRMKLGKDDRDSLPVFLSPTKSVSNAFTDPKSVAFKEMKKRLHTSQKLNAL
FT                   PGREDEFAMIYMNLESAVNEQTGCCVYVSGVPGMGKTATIKDVVEQMTLSSEKGEMKQF
FT                   DYLELNGLKLLSPTVTYEVLWYHISGDKVSASNAALLLEEYFKREDHKRKPLVILMDEL
FT                   DQIATKKQNVMYNFFNWPTYSTSKLIVIAVANTMDLPERMLSNKISSRLGLRRIQFRGY
FT                   TFQQLGDIITHRLEMITKNNRRKVVITPDAIGFASRKVASVSGDARRALTICRRAVEIA
FT                   EKEYLENKKDKDDNEPYQVLISHISAAINETVNSPLSKYLSSLPFASKLVLASLLRRSR
FT                   RTGLAENSLGDIIDEMKNSFAMATHSKDQENDELNMLDVLYTDKTFTTVNETTPILNLR
FT                   IHFFKQIVTSLVEAGIIIQQNLPGERSRLVQLNVPEEEVVSVFKKDNAISQFL"
FT   CDS_pept        complement(join(662296..662863,662942..662976))
FT                   /transl_table=12
FT                   /locus_tag="CD36_02880"
FT                   /product="M-phase controlling GTPase, putative"
FT                   /product="septum-promoting GTP-binding protein, putative"
FT                   /note="Similar to S. pombe SPG1"
FT                   /note="Similar to S. cerevisiae TEM1"
FT                   /note="Similar to C. albicans SPG1"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44548"
FT                   /db_xref="GOA:B9W789"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W789"
FT                   /protein_id="CAX44548.1"
FT                   /translation="MEEDNQQDHNNQVALKIGLIGDSQIGKTSLMVKYVEGSFDEDYIQ
FT                   TLGVNFMDKKIQIRNTTITFSIWDLGGQKEFINMLPLVSNDAVAILFMFDLTRKSTLNS
FT                   IKEWYRQVRGFNKTAIPFLVGTKYDQFIDLSFQDQIEITQQAKKFGSAMKAPVIFCSTS
FT                   HSINVQKIFKIILSKAFDLKLNLEEIVNVGEPILIYK"
FT   CDS_pept        663558..664328
FT                   /transl_table=12
FT                   /locus_tag="CD36_02890"
FT                   /product="40S ribosomal protein (S1/RP10), putative"
FT                   /note="Similar to C. albicans RPS1"
FT                   /note="Similar to S. cerevisiae RPS1B"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44549"
FT                   /db_xref="GOA:B9W790"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W790"
FT                   /inference="similar to AA sequence:UniProt:P40910"
FT                   /inference="similar to AA sequence:UniProt:P23248"
FT                   /protein_id="CAX44549.1"
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKDWFDIKAPTTFENRNVGK
FT                   TLINRSTGLKNAADGLKGRVFEVCLADLQGSEDHSYRKIKLRVDEVQGKNLLTNFHGLD
FT                   FTSDKLRSLVRKWQSLVEANVTVKTSDDYVLRVFAIAFTKRQPNQIKKTTYAQSSKLRE
FT                   VRKKMIEIMQREVSNCTLAQLTSKLIPEVIGREIEKSTQTIFPLQNVHIRKVKLLKQPK
FT                   FDLGSLLALHGEGSTEEKGKKVSSGFKDVVLESV"
FT   CDS_pept        join(665415..665429,665623..669861)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02900"
FT                   /product="bud/polarization protein, putative"
FT                   /note="Similar to S. cerevisiae TCB3"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44550"
FT                   /db_xref="GOA:B9W791"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037756"
FT                   /db_xref="InterPro:IPR037761"
FT                   /db_xref="InterPro:IPR037762"
FT                   /db_xref="InterPro:IPR037765"
FT                   /db_xref="UniProtKB/TrEMBL:B9W791"
FT                   /protein_id="CAX44550.1"
FT                   /translation="MSNSRSEEQKKNKPREGESGSIANKGDIDDFNKKVNSDINNKTTS
FT                   VNGATNKPKPPTQAPPEAPKKKVSIRDNTTFSWKNVGGWDVEDNTDKKALLKNTKKVEG
FT                   YIIDHFYGDWYWNCALIIGTCFFSWFFARLGGGILSLGLVLLFTNSVYRSEMRRFNRNI
FT                   RDDLTRVKADNRLVNELETMEWMNSFLDKFWVIYMPALSETVMFQANEILKDQAPGFGI
FT                   DALSLDEFTLGSKAPRVDSIKSYSKTGQDLIEMDWAFSFAPNDTDDMTKNEIKRKIDPK
FT                   VALGVTVGKAFVSKTLPILVEDMSFTGRMKVRLRLSANFPHVKMVSVQFLEAPEIDYAL
FT                   KPVGGDTFGIDIMSFIPGLSKFVNTIIHATLRPMFYAPNWFDVDVEEIMAAQSNDSIGV
FT                   VEVTVKRCRKLKTGNPTKPKSLNPYVQIKVTNNGKIDERTKTKKLVNDPIFMETKTILV
FT                   NQLEGNFLHFNVYNLIEDKMDDQLIGNCEFGLGELLQEETIQGITKNIMEGGKVVGKME
FT                   LDIKYFPTIQPTILEDGSKEVITDNEVGIMKLTLHEARDLDISKSVIGLLNPYAEIYVN
FT                   NEKAKTCRRLRQTNEPGWNESFESLIKQQSETSIQVLVRDSVNSDIVANLEVNLQDVIF
FT                   ESQRGQHWFTCPPLSKNGPAPKIRLTTSWKPLAIDEATSEKVVRNAPIGGMRLHLRGAK
FT                   GLKNLESVGYVDPYVRVMLNGKLRAKTVTFAETVNPQWNSVYFLPVANEHQHYLLQIMD
FT                   AEPEGKDRSLGTAAINIADILRKNEEGYYLGYDGSDEIIEQPVLFNTKEAGSIFYSISF
FT                   FPAIPTYSLSQLHNMETYQKELSEQEEREKERYARDEKLFKENPEEFEWMEIENKHMKV
FT                   PPKVELKLQDAIKYRAGNMIVHLKGGQFEKPDVYVHTLFDEQAYPSGISPLSEGKKLTT
FT                   ASVGEAFIRDLPNSNLIFRVAKVAEVTKSSEVIVEKMYNTLDIYEKSFEKPIKLNLGNR
FT                   NTIEVQLEFIPSTVKLAPLDTILDVGKIKLEIIGGENLKSVDSNGKSDPLCTVNLDGVE
FT                   VYKTDKKRKTLDPIWNESVEFPMISRSRQVLLVEVYDWDYTHDDELLGVANIDLSNIPA
FT                   LTTTPFSVDLDTQGKVNLRATFFPEYIRPPLDSKSALPIDLGAVSDVGVKAVGGAANLA
FT                   TGVVGGGIGVASDQLSKGTGFLKSFKSKRGRNSNHKNSNDDSSSLAPSALSQGKSSVSD
FT                   DGVNNLKPDIPEEEKELREQQGEEIESIQAVPNIREQDLPKPQQPFVPQGNVRGHQRNV
FT                   SNATDVSSFAASIHGADAIPGRLTIVEARNFKAGDNLEVKASLKTSTKDKSLIKTRGTK
FT                   FDSVSDTYKWGESVPFRSSPSGSIVLQLREHHTFGKSVVLGEASLNLENYVNVSENITL
FT                   PVGSGELVVNVKYFT"
FT   CDS_pept        join(670413..670424,670804..671322)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02910"
FT                   /product="60S ribosomal protein L16, putative"
FT                   /note="Similar to C. albicans RPL16"
FT                   /note="Similar to S. cerevisiae RPL6A"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44551"
FT                   /db_xref="GOA:B9W792"
FT                   /db_xref="InterPro:IPR000915"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041997"
FT                   /db_xref="UniProtKB/TrEMBL:B9W792"
FT                   /inference="similar to AA sequence:UniProt:Q9P834"
FT                   /protein_id="CAX44551.1"
FT                   /translation="MSQVAPKWYQSEDVPAPKQTRKTARPQKLRASLVPGTVLILLAGR
FT                   FRGKRVVYLKNLEDNTLLVSGPFKVNGVPLRRVNARYVIATSTKVNVSGVDVSKFNVEY
FT                   FAREKSSKSKKSEAEFFNESQPKKEIKAERVADQKSVDAALLSEIKKTPLLKQYLAASF
FT                   SLKNGDRPHLLKF"
FT   CDS_pept        672246..673487
FT                   /transl_table=12
FT                   /locus_tag="CD36_02920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44552"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/TrEMBL:B9W793"
FT                   /inference="similar to AA sequence:UniProt:Q5AI48"
FT                   /inference="similar to AA sequence:UniProt:Q12331"
FT                   /protein_id="CAX44552.1"
FT                   /translation="MKFSSLLPLAVFSGLVTSKNIFDLESLQQGLLDEETATNDKREPV
FT                   NILHLDRFKMGVSGEEKDNAKSKRDPKNVIDLASLKVGSTEEEEEQKDKREPKNLFNLQ
FT                   ALNEGLKDEETKNKREAKNLPNLDALEEALKGGGLPKKDAKNLIDLVALKQSLEKDAAK
FT                   RDAKNIPNLQALRTGIEEEEDGSVAKRDAKNVINLNSFIETSSKREGKNLFDLTKFQQS
FT                   GQQIKKRDQTILTQEKSLFVLDSVDCYNNLLQSILPQLSSISIFSSYIRQFASIDARTA
FT                   NPQEVILIVAPDNDSLETKLSDLKPWEFPELITPEQSEQEQDKTLKKNLLHFLNGHLIN
FT                   NFEENLVIDKSSAEAVTIISKLNNGKFLKIKQDQLSQKFSIRLLDSEDWIDVETIKQVE
FT                   NGFVLIINDSLVKP"
FT   CDS_pept        complement(673798..675552)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02930"
FT                   /product="Golgi-localized, ADP-ribosylation factor binding
FT                   protein, putative"
FT                   /note="Similar to S. cerevisiae GGA2"
FT                   /note="Similar to C. albicans GGA2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44553"
FT                   /db_xref="GOA:B9W794"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR038425"
FT                   /db_xref="UniProtKB/TrEMBL:B9W794"
FT                   /inference="similar to AA sequence:UniProt:P38817"
FT                   /protein_id="CAX44553.1"
FT                   /translation="MSSSYSLDKINPKLLRRIYRACRPTNDEPNLALNLEICDYVNAKK
FT                   GSAPRDAAIAVVKLISQRDPQTSELAIALLDNLVKNCGYPFHLQISRKEFLNELVKRFP
FT                   ERPPLRYTRVHRLILAQIEEWYQTICRTSKYKDDFGYIKDMHRLLSNKGYVFPEVKVED
FT                   VAVLNPNDNLKSLEELQQEESIVHSAKLQELIRRGRPQDLQEANKLMKIMAGFKDDNVK
FT                   ENKKQIKQDITRLTRKVEILGEMLTSIESQGGKIDDSSDEAIIELYSSIKSSQPIINKM
FT                   IEQSSDHDDNEEDVNKLLALNESANNVINKFQLLKGGNVSEASKIKTGSASQELNLIDF
FT                   DDAPEDVSASKEQGYTDLLSDLSNLTFSENNNSTSMSNSTNVNPLNLYGAGGSISLGAG
FT                   SGFPTASNTPSIHQPTPSVAQGKQVSSSNFDLLADLNSPSPQLQSNTNSSSLDPFGLQF
FT                   PTTTPSQVTGQGDGYIKMIPINQTSNLKIEIGVKSSSANSLKGKILFSNLQTSTISNLK
FT                   FLIAVPKSCKLELRPQTSDTIFGFNNHGIQQDFNIENPLSKQLKIKWKVEYQINGVANE
FT                   ENGVSVLE"
FT   CDS_pept        676137..676610
FT                   /transl_table=12
FT                   /locus_tag="CD36_02940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44554"
FT                   /db_xref="GOA:B9W795"
FT                   /db_xref="InterPro:IPR034455"
FT                   /db_xref="UniProtKB/TrEMBL:B9W795"
FT                   /inference="similar to AA sequence:UniProt:Q06333"
FT                   /protein_id="CAX44554.1"
FT                   /translation="MSVDEDRSSRYDQMTSQNNTKSKDGCNDLLPPSEQISIPSPENDN
FT                   TPPSPAPSNDDPDPLELKKLSLNYDYLMYKIRDYINTLTEQTYQSILSKQYQINQEYLH
FT                   DQLNLFDNYESIDEMLKTISQLEMEFLKLDQLEVFIQDFKQRLIVLEHEFDKL"
FT   CDS_pept        complement(join(676946..677575,677648..677683))
FT                   /transl_table=12
FT                   /locus_tag="CD36_02950"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44555"
FT                   /db_xref="GOA:B9W796"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:B9W796"
FT                   /inference="similar to AA sequence:UniProt:Q6BHU3"
FT                   /protein_id="CAX44555.1"
FT                   /translation="MSQLLYKYFLQKTNLDHLVTFGDANHDPYFEEIPDNELHFYQRKG
FT                   AKRRRKLPDFIPKHDLKILNSVKNRAYRLDLSLNLCGLRIGWAGVIGLIPWIGDIIAFY
FT                   FALQLVRKARTIEGGLPKGLEAEMMANVMFDFGIGLIPIVGDFINVLYKCNSRNFILLE
FT                   KYLVKKYGAIANPLPPSNPSVTQTPINNNLNPPSNPSGRETPTAHISNRPPNPPPRDL"
FT   CDS_pept        complement(678075..679046)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02960"
FT                   /product="mitochondrial ubiquinone-synthesizing complex
FT                   component, putative"
FT                   /note="Similar to S. cerevisiae COQ4"
FT                   /note="Similar to C. albicans COQ4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44556"
FT                   /db_xref="GOA:B9W797"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="InterPro:IPR027540"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W797"
FT                   /inference="similar to AA sequence:UniProt:O13525"
FT                   /protein_id="CAX44556.1"
FT                   /translation="MLKSTVSNTRIKCCRIDQRRNYLFTALASSALGSFLWSKNNVLAS
FT                   KMENGELHYHDPNLTFNKKLFNGKPPFERRAPDYPGHVPLYNFEKVLMFLGSSMGAFFH
FT                   PEENKYIVALGESTAITPILQHLRHKMLSDPVGRTILREKPRMTSDSLNLTYLRSLPDN
FT                   TIGKNYVNWLDKENVSPDTRVPVRYIDNEELAYIYQRYRECHDFYHAITGLPIIIEGEI
FT                   AVKVFEFANIGIPMSGLGALFAPLRLKPSQRQRLREIYYPWAIKNGLFSKPLINVYWEK
FT                   ILEKDVNEFRQEMGIQQPPDLRNMRKEYFAKKKLEKQLQGRK"
FT   CDS_pept        complement(679266..681272)
FT                   /transl_table=12
FT                   /locus_tag="CD36_02970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44557"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="UniProtKB/TrEMBL:B9W798"
FT                   /inference="similar to AA sequence:UniProt:Q6BHT8"
FT                   /protein_id="CAX44557.1"
FT                   /translation="MSSRRNKRPYKGLILKPKPLKPGSVFATGTGTRTGLGTVSVSASP
FT                   LASTSTTATTIISFQNGQTYNVPNSGNVSPSTSSTSTNSLVTKQHIKKSLQNDFKLKST
FT                   ANTNNNDTDNNIPSHNGSNGFGVVGDLYDISDPNNFNEFEFLYSIYVPNKYLIKNNKKS
FT                   IKHLLIHLPKLYHDSATNSSGSTTSTTTNTNQTTNLNLSIHLFLSTIMVKFVNSWYLTK
FT                   LNTTNLSFLKLVYQLMVDFIRDIISRIESVDIMLMIDQLGDILNTHLKQTVSNKYSGNN
FT                   QYPYKFLEDYYFIQQPTSNTFDFDKSSLQVVNDHLKSNHIIFENFNSSKDQNTNNEMLY
FT                   YRLLVKNVLSASFKDNALSPSTSKITSDLIIHILSDIVIVKLIEKLSSSDFIFDKLNEL
FT                   LDSLLSLSSSSSSSSSSNSIEPNSKVKLESTFYSSWTQKLQKSISQIYSGFTSFIVLSS
FT                   NSKKSQLKGNENGDSVSGTNSQGNGTSGVLNWSLFSLLNIIFNVQHRKPFVYNLMISIK
FT                   TLLLQMNNRIVSSIDRITGEFIKTKIKQSITQDKVARIINDLRINLFYPSSDNQESKTV
FT                   NQENQISIDILAEKIIKVYKTYFAKYLDLSYKGETDQDLKDSIKSVLIIFQQQQEHKEE
FT                   KESDPHQYLDNRVNKLLIVKLLDCVIGNLYTDI"
FT   CDS_pept        682212..683120
FT                   /transl_table=12
FT                   /locus_tag="CD36_02980"
FT                   /product="lipoyl ligase, mitochondrial precursor, putative"
FT                   /product="lipoate-protein ligase, mitochondrial precursor,
FT                   putative"
FT                   /product="lipoate biosynthesis protein, putative"
FT                   /EC_number="6.-.-.-"
FT                   /note="Similar to S. cerevisiae LIP2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44558"
FT                   /db_xref="GOA:B9W799"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B9W799"
FT                   /protein_id="CAX44558.1"
FT                   /translation="MKILTRQYHTIRPNYRKLQHIHFPGISSFQHGLNIQQSLVDANLN
FT                   YKSLEFKYRRIQRQQQQQLQQQPQSQPQQPFTNSKDTSLLDLKNKIEKLQPLPTILTFE
FT                   FDNVYAGGLRSKSEVSTDDLEGFKRIGGQYYQLERGGQVTWHGKGQLVAYLILDLKNFV
FT                   QLTTKCYINNVLLKSIQNVLKKSYNLDSVIGVENPGIWIEDNKSISSLSESLKISSVGV
FT                   RIRHGITEYGIALNINPDLKYLNTFEMCGLKNKRATSIHEQLDHNHLEIPSVEHVGKSF
FT                   VDEVALALEMDSVEYINADSL"
FT   CDS_pept        complement(join(683542..684761,685668..685728))
FT                   /transl_table=12
FT                   /locus_tag="CD36_02990"
FT                   /product="GPI-anchored extracellular protein, putative"
FT                   /note="Similar to S. cerevisiae ECM33"
FT                   /note="Similar to C. albicans ECM33"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44559"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A0"
FT                   /protein_id="CAX44559.1"
FT                   /translation="MQFKNILAITAIAGLASAANNSTLTTATPSVKSDCSFKDFTATAS
FT                   NQVQQVAACATAVGDITIQGDSFGTVELTGLEQVYGSLHVKNATKATTVNAPTLQLVSG
FT                   ELEFNANTILSDLNLAQLTTVGSFSLNALPALEKTGLTAGITSAESVIISDTGLSSLTG
FT                   INVYKLKVFNVNNNDNIDTIDSGLQEVTDTIDISYNAEKVDVILKQLSSAKNIVLQQVN
FT                   SFSAPNLTVANGSFAVSSSSVEKVELAGLTSIGNSLTVNKNEDLTELDFPKLKSIGGAL
FT                   QISDNDELKSFAGFPKLETIGGSVNINGTFDNGTFESLKRVSGGFILKTDGKLSCSAFN
FT                   KLNTNGDVKGDKFQCEDRQTTSSSSSKKSGSATETSGSGETGSDSSSSASGSSGSSSSS
FT                   KKAGAASNNGKLASVVAAFAAVGVALF"
FT   CDS_pept        complement(690299..693544)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03000"
FT                   /product="zinc-finger transcriptional activator, putative"
FT                   /note="potentially activates transcription of aromatic
FT                   amino acid catabolic genes in the presence of aromatic
FT                   amino acid"
FT                   /note="Similar to S. cerevisiae ARO80"
FT                   /note="Similar to C. albicans ARO80"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44560"
FT                   /db_xref="GOA:B9W7A1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A1"
FT                   /inference="similar to AA sequence:UniProt:Q04052"
FT                   /protein_id="CAX44560.1"
FT                   /translation="MPTDKPVVADFTGGDALQTSVKSPEPSSQQQSQSQGKYRRNYRAC
FT                   LNCRLRKVKCDLGPVDNPHDGKCARCLRERKDCVFVESKRGGTANVVNGKRKKQRTSST
FT                   VMSRSETQSPDSNNVSSTTSTIASQNDNINTPLINMSINNIMQKLPGVESILPKDNSRN
FT                   PPQSGFSNTSTSPSSSSLPMGQPPQLPPISSKTSILNQSSSSLKNPKSLSNEFTTMESA
FT                   LVFLANAAGEIAKADERDNIDAQSKYDQIEASLSGANSHRVSIDETTNQQQQEQQNQHY
FT                   QQKSEQGQRHKPSPSLQQQEHHQQQPLNTPNNGPGVFTNNYHGQPEKSNIPPYVKPTAS
FT                   RRMFVPPAESGNAVRPKGSNKLSNIDYIGPAPRGILTEDEAKRLINLFFVTMHPYFPHI
FT                   PKFLHSPQVLSNYPILLCAILTISSRYHPFETDMTNHTNGNGAVPRHIEVHDRLWLYVQ
FT                   RLISQTVWAEASTRSIGTVFAFLLFTEWNPRAIHWRWSDYANKAEEINDTDQQQQQQQP
FT                   QANSNTNGSASLSSAAAAATASTAATTASAFGQSSDENNGGLAGLGAMRRSHRMAWMLI
FT                   GSAVRLAQDMGFMEISSKAFLATHIAEINAVMNMSRRSMLANSLSEVDLDEDEITVEDM
FT                   EQAEEKDDDSKIMQMNEEELKKISTHHILKFTKSQKATIELLQIMSLGHESLYGYKAQL
FT                   GQLTHRQTLSVLNILSPLINNWGRKYKEFLVPSSPIVNSKFAKLAPNFPQHWLDSNNKI
FT                   CREIADTIEQETFIIEFNYVKLYIYSLALNQSPKSMLEKGTKIKLDELSKAAKYIEQAF
FT                   HAANETLNAAHRIHRFKMLRFMPVRLLTRFIRAAAFIVRCHLTMTAQENISLSVSKITI
FT                   DEIIKSTHRAAMTLRECSPDELHLLSRYSTILMVLYSEMKSKRNRKEAVEDDENNESTT
FT                   IPETVGEDSSSGNSSESKQASGGVRATTVNASGSSFASVSSGVSNNGVFGVGRSTSAAT
FT                   QPQQQQRQQPIQPSHTTAGMATSTYKSFGNNNIHNNSAPAAVDAGQMEMSDNSSSSFPS
FT                   VPPPVEDFDFDFNIDELLGDGFQNIVDLWSFLN"
FT   CDS_pept        complement(join(694043..695195,695375..695415))
FT                   /transl_table=12
FT                   /locus_tag="CD36_03010"
FT                   /product="septin, putative"
FT                   /note="Similar to S. cerevisiae CDC12"
FT                   /note="Similar to C. albicans CDC12"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44561"
FT                   /db_xref="GOA:B9W7A2"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A2"
FT                   /inference="similar to AA sequence:UniProt:Q8NJ84"
FT                   /protein_id="CAX44561.1"
FT                   /translation="MPEPVGIANLPNQRYKIISKEGATFTIMVAGESGLGKTTFINTLF
FT                   QTSLKPHQEPSHRHNKFTSPHQTVEIDIVRAILEEKNFEIRLNIIDTPGFGNNVDNHDS
FT                   WVPIIDFIDDQHESYMKQEQQPSRTAKKDLRVHACLYFIRPTGHSLKPLDIEIMKRLST
FT                   RVNLIPVIAKADTLSPQELDIFKTRIREIIEAQDISIYTPPLELDDPASAEHAKQLIES
FT                   MPFAIIGSEEEVEVGPGQFVRGRKYPWGVVEVENDQHCDFKKLRSLLLRTNMLDLVLST
FT                   NELHFETFRSVKLGGDEQENGEENGTEELTNEKGEVIKKPSGSKKPRRLHNPKFKEEED
FT                   ALKKFFTEQVKAEEHRFRQWETNIINERNRLNQDLEEMQSKLKSLEEQVKRLQIAKR"
FT   CDS_pept        complement(696510..697307)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03020"
FT                   /product="14-3-3 protein, minor isoform, putative"
FT                   /note="In S. cerevisiae: involved in regulation of many
FT                   processes including exocytosis and vesicle transport,
FT                   Ras/MAPK signaling during pseudohyphal development,
FT                   rapamycin-sensitive signaling, and others"
FT                   /note="Similar to C. albicans BMH1"
FT                   /note="Similar to S. cerevisiae BMH2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44562"
FT                   /db_xref="GOA:B9W7A3"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A3"
FT                   /inference="similar to AA sequence:UniProt:O42766"
FT                   /inference="similar to AA sequence:UniProt:P34730"
FT                   /protein_id="CAX44562.1"
FT                   /translation="MPASREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNL
FT                   LSVAYKNVIGARRASWRIVSSIEQKEEAKGNESQVALIRDYRAKIEAELSKICEDILSV
FT                   LSDHLITSAQTGESKVFYYKMKGDYHRYLAEFAIAEKRKEAADLSLEAYKAASDVAVTE
FT                   LPPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAVADLETLSEDSYKDSTLIM
FT                   QLLRDNLTLWTDLSEAPAATEEQQQQSSQAPAAQATEGKADQE"
FT   CDS_pept        complement(698786..700480)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03030"
FT                   /product="ribosomal export complex protein, putative"
FT                   /EC_number="3.-.-.-"
FT                   /note="Similar to S. cerevisiae ARX1"
FT                   /note="Similar to C. albicans ARX1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44563"
FT                   /db_xref="GOA:B9W7A4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A4"
FT                   /inference="similar to AA sequence:UniProt:Q03862"
FT                   /protein_id="CAX44563.1"
FT                   /translation="MQLAVRQEDADILLKQKNILDEPVVEKYRVAGQITQTALAYITSL
FT                   INNSYHLQTSPKLTIQQLCLLTDSFLLKLLSRQYVNKVNEKGVAHPTTINVNQLLNGFS
FT                   PEIDDDREFFLNQGDVVTISLGVHIDGYTSQVSHTLVIYPPSADAKPEGPLLGSNADAL
FT                   CACHLATESVVVLLGCSLSPEKLPANLRNANNTVAGSQIRELVDAIADSFNCVVVPGSK
FT                   IRRVRRFLAGQAEGIVAERDFKGVVWDESHQEARLLKQSTNSSTDVILSDSNKPVQTNN
FT                   SSAIPTDDFIIVPGEVYQIDIRMAGLSDIDEIGIVTTEEIDHFTGKNNKQDFNAKSSIF
FT                   IRDFAVTHQLKLKTSRKLLGEIDRQFSVYPFKLDYASKNFPVNTESSEEEIKQQIAAIS
FT                   EDMKSNRLGAAELSNRHLIQPKPIQTTKFIPLKEILLSANPTGKHGIDATKPVLPGMEI
FT                   PLPNLGVSSLKLKSLLKTGTSINNVRESTTVAINENNQELIRLTGGESTAKSNWVHSQY
FT                   KLPGPLNETIGQLVQLSKDKRFGIKIKEVVPYKVQQTNMSVESMQID"
FT   CDS_pept        701163..701588
FT                   /transl_table=12
FT                   /locus_tag="CD36_03040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44564"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A5"
FT                   /inference="similar to AA sequence:UniProt:O14155"
FT                   /protein_id="CAX44564.1"
FT                   /translation="MSWDQTKFTLSPKSKGCYLITDDVIRSVPQIKDYEIGILNLFLQH
FT                   TSAALSINENWDPDVRTDLDKSLDRIAPEGDFYLHDAEGPDDSVSHIKSSTIGVSLSIP
FT                   ITNGRLSLGQWQGIYLCEFRRYRHSRTIVATINGKKK"
FT   CDS_pept        complement(701622..702845)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03050"
FT                   /product="histone-methyltransferase COMPASS (Complex
FT                   proteins associated with SET1) component SPP1 homologue,
FT                   putative"
FT                   /product="histone-methyltransferase SET1/COMPASS component
FT                   SPP1-homologue, putative"
FT                   /note="Similar to S. cerevisiae SPP1"
FT                   /note="Similar to S. pombe SPP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44565"
FT                   /db_xref="GOA:B9W7A6"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR037869"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A6"
FT                   /inference="similar to AA sequence:UniProt:O74508"
FT                   /inference="similar to AA sequence:UniProt:Q03012"
FT                   /protein_id="CAX44565.1"
FT                   /translation="MDLNTTQYDKSKEEVSDNSMDIKSHLKRNKPSPAIPSKRVKHDTG
FT                   SSPSTTEESNEEIARQYKKFMNAPKYDLNSEELFCVCRRPDLGEMMVACDGCEEWFHFK
FT                   CMKINEKYSNLIAKYFCKFCEWKGEGNTQWKRKCRITSCYQPIAERSKYCSKEHGLEFM
FT                   KSSLLESTINSTDGPSLQKLDARVIKDVLDYVSGNFDKLQKMGSSFPELEVVKNYKNDD
FT                   SALDEFPETVKTDLQKVHAKLSTLSEQIGKQEQALKALVNTKENIKHLNDKLTNIVYED
FT                   SVSDKQTSKKKKGARGKKKIDICFCDKGEQLIVQSVTDSGTIFDDLLKVIKCRVFENDE
FT                   CKEEDLDWFMNDLCIKDKKKCVRHSGWWNLYYDEAVRNLEQLQSKLEETMEQKEMILKN
FT                   YSISVYES"
FT   CDS_pept        703043..705076
FT                   /transl_table=12
FT                   /locus_tag="CD36_03060"
FT                   /product="DNA-dependent ATPase (MGS1), putative"
FT                   /product="homolog of human Werner helicase interacting
FT                   protein (WHIP), putative"
FT                   /note="large, unusual large C-treminal tail, also found in
FT                   Calbicans; genome stability?"
FT                   /note="Similar to S. cerevisiae MGS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44566"
FT                   /db_xref="GOA:B9W7A7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A7"
FT                   /inference="similar to AA sequence:UniProt:P40151"
FT                   /protein_id="CAX44566.1"
FT                   /translation="MMTQAKEEQCPICSKLFAVSQLYEHVNSCLDNQESKASPSRETSE
FT                   ETNGKAETPVPKKRNALSALGLKADTSSSSQKKLKKSDAKKPSLTSKLIEQKRLQAEIR
FT                   RRDKEIPLEEQFKAIAEDAMTQLRTQEKPLANGIEETKSQKESKFLKKAKEINELKRQA
FT                   SIPLAHRLRPKSLDDFFGQEKLVGKNGALRNIIQADIIPSFLLWGVPGIGKTSLARIIA
FT                   KTTSCKFVELSGIDSNAKRLKEVFVQAENHKNLSGQRTILFLDEIHRFNKAVQDLLLPV
FT                   IEKGTLTVIGATTENPSFNLNNALLSRMHTFVMEPLNVDSLIKILTRALFEVNRVRKNL
FT                   YGLHYISLQKDAYHYIAELCMGDSRVALNILETINAYLSAEKFKNTDSTDDEQTKKQGV
FT                   IKVSADLLKPLMKSRDFHQFYDRNGDSHYDIISAFHKSVRGSDPNAAMFYLVKMLSGGE
FT                   DPLFIMRRMIVIASEDIGLRDSSCLPFVIAAKEALEFVGMPEGEIILAHCANKLALAPK
FT                   STKSYRALRTAQSIIKENPDLTKLPVPLHLRNAPTKLMKDLGYGDKYKYNPQYENGKVH
FT                   QGYFPDGMDPLKLLEDTHLGKERDLSVSDDQYESAKLAVEDYEKFKKSYRKQFFNGHAT
FT                   DFEDSDENDSSHNGEYADNFEKSFDENLAPELQKEYYGDDIS"
FT   CDS_pept        join(705235..705261,705344..706447)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03070"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44567"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A8"
FT                   /inference="similar to AA sequence:UniProt:Q6BHR8"
FT                   /inference="similar to AA sequence:UniProt:Q6FN14"
FT                   /protein_id="CAX44567.1"
FT                   /translation="MCGRFALGLALNELPKEFGRTVLRDQANEIQQERDTNDGNHSYSI
FT                   RGSEDDMKFQLNVAKVTDWYPSYNIAPTNSALIIYMMDSGTQFNAKYILEPSKFGIVPA
FT                   WAKPSDSTPVGKGTGKEGSKYSRELGRIQAKYFNCRRESLKQAKSLWNSCKNNRCVIPI
FT                   QGYFEWMKTNSDKIPYFVHSKTVPLCFLAGFYSHNYNYTENQNVSGEYLSTFTVITVPA
FT                   VKEDANDMSWLHNRKPMLIAAGTKAWYDWLNPKIPWNEKLVETVLNSTTNEAYADIEVY
FT                   QVTKEVGNSSNDGENMIKKINSKKQSSLSHFLGSQKGKRKAKPTSHFSPVKPETEVKQE
FT                   FEEEGVPKKRVKSEPLSSPKKRKKVPGDLFEVKKEV"
FT   CDS_pept        706711..707643
FT                   /transl_table=12
FT                   /locus_tag="CD36_03080"
FT                   /product="mitochondrial ribosomal protein (small subunit),
FT                   putative"
FT                   /note="Similar to S. cerevisiae RSM24"
FT                   /note="Similar to C. albicans RSM24"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44568"
FT                   /db_xref="GOA:B9W7A9"
FT                   /db_xref="InterPro:IPR019349"
FT                   /db_xref="InterPro:IPR039848"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7A9"
FT                   /inference="similar to AA sequence:UniProt:Q03976"
FT                   /protein_id="CAX44568.1"
FT                   /translation="MSIYSRSVSLIRCYSSSQAATKKPFQGPLFLNPHAWKGLPADQVF
FT                   ELHKIRKEYMGDAYNPTDEERTAILSTISSLVPNKPPLDYAFEIEHFKERLMNNTPMQD
FT                   RGKPQKLSNQYVVNSGAVPHQRRRIEQLTRKIAYEAPLLAKYRQPYTPRPRTEAPIRLT
FT                   YNSDFTDDTSSPHNRRVTLKVSLRDLNLDPKQQHKFKVLAGDKFNYDENTFQLKSERYP
FT                   EAAQNVNWLVDTFNKLLTEAKDLSKDDYSDIPLSKSHMKILVKKAAPSFPEHWKKPEDA
FT                   PIKRHEIVKKLVATTERAKDNEYIKKISP"
FT   CDS_pept        707916..709799
FT                   /transl_table=12
FT                   /locus_tag="CD36_03090"
FT                   /product="transcriptional adaptor, component of histone
FT                   acetyltransferase complexs, the ADA complex, the SAGA
FT                   complex, and the SLIK complex 3, putative"
FT                   /note="Similar to S. cerevisiae ADA3"
FT                   /note="Similar to C. albicans NGG1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44569"
FT                   /db_xref="GOA:B9W7B0"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B0"
FT                   /inference="similar to AA sequence:UniProt:P32494"
FT                   /protein_id="CAX44569.1"
FT                   /translation="MTDAHSVSTTLDDIINELKLTYDSSVGLLDGDSIRTIPNINTLTN
FT                   LNKLLKNLWNQLDEVESIDNDVLKKIRAIKESESKKDSKTSENDKKRKNEELTPPNHGD
FT                   EDEMPMSATKKRKIIAAAKEADDKEEKDLVSEADEKGEDEIDEKEEKENLNSKDDPIPP
FT                   VQTGNFTQDNDTRLKNPKSEYVEPQTLSASAIAELGLFSEENNGLETQGREYLKKKYGV
FT                   ASYPEKDLQDLLPGEIPNIDFSKNKPPSNQVQFTTFQSYIESYFRPYSTEDIKFLKERN
FT                   VVPPGFEKQGYDADVTPFIIPKLGKFYADVWSEEDSTLGSKLNSPAFQQPSSDSYKPKG
FT                   SIEGLTDEALFTENISCGPLSNRLLSAILSNREGGLSDDEDAPAHDSKSETKEASKSSL
FT                   TEEEVATQLNSEEDYKLSTEQNDFQTIEERLKRELKYIGIFMNLPTTGEPKPKAKQVNG
FT                   RASKKISASIIDNDEWIKNKEDDEVCAEIRKLQMELKEVVSRNRANRKKLIPLVEEHIA
FT                   YQEYCAILEDLDKQVDSAYMKRLKGRGKKKRSDVVTPQQQALNSGLRALLEKRRRWIDN
FT                   IGKLFPVAEKMKRVPDKSILIREGAVESEQVDDDNNESTSPAVDMLTQKSL"
FT   CDS_pept        complement(709921..711324)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03100"
FT                   /product="mitochondrial processing peptidase beta subunit,
FT                   mitochondrial precursor, putative"
FT                   /EC_number="3.4.24.64"
FT                   /note="Similar to S. cerevisiae MAS1"
FT                   /note="Similar to C. albicans MAS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44570"
FT                   /db_xref="GOA:B9W7B1"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B1"
FT                   /inference="similar to AA sequence:UniProt:P10507"
FT                   /protein_id="CAX44570.1"
FT                   /translation="MLRRLSALKKYNSGIKCRGFNTAAAPSPTYQTSILPNGLTVASES
FT                   MPGTRTATVGVWINAGSRADNPKSSGTAHFLEHLAFKGTKTRPQAALELEIENIGSQIN
FT                   AYTSRENTVYYTRCLATDIKQNVDILSDLLTKSKLENRAIDNERHVILQESDEVDKMYD
FT                   EVVFDHLHAVAFKNQDLGRTILGPREMIKTINRQDLVDYITTNYKGDRMALVGVGCVDH
FT                   EGLVKLGEKYFGNIVKSEEPFNQSGGTLPLFYGDEIRIQDDSMPTTHVALAVEGVSWSA
FT                   PDFFVASVANGIVGTWDRSVGIGSNSPSPLAVTAATGGPEKTPIANSYMAYTTSYADTG
FT                   LLGVYFTADKNANLKLLVDAIQKEWGRLSRGDITDEEVERSKSQLKASLLLALDDSSAI
FT                   AEDIGRQVVNTGYRLSPEEVFSRVESISKDDIVNWANYRLKGKPIALAAVGNVKTLPSH
FT                   KDISNGMFF"
FT   CDS_pept        711617..712903
FT                   /transl_table=12
FT                   /locus_tag="CD36_03110"
FT                   /product="actin, putative"
FT                   /product="actin-related protein, putative"
FT                   /note="Similar to S. cerevisiae ACT1"
FT                   /note="Similar to C. albicans ARP7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44571"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B2"
FT                   /inference="similar to AA sequence:UniProt:P17128"
FT                   /inference="similar to AA sequence:UniProt:P60010"
FT                   /protein_id="CAX44571.1"
FT                   /translation="MTYTAPAVVIDNGSYTTKAGFSSEDLPSLVFNSNYMKHDKTQQVI
FT                   IGDEQMENNSEQQVIKLLDDGLIYDFDNIVHNWQYVFDNVDNNNPINSSEFPLVVTEQP
FT                   WNTSKNKVNSCQIAFETLQVPIFSLVKAPLAQLYRCGKSTGLVIDIGSSVTSVTPILDG
FT                   VIQSKCSYHSKYAGDFVNLHVLNYLERKTAINNLLPSKFANSSESFKQYYISRNILQEY
FT                   KNLSLNYQIKDYQLYNHEFINVSDQQNYLENLFDPTLNKLPNIHIPEPSIDNPSSHGLT
FT                   NLVFLALKNLESTLLPQNTNDNTSQNRYQKFIEIFKLLLSNVLITGGTSAANGLPDHII
FT                   NDLRALTQKYFPNYPFSYAVQQIRPSNTENAEIWDRQFGAWFGACNLASMINDNDEKSN
FT                   SAKIALDNWFITKADYEELGEDLVAEKFK"
FT   CDS_pept        complement(713084..714592)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03120"
FT                   /product="enoyl-CoA hydratase/isomerase-family member
FT                   involved in endocytic membrane trafficking, putative"
FT                   /note="Similar to S. cerevisiae EHD3"
FT                   /note="Similar to C. albicans EHD3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44572"
FT                   /db_xref="GOA:B9W7B3"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B3"
FT                   /inference="similar to AA sequence:UniProt:P28817"
FT                   /inference="similar to AA sequence:UniProt:Q66RH2"
FT                   /protein_id="CAX44572.1"
FT                   /translation="MLRFNNSSSLLKQIRKIATTSINMSSKLSSNHTSGGEEPVVLSSV
FT                   KNHARLITLNRVKKLNSLNTEMIELMTPPILDYAKSKENNVIILTSNSPKALCAGGDVA
FT                   ECAVQIRKGNPGYGADFFDKEYNLNYIISTLPKPYISFMDGITFGGGVGLSVHAPFRVA
FT                   TEKTKLAMPEMDIGFFPDVGTTFFLPRLNDKLGYYVALTGSVLPGLDAYFAGFATHYIK
FT                   SEKIPQLINRLADLQPPAIEGDITVLSGNNQYFNQVNDILNDFSEKKLPEDYKFFLSTE
FT                   DIATINKAFSQNTIDDVLKYLENDGSPFAKKTLETLLKKPKSSLAVGFELMNHGAKNSI
FT                   KKQFELEMVSATNIMSIPADQNDFAKGVIHKLVDKIKDPFFPKWNDPSTVTQQFLKNIL
FT                   STSKNTDKYLKAPFIKKWFGVDFEDYPHQMGLPTNKQVADYISGSDGSNRTYLPTPAEV
FT                   FKHFKQKTNNKLGVEEKIRQILDLHGETAKYDHKYVTWKEDPTK"
FT   CDS_pept        complement(715393..716982)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03130"
FT                   /product="autophagy-related protein 21-homologue, putative"
FT                   /product="hosphatidylinositol 3,5-bisphosphate-binding
FT                   protein, involved in the maturation of proaminopeptidase I
FT                   protein 1, putative"
FT                   /product="cytoplasm-to-vacuole transport protein, putative"
FT                   /note="Similar to S. cerevisiae ATG21"
FT                   /note="Similar to C. albicans ATG21"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44573"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B4"
FT                   /inference="similar to AA sequence:UniProt:Q02887"
FT                   /protein_id="CAX44573.1"
FT                   /translation="MATINDLSFNPDYSSISVSTSDGFKIFNCEPFGEFYSSQESPLRK
FT                   SISNSLEDSTGSYNQIHSKNDFQDTPAKLPTAFLKMLFSTSLTIVVPQSEDNLGSRLLK
FT                   IYNLKQNLKICELNFPSSIIDIKLNRKRLLVVLDTGQLYIYDLSCVRLLKILQLSFNEH
FT                   NSNQKFIGDLGADDNSWLIIPVISTSNQTDLLNAETGSQPSTPKLTPSDSVINTGSYSQ
FT                   FIEFTRNSSLSSLKKKNKLITLDDIKKDSEGWVIVYDTINLAPVVIFEAHHSAIARICI
FT                   SHRDNKIATASVKGTIIRVFDLKEFEGKVKVHQVKNLRRGHNLVKVNSLSFHSDNHILG
FT                   CGSESNTIHLFKIHDEESELCANENNEDRTNHNSDYEDSDGDTSKSSEDLNENLANLLI
FT                   SKPLDPISMEADDKLSNSWFDKTKKLISNQYTNSIIKKLPYKGYLENLIWQPPRRSFAY
FT                   IKLPEYAPHNEKDPRSNKVEIGFNNDLVFIASYHTGNFYQYQIPKQRGSVSSISEDDKR
FT                   EECSLISQFNLI"
FT   CDS_pept        complement(717280..718161)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03140"
FT                   /product="translocation protein, putative"
FT                   /note="Similar to S. cerevisiae SEC62"
FT                   /note="Similar to C. albicans SEC62"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44574"
FT                   /db_xref="GOA:B9W7B5"
FT                   /db_xref="InterPro:IPR004728"
FT                   /db_xref="InterPro:IPR011553"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B5"
FT                   /inference="similar to AA sequence:UniProt:P21825"
FT                   /protein_id="CAX44574.1"
FT                   /translation="MSAPTPPQTGQFQVATSSQRSPVAVNIVNYLFQNPILKQRTGLLD
FT                   NTNDIEFFRFKRLQRALLSDDYKQKQQNPKNGLIPVANNEDVQKVFVLLIQNQLLLPLQ
FT                   KLHYAEVKAVKGWKPNKEKPTLKRADKAVMDPDVYYGWLYQKPNPYILLYSFLAIAGVF
FT                   AIILFPLWPNFMKRGVWYLSMGALGLIALFFATAIVRLIIYIISLVAFPKPFWLFPNLF
FT                   EDCGVIESFQPVYAWEEPKKKKGKKKKAPKLEVVEEKVGSSTGDVKATGSELSNGSSTT
FT                   GKRKVTLEEVEE"
FT   CDS_pept        complement(718787..720655)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03150"
FT                   /product="ABC-family memebr, APTPase, iron-sulfur protein
FT                   required for ribosome biogenesis and translation
FT                   initiation, putative"
FT                   /note="Similar to S. cerevisiae RLI1"
FT                   /note="Similar to C. albicans RLI1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44575"
FT                   /db_xref="GOA:B9W7B6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034348"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B6"
FT                   /inference="similar to AA sequence:UniProt:Q03195"
FT                   /protein_id="CAX44575.1"
FT                   /translation="MSTKGKGKTKNGRGDTHAKNERIAIVSVDRCKPKKCKQECRKSCP
FT                   VVKTGKLCIEVTPASKIAFISETLCIGCGICVKKCPFDAITIINLPTNLEGETTHRYSA
FT                   NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPDWEEILKHFR
FT                   GSELQNYFTKVLEDNIKAIIKPQYVDNIPRALAKSKVKQVGAILESKNERNEDYNYILN
FT                   VLELKNVLNREVENLSGGELQRFALGMTCVQDANVYMFDEPSSYLDVKQRLRAAEIIRS
FT                   LLDPTTYIICVEHDLSVLDYLSDFVCIIYGAPSVYGVVTLPASVREGINIFLDGHIPTE
FT                   NLRFRTESLQFRLADAADDLILDKSNSLEYPSMQKTQGDFKLRVEAGDFTNSEILVMMG
FT                   ENGTGKTTFCKLLAGAIAPDGNQEIPKLNVSMKPQKIAPKFTGTVRQLFFKKIRAAFLH
FT                   PQFQTDVVKPLKIEDIVDQEVQTLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQR
FT                   IICSKVIRRFILHAKKTAFIVEHDFIMATYLADRVIVFEGQPSKDAVARSPESLLTGCN
FT                   RFLKNLNVTFRRDPNSYRPRINKLDSQMDKEQKASGNYFFLENTEL"
FT   CDS_pept        723061..727281
FT                   /transl_table=12
FT                   /locus_tag="CD36_03160"
FT                   /product="chromodomain protein 1, putative"
FT                   /product="ATP-dependent chromodomain helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to S. cerevisiae CHD1"
FT                   /note="Similar to S. pombe HRP3"
FT                   /note="Similar to C. albicans CHD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44576"
FT                   /db_xref="GOA:B9W7B7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR025260"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR041150"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B7"
FT                   /inference="similar to AA sequence:UniProt:P32657"
FT                   /inference="similar to AA sequence:UniProt:O14139"
FT                   /protein_id="CAX44576.1"
FT                   /translation="MVKQYIPEEAELNPELYGLRRSHRERRGPTIVESDSEEDVAPSRK
FT                   KKKIQDDYEDEISMDEDENDEFDDDDDIYYDGSFGVGKRKKSKPKTSRKQKTKKTKARK
FT                   TKESPSPPQELRFSTRNNKQVNYAIDYDEDDADLLESEPEFDEEDEEGDYYYYQQAIEP
FT                   ENERGIDIVMDHKLNEENTEKTGDPKSDYLFKIKWTDASHLHNTWEKYQDLKSFKGFRK
FT                   LDNYIKQFIIYDDEIRNDPLTTKEDLEAMDIERERKRDEQEEYTHVERIVDSERVETDD
FT                   GETKLQYFVKWKRLYYDECSWEDAKEIAKIAPEQVTKYQQRLNSKILPSLSANYPLSQR
FT                   PRFEKLFKQPVFIKNGELRDFQLTGLNWMAFLWSRNENGILADEMGLGKTVQTVAFLSW
FT                   LIYARRQNGPHLVVVPLSTVPAWQETFEKWAPDVNCVYYMGNGEARKTVREYELYNQNN
FT                   KPKFNVLLTTYEYILKDRTELGAFKWQFLAVDEAHRLKNAESSLYEALKSFRVSNRLLI
FT                   TGTPLQNNVKELAALCNFLMPGKFTIDQEIDFETIDSEQEQYIKDLQKKISPFILRRLK
FT                   KDVEKSLPSKSERILRVELSDIQTEYYKNIITKNYAALNAGNRGSQISLLNIMSELKKA
FT                   SNHPYLFDGAEEKVLDKEGSHSRENTLKGIVMSSGKMVLLEQLLSRLKKEGHRVLIFSQ
FT                   MVRMLDILGDYMFIKGYQFQRLDGTVPSSKRKIAIDHFNALGSKDFAFLLSTRAGGLGI
FT                   NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVSVYRFVSKDTVEEQILERARKKM
FT                   VLEYAIISLGITDPNAKSSSKTEPSTNELSQILKFGAGTMFKENNNQQKLENLNLDDVL
FT                   SHAEDHVTTPELGESNLGSEEFLKQFEVTDYKADVEWDDIIPQEELTKLKDEEKRKADE
FT                   QYLQDQIAMYSRRKAAIRKFENGSSVPSDVEDSGEDSRPLRRRNAGDHQLSEKEIRGIY
FT                   RSILKWGELSGKWEQLVEEGSITNKNPVLVKHAYNEIISTSKQLVKEEEARRGVVLAEL
FT                   ERKAEEQKRRPPVPGEPNQTALWIAKKKEKKAVLFEYQGVKNINAELVLNRPVDMKLLE
FT                   KIVTKTDFMNFVLPRHPKQVQAWSCEWTAKDDAMLLVGVYKFGYGSWVQIRDDPLLGLQ
FT                   NKLFLENPSTGKDPATKQDGKETVKKVPGSVHLGRRVDYLFTLLRDEESDSSVGGSTPV
FT                   ASVRKRIKKSTPVPHNSSNSNGSHNTNTSNSNGGTANNTGKHRKPVKLESSEKLIKQKR
FT                   TNQRRNSASASPALGYAKFKEEKRELEYESMDEGSCKSIMQPVTNSLHKLHKGSKGLDK
FT                   HEWAKILKSELLNIGDFIESEVRKVQNKDKLRKHLWSFTGLYWPSKVPSNKIGAMYNRL
FT                   KQSN"
FT   CDS_pept        727796..729679
FT                   /transl_table=12
FT                   /locus_tag="CD36_03170"
FT                   /product="polyadenylate-binding protein, cytoplasmic and
FT                   nuclear, putative"
FT                   /product="poly(A)-binding protein, putative"
FT                   /product="ARS consensus binding protein, putative"
FT                   /product="polyadenylate tail-binding protein, putative"
FT                   /note="Similar to S. cerevisiae PAB1"
FT                   /note="Similar to C. albicans PAB1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44577"
FT                   /db_xref="GOA:B9W7B8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036053"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B8"
FT                   /inference="similar to AA sequence:UniProt:P31209"
FT                   /inference="similar to AA sequence:UniProt:P04147"
FT                   /protein_id="CAX44577.1"
FT                   /translation="MSAAETNQLQESMEKLNIGSTSEEQPAAATTTADQSAEEQGESSG
FT                   VAENSASLYVGELNPSVNEATLFEIFSPIGQVSSIRVCRDAVSKKSLGYAYVNYHKYED
FT                   GEKAIEELNYTPIEGRPCRIMWSQRDPSARRSGDGNIFIKNLHPAIDNKALHDTFSAFG
FT                   KILSCKVAADEFGQSKCFGFVHYETAEAAEAAIENVNGMLLNDREVFVGKHISKKDRES
FT                   KFEEMKANFTNIYVKNIDLNYSEESFEKLFAPYGKITSIYLEKDQDGKSKGFGFVNFEN
FT                   HDSAVKAVEELNDKEINGQKIYVGRAQKKRERLEELKKQYEAARLEKLAKYQGVNLFVK
FT                   NLDDAIDSEKLEEEFKSFGTITSAKVMVDDAGKSKGFGFVCFTTPEEATKAITEMNTRM
FT                   INGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAAGGLPGQFMPPMFYGQQGFFPP
FT                   NGRGNAPYPGPNPQMMMRGRGQPFPEQWPRPGPNGQPVPVYGIPPQFQQDFNGQNMRPQ
FT                   QQQQQPRGGYYPNRNQTNKRDLAAIISSVPQDQQKRILGEELYPKIVATGKAQEPEAAG
FT                   KITGMMLGLENQEILDLLDDDELFNNHFEDALTAFEEYKKSEAAGNAEEQA"
FT   CDS_pept        730707..733373
FT                   /transl_table=12
FT                   /locus_tag="CD36_03180"
FT                   /product="trehalose-6-phosphate phosphatase, putative"
FT                   /EC_number="3.1.3.12"
FT                   /note="Similar to S. cerevisiae TPS2"
FT                   /note="Similar to C. albicans TPS2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44578"
FT                   /db_xref="GOA:B9W7B9"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7B9"
FT                   /inference="similar to AA sequence:UniProt:Q9HEP0"
FT                   /inference="similar to AA sequence:UniProt:P31688"
FT                   /inference="similar to AA sequence:UniProt:P78875"
FT                   /protein_id="CAX44578.1"
FT                   /translation="MAPQQAKVFSANGSIPSPKEFEGKGKLKLSGRILNVMTSLPLQII
FT                   SDYDNKNGEYYWDVEAVRGNSALYSSQNFLAENKEWETHLIAWTGELINKKKDTSLLTA
FT                   DTLQDDPLYLDEEDKSKIEKKLCDASGTPNIHPVWLLRRDQGRWRKYAENVLWPVFHYI
FT                   QGQPSDGKAETDAWYDYVKFNEAYLNKIKSVYKPGDIIWIHDYYLLLLPQLLRMEFPNA
FT                   YIGFFLHVPFPSSEYFRCISKRSQLLDGMLGADKIGFQSDSFQRHFISCCARVLGCEVN
FT                   RDSVSAYGTTISVETLPIGIDTEKIEHDAFSKNLGVEEKVQALKQVYKGKKLIIGRDRL
FT                   DKVRGVIQKLEGFEIFLDMYPEWRETVVLIQVSSPGYSHSANVETRVTEIISRINSKYG
FT                   NLNHTPVLHYQMRVAKEEYLALLRVADLALITSVRDGMNTTSLEFVICQKYNNSPLILS
FT                   EFTGTATVLKDAIMVNPWDSVGVAKTINDALMLSMKEKVSLESKLYEKVISNTVQNWTS
FT                   TFICDILAHSIVTHTNSYTPALNRPLLLNNYDESERRLFLFDYDGTLTPIVQDPAAAIP
FT                   SDKLNRILDVLSSDPKNQIWIISGRDQAFLEKWMGNKNVGLSAEHGCFMKDIGSKEWVN
FT                   LAASFDMSWQEKVDDIFKYYTEKTPGSNIERKKVALTWHYRRADPDLGNFQAEKCMKEL
FT                   NDTVAREYDVEVMAGKANIEVRPKFVNKGEIVKRLVLHPHGAKQDKHPSGHCTKDIPID
FT                   QLPDFMLCLGDDLTDEDMFKSLIEINKKWTNDNRPTNKFGSYGVYPVAVGPASKKTVAI
FT                   AHLNEPRQVLETLGLLAGLVSIFESAGTVDLDDRGHLANSVSSERSKHAVSKAVSLRKK
FT                   ASQEKEIVKEAPTNGAK"
FT   CDS_pept        734190..735467
FT                   /transl_table=12
FT                   /locus_tag="CD36_03190"
FT                   /product="alcohol acyl transferase, putative"
FT                   /note="Similar to S. cerevisiae ETH1"
FT                   /note="Similar to C. albicans ETGH1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44579"
FT                   /db_xref="GOA:B9W7C0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C0"
FT                   /inference="similar to AA sequence:UniProt:Q9Y714"
FT                   /protein_id="CAX44579.1"
FT                   /translation="MGILGWGFRSNIKIHQSDDEGSATLALKDKGTIKFSQFIKQDLPI
FT                   LDESQKLWLNPLLFNGTLQTLYYTSMDSSNKFLIYYGRELFTYSDGGICSLDWVIPKPD
FT                   DEQKFNTIRKETLPEGFPRLQPRCRYFTNEELAELHQEDSTSEKPIVVIIHGLGGGSHE
FT                   SLIRDFAETIEKKTSGWGIVVINSRGCGRTKLTSGKLFNAGSTNDIREVLQDFKKRWPN
FT                   RPIYLVGFSFGGALTANFLGEEGEKENPENLVKAACTVGCPWDFVDGAYHLQKSWTGKY
FT                   LLSPALAKFLAKIVTNNYKELEAYAPDIVNKETLKTIKNCKTLWEFDDNVTCKTTPYKN
FT                   AFEYYQELSPIKKISQIKTPLLALNSTDDPAVGVKFPISQMKANPYFCLVETDLGGHLG
FT                   YVQSNGEFWCVQLVEQFFQRFEELVK"
FT   CDS_pept        736710..738659
FT                   /transl_table=12
FT                   /locus_tag="CD36_03200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44580"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C1"
FT                   /inference="similar to AA sequence:UniProt:Q09889"
FT                   /inference="similar to AA sequence:UniProt:Q09729"
FT                   /inference="similar to AA sequence:UniProt:P43602"
FT                   /protein_id="CAX44580.1"
FT                   /translation="MFQHHLNLALFDIKLKTAHKNLLLIKGNEHEIETLPFEGSVKLSL
FT                   NEDIHIKKITLSLVGEFYYEYMDKVTHQQYLDRLCVLKVDWGNLLSNDEGKVVFGNYGD
FT                   RTIPMYKLKNLKNGELGFSVSGSNTGLNTPSPGSSSGTATPTRPQALRTKSTPIFFKDK
FT                   DAVSSKILRVPNSGVDGTPFKNVQMSSNHSFLLPKGNYNLPFKVYLPTNIPETVESLPL
FT                   GTLLYKLQCNIERGRFEKSVNVSKHIRIVRTLNPRNLNLTDSIDVSNTWVGKLQYNVNM
FT                   SKKGVAIGSTIPINITIIPIVKGLSLKAINGCIVEHYHVQIGNERSPEYERVIGKQDLD
FT                   TPNSDDLPYEKWEFRIHYKVPEHLKKITQSCELRDNMIVVKHRLRVSIQLRNSGGHVSE
FT                   LRANLPIFVYISANSGHVIGRHYDVDNHHGTFQLDYQKEDILFHHHDRREPLRVPGTSA
FT                   TETEEENESEDSDGEDLDREDSAPPMYEKHVFDKIYDMNLPQTPLEQFRSQQATPSHSN
FT                   NNSSVNVSSYFDIPFSQALENNSKKKQVQTPIFDIDYMSHIPSYTEALDDDDDGGGDED
FT                   FAPGYSDSGSENVSVVSGGTTPIKITLPKNNSTGHFKSSSKHNSLPSTKSNSGSKSDLE
FT                   SSLKLRFFHHSKKK"
FT   CDS_pept        738871..739695
FT                   /transl_table=12
FT                   /locus_tag="CD36_03210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44581"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C2"
FT                   /inference="similar to AA sequence:UniProt:Q5AI10"
FT                   /protein_id="CAX44581.1"
FT                   /translation="MFNNDPFKIYHDNVHKNIERMKREKKLIVFSQRIPTDKSCHSHLH
FT                   KRQPLSNITSARINKPKPASKSNLLSTRNLLSKFDKPKREIFSNKSYEFEVLDKRGLNN
FT                   KYTKIENEFESKNIDSKDPLVSSFLKKFKEVINWYKLSKFQFEATNTIYKEGVNGSGNF
FT                   DQADKSVITRQIMQNMVKRNYIRPEYSRIKITATHKVNQIGKLSEFMYVVRVLDETNNY
FT                   ANLKQTEKTVLLMNVANCEIKVEDRLNLNDLCYLMDYRGKKLEVYLRWHVVK"
FT   tRNA            740375..740467
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CD36_tRNA_0007"
FT                   /product="transfer RNA-Asn (GTT)"
FT                   /anticodon="(pos:740409..740411,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 33.61"
FT   CDS_pept        740767..741822
FT                   /transl_table=12
FT                   /locus_tag="CD36_03220"
FT                   /product="lipase 2, putative"
FT                   /product="tri-/di-acylglycerol lipase, putative"
FT                   /EC_number="3.1.1.3"
FT                   /note="Similar to S. cerevisiae TGL2"
FT                   /note="Similar to C. albicans TGL2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44582"
FT                   /db_xref="GOA:B9W7C3"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C3"
FT                   /inference="similar to AA sequence:UniProt:P54857"
FT                   /protein_id="CAX44582.1"
FT                   /translation="MIKSIRFYSKVIDLKHEGKTAAKILKSEYKSLKDHYKAPKYPIVL
FT                   CHGFSGFDRLSLMPIPKEIGHQIDKAKEYAPRGLIELDYWYGIKEALEKLGSTVFVAKV
FT                   PAFGDIKSRAISLDKFIDKECKHLRQNESKSSLYNDSNHDSTTFENKNEPIKVNLISHS
FT                   MGGLDSRYLISKIHKDNENYKVASLTTISTPHHGSECANFVVDLIGNNTILKDICPRSI
FT                   FDLTTSNMKKFNQTVKDDPDVQYFSFGARFNPRWYNLFSLTWLVMKYEIKKDKARELRR
FT                   LIDNDGIVSVESSKWGQYIGTLDEVDHLDLINWTNRARSTFDKVMFAQDPTFNPIALYL
FT                   DIADKLAEKGL"
FT   CDS_pept        complement(742243..743679)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03230"
FT                   /product="vanillin dehydrogenase, putative"
FT                   /product="hydroxybenzaldehyde dehydrogenase, putative"
FT                   /product="aldehyde dehydrogenase, putative"
FT                   /EC_number="1.2.1.28"
FT                   /note="similarity to prokaryotic protein"
FT                   /note="Similar to C. albicans ALD4"
FT                   /note="Similar to Acinetobacter sp. hcaB"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44583"
FT                   /db_xref="GOA:B9W7C4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C4"
FT                   /inference="similar to AA sequence:UniProt:Q7X0E2"
FT                   /protein_id="CAX44583.1"
FT                   /translation="MTSRTIPSIIAGQEVSDAEFVHPVYSHEDTNKVIHTFSYIQVSSN
FT                   IINQLAENSKNGFKEWSNTPVSTKKEIFYKCLEILREKKNEFIEAHKEIGGPDWFANVN
FT                   IDNAIGHLEEYIGNLSNSEGELFHSEHNKLALTVRSPVGPVLSIVPWNAPVILGARSIF
FT                   APLAAGCSVIAKSSEKAPRAVYLLVKCLIEAGVPANVVQLVHLKPEDNPKFLDALLATG
FT                   AIKKINFTGSTLTGKQIACTAAKYSVPCLLELGGKNVSIVCQDADIKKAVGNIIWSAWA
FT                   HKGQICMSTDKVFVHDTIYNDFKSELIKIASDIVQDPDYSIAHRDPLGASKVVELLNDA
FT                   LKKGASLIFGNLDDSEVKKNNVVSPMVLEGVTPEMKINSTESFGPIFAIEKFTDVNAVV
FT                   DRVNEDDYGLKASIWSSNLMNAIDLAKRIECGGVHINNSSISDESHLPHGGVKSSGNGR
FT                   FNSKWGVNEFSFIKTITANP"
FT   CDS_pept        complement(744261..747836)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03240"
FT                   /product="transcription modulator, putative"
FT                   /note="Similar to S. cerevisiae SIP3"
FT                   /note="Similar to C. albicans SIP3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44584"
FT                   /db_xref="GOA:B9W7C5"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR039463"
FT                   /db_xref="InterPro:IPR042067"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C5"
FT                   /inference="similar to AA sequence:UniProt:P38717"
FT                   /inference="similar to AA sequence:UniProt:O13818"
FT                   /protein_id="CAX44584.1"
FT                   /translation="MVKSPKSEKSKPLSSQPHQETLLHHFKLISVNFKEAALDSPSFRA
FT                   SMNHLDLQINTIEQWLAALASSFKKIPKYLKEVQSYCNSFLEHLVPTFIQDGIIDQEYT
FT                   VTGLNTTLDGLKTVWGLSIQALSVDAKNLKSIELFKRHHVTKYKETRKRYEDYQAKYDK
FT                   YLSIYLSSSKSKDALMVIEDAKQLYQVRKEYIHASLDLVIEIQSLSKNLNKLLVGVNTD
FT                   LWRNKWNIFGSRGVGDTIREEWDKIQRIQSWNDSYTLAIEKLNSDMLTARNQVEEGCHI
FT                   QFQPSTNVNDYKSTIINNRTLRDIDEPGIEKHGYLFMKTWMEKSSKPIWVHRWAFIKNG
FT                   VFGLLVVSPSQTFVQETDKIGILLCNVRYAPNEDRRFCFEIRTNDFTAVFQAESLVELK
FT                   SWLKVFENEKLRISGPEALDNGLFNIASGRFPPIISEFSSTVDTVIDQQLTNAKVTLAG
FT                   GQVVAASSLSNHLERFEDFFKKYMYFEIPKICPPFMTDTTKSSIMAYCLTSPTQIPNAL
FT                   TANIWGSVNWGLYYLHDTARDSSTYLPGKDTEMIKFQEEHFENDKFYPDFYPKEYVNLD
FT                   IQMRALFETAVEPGEYCVLSYSCIWSPNSKQELSGRCFVTNYHMYFYMQALGFVALFKG
FT                   FLGHLVSVDFVSQKNYDLIKVYNIDGVIKMKVFLDDANCIKKKLVYLINNIVSDKPKSL
FT                   QGVLADFSDIEKQIAIEKSDEKNLREINQLSKGLSSKSLASEKLLLSGETSSILPGQSG
FT                   RMIKHKVNFTPDYNLISERTYPAPPKAVFHALLGDNSVIFRSQLSFASTKYFLQKPWAT
FT                   SNKGTLYRDINVPAMYDGKDCFVQVKQEIDNMEDNTYYTFTHELSKFELLLGSPYKAVF
FT                   KIVIVEHISKRSKVFIYSKIYFDRLSLWNPLVIRLNNQVDVNKVKKLEKSISEAVKEIG
FT                   THGMIVRAIYLYGKLSHTSEPEAVTSTSVIKFGIVSLFKLGLGKAFSKAHGFALNAIIK
FT                   PFQLMVLLLESLRMNVFLVVIIILLSLFNLFLAGKTATSYWNTRSASKLAQEYVTKEPR
FT                   MLQRSIYLKDLENILNKNVTIAESRPFSLFKQNSFIFNLDADTEWSNYFGSNSRDVARS
FT                   LKNSFQDIGIKRHDLLVKLRILKSMEEEIIQAEWQNWIMSEAQKCDYVMDNVVGQIDKV
FT                   DNYQEGIDNLVEYCQECKAILSELI"
FT   CDS_pept        complement(748273..751227)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44585"
FT                   /db_xref="GOA:B9W7C6"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="InterPro:IPR038096"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C6"
FT                   /inference="similar to AA sequence:UniProt:Q6BP92"
FT                   /inference="similar to AA sequence:UniProt:Q5AI04"
FT                   /protein_id="CAX44585.1"
FT                   /translation="MPNLPSISIPPETPRAKAKDSNASNLGSVNRNILTPSFSFGLNFS
FT                   PSFNFNSPSIQAISPGNFLHISNSFNKAINRTPITSASSALVPPSTGKKHNRFLEALTR
FT                   SSQQDDENNKEEDNVSDKENNDEIWSTINTSQAQHNSTNQTSMYEDENDHEKDNSFLRP
FT                   NKLELKKIEENKKSPSLDRAADISPKTTSDNHVVKKRKLSTDHGVTDSPNNSVASKIDS
FT                   TMQSPTNYRKQSVAYSTKSNSSSATNADDKVWWPELDDVLIKSLYKYKKFKEDQDSFDA
FT                   SSILKKTSQNKIISRMLLNKTGVLRTTKQISSRIFRLSKSGKLVKETKTPQTGSFGNND
FT                   LDSILSTPLRSLVNARGSIDSIKLNTVIDEELDMLLGTSPINDEFDDTSYKLEIRDFRL
FT                   SFRSVHDHHIFTNLVSIDVNKSLSVPIEEAIRMKLESKKVPAWIINHDLNLNCHHIASS
FT                   TPCSTATASHQFQQSHLNLTGGNFESHMTLDVSCGEKSQRMLSWRSYIVVYKKGSKLLE
FT                   VVDVINGYFSESSKSYTLQIPFLKNFFLGYITYLANGAAITPDENLKIVQIIYSNPKSG
FT                   AMEFDLDESTVRAYIIHELNMAGTSGSSKINIVDVHSKHQSALKQEHADIDDNETVLAD
FT                   SSPFKLSPNSSRNWDTPSKSRLRIDAKKANVDGGAIAGPLTAPIYNAELLNKKMLDEQE
FT                   KLKSNLQKDQVRPPLMHSQSVCNVNLSTQRGNSSPEMANNSTLAFSTPMTNRQAPIQNS
FT                   LVPSSNFTPYQIAQKSFIARTLSESQLQSQVDIQEQSNTQSLPPQQLEGMVNPQIHYVQ
FT                   TQMPSQASTGVAIALPPQVQNQLPQQIVHHIPLQNLGQTGSISQQSFPLVTNNNVITPD
FT                   NNFMRQQWQQQMYFQQVAQQQFQNNGFHMSTVSGKVQSTKHNSKMVKHPSNPSSSQQNV
FT                   HNKENIKPRQITFGPILGHDPSRDLKTIKKQNTKNNGIVQCFPANTQIMYKPKK"
FT   CDS_pept        complement(752125..753543)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03260"
FT                   /product="serine/threonine protein kinase, putative"
FT                   /note="Similar to S. cerevisiae SPS1"
FT                   /note="Similar to C. albicans SPS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44586"
FT                   /db_xref="GOA:B9W7C7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C7"
FT                   /inference="similar to AA sequence:UniProt:P08458"
FT                   /protein_id="CAX44586.1"
FT                   /translation="MRIIKDKKQMASLNSPTLSSSSPSSGQSSNYVLSKCIGRGNFGDV
FT                   YRAQQVSTNKLVAIKVVNLDESPDDIKQIIKEIHFLSRLRNPYIIHYIESFSQEYNMYI
FT                   VMEYCGGGSCSDLLKYHKKLPEEVVGYIIHKVLLGLQYLHQEHKVHRDIKSANILLTEL
FT                   GQIKLGDFGVSTEITITRMKKNTFVGTPFWMAPEVITRAKLIEGNVKNCGNSNGNYSAG
FT                   ASAGYNEKADVWSTGITTIELVTGSPPLSQYDPLKILFDIPKKRPPLLSGIDFSDNIKS
FT                   FVKHCLIKEPDKRSSATVLLQHKFFKACVTGDVQARLINLISLKIANDDHKAGYKPRFK
FT                   ISGKLDNGKENLEAPIEWEFTNTLIQQQKTAPPSPVLEEVDEFIDDSSSNYPSNALGHN
FT                   NSTSLKLFSSKHHVTSRKCELLFNCLHMVQLRGKDEYTRCQVDKFIGSICEFEEKNPGF
FT                   CNAIVEELEKHIYH"
FT   CDS_pept        complement(753904..756786)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03270"
FT                   /product="ADP ribosylation factor, putative"
FT                   /note="Similar to S. pombe CSX2"
FT                   /note="Similar to C. albicans AGE1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44587"
FT                   /db_xref="GOA:B9W7C8"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C8"
FT                   /inference="similar to AA sequence:UniProt:Q9UUE2"
FT                   /protein_id="CAX44587.1"
FT                   /translation="MELLSQISFPYYQEDDSCVTLNKLSFTDELDSRRSVIALNEKKQV
FT                   DTFNTVYTNTQQIVPQLASYIENPDDEEKSQFPLLIKISPEFNKLKLHVSIKPVVGFES
FT                   RSLIIVKSRGVTDVDVLKNQLYDDNTQDKPMTELSKLEYRKLPIEENNHSFQKIIINDF
FT                   FDPRIVNNTKLNISLWEHDSVSNEFRHFLNFSVWIDRLVPVEPSINRSSFSLATKGQPL
FT                   EEKSPESKLFSLGDFRKEFKIDIEDGPEFRKTLTRLENNIPWAKKGYSNLIDEFRMLES
FT                   SVRRVTNSKIKVMDAIDHIVDLESTSLLKEFGFKHDFHVVFKAMFEPFEKNLNFFFENV
FT                   CDHKLLNKIYANIGFTQIDSSAVYLELQKKFEADSKEYYSWLNKYLSNEKERPESKLLA
FT                   KRKVFELSKFDYLNSLTKVTNNQYVNEVLENFFKFLNLKYDQRYPRLLDYHSFKDKKSN
FT                   QNLLGDNYQIYMNVLLRFNSERYQFRQMIEACQTNEELTNLIRCNRLNHKSFSTSSSSS
FT                   SPPTSTSSPHNLITSSIDEFIITKENWDLIFNDSKPPDNEIGPDDSEKSGILFTLGGQK
FT                   KQGWHKEWVVLKKGQLIEYSDWRKGRTPINKPIEIALASVKAITHDKRQFCFEVLTSKG
FT                   SKHVFQAFDNDDRNKWVKALHNAGQLINTKRLEQAHAKSSPHEGRKKTIGKLITEFKDK
FT                   PIIPGQDRSISPISLTSKAPPIEKDYLQMVRSAPDSDNNVCIDCGSTESVEWISINTLT
FT                   CFCINCASCHRNIGSHITRIRSLKMDKFENETELLLKYINNRVVNSYLEENLPSKEKIT
FT                   SDADNESRLNFIRNKYQLKKYKSIIPDIDNLLIKAIQKINVPEVLKYILCGADINLNIQ
FT                   INIPNRNEYLVITLFEYSLRKYIEIKDGHDRELGYKPKKLFIISELLILNGCKVSDHIK
FT                   DLQKEDLGLTDAAVEYWKIRSLKLSGGKAS"
FT   CDS_pept        757919..758800
FT                   /transl_table=12
FT                   /locus_tag="CD36_03280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44588"
FT                   /db_xref="GOA:B9W7C9"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7C9"
FT                   /inference="similar to AA sequence:UniProt:P47153"
FT                   /inference="similar to AA sequence:UniProt:O13752"
FT                   /protein_id="CAX44588.1"
FT                   /translation="MVLSYIIEKIPVLTEDPFLQYRPFPEVPKTLFQRHWHEIFASFTF
FT                   YFIIQHLSGPIFSIIMGPRYTKLSKSTRVNFDVHVTSMVQCFVSFALMVPHLNNPHWAN
FT                   RLNDPVNSLLGSTDFGGLVCAVTMGYFIWDLYVCAKYFSLFGVGFLFHGFAAMYAFATG
FT                   FVPYCQPWAGPFLTFELSTPFVNINWFASKLPAGTFSEKTIIINGILLMVTFFCVRIIW
FT                   GFYAVSQLAVDMLASLDQVNKLLPISLLILNFLLNSLNVFWFYKMVMIARKKARGQEST
FT                   REAANEVREKIE"
FT   CDS_pept        759364..759987
FT                   /transl_table=12
FT                   /locus_tag="CD36_03290"
FT                   /product="RAB-family small GTP-binding protein, putative"
FT                   /product="YPT1-like RAB GTPase, putative"
FT                   /product="transport GTPase, putative"
FT                   /note="Similar to S. cerevisiae YPT1"
FT                   /note="Similar to C. albicans YPT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44589"
FT                   /db_xref="GOA:B9W7D0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D0"
FT                   /inference="similar to AA sequence:UniProt:Q8J031"
FT                   /inference="similar to AA sequence:UniProt:P01123"
FT                   /protein_id="CAX44589.1"
FT                   /translation="MNNEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTPDYISTIGVDF
FT                   KIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQ
FT                   EIDRYATGGVMKLLVGNKADLSDKKIVEYTAAKEFADALDIPFLETSALSSTNVEQAFY
FT                   TMARQIKAQMTNNANAGNVSNAKGKSNVNLRGESLASNQSNSCC"
FT   CDS_pept        complement(760286..760831)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44590"
FT                   /db_xref="InterPro:IPR020915"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D1"
FT                   /inference="similar to AA sequence:UniProt:Q5AHZ9"
FT                   /protein_id="CAX44590.1"
FT                   /translation="MSAIKLAVPEVPKAPELIPVFTFNLKLASDPASIYVNNETDKTLN
FT                   LATIANGEVKTVPNKLDLELDIHSIYGTDDLNIKNSVSTATLDCKLYGKTANGSGAFIY
FT                   YSGKVQLDETSVSVFTKKTKEAAIEDSYVTCNPTFYFDDKVEDKYKWVLKENFFAKGRF
FT                   GRDEDDVLYVQYYVYVVR"
FT   CDS_pept        761705..763150
FT                   /transl_table=12
FT                   /locus_tag="CD36_03310"
FT                   /product="26S proteasome regulatory subunit, putative"
FT                   /note="Similar to S. cerevisiae RPN3"
FT                   /note="Similar to S. pombe RPN3"
FT                   /note="Similar to C. albicans RPN3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44591"
FT                   /db_xref="GOA:B9W7D2"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="InterPro:IPR035267"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D2"
FT                   /inference="similar to AA sequence:UniProt:O42897"
FT                   /inference="similar to AA sequence:UniProt:P40016"
FT                   /protein_id="CAX44591.1"
FT                   /translation="MPESNDIKMKDVQQDDVSSEIDSLVKEIEQSFILLSKVATTFDNR
FT                   YVSKVFRDLGPLRRKLVKNGNSVLATVINNTYSQNHNAKAYLLKYLNESPSSVGNDAMD
FT                   VDNIVLIPEIELYIHLLVQVYLLDTGKLQELNSLGEHVVQLMKSFNRRSLDFIQAKVWF
FT                   YVCRAKELIGDLYSIRPELSYSLRTATLRHDIETTASIITLLLRNYLLTHDINQASDLV
FT                   EKVEFPENAGNALVARYSYYLARINAIQLDYSTANECAVTAIRKAPQTSLANGFVQAAT
FT                   KLSIVIELLMGDIPELKVFKNKSGNLEPYFNVTKAVRLGDIKLFGEVLHKFENEFKKDD
FT                   NFTLISRLRQNVIKTGIRIISLSYSKISLKDICIKLHLDSEESTEYIVSKAIRDGVIEA
FT                   SINHQKGYMQSKELLDVYSTKLPQAEFDQRIKFCLALHNESVKSMRYPNDNEKGNVNKD
FT                   IEPSEEIELLKAIEEGDLDDFMD"
FT   CDS_pept        join(763326..763399,763479..765102)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03320"
FT                   /product="RNA polymerase II mediator complex subunit,
FT                   putative"
FT                   /note="Similar to S. pombe MED17"
FT                   /note="Similar to C. albicans SRB4"
FT                   /note="Similar to S. cerevisiae MED17"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44592"
FT                   /db_xref="GOA:B9W7D3"
FT                   /db_xref="InterPro:IPR019313"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D3"
FT                   /inference="similar to AA sequence:UniProt:P32569"
FT                   /inference="similar to AA sequence:UniProt:P87306"
FT                   /protein_id="CAX44592.1"
FT                   /translation="MVEKQFNIDLELNDTGHIDPFLQDEDKLKLEELIPRILFERKSFL
FT                   NVTEDSLRKEIDNSLKPSEEASLNTEESREETIETDQQEVFNKHKFELSKNINNALNET
FT                   QLSLDFVSLLLSSVKPNLAKSTVSPHLSKFVKPTSLNSDRLGQESNGNQESKVTGSFGQ
FT                   GWKLESLGKITDLFKEASTNLNDQVIKERRYWNMINLVLANDEVLFRMRDPQNNARAIG
FT                   VKYGYGDSGSNFHDQGLALLRKDNQTGEISFHPISSINNAKIVEKVSKFIRVKILSQID
FT                   GDYMLTGQSVFNFDFQKSNQSIINDIEKARFFLFEEDLFHQLIREAKLLVNYNVSIISN
FT                   KIIIEINNVIIEIESIVYDELNEEELENYYQNISEYSTLHNKKCQLILNYLKLMLCCYY
FT                   KYNLKLKQKVPTALTKWKQSNSHPLILRPLVGNMRHELNLLNMKSVLDRLMQVHETELS
FT                   HSKLDVEKFINLATRSKKQNPFQKSIEKPVSKFHLVLRNKTSNVLDVNIQLTTNESFVN
FT                   LIINMTIIRFETENDFTNNVNGINVLQLGFSDFNEIEECLDWSIQNFV"
FT   CDS_pept        complement(765167..765670)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03330"
FT                   /product="conserved hypothetical protein"
FT                   /note="in S. cerevisiae, involved in mitochondrial DNA
FT                   maintenance and required for slowed DNA synthesis-induced
FT                   filamentous growth"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44593"
FT                   /db_xref="GOA:B9W7D4"
FT                   /db_xref="InterPro:IPR018815"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D4"
FT                   /inference="similar to AA sequence:UniProt:P47155"
FT                   /inference="similar to AA sequence:UniProt:Q5AHZ5"
FT                   /protein_id="CAX44593.1"
FT                   /translation="MQFLSAKILLYIRVFALVVVSFFLIKDPDALSMAGFIVLLGQAMQ
FT                   VPLIRLTPTNPLLGMTSVVFVTLALSDLIPLLAENWSYFENLVPIRLSGYFCLAAYIYF
FT                   VPTSIVSNSLVITYVLFEIWGNFLIYNNLRDEKYYRMKKFVEENSEAIRTAHDEQVRVI
FT                   ELDE"
FT   CDS_pept        complement(766061..767503)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03340"
FT                   /product="ubiquinone biosynthesis monooxygenase, putative"
FT                   /EC_number="1.14.13.-"
FT                   /note="Similar to S. cerevisiae COQ6"
FT                   /note="Similar to C. albicans COQ6"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44594"
FT                   /db_xref="GOA:B9W7D5"
FT                   /db_xref="InterPro:IPR000689"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D5"
FT                   /inference="similar to AA sequence:UniProt:P53318"
FT                   /protein_id="CAX44594.1"
FT                   /translation="MISRFVRTLATSTKFQDVVIIGGGPAGLTLLAALKTSPKTKHLKC
FT                   TLIEGSSLDNVRKFHKDPPADYTNRVISLTPKSIDFMQNKVGSWDFIHEDRVKAYDGII
FT                   AYDSQDANSRIEFDISTIGQSMLAAMCEVINIQSSLLAKIESLEDKSTTIKDNSKVVEI
FT                   VNPIEPDLDNHNLTEIDTSVSEPKLDWPIVKLENGESIQTRLLVGADGYNSPVRKYAHI
FT                   ESRGWQYNTFGVVATVKLQYEDFRAVGWQRFLTTGPLAILPLSEDNATIVWSSTPELAD
FT                   LLLKVNEKIFPQLVTAAMVLEEVDLNYIYSVLQEDPNDFSVLKDIEWRLSKFNPEELEE
FT                   RYPLPVVEVLSGSRAKFPLKMSHADTYVAPRVALVGDAAHTIHPLAGQGLNMGQSDVAA
FT                   LVEVLEKGIDRGMDIGSTLVLENYVANAWPSNHALLGICDKLHKVFSTDFYPLVWARGF
FT                   GMKSINSLGTIKEFMMKSISGR"
FT   CDS_pept        complement(767931..768965)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03350"
FT                   /product="transcription initiation factor IIB, putative"
FT                   /product="general transcription factor TFIIB, putative"
FT                   /product="transcription factor E, putative"
FT                   /note="Similar to S. cerevisiae SUA7"
FT                   /note="Similar to C. albicans SUA71"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44595"
FT                   /db_xref="GOA:B9W7D6"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D6"
FT                   /inference="similar to AA sequence:UniProt:Q05959"
FT                   /inference="similar to AA sequence:UniProt:P29055"
FT                   /inference="similar to AA sequence:UniProt:O13749"
FT                   /protein_id="CAX44595.1"
FT                   /translation="MSPSTSTAVQEYIGPNLNVTLTCPECKIFPPDLVERFSEGDIVCG
FT                   SCGLVLSDRVVDTRSEWRTFSNDDQNGDDPSRVGDAGNPLLDTEDLSTMISYAPDSTKA
FT                   GRELNRAQSKSLVDKKDNALAAAYIKISQMCDGYQLPKIVSDGAKEVYKMVYDEKPLRG
FT                   KSQESIMAASIFIGCRKANVARSFKEIWALTNVPRKEIGKVFKIMDKIIREKNAANPNA
FT                   AYYGQDSIQTTQTSAEDLIRRFCSHLGVNTQVTNGAEYIARRCKEVGVLAGRSPTTIAA
FT                   TVIYMASLVFGFDLPPSKISDKTGVSDGTIKTSYKYMYEEKEKLIDPSWIESGKVKLDK
FT                   IPKN"
FT   tRNA            complement(769454..769569)
FT                   /locus_tag="CD36_tRNA_0008"
FT   CDS_pept        770855..771682
FT                   /transl_table=12
FT                   /locus_tag="CD36_03360"
FT                   /product="dolichyl-diphosphooligosaccharide-protein
FT                   glycosyltransferase delta subunit precursor, putative"
FT                   /product="oligosaccharyl transferase delta subunit,
FT                   putative"
FT                   /EC_number="2.4.1.119"
FT                   /note="Similar to C. albicans SWP1"
FT                   /note="Similar to S. cerevisiae SWP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44596"
FT                   /db_xref="GOA:B9W7D7"
FT                   /db_xref="InterPro:IPR008814"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D7"
FT                   /inference="similar to AA sequence:UniProt:Q02795"
FT                   /protein_id="CAX44596.1"
FT                   /translation="MKTSVFIAIFNLLVCALAYADLTGTIKVNDKKITLGEFNTQEVRQ
FT                   LTVNSPKDIIEIDLNSKDIDGKPDQIMISLADVQNPAIVTHYVPVVKESKIKLNIKALS
FT                   IPEVLKTKDKLVLAIVIADSKSKNNMIRRLVEVLPSPEFKSTSRYQAKPRIGIQPEIHH
FT                   IFKEDEKTVNPIVPVLFIIAAFTLLLCLFGSWVGFIGIDNLFRTFKTISKVQLLHNVSF
FT                   LISVLGFELNFAKYYLGQSIFTTLFYGFILSIPCVYFGVSVLRSLAKNRALGK"
FT   CDS_pept        complement(771792..772343)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03370"
FT                   /product="mitochondrial inner membrane protease subunit 1,
FT                   putative"
FT                   /EC_number="3.4.-.-"
FT                   /note="Similar to S. cerevisiae IMP1"
FT                   /note="Similar to C. albicans IMP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44597"
FT                   /db_xref="GOA:B9W7D8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR026730"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D8"
FT                   /inference="similar to AA sequence:UniProt:P28627"
FT                   /protein_id="CAX44597.1"
FT                   /translation="MTFFESLKFVGSTLSWTLRAGCIAHLIHENVYEFTETRGESMLPT
FT                   LQNQHDYVHALKKYKYGRNLEMGDCIVAIKPSDPSHRICKRITGMPGDMILVDPSSSSE
FT                   LTNTPNEIVQHDGYNKYIRIPEGHVWCTGDNLCHSLDSRSYGVVPMGLITGKIVAANSM
FT                   SEGISTLYNFRWITNTLQDE"
FT   CDS_pept        complement(join(772649..772908,773241..773373))
FT                   /transl_table=12
FT                   /locus_tag="CD36_03380"
FT                   /product="40S ribosomal protein S22, putative"
FT                   /note="Similar to S. cerevisiae RPS22"
FT                   /note="Similar to C. albicans RPS22"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44598"
FT                   /db_xref="GOA:B9W7D9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7D9"
FT                   /inference="similar to AA sequence:UniProt:Q96W54"
FT                   /inference="similar to AA sequence:UniProt:P0C0W1"
FT                   /inference="similar to AA sequence:UniProt:Q3E7Y3"
FT                   /protein_id="CAX44598.1"
FT                   /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKLLTVMQKHG
FT                   YIGEFEYIDDHRSGKIVVQLNGRLNKCGVIQPRFNVKINDIERWTDNLLPARQFGYVIL
FT                   TTSAGIMDHEEARRKHVSGKILGFVY"
FT   CDS_pept        774049..777582
FT                   /transl_table=12
FT                   /locus_tag="CD36_03390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44599"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E0"
FT                   /inference="similar to AA sequence:UniProt:P36097"
FT                   /protein_id="CAX44599.1"
FT                   /translation="MASSSQLSTSANELSQNERLLSSSLFDKVRPVCIELSEASIVQPL
FT                   NTNKVVNLMISIEDILKRHHDEYYSNGNFKIYQISPKLADYIFYPLSNILKQPVLDDTI
FT                   IQHLFGIIGFLVEYSWSFNVNFVLTDQLLPLAIYLSSGDLSREPLPITTKSIQFKLATV
FT                   AVLYNITSTLNKEYFQYQTEKRLLFISNVITICLSIIVNSRVDSQDTIQLVLKCLDLIS
FT                   NVKKYLNSSQLSIILPGIVSSITKFISLNSNLNYQIIIQSLRLLSGFICVSFNDRELDA
FT                   QIELNEGVNNISDIHIVWDDDNETLDNNSIFSDVTITENDHRSNVWLKATSKQLKLSLI
FT                   IIFKSILLGPKNRQRLRSKQELYDEVLEFVKTVLKNCFNSLFKEFASLAVDIVSILGYV
FT                   TSEDNKEIAEKADKLSNTICMVIEGQTNKEEVFFELVKAKLSDLIDNKLSGIVFTLDED
FT                   KIALTVGTMMFNFSLLLCLSRRARLDFDDLDSLKQRCLALLIEYVADMFKFESSKQIKG
FT                   SRSGGLLETTEMTNELDSIELPAYINAKGVVKQEPSKKEHDRRAHIHNLKTISRNWTTS
FT                   EINNSPGSTLIGISSKFSERILRNFISYLSGLKYESANNSTLTELENIFELADNNDVIA
FT                   KSTTLWVASSYCELPLSKLGNFDLGDYLVLDNEEDMEIDDDTKEMSFLVLSRAEELLEE
FT                   ISESQEKCSSQTYILAYSAALQAIKVITGSISLDQFRTNFLMDHLLSVFQALTYNDMPE
FT                   IQLQAQSMLKVVLDTYYNGSMVNLISDNSDYLIDSISLQMSVASNLTPMLPGILLIIIK
FT                   VAGIQLLESNQLHDVLTDIFVILDSYHGYNKLVESFFIVFEALIDQIHDKFDSQLKVNF
FT                   EESPKVNTSLYKPWGMTNKDQLLELLDESNKMVDKYEGYDSNKEYFKRKADLPFSEMQT
FT                   DSDDEEEEEDNEANIDDDEEEKEETWGSPISKDVYMILLRIFNYGFTLISQESYTLKTQ
FT                   IIKTLRLLLPLLCTNYKLLLPVLATNWQLLIALVIGSQSLSTSIESNGLYASEDIGVMT
FT                   QALQFVTEILEEDKKRYEHFFNKKFQEAWDFISRYSKLVPQREVKSTNNITEQKQLVVS
FT                   EKAIYIFRNYPLLKTSLVTFLITGVQNYEKMIPDIHRFEIIKLCYELQIPQNIHLSRDT
FT                   MGILEVLKNAT"
FT   CDS_pept        complement(777622..778473)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03400"
FT                   /product="DNA polymerase epsilon subunit C, putative"
FT                   /product="DNA polymerase II subunit C, putative"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to K. lactis DPB3"
FT                   /note="Similar to C. albicans DPB3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44600"
FT                   /db_xref="GOA:B9W7E1"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E1"
FT                   /inference="similar to AA sequence:UniProt:Q6CLM5"
FT                   /inference="similar to AA sequence:UniProt:Q5AHY9"
FT                   /inference="similar to AA sequence:UniProt:Q6BX14"
FT                   /protein_id="CAX44600.1"
FT                   /translation="MTLEIYFWVDSHNTRINKKNIIKKHNNVFSTFSNLIKLNKGKNIM
FT                   SQKEQSELLSPQEPREETPTITSQSELITTTPKADDQNAADPQPEQQPQLNQEQDEFQN
FT                   NLTLPISKIKKIFKMDPEYTGASASAVYTAGLATELFVQYFAEQASLLAKMEKRKKIQY
FT                   KDFSNAVASHDALNFLSDTIPRTQPVGELVQQKKINVKQTAPKTTKDKIDDNTNPQAGG
FT                   DIVKKDLLAKGQQTLNFPIANSTTSLKTSETPVKKSVISNLVSTEDDRSTTGGDDDIVM
FT                   KD"
FT   CDS_pept        complement(778577..779083)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03410"
FT                   /product="60S ribosomal protein L27, mitochondrial
FT                   precursor, putative"
FT                   /note="Similar to S. cerevisiae MRPL27"
FT                   /note="Similar to C. albicans MRPL27"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44601"
FT                   /db_xref="GOA:B9W7E2"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E2"
FT                   /inference="similar to AA sequence:UniProt:P36526"
FT                   /protein_id="CAX44601.1"
FT                   /translation="MRVSQVLNFQVSVSNALRRPWQTFRDGTLYYGQLKSGSKRHALTG
FT                   KQGNKHYYKGTRSSGIGSWDSRGRYHINWEKVRTYVVPEGLNNTELKALVSPKSPKFIQ
FT                   QVVGYRDHFKSPELAFHNARNFIEYGANYSDVDLEQEGYIHRIVHPDILEAERKESMGV
FT                   EGIKN"
FT   CDS_pept        complement(779812..780897)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03420"
FT                   /product="D-aminoacid oxidase, pseudogene, putative"
FT                   /note="D-aminoacid oxidase, putative"
FT                   /note="Similar to C. albicans DAO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44602"
FT                   /inference="similar to AA sequence:UniProt:Q5AHY7"
FT                   /inference="similar to AA sequence:UniProt:Q99042"
FT                   /protein_id="CAX44602.1"
FT                   /translation="MASVVVLGAGVIGLTTALELKRSNAELDITIAAEHLPGDIDHTYT
FT                   SPFAGANWHSFATPEDKRLQEIDKPGYKKFLQLAAADPRSGIWVVDNLSMYTDYEVTSN
FT                   NGNYRKFIPWFKDFVDGFEIVDKSKLPEGIAFAHKFKGVVISVPTYLDYLVQQNKEIGN
FT                   VVRRIPRIHHIEDVRKFHSSGKKADYVINAAGLNASKIRGVEDKKFNFPVRGQVLLVKN
FT                   NAKIQLGVEGFPGLPNEMLYMMPRKEGGTIIGGCFLEGETSVSEDKELTARIIKRAIKY
FT                   APELIDPNYKNNPSKIEILKVNVGFRPFREDGARVELDKKYKWLIHNYGAGAGGYQGSF
FT                   GLSKLVVDIMEKELRKLKAKL"
FT   CDS_pept        782628..786113
FT                   /transl_table=12
FT                   /locus_tag="CD36_03430"
FT                   /product="endo-1,3-beta-glucanase, putative"
FT                   /product="endo-1,3(4)-beta-glucanase 1 precursor, putative"
FT                   /product="laminarinase 1, putative"
FT                   /EC_number="3.2.1.6"
FT                   /note="Similar to C. albicans ENG1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44603"
FT                   /db_xref="GOA:B9W7E4"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR040451"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E4"
FT                   /inference="similar to AA sequence:UniProt:Q9UR03"
FT                   /protein_id="CAX44603.1"
FT                   /translation="MLFKSVLFSTLVAIQALAENPAHQETVTVTKTTHISNPCLENYAK
FT                   KLLPNNPTGLTTGIPIVIVYAPQQPNSKVKQSQSLQPTESSKAQQQQIQGSAVSASIHD
FT                   TPTVIDHNKITVTSTTICNQKVCTVQTFSTIIPHSGSVTTTTTTTTEQNEEKSIVNTKS
FT                   STHKAFPSSNGAVTLQKTSVKTAGTTTSTVFSATSLPSTTYTPLTSASLVPTTKKNPVS
FT                   SQLVVSTSKTVSINTSLITDAVTIKKKSTTLPNSEYSSTYTNGSISFISTSANKVKSTV
FT                   TSDISNNSQTGSSLSLSSTKNQSGSMTDSSLTSITESSSLVPNFSYTNSSRVSSTMKSS
FT                   SAKSSLVLEKSTSNLLSSSSFLNSSSTASTTEFSELASSTTSDHSLSSSSSSVELSSSL
FT                   SSEVSTSSSSEVSTSSSSEVSTSSSSESIETESSDEVASNYSGDLFKAIDTNAPPAVFS
FT                   RNEIPLSIPAGVDNNGKPIGTNKFYTNLVLGNQDFMVYPLPYGLYWSKTNYYGFAVQHN
FT                   DVSDRVFGSINTNNVGVPSYYFTPTNNGELIFSATSFSKDSMHMRVSQMAELSALVTLS
FT                   SSSNDNANYLDLPLVQGMGFVTGIYNGNLTPLLNSLFGVKDLSIETSDALLSNVLKYRA
FT                   TLLNNVQWLIYITLPDKDTDFKLEVKDFYNIKGSKPVDGLIIQVAIAPKDDADDKYYDA
FT                   AAGMYVTSATVSGSVSQGTDASYKFTYATSGKSSSNNPIVFALPHHMDSLAGSALDTST
FT                   GITVTSTTKGDMTGFLTNELEFSETINQNVEFLPWTEGMTGSLTYTKDQLKLLATAANK
FT                   ELAVDIAQTVKNMDSNYFSGKVIDKYAQILLVVSEIIQDEEVTKDALKAMKDAFEVFTQ
FT                   NKQYYPLMYDTKFGGVTSTSAQNGDPNSDFGAAYYNDHDFHYGYFIHAAAIVGYVDKKL
FT                   GGTWAQSNKDWVNSLVRDASNPSTDDTYFPVSRMFDWFSGHSWATGLFVTYKNIESSSE
FT                   SLHFAAALKLWGKVVGDQSMEARGGLMISIMARSFNMYFYYKSDNTVEPKQILPNKVSG
FT                   IFFENKVDYTTFFGSPADHPEYVHGIHMLPITPSSSLVRKASYVQEEWKDQIAGFIDNV
FT                   DSGWTGILRLNQALFDPKPSYEFFASDNWDDKWLDNGQSRTWSLAFAAGVLNAS"
FT   CDS_pept        786500..787771
FT                   /transl_table=12
FT                   /locus_tag="CD36_03440"
FT                   /product="hypothetrical protein, Candida conserved"
FT                   /product="mitotic spindle checkpoint protein, putative?"
FT                   /note="Similar to C. albicans GRH1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44604"
FT                   /db_xref="InterPro:IPR007583"
FT                   /db_xref="InterPro:IPR024958"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E5"
FT                   /inference="similar to AA sequence:UniProt:Q59JN9"
FT                   /inference="similar to AA sequence:UniProt:Q10149"
FT                   /protein_id="CAX44604.1"
FT                   /translation="MFTFAKKLVDRFEGSSALDSTSNDSYFKNATAINNKGYALRVLNV
FT                   IPHSTAHQKGFESWFDYIIRINNHELPMLYPSLSNFSYSINDDGTINYGGNTTTEQAAA
FT                   VNFELLMQEINTLAKHEQDLVVDVWSAKGGIVRQISLPLSKYESIDTSDIADASVQQLF
FT                   VDNFKQLGLTLESQHLTTATYVWRILTTHQGSPAFMSQLVPYSDYIIGCDSAYPTDSNG
FT                   KGLLTKGGESLLSKTVLNYYNYHYSISNEDNIPITLYVYNHDYDILRPVTVNLSRSWGT
FT                   GYNRGILGCDVGYGLLHRIPEVVGKFDNNSIVDDILFENSQNLGYQQQVNLPPQHSSYV
FT                   PASPENKKENTNIINSPPPVMGAGAPPRASTRKKKHVAAKDTFEGLDDYMNEELEKSKK
FT                   LDVASQSQNASGTPPPPPPAQSNK"
FT   tRNA            complement(787886..787973)
FT                   /gene="tRNA-Thr (CGT)"
FT                   /locus_tag="CD36_tRNA_0009"
FT                   /product="transfer RNA-Thr (CGT)"
FT                   /anticodon="(pos:787939..787941,aa:Thr)"
FT                   /note="tRNA Thr anticodon CGT, Cove score 43.71"
FT   CDS_pept        complement(788309..792133)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03450"
FT                   /product="morphogenesis-related protein, modulator of both
FT                   1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway,
FT                   putative"
FT                   /note="Similar to S. cerevisiae MSB1"
FT                   /note="Similar to C. albicans MSB1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44605"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="InterPro:IPR037508"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E6"
FT                   /inference="similar to AA sequence:UniProt:P21339"
FT                   /protein_id="CAX44605.1"
FT                   /translation="MVSTKQLIANLELPKLPFHHEKQTNQKPKHNYLSSTTIIDAGIMD
FT                   PAQFTRKNLKSVLHIITQELKKRGTKTPHIFLPFRSKVNDEKLESFLSSIAPSGELRTD
FT                   NTQLQHLCSETDEFTLISTLKYFWSRLPNNEIIGWDVYLEFKRREAEKGYPKNAFLSIM
FT                   PKCLSSPAHASIVYDFLDLILSITSNSQFNYLSGRKISKMASFWAFSCRQQFLQSPFYD
FT                   ATQEEVEHNFIEGIDTWKKSTNALFHLVLAFLRSMLPETNSETLKIPKTLQSLLVTTSY
FT                   PPSSDNESDQSMLRGAITIPCVCVSTTQPSKDPYELVSKVRHNLKFDKKDDFLSIENYT
FT                   ILKNLFSKKGTFEIVNSLTDESKRILSRISSEPIPSKFNLAPGWDKSKIETDPDIPLFS
FT                   EISIKDVSIHDYYIWTWLASISSDQPSVTKQIFGRSIVVEAEVLGFQKWIVVTEKTLSS
FT                   EGYLQRFNLDRRMLSKHKRQISMEDYKNSPLPPIPVDETENAKSNEGRKHSNSVSSTSL
FT                   FSNKKNDMGEFKSDQNINSARSSADTSTSNHSQEKATQSAPPYVTRASDIFDKSFSDQF
FT                   SYIYPILSESMETNEVDQQNTSSRELTTSASRFTKTTMGDMIAPAKNPVGRKAPPSFVS
FT                   NSSILEAYTNTPSSQDSYLNHRQSSTPDNTFSPSKSDNNTIDTLKEDKYFEPFDMYHPE
FT                   MDANSQQEPVEPYDNYYVDVETKTSATAAAPPPSQKLQPPAGTHHQFSQPLQISPNEIS
FT                   SLPSDSTIVNKNEKSNNDSTIIAASNNVSENGNEEKAGDESPDEQTKEENEEELQRKIE
FT                   EKKQKKKKEKKKLEKQAEAAQLAAAQAAGFPFALLPSNVPPPHIPGMPETPSTSPKKKK
FT                   QNSPKKNTSPKKKTPKKVKRTPCDQNKPLPQPTEEVNKQENTNVDSSSATNSEPPVSAD
FT                   DKKLAISSQPENDAMPLLAPPPPPPQANTSVMSSPRMGFVSSPRIPPTQFANPEVPSNE
FT                   QLVTPKEQYNIFVSQPPHGTEIGTQSPRHPYFMQDERVNPTEDAPAQAPAPAPAPAAKP
FT                   QVTNIDTAPLPSVNKPRILVSNLEPHTPVDANSTHDSSQPKNSPQPQASVYNATPPMAH
FT                   PPLQSLPRPNYYQQPQHNQNYFQPVPPHPQFIPRQQPSYYQQQPLAYGSSPMQQQVPGP
FT                   MHTYPPHAPPPPHLPPQQMQYQQYYSQHLNSHPHQHQYPPPPTHNGMMMMNPQQHAPMQ
FT                   PPPTMPPMNGGGANRAMMNMVPVGAKHNKNQVTNKANLRAAFAEGSFGI"
FT   CDS_pept        complement(795209..796987)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03460"
FT                   /product="conserved hypothetical protein"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44606"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E7"
FT                   /inference="similar to AA sequence:UniProt:Q59KB0"
FT                   /protein_id="CAX44606.1"
FT                   /translation="MPVPTSTLIKTEEEEREIRLAEQRQVWERQRLEVEERRRRAESQR
FT                   IGSPFKHPWWTAFSDAGPQPRCLDEWLTVEISNSIREKPDWKTKYKNDEIVAKWKREIK
FT                   QQCQDKTRYLDQIIDYVFKELQWYEDVEKDLNTFQIGCDYRIVFSDGAVNESLKKSFTN
FT                   GAQKLVESFGNDFDYHPGSNNQVVDLVHPSLFIVQYDKTPVLKNGQLEIIKYGEEIEHA
FT                   KAGVDPSGVSKKFQWIPALVAKNSNGKFEFGSYINNLHPIKYKDLYDSIGDIFNAAIPG
FT                   LNCVLTRYASQEFIRIPIPGGSDAYTDEYDKDREELDAELEREAEETGHDYDWEKMEAF
FT                   EKDKSKYLREFIPKWEQAPVFDKPIDLATMFDNLKVIVKLANIELTPENPVYAGGSWHV
FT                   EGAINEDIVATVLYYYDVENITESRLSFRTGFDDPCYEQGDDFYTETIFGIKDEEVMVR
FT                   EIGGIEAKEDRVVVFPNMFQHHVDPFELKDKTKPGHRKILCFFIVDPYNHNVITTDKVP
FT                   PQQKEWWDDSSLDYLFPGNLKQQILDLKGDNSSSWPMTLAQAKEARVALMEERSARGEG
FT                   DEYEGAFTRSFSLCEH"
FT   CDS_pept        complement(798048..799745)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03470"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase,
FT                   putative"
FT                   /product="endoplasmic reticulum mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase"
FT                   /product="man(9)-alpha-mannosidase, putative"
FT                   /EC_number="3.2.1.113"
FT                   /note="Similar to C. albicans MNS1"
FT                   /note="Similar to S. cerevisiae MNS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44607"
FT                   /db_xref="GOA:B9W7E8"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E8"
FT                   /inference="similar to AA sequence:UniProt:Q8J0Q0"
FT                   /inference="similar to AA sequence:UniProt:Q9P7C3"
FT                   /inference="similar to AA sequence:UniProt:P32906"
FT                   /protein_id="CAX44607.1"
FT                   /translation="MLLKGFMLSLVLYAVYHLASNGGQFSFDFSGHSKWERAQSEVRQA
FT                   MLDSWHTYEKYGWGYDVYHPIKQEGENMGPKPLGWMIVDSLDTLMIMDCPEEVSRARDW
FT                   IKNDLDYTFDYNVNTFETTIRMLGGLLSAYHFSNDDVYLDKAVQLANALHGAYDSPSGI
FT                   PYSSVNLKSGKGIKNHVDNGASSTAEAATVQLEMKYLSKLTGEILWWNLAEKVMQVLES
FT                   NKPQDGLVPIYVNPDTGKYQGHLIRLGSRGDSYYEYLLKQYLQTNKQELVYWDMYRESV
FT                   EGVKKHLVSDSYPSGLTFVGELDNGIGGRLSTKMDHLVCFYGGLLALGATGGLTLNEAQ
FT                   SLKSWNEEREADFKLGEELTYTCYKMYHDVTPTGLSPEIVVFNEDTSKSKDFTIKPMDR
FT                   HNLQRPETVESLFYLYRLTGNVKYREMGYEIFQNFIKYTKVVNSEGEVSFASLSDVTSL
FT                   DSNGLPKFKDNTESFWWAETLKYLYLLFDDNNKIPLTEYVFNTEAHPFPRFDTNDYFKT
FT                   GWRRKIDENEKAQMRESKVIDKSHLPEAQPVDKSADQEAKEIIEEIAG"
FT   CDS_pept        802429..805272
FT                   /transl_table=12
FT                   /locus_tag="CD36_03480"
FT                   /product="weak acid response element-binding
FT                   transcriptional factor, putative"
FT                   /note="Similar to S. cerevisiae WAR1"
FT                   /note="Similar to C. albicans WAR1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44608"
FT                   /db_xref="GOA:B9W7E9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7E9"
FT                   /inference="similar to AA sequence:UniProt:Q03631"
FT                   /protein_id="CAX44608.1"
FT                   /translation="MSEIVPEKQSDDGISPSASNGTNTNNPLNNTGQQISKPEESNKKP
FT                   KVTRRSVACKSCHSLKVKCTPSDPNNPSAPCVRCINANRICEIDLNQTRKRRKKSEILE
FT                   AKRQAGQSLSENKREKKTSTQSGYNSSDSYSSSIRNTNDPSLTSRYHSPMTFDPTSPMV
FT                   FRPQAGSAVPPIPSNLNPVSTAPTPTPTPGVPPPQLPSPHDSALLRGNTTSPMSKDDEI
FT                   NQLKQRIRVLEIELANKRLLANRKGFSTDSPTDLQSPPFISKFDLESEVSILAESSAKL
FT                   TDLTNQLNEAASRRIQLVSAKKPVDLISKGVITVAEAEERLKLYREQIYGRHPLIAIPD
FT                   NMHAEEFSQSQPFLFNSIMSACNLITKNADKDVVLAIDNEAMTSVAVEVMVVGTKSVEL
FT                   VKAFSVLCLYYNSPELFKQRRYHMLNTICVSLLHDVGIFARPTYSFNQAEGTLKQDIGS
FT                   KDKGNDEYRELVLITYFVTVSTCLVLRRSIYARWTPYVEECCSLLENSPQEKHRRLALF
FT                   ARMNNKLDKIHHIVHAPEMPGRKSGASQYVIQELQRLLSELKLKIKDNQHALLSYYYSV
FT                   EAYLHEPILTKVFKSDTELDGKAMKSICYCTSSCLNALDEYSKLTPDQVALLPFPFGSR
FT                   IMYTAGMLLRLRYFILSLPSHIDKELVPKRAVTSIQCVSKLVEQANILNPHNHYLTKMR
FT                   LVLQLFIQTYATQVLELLSKNGNTPQNFKPDESETQQLRALAREYNDIRKVSKVSLVSD
FT                   TRSAEPLDVLSYAATFRRDNNDKNNTPGSPRKSFSENDQTIKTPSQYGQFASANNTPAP
FT                   QVINSPPITQTNVHIPQQSRSITNGNNRNGTQLSFTNTTTPSLHQFGDVVPPSSMPQPD
FT                   YRQFRLPSISNTVHYSSNPRLNANLANPDQLENSYQVLNDEFWSNLLSTDSTDRINFTS
FT                   NNFNGNIGNDEVFFMNN"
FT   CDS_pept        805781..806335
FT                   /transl_table=12
FT                   /locus_tag="CD36_03490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44609"
FT                   /db_xref="GOA:B9W7F0"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F0"
FT                   /inference="similar to AA sequence:UniProt:Q6BSF0"
FT                   /inference="similar to AA sequence:UniProt:Q5KP22"
FT                   /protein_id="CAX44609.1"
FT                   /translation="MKDSRSKFSFLDILRILGGILFLNAFLSWWFTSTSTWGYRGKWLN
FT                   TNYLKFRLFNANNLLNLTISELSLYNGTDTNLPIYLAIDGKVFDVSSSPKVYGPGGPYH
FT                   ELTGKDAARVYVTGCFNKKDEYTYDLRGLDESEAENDIQSWQQFFLDHDKYWYVGTVQH
FT                   EPITGDPPAPCEHMKFPGMYH"
FT   CDS_pept        complement(806427..808196)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03500"
FT                   /product="cystathionine gamma-synthase, putative"
FT                   /product="o-succinylhomoserine (thiol)-lyase, putative"
FT                   /EC_number="2.5.1.48"
FT                   /note="Similar to S. cerevisiae STR2"
FT                   /note="Similar to S. pombe STR2"
FT                   /note="Similar to C. albicans STR2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44610"
FT                   /db_xref="GOA:B9W7F1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F1"
FT                   /inference="similar to AA sequence:UniProt:O74314"
FT                   /inference="similar to AA sequence:UniProt:P47164"
FT                   /protein_id="CAX44610.1"
FT                   /translation="MPSQEIGVPIPNLPHAVSVTLPTWEATVGYEEGEDWVVSKMNSGY
FT                   PRFFIHSSIQKLCSNLEKKYGRDGERCMCFPSYKVAKRCREFIKTHTINPTSFKIRVLQ
FT                   LSTLEPTNDNEKSTRIGATIGVVFFPRSEYHLAKNYWQHSGEGISSRMGEYILKELFEK
FT                   DNDNSNGTDVSKLKGNLKQELQSLQIQSRSPSISASRASSASGYNIDDVNRDFDSFIEQ
FT                   KYGRVLDLKFANEAKAALRRRIAGKADKSTERLEELERAKRGKHLNENDVYLFPSGMAS
FT                   IFYAHHALLNISKQPKKSVCFGFPYVDTLNILKKFGPGVHFLGLGDDASLDKLEEELSQ
FT                   GLDILALFCECPSNPLLKTPNLNRIRQLADKYNFAIVIDETVGNFINIHVLPFADMVAS
FT                   SLTKVFSGDSNVLGGSLILNPDSKYYNILKQFFNKEYEDLFWAEDALWLERNSRDFVER
FT                   VHKIDDTSEKVVALLQKSPLISQIYYPSVSDTKKYYDVIKNEGGGYGGLISFLFKQPQQ
FT                   AVKFFNAVNLHKGPSLGTNFTLACPYAILAHYQELDEISQWGVDRNLIRISIGLEDPIE
FT                   LLDVLQKSLDESI"
FT   CDS_pept        join(809514..809525,809631..811328)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03510"
FT                   /product="ATF1-like transcription factor, putative"
FT                   /note="Similar to S. pombe ATF1"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44611"
FT                   /db_xref="GOA:B9W7F2"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR021755"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F2"
FT                   /inference="similar to AA sequence:UniProt:P52890"
FT                   /protein_id="CAX44611.1"
FT                   /translation="MSSDHKSKFDLELNPFERSFATKESSSVSLNELAAASNNDAISEV
FT                   NSVATSGSSIKNGSSSNKHNLHIPNISSVNQQQGVNGKLPGITPPLFTPGGRRLPPIGL
FT                   SPGGTTTRQYSNSTNSGSLPSNPDTLGSSIWGVLPTNQTFQQQQQQQQQQQSQPQPHNF
FT                   NQFMSGMRKTGLTPNESNIRSGLTPGGLNNFGFGSNLVPGLSTPGALLNGPITPGLSSL
FT                   LGITQTPSSLLIPTTSSFSQNNSSHLVQPTTNNSVGPIPESTALGSQVNIPQTQQLQSD
FT                   QSSQAIVGGLPPSQPQPQQHQQQPVIAQQIHTIPENQSIAFDIIPESKPASSETTNLET
FT                   DLATTNTTTKKRKNDTAGASNKKPKVTKGKKKEPKSKSKGKNNRELNEDDHQNSLNKAE
FT                   GESVSQKENGIEENHNVEVEPNEGHLENGDETTSTKSNNNTTTTTTTTTNGTTTTTPTT
FT                   TKSKNRKNSSTTLTEEDKRKNFLERNRVAASKCRQRKKLLIQKMEEELEFYSNGYRELS
FT                   AEVNKLRGAILLLKKKHNIQDEIIDGLLSKPNTVPTNVTSIPSTIPTTLNPT"
FT   CDS_pept        complement(811539..814736)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03520"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase
FT                   1, putative"
FT                   /product="HMG-coA reductase 1, putative"
FT                   /EC_number="1.1.1.34"
FT                   /note="Similar to S. cerevisiae HMG1"
FT                   /note="Similar to C. albicans HMG1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44612"
FT                   /db_xref="GOA:B9W7F3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="InterPro:IPR025583"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F3"
FT                   /inference="similar to AA sequence:UniProt:P12683"
FT                   /protein_id="CAX44612.1"
FT                   /translation="MLNFLTEVTGALAQTSARRPIQFMVVPALLASIAYLSIIDDYIPE
FT                   HIKSSSGLSGISYYHPYTSSHYKSQPDLDKWTAIDKDHINDDIYTQANRISVIPLRFRR
FT                   FQDVVPNVPNAIQISDNEQILIIPTNEIENSLDQLQEITNNGITWKARNNDKLAKYYDY
FT                   IRYGFNKIQDAIQHAENFDILLIFVAYLGMWYAIIKVFVDMRKIGSKFWLAFSTLTSST
FT                   FAFLLALLVSNKFLNTKVSLLSLSEGIPFFVSVIGFKHKVSIATIVANSSTASPEDVPH
FT                   VVGKAVSSHCLSMLRDHLVVIGGLLSCAIYAHHLTGLRNFCILSSLILSFDLILVYTFF
FT                   SAILGLKVEINRARRTEDLQNALEEEGISSLVAARVAEQSATIEHPNEHNFFKSNNSSI
FT                   AYFKVIMSLGFFAFHAFWLGSSWLYSTTDGGESFSRFSFLSNIPSLSKDISQQIPIGKK
FT                   GTVVTILPTIFFMPSGFIVQLEDFIYLVLSKFSSAIRDSIISKFLVFGFALSVVTNVYF
FT                   LNAARYQVSATHKLIEKEISRPQENTTTSTTTATTSSSGVATSKDKRLKSVREIPDNEN
FT                   DESSDEELEIKAPVKVLPLEQCVKVLKEGQVKTLSNDEVSSLVVGGKLPLYALEKQLAD
FT                   NKRAVIVRRKAIAKLANAPVLDTNRLPYAHYDYDRVFGACCENVIGYMPLPVGVAGPLI
FT                   IDEKPYHIPMATTEGCLVASTMRGCKAINAGGGVETVLTRDGMTRGPCVRFPTLKRAGA
FT                   AKLWIDSEQGQATIKKAFNSTSRFARLQHIQTALAGTSLFIRFRTTTGDAMGMNMISKG
FT                   VEYSLKYMVEECGWDDMEIVSVSGNYCTDKKPAAINWIEGRGKSIVAAARIPADVVTKV
FT                   LKSDVDALVELNISKNLVGSAMAGSVGGFNAHAANLVTAVYLACGQDPAQNVESSNCIT
FT                   LMEKDKETGDLNVSVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPHPTNPGENARQLA
FT                   KIVASAVLAAELSLCSALAAGHLVQSHMQHNRSKAPGAAAPTTPAITDAKASNGSIATN
FT                   GKDLRRLEEGSVTCIKS"
FT   CDS_pept        complement(816746..818008)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03530"
FT                   /product="nucleolar peptidyl-prolyl cis-trans isomerase,
FT                   putative"
FT                   /product="proline rotamase, putative"
FT                   /product="nucleolar proline isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to S. cerevisiae FPR3"
FT                   /note="Similar to C. albicans FPR3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44613"
FT                   /db_xref="GOA:B9W7F4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F4"
FT                   /inference="similar to AA sequence:UniProt:P38911"
FT                   /protein_id="CAX44613.1"
FT                   /translation="MSNLTPIATYNLALQPFQPVPAIEDDFPISIRITLASLDPEAADD
FT                   KAEPSSLRILKKSNSLLNDDYFEDDEDDEDEEDELDDDEEEEKEKSSKKSNGKKSNKKD
FT                   EEDDDEEDDDEDEDDEDDDVSEYIVCTLSPKHQYQQTLDLTITPDEEVYFVVTGSYPIH
FT                   LTGNYIEHPADQDDEDYDDDDEDYDDEYDLSPDEDEIIYGAPLDDDDEEEESDEEETPK
FT                   IEEIIEEKEKETETAKESKKRVAEEPTSKKSKKAKKDEKKSVQFSKELEQGPTGSTLVE
FT                   NNNKKSNASTKDKKDTSVNDDGDKKKKFPTKTLLGGVITEDRKIGSGATAKSGNKVGIR
FT                   YIGKLKNGKVFDKNTSGKPFSFKLGKGECIKGFDLGVTGMAVGGERRVIIPPKMGYGSQ
FT                   ALPGIPANSELTFDIKLVSLK"
FT   CDS_pept        818316..819290
FT                   /transl_table=12
FT                   /locus_tag="CD36_03540"
FT                   /product="ribonucleases MRP and P protein subunit,
FT                   putative"
FT                   /EC_number="3.1.26.5"
FT                   /note="Similar to S. cerevisiae RPP1"
FT                   /note="Similar to C. albicans RPP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44614"
FT                   /db_xref="GOA:B9W7F5"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F5"
FT                   /inference="similar to AA sequence:UniProt:P38786"
FT                   /protein_id="CAX44614.1"
FT                   /translation="MSYDLNIPWPINNYDKSPTLQQLTNLRNIIITNYSLGITHQVINF
FT                   QISLESVKIPIATTNNNINPIPKDQLLNELLPKFPKLKLFTRLTLVVNDSSKLPQLGKL
FT                   QNHFDIIALQPLNEKVLQLSILNLDIDLISINLSSKLSFYLKFKTLNNATEKGIKFEIC
FT                   YSQLISGNNNNSCGGYVDDSINANLIKKNFFNNVLQLIRGCRSRGIIISSGAQNPLQLR
FT                   NLSDILILLKTLSSSPLDLSKNNCQKFITINPQRVLINGKLKQKSYRQTIVVNNNSDLL
FT                   QDNKPQKESTGGSSSSSSSGGGGFKKKLDDTSSGRLLKKRKTK"
FT   CDS_pept        complement(819413..820549)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44615"
FT                   /db_xref="GOA:B9W7F6"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F6"
FT                   /inference="similar to AA sequence:UniProt:Q6BYH0"
FT                   /protein_id="CAX44615.1"
FT                   /translation="MEPLRPPTQIKKSTKKLPSLVDISLLKIKKHIHSLTDIGTTPYHL
FT                   LEPVLQQIPAKQLNELELNCQQLLPYSDKLWMKLIQKDFPDRPTPPPSSSSTTTPIKLN
FT                   PKIKAFCGLDMPYKSLYYKYCQDRDEFRKDSAKRLRHANKSLERQKSKNKIVAIDEVLR
FT                   DPTIKSRRFYDLPSYTTNTRRSYGIMGNKNSILEKAKRDTMINRTLIFGNANANRHLNS
FT                   YDPFDAFKVDKNSSISTLSRGSKFMRPPKTTTTTSSTTSNVRPGVRRTTFFNSAGSGGQ
FT                   STNLSTTKSSNSTNNIPNKLNTNTVTDNTKSNLNTSQQKCSTKPSIFLHSKRKSTIMTN
FT                   DSPLIKKKKPRKQNKQSEMLETKETPSKLKPLKSSIFS"
FT   CDS_pept        822483..823604
FT                   /transl_table=12
FT                   /locus_tag="CD36_03560"
FT                   /product="phosphatidylinositol transfer protein, putative"
FT                   /note="In S. cerevisiae: controlled by the multiple drug
FT                   resistance regulator Pdr1p, localizes to lipid particles
FT                   and microsomes, controls levels of various lipids, may
FT                   regulate lipid synthesis"
FT                   /note="Similar to S. cerevisiae PDR16"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44616"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F7"
FT                   /protein_id="CAX44616.1"
FT                   /translation="MFAKLRSKVSTPPPPIATTNSPTSSSSETISTTNEKSSLTTTPTE
FT                   LSPVVYVPFSSPSSNSHIPQEHELTQEQKDKYLHVLHHFQQPDLKIAISEETHKLKQKT
FT                   KELTIGEKSWITRECILRYLRATKWHELEAIDRIELTLSWRREFGISEPFDNENKVNGN
FT                   LVSEENETGKEVILGYDNDSRPCLYLKPGRQNTKTSERQVQHLVYMLERVIDYMPAGQD
FT                   SLALLIDFKAHPIGTQSGKIPPVGIGRQVLHILQTHYPERLGKALLTNIPWLGWTFLKI
FT                   IHPFIDPLTREKLVFDQPFINYVPKEQLDKDFEGLVNFEYDHKKYWDVMIKISQDKKHQ
FT                   YFERFEKFGGIIGLSEVDLRGDNEELIHPVGTI"
FT   CDS_pept        complement(823766..824734)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03570"
FT                   /product="3'-5' exoribonuclease, exosome subunit, putative"
FT                   /EC_number="3.1.13.-"
FT                   /note="Similar to S. cerevisiae CSL4"
FT                   /note="Similar to C. albicans CLS4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44617"
FT                   /db_xref="GOA:B9W7F8"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F8"
FT                   /inference="similar to AA sequence:UniProt:Q59VW3"
FT                   /inference="similar to AA sequence:UniProt:P53859"
FT                   /protein_id="CAX44617.1"
FT                   /translation="MSDNIPGGGVVPGQYITPTYKLENNDSSIPVKYIPGPGTIISNIN
FT                   IPTTTTTTPTTTATSNLIKSMPIIVSTILGTVSISPIDQTQSTSSTNNDDDMIIDHEQT
FT                   QTKQDEDKYVKSYLVTVIPKSTKLQPTTTTNNSGAVSSIALPKENDIVLVRITKITKIQ
FT                   AYCEIISLDTTTNILSDSGISSNGNGSHVSMSTTGSNSQHLFNQNSIACSQSTNQSVQI
FT                   YELGENFKGIIRINDIRSTERDKLKIIDCFKPGDIVKAQVISLGDGSNYYLSTAKNELG
FT                   VVFAKSENGAGDLMYPIDWQNMIDINSGIIEKRKNANPFLN"
FT   CDS_pept        824995..825267
FT                   /transl_table=12
FT                   /locus_tag="CD36_03580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44618"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7F9"
FT                   /inference="similar to AA sequence:UniProt:Q6BYH3"
FT                   /protein_id="CAX44618.1"
FT                   /translation="MSNSNATNNQYPKYINDTTPPTITLKQYDNASWASTTCLDHNSQT
FT                   NQYIVVVMENPKQIVAIIDSQDNMILDILFKNAHEAHSKQEYDQK"
FT   CDS_pept        complement(825698..830704)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03590"
FT                   /product="bud neck localizing protein phosphatase subunit,
FT                   morphogenesis and cell wall composition modulator,
FT                   putative"
FT                   /note="Similar to C. albicans BNI4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44619"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G0"
FT                   /inference="similar to AA sequence:UniProt:Q5YCZ3"
FT                   /inference="similar to AA sequence:UniProt:Q59QJ2"
FT                   /protein_id="CAX44619.1"
FT                   /translation="MADSTFDEFFENDFYSAPTSINNSKNHVKNVRNSIQIKHSMSSRS
FT                   LNDFTKDIPSSATISNSITKSNTSTNPSSKSGNTSGGSTRTSIIKASPSLKALESILNE
FT                   KNKQYNITNTNIIEEVEDEEEQEQEQESGKNHYQGLNTLSPPILFTYNSSNVRESVQTF
FT                   ETAIESLNEDDTLAVLSTNTGNSNTNSLITNNNNINNNGYNNGYPLTTKTSKSSSTNSH
FT                   KYNKSSISTISESGYSTDDTPIISQPLTFQSFTPHSFESPQLKMVDITEESNFDNENSN
FT                   STITTNTVRTKNESKNNLFCGGGSSSSGANNSVNEGAQYNKSSTNFSNKQIDQNFHSSS
FT                   QQSFQQLQQPQQPLQPPLNSTNQQMPQTNSQPLHPPRHVKHPTNNTTNNNPFYNTTTTT
FT                   SHSNQNNLFNKNVSVPLTQQPAYPGNNSNNNNNNTGPNLHHNKSNNYNIIRTVSNNSNS
FT                   NMSLDSNFSSHSPSNSNNSRGKIVRKSKSMLTVLTNDNDSMSSLHTPPPPHQPTNDSAS
FT                   LGSPHKRPSHPRSNSSYSIMKDKINRKNNTTNNNSASTVHHSENKTLSHKRSSTLNDLS
FT                   KLNSEQLASSSSSSSPAGVLPSTASTNSKSSNGKKKFSFKSLFKSKSKSHSLNDSNSSI
FT                   SEPKKITSKSYSTPNMQILSEQPKSIDDINNTNKQTTKPESKSNISFMNRFKKNKSSDN
FT                   LNKLGSSHQQPGLKKGVSNSNPSLSSLNGNKTNKSLPQNQDNSKFGLSAPPVNRNSFNF
FT                   IREVSEDSVYIGDQNDDIEDEHSGEEDVKPVTKNGYKSFGNIHNNSDEEDDNVDRLSIE
FT                   EQQPDVSDDEEKEKDFEYYDAKNLTEDPPKKMSSGNKYGEEISLIPPLIDSNQFGSPFK
FT                   VNYQSSPKSIDNRHEGKDTDSPLQRTIKRFSNTPSSLTIPIKPPSPIRYPQQKQQQQQQ
FT                   QQTNTNNNAHSTEDKTNTQLLGEALFPKSLNAHEVESIVSLERSRSMKSVKSNKRSSFV
FT                   NYDGSDDNIVHYVGPISKPTTSGNGITRSNSILKNSTSRKSNLNEELKMNSIDGTVSGT
FT                   INSNNNNNNNNNNNNSDTSGNIKVINDTTTMNDTYTTITDTGNGAIGENILGSSGNGFG
FT                   NTSASGIDTGDDLMEFSEFIDVENMNFLDSPIPGSPITNNGKFLQTSTTPSSPLANYQF
FT                   DHNSINKIEQQEQQQEQQQQQGNIVDQSTPEPPVIVINKDNLDTKSMTNSTVGTKTNSI
FT                   PTITIPDKETTEITTGINNKDSIDSKTPSSSPLSMKHYDSPKTSVEEKEDQPHNEKNES
FT                   TNQQQQQQQESTDIIDEHVISKSPILESAYRVRSQKKPENGKFTKQNRPISMSFKGLNA
FT                   PSFTGKLKKEVLRSSDSHQSFNINFNDEEDDGDEDDDSSLSVGGGFGSSSEDDDDDDDD
FT                   DDDDAYSFEQENDISSASRFYNTNDDYIENKENRVPGSGNTNNSSIANEKVSPLIPPPP
FT                   PPSNSHSNIIVQPQSPAPSNKSSVFSPKQSNDINKKPTNQPPSSPPQQSQSQSQSHSQH
FT                   FSLQPLKKFTHNKIPSISDQSSINSESSPRSFTSMISKKWGNRKNGGNSSNSPNSPNSN
FT                   SNSTLPPPPPPAPAPSQLPGKLQITTGVRFSSRIILYDTYNEDEYDRHPDTATCNQLTP
FT                   LLAQQIKDELNNFKSEMEIHVESRCYTHFF"
FT   CDS_pept        complement(833411..835165)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03600"
FT                   /product="conserved hypothetical protein"
FT                   /note="in S. cerevisiae, similar to globins and has a
FT                   functional heme-binding domain; involved in glucose
FT                   signaling or metabolism; regulated by Rgt1p"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44620"
FT                   /db_xref="GOA:B9W7G1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G1"
FT                   /inference="similar to AA sequence:UniProt:Q59QJ0"
FT                   /inference="similar to AA sequence:UniProt:P53857"
FT                   /protein_id="CAX44620.1"
FT                   /translation="MSTTFRYSGASDFHQPLGSSNKNNVFGRNNSTISSTNSLISNNSD
FT                   TGTDTTTTTTSTTTTNNVKRMHSSLISKYNSNRSTIFTNDTDSLSSFISYDTSNNSTIA
FT                   SSISPNSPANHHSYSTKHQLPPYMMNKSPQYIHQSTSRHSNLNHNNNTFLYNTYSNHSN
FT                   NSHQQQQILNEDLVTLNSSMDNLEDGFYKLIRLDTRISFESYYVEQRQDQYKVKLQLNK
FT                   HQIDLLRYTWNQMLLEESNEEEEEEEEERDGNGDEDDIEENVNAYYSNNDNNIPGAFPT
FT                   GFANSRRKIIKRKSTRNVNGNGSNTNTMTRLDSTTIASSLFCRQLYFNLLSKDQTLEKM
FT                   FPSIKHQAANMAGILSLTISQLENLSNLDEYLSKLGKLHSRILNIEECHFKLMGEAFVQ
FT                   TFQERFGSKFTKELENLWIKLYLYIANTLLQTGIDPILKLTRYESNGSFTTSTNIDLTN
FT                   GDSIILDDNISINDDNISVSNILDPKHLQQHQQNHPRSYNSSFNQDDNDNDNDNGNGNG
FT                   NNGVHPTTNTVVLTKSNISIIESVTPHHQQQQQQQKNNNSGSSNIATSSKKTKFSIRKK
FT                   KKENCVVM"
FT   mobile_element  complement(842118..844506)
FT                   /mobile_element_type="retrotransposon:kappa A, Tcd19, LTR"
FT   CDS_pept        complement(842340..844319)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44621"
FT                   /db_xref="GOA:B9W7G2"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G2"
FT                   /inference="similar to AA sequence:UniProt:Q59JU0"
FT                   /protein_id="CAX44621.1"
FT                   /translation="MPCKAYDMEPNLPANPEYFIAAHLSYPACLFTFLGYLIHLLLSVV
FT                   QFIDFQTVICCSMVYIYCRSKQPLMKEHVSSFSVGAAKRPFSNMRNVSVYLLNFVDHFS
FT                   HNDASKQIPIFQPRTSFFSQCCNFFPKAIKSCCSVFMSSSNNPYKFPAVDMDKSPVVIL
FT                   NSIGPALHSVPFNSQILKVSLFSSVTDKIHERSLNLIDNSTTFYSLTEFKIWLLKQSKP
FT                   SKKFKPSKAQSEAYFVRQVNISLGQVFNSPVALNFHDAQLQLFRWAHLPYLSGVQAAML
FT                   LPLLQNSLWSSQPWLSNAAIQILNKFPTIDFHELLFKLGQTPLCVPHDFPCNPRPKYSI
FT                   SKQSRGRRRDSGITKCSISADNVATSPGPTPAKNFNGTYRRLIDKNDIIPQNDNTVQVI
FT                   PTKSIANNDAIVAPTPFTPIIDKDYIGALTSSANTTHKDSIVTLPSADITFLAIPTLSE
FT                   CIVEGTSNDPVTSSIIPNRFNFPTILHVSQNFSEVVSKLSSVFFSICHSSTDKLELFLE
FT                   ISHICFSSILIFPIFCFSFLQDFLNTHVASAADIGFQSSMSNAFLFGIQSGFTIRSRFF
FT                   VWEVGSVDRTVHKALETAHAKITTTDDTSRNDLDTKLNVRVPIICQYPHVPDVVLKSLR
FT                   SHLTSKFIGHYEVFKEYLPRVCLL"
FT   mobile_element  846522..846990
FT                   /mobile_element_type="retrotransposon:solo LTR, episemon N"
FT   CDS_pept        join(847391..848104,848104..848394)
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_03620"
FT                   /product="conserved hypothetical protein, scrambled
FT                   pseudogene"
FT                   /note="frameshift; stop codons"
FT                   /inference="similar to AA sequence:UniProt:Q59QP3"
FT   CDS_pept        849224..849787
FT                   /transl_table=12
FT                   /locus_tag="CD36_03630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44623"
FT                   /db_xref="GOA:B9W7G3"
FT                   /db_xref="InterPro:IPR018593"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G3"
FT                   /inference="similar to AA sequence:UniProt:Q59QI5"
FT                   /inference="similar to AA sequence:UniProt:Q04675"
FT                   /protein_id="CAX44623.1"
FT                   /translation="MTSQTTTTSSSSSTIKQSPFETSILDQVRLNLIHYNYWNNVTVYK
FT                   HDDLEFLSGYPPEPLIPSDNINITPATPILKSLNNPKQIEIDNKDDKIENINQLQSETD
FT                   IEWIIPRRLIHHQTQTQTQTQLQNQNQNQDQSKLTVGEINHWFKIIKTIIGYRPKRIII
FT                   AIINDDGTIVYYFIHDGITKPRQN"
FT   CDS_pept        complement(849951..852035)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44624"
FT                   /db_xref="GOA:B9W7G4"
FT                   /db_xref="InterPro:IPR038869"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G4"
FT                   /inference="similar to AA sequence:UniProt:Q59QI4"
FT                   /protein_id="CAX44624.1"
FT                   /translation="MQRRIRFRRSIQDSTDQQQQQQQQRMGVSRRSTSNRLNSPTSLTP
FT                   TTTTTTFPSSVDPITVIRSNTRGSLAPNTNNLIRADDDDGDDDNTIYATTTTTQPLHRS
FT                   NTTTYTSHFARPKVTTILSLPQKLLRWIYSISLILITLLVLLLISVTILDVVIQTLDSP
FT                   SDSAIKTFTVLGACGFFILISIIIYFVRLYQLRVSINNIPNKSLYIPFENDFANDTIFH
FT                   YIDDKLKYCHEIKFKSGPLQNTTCIINHPGLSPPEYIMKRNSQCLINMNKNLFSPLKNN
FT                   HKESINQINENDSNNIIGEGTLLPPNIHYEDVIRSFGDKFYTGKIFTNDSLPIELSIEE
FT                   IIIYLTNQFFDSNKNFQNNPNINKLILLYEKFRFSNELINQRELIEFMIEFDKFGQMCQ
FT                   NDYQIKLPRSISHSRNNSTNKLRKLSRLSGKFSGFDLSDYSSTALFDDDDDEVGADYNQ
FT                   EYDSEYDDDDESYDDDDDDDDDVDDNSSSNNPFQHYKVESKYFEKATNSDDDDNNNNGN
FT                   LETSSSLNITHNRGLHHQSSFSSSKSVIRNKLALGNRSLLLKNDSHGSSSTTTTKRSKQ
FT                   QQQQQHDVMGEDNYDEEYYQLSRRQSGYITDSENEDYELDSINNNKDEEEEEDEEEEEE
FT                   EDDDNYDDQQQFYQFRTGQRIVPEITINQEINQQQERRSSNDDSIKRLSPTSSIKRHFS
FT                   "
FT   CDS_pept        complement(852848..854026)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03650"
FT                   /product="palmitoyltransferase subunit, putative"
FT                   /product="Rasprotein acyltransferase subunit, putative"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to S. cerevisiae ERF2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44625"
FT                   /db_xref="GOA:B9W7G5"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G5"
FT                   /inference="similar to AA sequence:UniProt:Q06551"
FT                   /protein_id="CAX44625.1"
FT                   /translation="MAQDKTDKQMSFIHRFITNWLIMDPNLISQYTNTNNQSTTQQFRN
FT                   YQIENQGHSNFIYFLGGRLHTIKTKYPINLITLSLILIPGILYIIFELSWQWKNFSPII
FT                   VIIFLYIWIISICQFFKLSTGDSGKLPKNIHLPKKLIINNDNDNGNSYKVMEPPDEYFN
FT                   TVTLPYWKKKNNDKAKTFDASHGIQVKYCSTCHIWRPSRTSHCNTCQQCILNHDHHCIF
FT                   LNNCIGQRNYKFFLWFLLYMVIACLYLLIISILQLCHYKFVSQQQQQQQQQQQTKITNF
FT                   HQSIKTHPVSLLLLIYSCLAIWYPSLLLAFHIFLTSQNITTREYLNFVYKKKPDFTDSG
FT                   FVNVYNTHSIWKNLYINWLGKSIGVSLTFPRDVYQQGDIRFANIEPLGSFSN"
FT   CDS_pept        854512..856014
FT                   /transl_table=12
FT                   /locus_tag="CD36_03660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44626"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G6"
FT                   /inference="similar to AA sequence:UniProt:Q59QI1"
FT                   /inference="similar to AA sequence:UniProt:Q59QK9"
FT                   /protein_id="CAX44626.1"
FT                   /translation="MFRIRPVLYKSSNVLQTLKPGIISRPFSFITKPTTTTTTTTQIIS
FT                   HRLIQSRNLMSTKTTNLGPVKFTLQILTGVYCGLLIVCFGSCYLLYSDANQRQNIPFEL
FT                   SLDDHINAVMAINKDDVCEAPRHATKHYRRLLIDLAKQELEGTTENTTIDESKFDNRYD
FT                   VPILSTDFLIHNKSIKFINFYIDMILRYSKCLLSKGELDVAIKMLTRIVNDDFIFFKLG
FT                   DAEKLSSSSRVLAKITPDITKKISILQRSIEMLTETNKSMQIDNNYILLENSKISDELI
FT                   NCLNDLASNLAKLSQQQSNKNKFNPELLNQSLQIYLSELRSLQTIRSKIESNQANQATY
FT                   PLFNVDRANLIGMINTIKAHISEIMWVKGHKDKAINLSEQILQELYYDRYSDPKFGPIL
FT                   LNVLNNLEIMYNNLRKSNDIKRCQQLKHDVSIYEIRKRFDIPWYERVMKRISKTIYLRT
FT                   PIGLVEKGLRDRFEPRSRVKELDEFEDEDDENRNQWFYPLAK"
FT   CDS_pept        856323..856835
FT                   /transl_table=12
FT                   /locus_tag="CD36_03670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44627"
FT                   /db_xref="GOA:B9W7G7"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G7"
FT                   /inference="similar to AA sequence:UniProt:Q59QK8"
FT                   /inference="similar to AA sequence:UniProt:Q59QI0"
FT                   /inference="similar to AA sequence:UniProt:Q6BHT6"
FT                   /protein_id="CAX44627.1"
FT                   /translation="MISAYSRIGLTTTLFKSSLISSSSNNIIRPLLLTNIRGIKTIPQP
FT                   PGYIVGTVNDAYVPPPPHKLEGSLHWTSERIVAIGMLPLVLSPFIAGGGASTLLDSSMS
FT                   ALLLFHCYTGFQSCIIDYIPKRVYGSLHNYAMYLLTFGTGIAGYGIYQIETKEGGVSNI
FT                   ISKLWKA"
FT   CDS_pept        complement(857115..857861)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44628"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G8"
FT                   /inference="similar to AA sequence:UniProt:Q59QH9"
FT                   /protein_id="CAX44628.1"
FT                   /translation="MSLTIEDIPKILLDTNKYNYLSELLTLDQSLSYNELTIHQQQLFN
FT                   TLELFTFGNYQQYLKYKDKYIELDGSLLNKLLELTLITINFENINQTINYQDIKDIYGI
FT                   DIINNNNNNNHHHHHEKLISLIIKLNFQKIINIKINDIENKLIINRGIEKHLLRDIYNS
FT                   NKINYKLKILNELNDINIRSVNIAKNYLRNWINEKLIPLKNEFEKKLLVESNESIEKNE
FT                   PNNSNTSNSSSSDMKSTRKRKVSDNV"
FT   CDS_pept        complement(858205..860745)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03690"
FT                   /product="vacuolar protein sorting protein, putative"
FT                   /product="pheromone-factor arrest protein, putative"
FT                   /note="Similar to S. cerevisiae VPS64"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44629"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7G9"
FT                   /inference="similar to AA sequence:UniProt:Q59QH8"
FT                   /inference="similar to AA sequence:UniProt:Q03944"
FT                   /protein_id="CAX44629.1"
FT                   /translation="MTDIPIALDNSQLLNNNNNLNPSNHHNHNHHHHHLSKQNSSSTIQ
FT                   KSSSSSSEQQQPFPNLETKKNGMIYIKNSQSLRNGTKVSNKLPRSTSNSSSNIGLNSTT
FT                   SNTNVDVKSSTAALGRKRSNSQSQVVSIPAKPKFTTASMSRDPSKGGSSSLQSSTSRSG
FT                   NSGHSGSNGSSSINPHKRNQIQYYVTLVPLNDTFIKKHLPVATYPETTKLGRPTGTKHK
FT                   PDVTNGYFDSRVLSRNHAQIYIDPKNGKLMIQDLGSSNGTYLNEVRLSQDPTEIKVGDM
FT                   ICLGFNVQAESTHKQISLRIENLNVISTQLETNNNGNFFINGNEQLDTPEFKRLSFIED
FT                   IARQVEKIEFDKDDSMISKESHEIQNNLTFDNALFSDINPNIEDNLLGLYSMMNSGIYN
FT                   NSQITSTTTLENIINVLVLNLSRIKQQNSSLNSLSTFLENYYYNINQLNQDYLDQQFQK
FT                   KLSKIEQELIKEQTNHQKSKDRFKNLELESNKKLDLLNRKFKSMERDRDNLKNSLNELK
FT                   LKYENLENDNNLSKETIEILNREKLDLQEALDEMTRQQQQQQEKEKEKEKEKEREVLKL
FT                   NGNKSKELLNDESVVSEAINGFIKDLSRTPSVRDNMKNLESSGTINRDTIKLTPPVSDN
FT                   EEDNEEDDDNDDEEEGVISLPSSPSLLQRNGSKLKHTQKKKGSNGDNDDHHDIESIDSF
FT                   SHSQQHYDKSSISPIISDFESIVATNSMIINSPEKQQQEVEPFPKVENQSCNGSPIKKS
FT                   SIQSNENFQDNNNNNNNNNNNNCNQGKCHNLFNKIFSNQQQQQQMGNKKKKNNNSNTQK
FT                   TIEAFNEIDKQKLQTVVIAMSAMIIGYYLQRLTN"
FT   CDS_pept        862115..862693
FT                   /transl_table=12
FT                   /locus_tag="CD36_03700"
FT                   /product="DASH complex spc19-like subunit, putative"
FT                   /product="outer kinetochore spc19-like protein, putative"
FT                   /product="19-kda spindle pole component protein, putative"
FT                   /note="Similar to S. cerevisiae SPC19"
FT                   /note="Similar to C. albicans SPC19"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44630"
FT                   /db_xref="GOA:B9W7H0"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H0"
FT                   /inference="similar to AA sequence:UniProt:Q59QH6"
FT                   /inference="similar to AA sequence:UniProt:Q50HP3"
FT                   /inference="similar to AA sequence:UniProt:Q03954"
FT                   /protein_id="CAX44630.1"
FT                   /translation="MAQQELPQQNQRFNNLDNCTDSLRQSIKILQQSNKLLDETLQDST
FT                   RLIKILSTNKVFDLIPELDLNDAKSNFTRNITPQLNQQLNKLEDELIRLQTNKTTLTNK
FT                   LKLINVRLKNYQRKSNGNDHDGDDDDEEGGGGRVRGRKNFNSSGLSDVDIDNLLINRHK
FT                   NGYDANKLHQLRFLRDKKTRLQYSLNRLS"
FT   CDS_pept        863299..864216
FT                   /transl_table=12
FT                   /locus_tag="CD36_03710"
FT                   /product="hypothetical protein, Candida conserved"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44631"
FT                   /db_xref="GOA:B9W7H1"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H1"
FT                   /inference="similar to AA sequence:UniProt:Q59QH5"
FT                   /inference="similar to AA sequence:UniProt:P53899"
FT                   /protein_id="CAX44631.1"
FT                   /translation="MSSSSGVTNLFIDKSQQPNQDEQGLINIGKNCQYCNQLDFLPFIC
FT                   EFCEKTFCSQHRTIEQHQCIGKDKFFNQHHSSSRSSSPESGNNNYNNTSISSKSLFPDR
FT                   EADKRKLEAKLNSINPKRPTTIKETQFRVGDVAIGSNAFKKFQKFLTTQKMNKNKNSVN
FT                   GLNSISKLFGKSTSNNNNKFIDIANLKKNAKGDNKIKINDRIYIWCIYVKNPDLSISID
FT                   KDKKPIFISKNWVVGRSLDSIADNLHIQNNNNITNESSEKLNIFKLENNGKDDVDGEPK
FT                   LIITSLKSTVFKTGDIIYLVRGTI"
FT   CDS_pept        complement(864384..865829)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03720"
FT                   /product="KTR/MNT-family mannosyltransferase, putative"
FT                   /EC_number="2.4.1.131"
FT                   /note="Similar to S. cerevisiae KTR4"
FT                   /note="Similar to C. albicans MNT4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44632"
FT                   /db_xref="GOA:B9W7H2"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H2"
FT                   /inference="similar to AA sequence:UniProt:P38131"
FT                   /inference="similar to AA sequence:UniProt:Q9P874"
FT                   /protein_id="CAX44632.1"
FT                   /translation="MISIISLRKRKLVSILAIFTIFIISSSIIGYYNGHHHIIKIVENY
FT                   TPEDFSNSITSLTNKFDFSYLPGFKGISNSNNNKTSNDSLDDLDINGFTLIPGNVKFKF
FT                   LNKGNKKGTPEQILHQNMKDYKELLGSNPIGQPKDAILVPPPPPEELPSYKRANATILS
FT                   LVRNNELQSIGISIKRLQKKFNSKYNYPYTFLNDEPFTDRFKQRILKFTGNAPVEFIQI
FT                   KPEYWEKPSFIDTVKESKEMEIMFKHDVAYAKKQSYHNMCRFYSSQFYKIPELAKYKYY
FT                   WRVEPHVNFFTDINYDVFKYMETTGKIYGFTINLYDNEESVKTLWPETIKYLNQGDNYK
FT                   YINPKGSFQWLLEDLQNPKKTKFAGGYSTCHFWSNFEIGDFDFFRNEAYDNWVKYLDST
FT                   GKFYYERWGDAPVHSIGVSLFADKDKIHFFKDIGYDHDPYTNCPNTETTQMCEIAKFSR
FT                   WEHLYDQNCLMNWLHHDQPKDVY"
FT   CDS_pept        complement(866780..867070)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03730"
FT                   /note="polyprotein, fragment pseudogene, putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44633"
FT                   /db_xref="GOA:B9W7H3"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H3"
FT                   /inference="similar to AA sequence:UniProt:Q5AG24"
FT                   /protein_id="CAX44633.1"
FT                   /translation="MQESYQTDNCYWSLVLERKKFSPIYTPAMNGRAETYNKFILKQLK
FT                   LVVLNFPDRLFDLLSLFNEIIAYCVYMYIDIFMCIICVYYIELKDSLSLLF"
FT   mobile_element  complement(866855..870254)
FT                   /mobile_element_type="retrotransposon:korimako A, Tcd33,
FT                   LTR"
FT                   /note="LTR followed by PBS, Gag and PR/IN part of Pol."
FT   mobile_element  867211..867639
FT                   /mobile_element_type="retrotransposon:solo LTR, lambda A"
FT   CDS_pept        complement(867738..868346)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03740"
FT                   /note="pol protein, fragment pseudogene, putative"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44634"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H4"
FT                   /inference="similar to AA sequence:UniProt:Q8TFK0"
FT                   /protein_id="CAX44634.1"
FT                   /translation="MVVDESMSFVTAGGKVLKSSAKGKLDLYIGHNYILTIENVYYIDD
FT                   LTTNLISLSDITKFGHRAIFEGVSLSLEKDNSKHLIVAEFDPETRLYIGISGIVPSLVE
FT                   TKERNKCVKNKTRTNLECDILAVKQLVDLKFPQYIANSNDKKDLFYYHLQTNHMSLRAL
FT                   DQLIDQGKISAKRNGPEARNKVSNCIHCKAVNSKKDITQ"
FT   CDS_pept        complement(870299..871333)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03760"
FT                   /product="cell surface hydrophobicity-associated protein,
FT                   putative"
FT                   /product="aryl-alcohol dehydrogenase, putative"
FT                   /product="aldo-keto reductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="Similar to Candida dubliniensis CSH1"
FT                   /note="possibly fungus-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44635"
FT                   /db_xref="GOA:B9W7H5"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H5"
FT                   /inference="similar to AA sequence:UniProt:Q7Z8E8"
FT                   /inference="similar to AA sequence:UniProt:Q59QH3"
FT                   /inference="similar to AA sequence:UniProt:Q02895"
FT                   /inference="similar to AA sequence:UniProt:Q4WQ19"
FT                   /protein_id="CAX44635.1"
FT                   /translation="MSIDKSKLVTRLGKSGLKVNTIAIGTMRLGSNWMGFNGDIDECLQ
FT                   ILKFCYDNGFRTFDTADAYSNGKSEELLGLFIKKYDIPRERIVILTKCYFPVKDSTEEG
FT                   MGEVDEVDFMNGKGLSRKHILAAAEASVKRLGTYIDVLQIHRLDRDVTYEEIMHSLNDV
FT                   VEQGLTRYIGASSMKTWEFIELQNVAKANGWHQFISMQSHYSLLYREDDRELNDYCKKH
FT                   GIGLIPWSPNAGGMLCRPFDSDKNKQFLENKQWAGIFGLSNVNENDKAIVNRVEELSIK
FT                   YNASMMQVSLAWCIAKGVVPIAGVSKFAQAEELVGIYKVNLTEEDIKYLDEPYHAKDLA
FT                   PLIE"
FT   CDS_pept        complement(872235..873269)
FT                   /transl_table=12
FT                   /gene="CSH1"
FT                   /locus_tag="CD36_03770"
FT                   /product="cell surface hydrophobicity-associated protein"
FT                   /product="aryl-alcohol dehydrogenase, putative"
FT                   /product="aldo-keto reductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="position of ATG and STOP codons determined based on
FT                   C. albicans"
FT                   /note="possibly fungus-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44636"
FT                   /db_xref="GOA:B9W7H6"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H6"
FT                   /inference="similar to AA sequence:UniProt:Q7Z8E8"
FT                   /inference="similar to AA sequence:UniProt:Q59QH2"
FT                   /inference="similar to AA sequence:UniProt:Q02895"
FT                   /inference="similar to AA sequence:UniProt:Q4WQ19"
FT                   /protein_id="CAX44636.1"
FT                   /translation="MSIDKSKMVTRLGKSGLKVNTVAIGTMRLGSNWRGFNGDIDECLK
FT                   ILKFCYDNGFRTFDTADTYSNGKSEELLGLFIKKYNIPRERIVILTKCYFSVKDDAEDS
FT                   TLEIDPIDFMNGKGLSRKHILAAAEASVKRLGTYIDVLQIHRLDRNVTYEEIMRSLNDV
FT                   VEQGLTRYIGASSMKTWEFVELQNVAKANGWHQFISMQSHYSLLYREDERELNDYCKKN
FT                   GIGLIPWSPNGGGVLCRPFDAEKTKQFLDNKQWSSLFGLDNAREADRIIVNRVEELSLK
FT                   YNASMMQVSLAWCMAKGVIPIAGVSKFAQAEELVGIYNVNLTEEDIKYLEEPYHAKDLA
FT                   RVSE"
FT   CDS_pept        complement(874230..875264)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03780"
FT                   /product="cell surface hydrophobicity-associated protein,
FT                   putative"
FT                   /product="aryl-alcohol dehydrogenase, putative"
FT                   /product="aldo-keto reductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="Similar to Candida dubliniensis CSH1"
FT                   /note="possibly fungus-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44637"
FT                   /db_xref="GOA:B9W7H7"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H7"
FT                   /inference="similar to AA sequence:UniProt:Q7Z8E8"
FT                   /inference="similar to AA sequence:UniProt:Q59VP5"
FT                   /inference="similar to AA sequence:UniProt:Q02895"
FT                   /inference="similar to AA sequence:UniProt:Q4WQ19"
FT                   /protein_id="CAX44637.1"
FT                   /translation="MSIDKSKLVTRLGKSGLKVNTVIVGTMRLGSTWMGFNGDIDECLK
FT                   ILKFCYDNGFRTFDTADTYSNGKSEELLGLFIKKYNIPRERIVILTKCHFPVNESDDKD
FT                   WKDADPIDFMNGKGLSRKHILAAVEASVKRLGTYIDVLQIHRLDHGVTYEEIMHSLNDV
FT                   VERGLTRYIGASSMKTWEFVELQNVAKANGWHQFISMQSHYSLLYREDDRELNEYCKKN
FT                   GIGLIPWSPNASGVLCRPFDSEKTQKFLENKWWASMFGLGDTTEIDKTIVGRVEELSVK
FT                   YNASMTQISLAWCLAKGVIPIAGVSKFAQAEELVGIFNVNLTEEDIKYLDAPYHAKNVA
FT                   PCTE"
FT   CDS_pept        876051..878102
FT                   /transl_table=12
FT                   /locus_tag="CD36_03790"
FT                   /product="aspartyl-tRNA synthetase, mitochondrial"
FT                   /EC_number="6.1.1.12"
FT                   /note="Similar to S. cerevisiae MSD1"
FT                   /note="Similar to C. albicans MSD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44638"
FT                   /db_xref="GOA:B9W7H8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7H8"
FT                   /inference="similar to AA sequence:UniProt:P15179"
FT                   /protein_id="CAX44638.1"
FT                   /translation="MLKILSKIQQNGVRYISTLPDKASTLAKFDFPLATHTIKSIDSNI
FT                   ENYLNKQQTKVTLNGHVHRKSRIRPALGFAFLRDTNGDEIQLLATPKYTEPSIFELMKK
FT                   LTVEDSVSVTGFVQPKESKMGKDQQWELVVEDFQILNSSNLDAAQLDKLKHNSPQNIPP
FT                   QFRYLQLRTPYYQKSLRLRSEAAKVIRNIFIENHDFVEIETPLLFKSTPEGAREFLVPT
FT                   RSFNKFYALPQSPQQYKQILMSSGFTRYFQVAKCFRDEDLRSDRQPEFTQIDLEMSFVN
FT                   NSDQVGIVVEDVIHNVWNKVGGKPTYKVNDEGFLEKVDLAEAGKSLQFNKLNYIDALVK
FT                   YGIDKPDLRSNLSFISLEDIFVAKENADFPVVEVCVLKEAFDASSGKYKLPKTFIDDHN
FT                   FSSRRPYVWAIQKNDDTFSYFKKLIDANIIATTDKFDESKLQELLNLQPGDILAVSTRA
FT                   QFPYENPTPLGKFRQLAIEEFPHKWQRPIIENGQLSVDYDRNDMVVGSWVVNFPLFNPV
FT                   EESSLISSATQENLKPKYPLYNFKKFESTHHPFTMAKIEDYDLLETNPLKVHGEHYDLV
FT                   INGVEVGGGSRRIHDPALQQYIFEEILQISNFQQLFGHLLKALSMGCPPHAGLALGFDR
FT                   LCAMLVGSPSIRDVIAFPKNQSGVDPVVESPTGVKEATLNEYFITTKI"
FT   CDS_pept        complement(878184..880316)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03800"
FT                   /product="nucleolar protein required for 18S rRNA
FT                   synthesis, putative"
FT                   /note="Similar to S. cerevisiae NOP9"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44639"
FT                   /db_xref="GOA:B9W7H9"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040000"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W7H9"
FT                   /inference="similar to AA sequence:UniProt:P47077"
FT                   /protein_id="CAX44639.1"
FT                   /translation="MGKTKSRGRRAEKKSKKNEPEFNEDVSNLDSDATFANHESSSTSG
FT                   IPNTFFGLVDNNELDYFKQAESTLNINAFESEEERQGFINSVLEEAQGKELKLVTNQIC
FT                   SKLMERLILFANYNQLKKIFKQFQNHFVSLAFHKYASHVLETLLVRSAALIEKELTQTD
FT                   EEQLQLQEEKEEEDKDSINDVPMEDLFISMLNEFKPHLTTMIDHSYASHVLRLLILILA
FT                   GKELPSSITSNSTLRSKKSKIARKMIEIKDNEDFDRAFQTPQSFKNELRAYCQTIIAGL
FT                   DTKSARELSIHKIGSPVLQLLIQVEGLVDRERSFWHLIFAKDSEGKDSVEESFVEYLLS
FT                   DSVGSHFLESIIKNDGARPKYIERLYKLYMKDRVLKLAKRSTTGVYIIQALLFKLKPVE
FT                   VEYILDQIIPELAELISIADNQNLDLANKLIDASISRGNYRRDEIINQLFIKFAPNYDI
FT                   ENPSDNTSTEFIENILQLTGSTLGNTRDDWPTAEERKRALFLEKLMEYDYKFVICTWFN
FT                   FMALPIERFVQMCFHGVFCHVVEKALIVEPEEPKTIQILRKRLLNIFQSQIVGLACNSY
FT                   GSHIVDTLWNFTVLLPMYKDRIASELLSESHKVKESTYGRLVWKNWGMELFVRKKYDWK
FT                   ALIKQQEQEYYGETEDSTEKRAKKPIELKMERLAEEKRRQEEMAERAQSGYTKRKLEEA
FT                   TGTGSEKKQKLRGRRR"
FT   CDS_pept        complement(881110..881604)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44640"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I0"
FT                   /inference="similar to AA sequence:UniProt:Q59QG8"
FT                   /inference="similar to AA sequence:UniProt:Q6BKS3"
FT                   /protein_id="CAX44640.1"
FT                   /translation="MKFSLALLTATIATIVASAPTQYSGQTIDGDQVVEIPDSAVEAYF
FT                   PIDDELTPVFGEIDNKPVILIVNGTTLTSGAYNEKRDANADARFRLTNFGYFEPGKRDA
FT                   NADAKFKLTNFGYFEPGKRDANADAKFKLTNFGYFEPGKRDANAEAGFRLTNFGYFEPG
FT                   K"
FT   CDS_pept        883362..885140
FT                   /transl_table=12
FT                   /locus_tag="CD36_03820"
FT                   /product="conserved hypothetical protein"
FT                   /note="fusion of albicans alleles: (orf19.1037; orf19.8639)
FT                   + (orf19.1038; orf19.8640); (orf19.11962; orf19.4482) +
FT                   (orf19.11963; orf19.4483)"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44641"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I1"
FT                   /inference="similar to AA sequence:UniProt:Q59KB0"
FT                   /inference="similar to AA sequence:UniProt:Q59VQ5"
FT                   /inference="similar to AA sequence:UniProt:Q59QG6"
FT                   /inference="similar to AA sequence:UniProt:Q59VQ6"
FT                   /protein_id="CAX44641.1"
FT                   /translation="MPIPITTFIITGKEEGEDDEEEDNDSHNLEFEERRRRAESQRIRS
FT                   PFKHPWWTAFSDSGPQPRCLDEWLTVEISNSIRKKPDWKIKYKNDEIVVKWKQGIKQQY
FT                   QDKSKTRYLDQIIDYVFKELQWYEDVEKDLNTFQIGCDYRIVFSDGAINESLKKSFING
FT                   VQKLMESFGNDFDYYHLGSNNQVIDLVHPSLYIVQYDKTPVLKNGQLEIIKYGEEIEYA
FT                   KAGVDPSGVSKKFQWIPALMTKNSNGKFEFGSYINNLHPIKYKDLYDSIGDIFNAAIPG
FT                   LNCVLTRYASQEFIRIPIPGGSDAYTDEYDKDREELDAELEREAEETGHDYDWEKMEAF
FT                   EKDKSKYLREFIPKWEQAPVFDKPIDLATMFDNLKVIVKLANIELTPENPVYAGGSWHV
FT                   EGAINEDIVATVLYYYDVENITESRLSFRTGFDDPCYERDDRFYIETIFGFHGDDLMVR
FT                   EIGGIEVEKNRIIVFPNMFQHYVDPFELKDKTKPGHRKILCFFIVDPYNHNVITTDKVP
FT                   PQQKEWWDDSSLDYLFPGNLKQQILDLKGDNSSSWPMTLAQAKEARVALMEERFARGEG
FT                   DDFESGFSRYFALNET"
FT   CDS_pept        complement(join(885262..886422,886506..886508))
FT                   /transl_table=12
FT                   /locus_tag="CD36_03830"
FT                   /product="geranylgeranyl transferase type II alpha subunit,
FT                   putative"
FT                   /EC_number="2.5.1.60"
FT                   /note="Similar to S. cerevisiae BET4"
FT                   /note="Similar to C. albicans BET4"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44642"
FT                   /db_xref="GOA:B9W7I2"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR032955"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I2"
FT                   /inference="similar to AA sequence:UniProt:O93829"
FT                   /inference="similar to AA sequence:UniProt:Q00618"
FT                   /protein_id="CAX44642.1"
FT                   /translation="MQHGIKRVKLSEEAKRLKLQKDQIKIENYRQLTNEIFNLRNNGNY
FT                   SDKALIKTNELLIINPEFYTIWNYRREILINNYSNNKEIYEDILNQDLNFVLIQLKKFP
FT                   KCYWIWNHRRWLLFELVKLDKINWNYEFSIICKLLDLDQRNFHGWHYRRFIIENMELQY
FT                   ENNLIKKLEINLNEFNYTTLKIEKDFSNFSAWHNRSKLIPKIYNLLQQQQQQQQQNQNE
FT                   KIVDNLPGSIELFKDPILLLNNDLEMIKTGIYMSPEDTSVWLYLYWLLTDDLFIKAFKS
FT                   SNDYMNILNEQLQLINEVNEMEKEDTGKDNIGCLKTMIFINTLIQKQNQNQNQNQNQNN
FT                   QILTEQIKNYLIKLIEIDPLRKNKYLQQLSGKAPIFTIENVLKIENI"
FT   CDS_pept        886747..887433
FT                   /transl_table=12
FT                   /locus_tag="CD36_03840"
FT                   /product="mitotic spindle checkpoint component (MAD2),
FT                   putative"
FT                   /note="Similar to S. cerevisiae MAD2"
FT                   /note="Similar to S. pombe MAD2"
FT                   /note="Similar to C. albicans MAD2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44643"
FT                   /db_xref="GOA:B9W7I3"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR027097"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I3"
FT                   /inference="similar to AA sequence:UniProt:O14417"
FT                   /inference="similar to AA sequence:UniProt:P40958"
FT                   /protein_id="CAX44643.1"
FT                   /translation="MPSSSSSLQPSSKLALKGSSKIVCDYFEFALNSILYQRGIYPQED
FT                   FITIKKYDLPMVINDDYEVQKYINNIMKQIKKWIYGSKLTKFVVVIISKSNLETVERWE
FT                   FNIETKEPPIENGDDDDDNNNNNNNNEGKSRQEIQKEIRAIIRQITSSVSYLPVLKDSD
FT                   TDTDGEGYTFNVLVYTDPNTSIPIEWCDTQGDGKILHGNNIDNVKFTSFSTDIHQIGTS
FT                   VSYKYE"
FT   CDS_pept        complement(887451..888539)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03850"
FT                   /product="cyclin-like, CTD-kinase subunit homologue,
FT                   putative"
FT                   /product="cyclin-like, CTDK-I beta subunit homologue,
FT                   putative"
FT                   /product="cyclin-like, CTD kinase 38-kDa-subunit homolohue,
FT                   putative"
FT                   /note="Similar to S. cerevisiae CTK2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44644"
FT                   /db_xref="GOA:B9W7I4"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I4"
FT                   /inference="similar to AA sequence:UniProt:P46962"
FT                   /inference="similar to AA sequence:UniProt:O74627"
FT                   /protein_id="CAX44644.1"
FT                   /translation="MPSIVQISRPFFSHKEISYLHNQTISDNLKPHYTNIKNKIFQFLF
FT                   QIIKQLKFPLRVLATAMNYYQRYYLFNKFEINNGIFEFSDDPYTISMTCLFLASKVEDC
FT                   IKRLKDIQIVGNKLRDIDDNNNNKIIESNGLSYIEQQRKHILSIEYKLLQIIKFDFNNG
FT                   PITIRTNVDNLLIQFCKNMKVNYKLSILAWLINFDIMSTPLSLVVPPHCIALAIIIISL
FT                   NLNPIEINLHHEPLLPNENCLSAQEILQSIDSDDFQCPEILVNEAIIYILDYYIHQYQI
FT                   SILNVYLPSIDSESNKEQIYKFMKLKSEFNDVKIMDEISCTPKLNETDEYLKKWDYTIS
FT                   SKGSTRFMLSNKRRRFNKELQK"
FT   CDS_pept        complement(889131..889979)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03860"
FT                   /product="outer mitochondrial membrane protein porin,
FT                   putative"
FT                   /product="voltage-dependent anion-selective channel
FT                   protein, putative"
FT                   /note="Similar to S. cerevisiae POR1"
FT                   /note="Similar to C. albicans POR1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44645"
FT                   /db_xref="GOA:B9W7I5"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I5"
FT                   /inference="similar to AA sequence:UniProt:P04840"
FT                   /inference="similar to AA sequence:UniProt:Q9P544"
FT                   /protein_id="CAX44645.1"
FT                   /translation="MAPAAYSDLSKASNDLINKDFYHLSTAAVDVKTVAPNGVTFTVKG
FT                   KTTKDDTISASVDAKYLDKATGLTLTQGWNNANALNTKIELSELLTPGLKGELDTSVVP
FT                   NGARNAKLNFFYQQSAVNARLFFDLLKGPIATADLVVAHDGFTAGAELGYDISSAKVNK
FT                   YSVGVGYANLNYGLAATATSNLSVFSAAYFHKVSPLVQVGAKATWDSVKSSNVNVEFAT
FT                   KYALDNTSFIKAKIADSGLTALSYTQELRPGVKLGLGASFDALKLAEPVHKLGFSLSFA
FT                   A"
FT   CDS_pept        891669..892544
FT                   /transl_table=12
FT                   /locus_tag="CD36_03870"
FT                   /product="vacuolar sorting protein, putative"
FT                   /note="Similar to S. cerevisiae VPS66"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44646"
FT                   /db_xref="GOA:B9W7I6"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I6"
FT                   /inference="similar to AA sequence:UniProt:Q06508"
FT                   /protein_id="CAX44646.1"
FT                   /translation="MEKFSSWRDKGTGISPFMPQKLPTFQNNIILSVASKSPIFLIKLP
FT                   FFIITYLIYTITGLNFILKFILTILFGFNRIEFTVDGIKKSQIDKLIKYKPQKGDLIIT
FT                   NYITPLDGYFLSLLSGNNSKIVLLIPNKSGDLYQYSPLGLFNYTFNYNDGGKLIQDLSK
FT                   LQNKIVFLFLEGTPSNNKSILPFIKLNSKYSFNDNFIIKSLIVKLKPNYFTLPIPHITT
FT                   KLQYFFELLTNLSPKIIHYKIYKFDNEFNISKIRNSFELNSLTSISQDLNIDSKNKFID
FT                   YYFDHSIKKN"
FT   CDS_pept        complement(892576..893349)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44647"
FT                   /db_xref="GOA:B9W7I7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I7"
FT                   /inference="similar to AA sequence:UniProt:Q6BRG5"
FT                   /protein_id="CAX44647.1"
FT                   /translation="MNTIKQINQINQKELISNTSYKSSWHYDYRDTNYLYIGNIPFNLT
FT                   EKDIIKIFSQYGIPTHINLIKDKDKDKDKDKQETEKKYHRGFGFLKYSNFKSCILAIDN
FT                   FNGIKLGDRYLKVDHNYYKLRNDENEDDYLIDYNNEIMMKVNEEEEELIENNKEIKLIK
FT                   GKGEDKQEKDEEKDEFKDPMAQFLTKKEAKEEEEEKVDDDFKDPMEQFIKDKKAKNHKH
FT                   KSSHRSSGRSSHRHRSSHHHQYKSKDREKKSYKIK"
FT   CDS_pept        893576..896050
FT                   /transl_table=12
FT                   /locus_tag="CD36_03890"
FT                   /product="eukaryotic-ribosome-biogenesis-protein-1-homolo
FT                   gue, putative"
FT                   /note="likely involved in the maturation of the 25S and
FT                   5.8S ribosomal RNAs; constituent of 66S pre-ribosomal
FT                   particles"
FT                   /note="Similar to S. cerevisiae ERB1"
FT                   /note="Similar to Mus musculus BOP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44648"
FT                   /db_xref="GOA:B9W7I8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR028598"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I8"
FT                   /inference="similar to AA sequence:UniProt:Q04660"
FT                   /protein_id="CAX44648.2"
FT                   /translation="MAKSGIKKDTVVVVEKKNQAPISRKRKPVQQEEEEAHSNDESSED
FT                   ELNVEGLIDASEDDEDEEDEQQSQENNSDGDDDSAGENPIDSEEELNQLLGEEEDPSDY
FT                   DSEDFSDEPKEDELSGINIKSLSVSDPKTINSISKFSDGSIRILKPEIEPKYDSDDSDV
FT                   ENFNTIGNIPISAYDEMPHIGYDINGKRIMRPAKGSALDQLLESIDLPEGWTGLLDQNT
FT                   GNSLKLTDEELELIRKIQQQENTDENINPYEPLIDWFTKDEEIMPLTAIPEPKRRFIPS
FT                   KHEAKRIMKIVRAIREGRIIPPNKVQQQAKEDDQFNFDLWQDEIEIPDHIMNLRAPKLP
FT                   PPTNEESYNPPEEYLLTEEEKSNWLKQSPIDRERNFLPQKYNSLRQVPGYKESIRERFE
FT                   RSLDLYLAPRIRHNKLNIDPDSLIPDLPSPKDLRPFPIRCSTIYQGHTNKIRTISIDPQ
FT                   GIWLATGSDDGSVRIWEVLTGRQVFKIILINKEINHEDHIESLEWNPDSNSGILSVCVG
FT                   ENIYLIVPPIFGFDIENTGKLRIESGWGYDTFGNKKKDLKISTQDDEDAEDAEDAESEE
FT                   ENATSVESKKEVAKWYPPNSEQAAMGISAIIQCRKTIKKISWHRKGDYFVTVSPDSKNT
FT                   AVLIHQVSKHLSQSPFKKSKGIIMDVKFHPFKPQLFVASQRQIKIYDLSQQILLKKLMP
FT                   GVRLLSSIDIHPRGDNLLACSYDKRVLWHDLDLSSTPYKTLRYHEKAVRSIKFHKGNLP
FT                   LFASASDDGNIHIFHGTVYDDLMTNPLLVPLKKLTGHKIINQIGILDLIWHPKQPWLFS
FT                   AGADGTARLWTT"
FT   CDS_pept        896627..897661
FT                   /transl_table=12
FT                   /locus_tag="CD36_03900"
FT                   /product="cell surface hydrophobicity-associated protein,
FT                   putative"
FT                   /product="aryl-alcohol dehydrogenase, putative"
FT                   /product="aldo-keto reductase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="Similar to Candida dubliniensis CSH1"
FT                   /note="possibly fungus-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44649"
FT                   /db_xref="GOA:B9W7I9"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7I9"
FT                   /inference="similar to AA sequence:SWALL:Q59VU1"
FT                   /inference="similar to AA sequence:SWALL:Q7Z8E8"
FT                   /inference="similar to AA sequence:UniProt:Q59VU1"
FT                   /inference="similar to AA sequence:UniProt:Q02895"
FT                   /inference="similar to AA sequence:UniProt:Q4WQ19"
FT                   /protein_id="CAX44649.1"
FT                   /translation="MSIDKSKMVTRLGKSGLKVNTVAVGVMRLGSNWMGSNGDIDECLR
FT                   ILKFCYDNGFRTFDTADAYSNGKSEELLGLFIKKYNIPREKIVILTKCYFPVKDSTEEG
FT                   WGEVDPIDFMNGKGLSRKHILAAAEASVKRLGTYIDVLQIHRLDHEVTYEEIMRSLNDV
FT                   VEKGLTRYIGASSMKTWEFIELQNVAKANGWHQFISMQSHYSLLYREDDRELNDYCKKH
FT                   GIGLIPWSPNSSGVLCRPYNSEKTQKFLENKQWASVFGLDNVREADKIIVDRVEELSVK
FT                   YNASMMQISLAWCMAKGVIPIAGVSKFVQAEELVGIYNVDLTEEDIKYLDEPYHAKNVA
FT                   PNIV"
FT   CDS_pept        complement(897753..898325)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44650"
FT                   /db_xref="GOA:B9W7J0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J0"
FT                   /inference="similar to AA sequence:SWALL:Q59VP4"
FT                   /protein_id="CAX44650.1"
FT                   /translation="MTTTTTTATEVPLSYTLGFIRCKDNNKILLLNRNKSPWMGLYNGV
FT                   GGKLQSGESALDCMIREANEETGLHLTNFINRGIMTWNINYSDKVTSHQQPSIGGLYLF
FT                   TADISIEQYEQYRTPLIYNDEGILDWKNMEWILHQNNFGIVDNIKIILQYLFDSKEQDL
FT                   FIVKYNDHHLISCVYLPNENPLYKEQV"
FT   CDS_pept        complement(898621..899469)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03920"
FT                   /product="conserved hypothetical protein"
FT                   /note="position of ATG codon determined by reference to
FT                   Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44651"
FT                   /db_xref="InterPro:IPR028071"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J1"
FT                   /inference="similar to AA sequence:SWALL:Q59VT9"
FT                   /inference="similar to AA sequence:SWALL:Q59VP3"
FT                   /inference="similar to AA sequence:SWALL:Q6FPS2"
FT                   /protein_id="CAX44651.1"
FT                   /translation="MKLIFIDNNPLIVKCWKHHYQVLSNIYKEYNFQCHHNIKFSFYNH
FT                   TIEHMVQTYKFNTGKTSIVTPANSLNYMGGGFDLHLLNAILLGTNQTFKHLENIIQNYQ
FT                   LQRFQGYLVPNQIYKINLTDLSEFDYTSSIVYKNWNLTEIIEIPTMVVPEKIHSISHLF
FT                   DSIWNLMSNINFEKGNILVLPGIGTGYGNLNEYESTKIMLFAIFLYNLSFTIEEKPSRL
FT                   DQLKKSLLILFFFNKDYRKLENHNDIEELETYVISDYGQNLNLVNGTVMELEQVFKCIR
FT                   W"
FT   CDS_pept        complement(899849..900244)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03930"
FT                   /product="histone H2A, putative"
FT                   /note="Similar to C. albicans HTA2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44652"
FT                   /db_xref="GOA:B9W7J2"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J2"
FT                   /inference="similar to AA sequence:SWALL:Q59VP2"
FT                   /inference="similar to AA sequence:SWALL:Q59SU5"
FT                   /protein_id="CAX44652.1"
FT                   /translation="MSGGKGKAGSSEKASTSRSAKAGLTFPVGRVHRLLRKGNYAQRIG
FT                   SGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGDVTIA
FT                   QGGVLPNIHQSLLPAKKAKAGAASQEL"
FT   CDS_pept        901024..901416
FT                   /transl_table=12
FT                   /locus_tag="CD36_03940"
FT                   /product="histone H2B, putative"
FT                   /note="Similar to C. albicans HTB2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44653"
FT                   /db_xref="GOA:B9W7J3"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J3"
FT                   /inference="similar to AA sequence:SWALL:Q59VP1"
FT                   /inference="similar to AA sequence:SWALL:Q59SU4"
FT                   /protein_id="CAX44653.1"
FT                   /translation="MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKTRKETYSSYI
FT                   YKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRL
FT                   ILPGELAKHAVSEGTRAVTKYSSASN"
FT   CDS_pept        complement(901682..902872)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03950"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans BST1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44654"
FT                   /db_xref="GOA:B9W7J4"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039529"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J4"
FT                   /inference="similar to AA sequence:SWALL:Q59VP0"
FT                   /protein_id="CAX44654.1"
FT                   /translation="MLSKRLISYTNLFPRSRKYKLIIYIIICLILIISGLIGYLYSIPI
FT                   VSPDQPQCDMVWMSPSYAKIRAFDESHSKYASKYNLYLYREQDIDKMPNENEGFTSLDG
FT                   VPALFIHGNAGSFEQVRSIAARCSEMYYNDEGNIFKNKYPHARNIDFFTVDFNEELSAF
FT                   KGLRDQVEYVTEAISFISDLYPENPHKNIILIGHSMGGLVARIAAASTHDNNNNNNNNN
FT                   VNIILTLATPHSDPFPWLPKTSNFPDEIGLISIYSSVDLMVPPSVVTPKSKSDYFFSVD
FT                   AAKLFGLPIDHQGIVWCGQLREKLSEALIGISGLITLQDKMKVFKKIFDKDKEIGPTPI
FT                   FGLAKLKLKLLQSWVHLLSLTIFGLKWTMIVLIIIQLRKVYIKFTNPPTPTPVPSH"
FT   CDS_pept        complement(903660..904457)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44655"
FT                   /db_xref="GOA:B9W7J5"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J5"
FT                   /inference="similar to AA sequence:SWALL:Q59VT5"
FT                   /inference="similar to AA sequence:SWALL:Q59VN9"
FT                   /protein_id="CAX44655.1"
FT                   /translation="MTEEKKKVATAPSPAIKFDQEKLLQTVQTLQFGWFIGNVLTLLGF
FT                   FLFTLSYFGILPDIGFIWYLISLLGALISFGILLVQFIQKNGFKLPLLIKDDNFHYFLL
FT                   AIFLIALRAYVWITLIPFVIFSSFHVLNYVNTHLLPIVGLENNPISKHITNFVNKNNLA
FT                   SIQIASGIELLTIIWLFLRVITFRKRSLTPFLVFLIFLKKRHEVSPFTRKYFDFFGTQG
FT                   DSAVAAINNPVVNDVWGHVKTAFRTIDSFKLVHDRTKDEDKAK"
FT   CDS_pept        complement(join(905499..906775,906894..906903))
FT                   /transl_table=12
FT                   /locus_tag="CD36_03970"
FT                   /product="cell division control protein CDC3, putative"
FT                   /product="septin, putative"
FT                   /note="spliced gene"
FT                   /note="Similar to C. albicans CDC3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44656"
FT                   /db_xref="GOA:B9W7J6"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J6"
FT                   /inference="similar to AA sequence:UniProt:P39826"
FT                   /inference="similar to AA sequence:UniProt:Q4WGK7"
FT                   /protein_id="CAX44656.1"
FT                   /translation="MAAVDHSTTGEIVPQNIKIIKKVLNGYVGFANLPKQWHRKSIRRG
FT                   FSLNIMAIGESGLGKATLINTLFNRDIIISQHDSDEFDEGEEEDVSVKIKSTQAEIEED
FT                   GVKLKVSVITAPGFGESINNVEAWKPIVDEINSRFDSYLEAESRINRTAVVDNRVHAFL
FT                   YFIEPTGHSLRALDIALMKQVHEKVNLIPVIAKSDTLTDEEILEFKHRILADISHQGIK
FT                   IFKPTDFEYDEEESANTRSIIDSFPFAVVGSTKEVQTPDGRLVRGRKYPWGVIEVDNEN
FT                   HNDFVKLRQLLVRNFLEELKEHTANVLYENYRTEKLKRMGIEQDNTVFREFDPAAKQEE
FT                   ERALHEAKLAKMEAEMKSVFQQKVSEKEKKLQRSEADLFARHKEMKDKLTKQIKLLEEK
FT                   KAQLEKQKLLPQDPPVQPAPQKSRKGFLR"
FT   CDS_pept        complement(907875..908438)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44657"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J7"
FT                   /inference="similar to AA sequence:SWALL:Q59VN7"
FT                   /protein_id="CAX44657.1"
FT                   /translation="MAFPPEDITQIVLEIATILRTRKQTLAVSEAACGGLISAYLVSVP
FT                   GASDFYIGGKLLYSMKTRLKLSGWSENEINNYMGPSEQVALKLARTTKYELGSTFVLSE
FT                   TGFAGPSTALHLKKKNDDDDDDDDDIKHDNESDGVGTVYIGLSGPNGDSSTNYHTGKSD
FT                   RNVNMSEFAKLGLQFLLEQLQLQK"
FT   CDS_pept        join(908810..909282,909387..909750)
FT                   /transl_table=12
FT                   /locus_tag="CD36_03990"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /note="26S proteasome regulatory subunit, putative"
FT                   /note="Similar to C. albicans RPN13"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44658"
FT                   /db_xref="GOA:B9W7J8"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="InterPro:IPR038633"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J8"
FT                   /inference="similar to AA sequence:UniProt:Q6CF86"
FT                   /inference="similar to AA sequence:UniProt:Q59VN5"
FT                   /protein_id="CAX44658.1"
FT                   /translation="MTSSKSLKFHAGKVQYDEETNRCTPLQHKGVISIKPSSEEPEFLD
FT                   FTWTPKQDSTQATPGNIEKDEFLLIPGDVTIKHIKSCNTGRVFALTFLSSGAKYLYWLQ
FT                   DVGDIDQLDKLTEKDQKIIQDIVDLISVNEEEEEEEEVEEENKGIKKEEESIKAQEPKF
FT                   RLPIGNISSVLDIESIDSHLDKLSLEQLKEMYGDYLPQSIGSNPTKSQIMEVVRSGFFQ
FT                   QCEQKLSESLRSNSGAGYLMSQSLKYDYKGEGVESFLNGVRELGKKENDKDEEMKD"
FT   CDS_pept        complement(910080..910397)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04000"
FT                   /product="histone H4, putative"
FT                   /note="Similar to C. albicans HHF1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44659"
FT                   /db_xref="GOA:B9W7J9"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7J9"
FT                   /inference="similar to AA sequence:SWALL:Q59VN4"
FT                   /protein_id="CAX44659.1"
FT                   /translation="MSGTGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGG
FT                   VKRISALIYEEVRVVLKQFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
FT                   G"
FT   CDS_pept        complement(join(910532..910558,910560..910739,
FT                   910742..911029,911029..911037))
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_04005"
FT                   /product="conserved hypothetical protein, pseudogene,
FT                   putative"
FT                   /note="rearranged pseudogene"
FT                   /inference="similar to AA sequence:UniProt:Q59VN3"
FT   CDS_pept        911328..911738
FT                   /transl_table=12
FT                   /locus_tag="CD36_04010"
FT                   /product="histone H3, putative"
FT                   /note="Similar to C. albicans HHT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44661"
FT                   /db_xref="GOA:B9W7K0"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K0"
FT                   /inference="similar to AA sequence:SWALL:Q59VN2"
FT                   /inference="similar to AA sequence:SWALL:Q5ADQ0"
FT                   /inference="similar to AA sequence:SWALL:Q6B1U3"
FT                   /protein_id="CAX44661.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVGL
FT                   FEDTNLCAIHAKRVTIQKKDMQLARRLRGERS"
FT   CDS_pept        complement(912086..913330)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04020"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans HRQ1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44662"
FT                   /db_xref="GOA:B9W7K1"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K1"
FT                   /inference="similar to AA sequence:SWALL:Q59VN1"
FT                   /protein_id="CAX44662.1"
FT                   /translation="MNVTIEESSGILRSLGVNNLILLSIPIVAILLYLSYFQNPNKNTK
FT                   PTFASSSSSSSAKEYKIADRPLGYWKPDYSFKTPIPPAFPNWDFEKTRPIPYRAFRHKY
FT                   NVTMGIRSMNWDSWIELDNEWKFYHDLKLKRLQEKESDLSGISDSSKAYEASWELLQEL
FT                   CQYLPARYPNMFKFENQIMTILPTDEKYDLKDKSNLNPIITAAKLVQDDLAIMIEKEDG
FT                   NYYLDSGCICLAGFWRLKDKFGMKLDDIHKSGDVPQYDKQLKSGMNKFFRRLTVNSPVV
FT                   RNNYFIQTDNNLDWSNSIGSETEEKIGWYTAKESDDVNKLYFRSERQSLRRLPISGAIV
FT                   FTIRTYFLPVTQLCEEPYIPRRLLNGIQSWSEDVGEYKGFHIFKDALLPYLEKKALEQE
FT                   ANGLDPTKEPQVYPF"
FT   CDS_pept        complement(913727..915184)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04030"
FT                   /product="mitochondrial protein, putative"
FT                   /note="position of ATG codon may be at 19147, based on
FT                   yeast hits"
FT                   /note="Similar to C. albicans FMP44"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44663"
FT                   /db_xref="GOA:B9W7K2"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K2"
FT                   /inference="similar to AA sequence:UniProt:Q59VN0"
FT                   /inference="similar to AA sequence:UniProt:P38211"
FT                   /inference="similar to AA sequence:UniProt:Q09712"
FT                   /protein_id="CAX44663.1"
FT                   /translation="MVDFHTYIKVSKLVFMKESKKARKKEPLFFFFYVARDFHFFRFFF
FT                   FVFFFSIFQDTHEFFIIVITLVPMIMMMILWKLLRLFIIIKSIQLIIIYFSPCQFDTSS
FT                   ELIIENLPITTTTTTTTNFPIIITTILNKLIVWDSVYFNDLFINPIQFEHQFVFCPGWI
FT                   QLIKFFSSISSSNNNNNNSYYTAQLISIIISNLCHFASVVVLYYLTKEMDMKFGLMSSL
FT                   LMIISPAGIFLTTNYSENLSNLLTLLMFYTYYKSMNFNDIKQPSNKSIINIFIYILSGI
FT                   ICAINFTIRANGLFLGMIYLFDLYHFIQNKSPLQIILSIITGSFLFLTFLMTNIYHYIK
FT                   FCPGRNEWCNNIFPSLFQFAQYHYWNVGFLKYWTINNIPNFLLVLPILLFNIYSLNYMY
FT                   QELPKNRKLLPLIVINGLIIIGGTFFWNIQILNRITSFSPLIYWTLAYNLNMNMNMNKF
FT                   WSKYVIGYCILWNFIQTGLFAAFLPPA"
FT   CDS_pept        complement(915253..917268)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04040"
FT                   /product="acetyl-coenzyme a synthetase 2, putative"
FT                   /note="Similar to C. albicans ACS2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44664"
FT                   /db_xref="GOA:B9W7K3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K3"
FT                   /inference="similar to AA sequence:SWALL:Q59VM9"
FT                   /protein_id="CAX44664.1"
FT                   /translation="MPTEQTHNIVHEANGVKLRQTPKEFFERQPNKGHIHDVNQYKQMY
FT                   EESIKDPQGFFGPLAKELLSWDHDFHTVKSGTLQNGDAAWFLGGELNACYNCVDRHAFA
FT                   NPNKPALICEADEDKDSFVLTYGDLLREVSKVAGVLQSWGVKKGDTVAVYLPMNAQAII
FT                   AMLAIARLGAAHSVIFAGFSAGSIKDRVNDASCKALITCDEGKRGGRTTNIKKLCDEAL
FT                   IDCPTVEKVLVYKRTNNPEIKLTEGRDYYWDVETAKFPGYLPPVSVNSEDPLFLLYTSG
FT                   STGTPKGVVHSTAGYLLGAALSTKYIFDIHPEDILFTAGDVGWITGHTYALYGPLLLGV
FT                   PTIIFEGTPAYPDYGRFWHIVEKHKATHFYVAPTALRLLRKAGEQEIAKYDLSSLRTLG
FT                   SVGEPISPDIWEWYNEFVGKNQCHISDTYWQTESGSHLIAPLAGVVPNKPGSASYPFFG
FT                   IDAALIDPVSGVEIKGNDVEGVLVVKDHWPSMARTVYKNHTKYMDTYMNPYPGFYFTGD
FT                   GAARDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALIEDKKVSEAAVVGIHDDITGQAV
FT                   IAYVALKEGNDEEDSDELRKELVLQVRKTIGPFAAPKSVIIVQDLPKTRSGKIMRRILR
FT                   KVSSNEADQLGDITTLSNPQSVDGIISAFGAQFGKK"
FT   CDS_pept        complement(919866..921809)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04050"
FT                   /product="heat shock protein, putative"
FT                   /note="HSP70 chaperonin family"
FT                   /note="Similar to C. albicans SSA2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44665"
FT                   /db_xref="GOA:B9W7K4"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K4"
FT                   /inference="similar to AA sequence:SWALL:Q59VM8"
FT                   /protein_id="CAX44665.1"
FT                   /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSFVAFTDT
FT                   ERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDHEVQGDIKHFPFKVVDKGSKPMIQVE
FT                   YKGETKTFSPEEISSMILGKMKETAEGFLGTTVKDAVVTVPAYFNDSQRQATKDAGTIA
FT                   GLNVMRIINEPTAAAIAYGLDKKSEAEKNVLIFDLGGGTFDVSLLSIEDGIFEVKATAG
FT                   DTHLGGEDFDNRLVNFFIQEFKRKNKKDISTNQRALRRLRTACERAKRTLSSSAQTSIE
FT                   IDSLYEGIDFYTSITRARFEELCADLFRSTLEPVDKVLSDAKIDKSKVDEIVLVGGSTR
FT                   IPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAILSGDTSSKTQDLLLLDVAPLSL
FT                   GIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERAQTKDNNLLGKFE
FT                   LSGIPPAPRGVPQIEVTFDIDANGILNVSALEKGTGKTQKITITNDKGRLSKEEIEKMV
FT                   SEAEKFKEEDEKEASRVQAKNQLESYAYSLKNTLSEEQFKSKLDASEIEEVTKAADETI
FT                   SWLDSNQTATQEEFADQQKELESKANPIMTKAYQAGATPSGAAPGGAAPGGFPGGAAPE
FT                   PSNDGPTVEEVD"
FT   CDS_pept        complement(922379..923146)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44666"
FT                   /db_xref="InterPro:IPR022036"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K5"
FT                   /inference="similar to AA sequence:SWALL:Q59VM7"
FT                   /protein_id="CAX44666.1"
FT                   /translation="MNPVTTIITNFNNSQLQTPPTSPVTFDKYYAHFNIQLEQSKLMPQ
FT                   PSKIKNGDPFTWSDIQFIIKSNQLEIFARSRQQTIKYHKFKQWLKDNELSINDYLLDYE
FT                   LHWNESDLREQKHEYIPDKEYSIEYPEDLIFHNSNDISILYNKFPYYFEPNVKHICIWS
FT                   KLKIPVDKNSQVGDISDMTKKLINKYLEKTFVAKGISWDQIVWFKNWLSLQSVRSISHI
FT                   HVILKDVDDKFIDELISSGCSEVLTLDDYRNLE"
FT   CDS_pept        924499..925284
FT                   /transl_table=12
FT                   /locus_tag="CD36_04070"
FT                   /product="phosphoglycerate mutase 1 (GPM1), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44667"
FT                   /db_xref="GOA:B9W7K6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K6"
FT                   /inference="similar to AA sequence:SWALL:Q59VM6"
FT                   /protein_id="CAX44667.1"
FT                   /translation="MAVHKLIILRHGESQWNQENKFCGWIDIPLSQKGKQEAIYAGELI
FT                   KRNHLDPDILYTSKLMRSIETGLTILEVLQKPWIDHIKTWRLNERHYGQYQGRDKHEVF
FT                   VELGKDKEKFQYIRRNYHGLPPLIEYGQDKSIDEKYNDILNKDILPRGESLSMVMERLI
FT                   PFFKYEILDNQMIQLNKTVLIVTHGSIVRSLIKYLNHVSDDDISKINVPTGIPLVFELN
FT                   DRGELIKPYYYLDQEKAEKGIAKVKMEGLERKGQTDEKL"
FT   CDS_pept        927270..928904
FT                   /transl_table=12
FT                   /locus_tag="CD36_04080"
FT                   /note="regulator of proteasome genes (RPN4), putative"
FT                   /note="Similar to C. albicans RPN4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44668"
FT                   /db_xref="GOA:B9W7K7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K7"
FT                   /inference="similar to AA sequence:SWALL:Q59VM4"
FT                   /protein_id="CAX44668.1"
FT                   /translation="MTSLAILPQLKRTITDIMDEELYQSPSSPNSMTSFPSGTANLMSN
FT                   TNHNTFNQYNNTPFNMNSNMNYNHASNRNSINSSPNLSATTFNNANNLGNVLNIPDSFL
FT                   EQLASQDYIDHLKSQQQQDQAFENADDIYVQQVHENPVNPFNDYGNPDSFIRAQEQQSQ
FT                   LPHPQQPISQQEQQRQQQANKTPLPQAFPTRRRRKITLLNDIGGIGGSSNRKKHFDEDY
FT                   LLYNPDISPGHIVTDCSLDSSLVIPPNSNELFLTESESPEFANDIIPGYENDYLFLDDD
FT                   DEQIEEDVSDDEGDNYFQVDEDFDDYLMNNNGFDGYPTFNNYEGPGDNISITNGLNTES
FT                   NNNIDETISDVNSNSESETVFDQPKEVSPAAISPASQDQDSDDMMIDMEDENQIAGATA
FT                   GEEEEVNKKHSKTGKKESKSPKENLSTTKSKKHSHGISGAEITLNNPNHQCNLINPSTG
FT                   EPCNKQFSRPYDLIRHQDTIHASMKKIFRCVICEGRLNGGPGNGKEKTFSRGDALSRHI
FT                   KIKHGLVGQEALDLINEAKENVEYIPV"
FT   CDS_pept        complement(929267..930364)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44669"
FT                   /db_xref="GOA:B9W7K8"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K8"
FT                   /inference="similar to AA sequence:SWALL:Q59VM3"
FT                   /protein_id="CAX44669.1"
FT                   /translation="MLKFLPEDYRPYLAYLPDLQACVNLFMTFTPLFSYGSTCYSIHKR
FT                   QTSMGFSIDICCTMFMASILRIYYYFCSPYEPTLLRQSIIMILIQTLLLKVSLYYRPNN
FT                   YDPELLTPMPLLENELNMRVPRRLSSATLEHQSYWSGDWFSSLGKLTFDIIKYVSGYFV
FT                   AYFNYGLRFFDVYYRRPLSFWQWKLEANYWWFVIGFSTVFGITTLIFHENVTYSNIIGV
FT                   LGLFIESLLPLPQILLLNRLQSVKNFKVILLLSWLGGDCTKISYLLFGTDNISIIFIVA
FT                   GLFQMSLDIYIAFQYLQFKYFTTSKNLNDGGILHRKNPSIDDVVNDLVSISSEIELDIL
FT                   EKGSKDIPKNQTNSSRSRSRSSTLA"
FT   CDS_pept        complement(930838..933201)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44670"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7K9"
FT                   /inference="similar to AA sequence:SWALL:Q59KY5"
FT                   /inference="similar to AA sequence:SWALL:Q59KZ6"
FT                   /inference="similar to AA sequence:SWALL:Q59VM2"
FT                   /protein_id="CAX44670.1"
FT                   /translation="MLNLFGKKSHQEVPPIKSQHKSKPKTPKNSPKVHHSPKFISTSDS
FT                   TKGIVYNSTRISRPNGVGSTSTLGSLSPTAEFVTSQVSKSYVDQNKKRQSSPTNHRHDA
FT                   NIPAKVTTGGSLEHPNGKSKPSIQHKKKKKAGERVVTRTRPMRKNYRDRRNSVSSRESL
FT                   ISREQRNKQNRHKAKPHQEVPRNTSVQVVPSVPVPNNLPYPIHDIMDTSFGSHYEDTIE
FT                   DHEEEEEGDEMPSGFEEVNRRSVSPQNKQQINVLNATRNEVSESNPSALDGSNNNSRDC
FT                   RNFTERNNRNLAVQQVGAVDSNHNQSSLESQRVEAVACILERTGSSARDSRRARRAREL
FT                   RRSASIREIEHLQPSSSSINGSRNSSNKNTGRTTNGRNNKSITIATTDVNSPQMHSHAS
FT                   QSNYNIPTPDFNVAESIIPNQVGRQSQSRQPTDVSIQEETTTLATPISQQQSQSQSRLQ
FT                   QTRNAIIDRLNSRIDASMFPIDLIDPPPLDEYSTDDSNHHHHHQHYNNGHDMNNEQWGH
FT                   SPPYRENLHKRVDLISFDPRYSIPVLRINKRLVKNSTNLHKIIRKLIKLQIVPEDVNLW
FT                   DINKVDDGEFYNVLPSLLMNEMEVSDQRQHQEQQRQQQEDYENELQRALAISLEEENQR
FT                   EMFRGFRYQKSSTNRVIEQIVQSPDVDLNHGRFVDASEVPLHEEPSQTQEGSSSQRDLL
FT                   RGFRYNQSRASRAAMNGLIETSMLANNTVNENENEQEENGDEFIDVDEAIHSWRLHDSQ
FT                   ENQSNNHRRLSPPHFKYLQPHQSHSSASSFMTAY"
FT   CDS_pept        complement(934537..934788)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44671"
FT                   /db_xref="GOA:B9W7L0"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L0"
FT                   /inference="similar to AA sequence:SWALL:Q6BRX3"
FT                   /protein_id="CAX44671.1"
FT                   /translation="MLSQIARSSVRGVRLFSTSRVALTEGAIPQSKDAFSEKERAQENV
FT                   YIKKHEAAQLKKLKEKLQKQQETIDKLEKELDEHKNSK"
FT   CDS_pept        complement(935264..935854)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04120"
FT                   /note="mitochondrial ribosomal protein s18 (RSM18),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44672"
FT                   /db_xref="GOA:B9W7L1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L1"
FT                   /inference="similar to AA sequence:UniProt:Q59KY7"
FT                   /protein_id="CAX44672.1"
FT                   /translation="MLSSLRLSSIRVVNGGSIRFVSSTTPKLNEELSVDTSSKPKIDDM
FT                   KSKTSWNESYASESSIQVNLNENLNKITENISASDPPIYVSPNLHRHFTMGDTYNPFDF
FT                   SMNRFDMEKKMKTTKKLSDPFEKSGIDPKNLYLMPEILSKFLTSTGQILPRHLTGCNAK
FT                   NQKRLSMAIEYARSLGLLSSQHRHARYMPTRNL"
FT   CDS_pept        936407..937351
FT                   /transl_table=12
FT                   /locus_tag="CD36_04130"
FT                   /product="serine/threonine protein phosphatase, putative"
FT                   /note="Similar to S. cerevisiae PPH1"
FT                   /note="Similar to S. pombe PPE1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44673"
FT                   /db_xref="GOA:B9W7L2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L2"
FT                   /inference="similar to AA sequence:SWALL:Q59KY8"
FT                   /protein_id="CAX44673.1"
FT                   /translation="MGERGPDQWLEQIKNCISLSESDMKQLCELVKELLMEESNIQPVQ
FT                   SPVTVCGDIHGQFHDLLELFRTAGGLPSDDNQTNFIFLGDYVDRGYFSLETFTLLMVLK
FT                   VKYPHRITLVRGNHESRQITQVYGFYEECLTKYGSTTVWKYCCQVFDFLTLAAIIDGKI
FT                   LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFCDLVWSDPDNIDTWAVSPRGAGWLFGS
FT                   KVSREFNHINNLQLIARAHQLVMEGFRYHFKEKDVVTVWSAPNYCYRCGNVASVMQVDE
FT                   DLEPNFKIFSAVQDGDLSAKNNANKQQRSDYFL"
FT   CDS_pept        complement(937844..940066)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04140"
FT                   /product="nucleolar protein Nop4, putative"
FT                   /note="Similar to C. albicans NOP4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44674"
FT                   /db_xref="GOA:B9W7L3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L3"
FT                   /inference="similar to AA sequence:SWALL:Q59KZ0"
FT                   /protein_id="CAX44674.1"
FT                   /translation="MDEESINNKEVVVESMDVKQDSGKNQDDGLDHKTLFIRSIPFDAT
FT                   SEELSEYFSQFVPVKHAVIVTDNEGKSRGFGFVSFTLDEDCLTALVESRKTKFKDRLLR
FT                   VDVAKRRDRKQQEGSDRQEKAPVAPIEKRRARLIIRNLPWSCKKPDELKKIFSKYGAVF
FT                   DAYIPKKKGGQMCGFAFVIMKKKSAAEKAVEGCQGLKINGREVAVDFAVEKSKWEQMKE
FT                   EEEEEDDDESDEEEEEADSTNKDDNDQNEEEEGDDDESDNDDASSDFDELNEVNSDKEL
FT                   DGSDEEIEEPEKKEESSHPKKKSNRQEPFSIFIRNIPYDADAESLKEHFSTFGSVKYAL
FT                   PVVDKETGLSKGSAFVAFAKEDAYLDCLENAPTVASTSMLIADDVSPAYVYQGRILSIA
FT                   SAVDRDSASKLADRNLLKRKEALGKAPGEKDRRNLFLLNEGRITENSKLAQYISKTDLE
FT                   LREKSYKLRTQQLKKNPTLHLSLTRLAIRNLPRAMNAKALKALGRKAVVQFATEVKENK
FT                   RQPLSKEEVNRSVKFKQSINGGEVEEEIAKSKNSKHKGVVKQAKVIMEVKGSGETGRSR
FT                   GYGFIEFRDHKAALMGLRWLNAHEVSIPEILEGLTEEEKKLAELEGLNKRRLIVEFAIE
FT                   NAQVVKRRREKEMIARNQNKENSKKRKRDDEDNDETERTSKGKKSGASSDRKQKKARKG
FT                   SQKKGNMNKGAPKSEESQKESTNKSGLSENVKKIIGLKRKRRKSKK"
FT   CDS_pept        complement(940387..943251)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04150"
FT                   /product="aminopeptidase II, putative"
FT                   /note="unknown EC_number=3.4.11._"
FT                   /note="Similar to C. albicans APE2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44675"
FT                   /db_xref="GOA:B9W7L4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L4"
FT                   /inference="similar to AA sequence:UniProt:Q59KZ1"
FT                   /inference="similar to AA sequence:UniProt:P32454"
FT                   /protein_id="CAX44675.1"
FT                   /translation="MFSSVRKGVISSTGKYRPNLYYGITILNINKSFFSKNSHTHDTVG
FT                   KTPNSVNKNTNRHTVPFHKISNSAFSSIGQKLSYSSMCRHSSFSDNSASVVTQEREVLP
FT                   TNVKPLHYDLTIEPIFENFTFKGEETIDFQVNEKTNFITLNSLEIEVQEAKIDGKAVTD
FT                   ISFDANKQTVTFKFEDYLTVDSIAKLYIKFTGELNDKMAGFYRASYQEDGKTKYMATTQ
FT                   MEPTDCRRAFPSYDEPAAKSKFTISLIADKDLVCLSNSSEKETVSLDGNKKKVTFQTTP
FT                   LMSTYLVAFIVGDLRYISNDSYRVPIRVYSTPGTEHLGEYSANIAAQTLKFFDQQFGID
FT                   YPYDKLDMVAVPSFSAGAMENCGLVTFRTADLLIDAENTNVNTKQRVTEVVMHELAHQW
FT                   FGDLVTMEFWDGLWLNEGFATWMSWYACNSLYPDWKVWESYVSDSLQHALTLDALRASH
FT                   PIEVPVKRADEINQIFDAISYSKGSSLLRMISKWLGEDVFVKGVSNYLKKHKWGNTKTS
FT                   DLWEALSEASGEDVVKVMDIWTKNIGFPIVKVEEIGNGEIKVTQNRFLATGDVKENEDQ
FT                   TLYPVFLGLKTSEGVDESSVLETRSKTIKLPTSDDFFKINGDQSGIYRTAYEPARWTKL
FT                   GKAGVEGKLSVEDRVGLVADAGSLASSGFIETSSLLDLVKSWSKESNYVVWNEILTRIG
FT                   SIKAALMFEDEATKKALEVFTRDLISEKLKETGWEFSADDSFADQQLKSSLFASAANAE
FT                   DPEAVAFAKEAFAKFVSGDKKAIHPNLRASIFNTNAKYGDEKTFDELYQIYRNPSSVEE
FT                   KIAALRSFGRFTKPEILDKVTGLLLQTDIVKQQDIYIPMQGLRAHKLGVEKLWTWLSQN
FT                   WDQIYILLPPGLSMLGSVVTLATSGFTKEEQKKKVEEFFAQKDNKGYDQSLAQSLDIIT
FT                   AKTKWTDRDAKSIYEWLEVNGYTK"
FT   CDS_pept        complement(943799..944332)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04160"
FT                   /product="peptidyl prolyl cis/trans isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to C. albicans ESS1"
FT                   /note="Similar to S. pombe PIN1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44676"
FT                   /db_xref="GOA:B9W7L5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L5"
FT                   /inference="similar to AA sequence:UniProt:Q59KZ2"
FT                   /inference="similar to AA sequence:UniProt:Q9C475"
FT                   /inference="similar to AA sequence:UniProt:O74448"
FT                   /inference="similar to AA sequence:UniProt:O42735"
FT                   /protein_id="CAX44676.1"
FT                   /translation="MASTSTGLPPNWTIRVSRTHNKEYFLNQSTNESSWDPPYGTDKEV
FT                   LNPYIAKLKNNGYKPLVNEDGQVRVSHLLIKNNQSRKPKSWKSPDGITRTRDESIQILK
FT                   KHLERILSGEVKLSELATTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNI
FT                   IETNSGVHILQRTG"
FT   CDS_pept        complement(944515..945354)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04170"
FT                   /product="uridylate kinase, putative"
FT                   /EC_number="2.7.4.-"
FT                   /note="Similar to C. albicans URA6"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44677"
FT                   /db_xref="GOA:B9W7L6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006266"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L6"
FT                   /inference="similar to AA sequence:UniProt:P15700"
FT                   /inference="similar to AA sequence:UniProt:Q59KZ3"
FT                   /protein_id="CAX44677.1"
FT                   /translation="MLSRQVLAGRQIASGFARQKAISQCFKRFNSSKTNSTPPPKYSKG
FT                   KLLAVLGTLAIGSTVAASFYNKETPKSAFEPSESGDKPEFSEGKVSVIFVLGGPGSGKG
FT                   TQSDKLVKEKGFVHLSAGDLLRAEQNRPGSKYGELIAKYIREGEIVPQEVTVALLKQAI
FT                   KENYEQGKTKFLVDGFPRKMDQALTFENTIAKSAFTLFFECPEQVMLERLLERGKTSGR
FT                   TDDNIESIKKRFKTFIDTSMPVVDYFDKQGKVVKVRCDQPIDVVANQVKEALKTRGI"
FT   CDS_pept        complement(join(945692..946416,946484..946520))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04180"
FT                   /product="oxidoreductase, putative"
FT                   /EC_number="1.-.-.-"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44678"
FT                   /db_xref="GOA:B9W7L7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L7"
FT                   /inference="similar to AA sequence:UniProt:Q59RC5"
FT                   /inference="similar to AA sequence:UniProt:P40579"
FT                   /protein_id="CAX44678.1"
FT                   /translation="MSHVSIITGASRGIGKAIAEVLLKDPNTKVIAVARTEAPLKVLAN
FT                   TYGSDRVGFVAGDITDPETSKKAVELAVSKFGQLNSIIANAGVLEPVGPIESTSVDEWK
FT                   RLYDINLFAVVELIKLSLPHLKKVNGKVVAVSSGAATKAYSGWYAYGSSKAALNHLILS
FT                   LASDEKDIQAISIAPGVVNTEMQTDIREKFGKNMTPEGLQRFIELHENKQLAPPEEPGT
FT                   VYAKLALQGWPEDLNGKFLRYNDEILKAYQL"
FT   CDS_pept        complement(join(946722..947446,947518..947554))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04190"
FT                   /product="oxidoreductase, putative"
FT                   /EC_number="1.-.-.-"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44679"
FT                   /db_xref="GOA:B9W7L8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L8"
FT                   /inference="similar to AA sequence:UniProt:Q59RC5"
FT                   /inference="similar to AA sequence:UniProt:P40579"
FT                   /protein_id="CAX44679.1"
FT                   /translation="MSHVSIVTGASRGIGKAIAQILLKNPSSKVVIVARSQAPLESFQK
FT                   QHGSDRVAFVAGDITDPATSKKAVETAISNFGQLNAVIANAGVLDPIGPIENTSVDQWK
FT                   RLYDINVFSVVELIKHSLPHLKKTNGKVIGVSSIAAFTAFNGWYAYGSSKAALNHLMFS
FT                   LASEEKDIQAIAVAPGVVDTEMQNDIREKFGKNMKEEAFQQFVDLHKNEKLVSPEEPGT
FT                   VYANLALKGWSEDLNGKYLDFDDALLKDYQM"
FT   CDS_pept        complement(948020..948829)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04200"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family, putative"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44680"
FT                   /db_xref="GOA:B9W7L9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7L9"
FT                   /inference="similar to AA sequence:UniProt:Q4WRZ7"
FT                   /inference="similar to AA sequence:UniProt:Q59RC4"
FT                   /protein_id="CAX44680.1"
FT                   /translation="MVDFNVNGKIAVVTGGTRGLGLYCAEALLLNGASTVVITSRKAKA
FT                   CEEAQKYLEKLAKDNNKNCKVISYPADIAVEEECEKFYAEIAKQVDKVDILVANAGASW
FT                   GAPLEDHPVSAVKKVLNLNVVAVYHTIKLFTPLLEKAGTKEDPSRLILMSSVISYSTND
FT                   MVGVYGYLSSKAAVSHLGRNLSVQFAPRHINVNSIAPGFFPSKMANGLIEAAGEALTST
FT                   NPRGRLGEKEDIQSLLIFLCSKQSNYVNGTIVPLDGGAHNNQPAAHF"
FT   CDS_pept        complement(949413..949934)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44681"
FT                   /db_xref="GOA:B9W7M0"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M0"
FT                   /inference="similar to AA sequence:SWALL:Q59RC2"
FT                   /protein_id="CAX44681.1"
FT                   /translation="MNMGVKRVRWVEPPATNIDEAVIKTPIQKTDSPVKPKLKVPRKKS
FT                   FPFSSEEDNKNVEYQEGLNKTEEIPGLLRDYFICVMKNVFRIIKMLFNNQIVVGFTNFL
FT                   ISVIAFIAITALRTIATVGKFLIDFNFSLFFESCVFLLEEHEIYFTTDLSLKRSNCKFN
FT                   KKHGTTTTDK"
FT   CDS_pept        complement(951042..955247)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04220"
FT                   /product="guanine nucleotide exchange factor, putative"
FT                   /note="Similar to S. cerevisiae TUS1 (SOP10)"
FT                   /note="Similar to S. pombe RGF2"
FT                   /note="In S. cerevisiae: guanine nucleotide exchange factor
FT                   (GEF) that functions to modulate Rho1p activity as part of
FT                   the cell integrity signaling pathway"
FT                   /note="In S. pombe: RGF2 is involved, with RGF1, in
FT                   formation of the cell wall and septum"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44682"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M1"
FT                   /inference="similar to AA sequence:UniProt:Q06412"
FT                   /inference="similar to AA sequence:UniProt:Q59RC1"
FT                   /inference="similar to AA sequence:UniProt:Q9UTR5"
FT                   /protein_id="CAX44682.1"
FT                   /translation="MSHQPNKRTLRRKPPPIEDSTPFSIYQNLASNPQQYSDFQHALSK
FT                   SPPIQVNTFIQSSPPNYTQSPPSAPPPPIPAQQPEYTSQIGTFSEMASTPVDQANYNVS
FT                   VSSEYPIDESFISMSGSPKPKGPKQIWEYEDDSIISQPIEYVRHASINSTDYKSRPRGY
FT                   QQMSTTSQSAPLDNIPYPLEDFSPIEANSSATTAPYPTQNFEDSINDYFEDDYDYTFED
FT                   DSPSQMQAHQSVEKYGNGVSPRINDVPDLTSKRSSLQSSQSVNNSWQSHSQTNSIHSGA
FT                   NSAGIQGQFPVSAPPFLESPPRPNLRQLATRNSQNFPPPPNQGIDYVSDSSYSRSPSPT
FT                   RRTIDRTKTVSSGFTYAESEYIEYFSEGYNEFSVQHGPSSRWNSVNSNATYTPENLFWD
FT                   DGYQLSSESPATEYFDYSMLPELPSVKPLPKSPSYFPDEVLASKQQQELPSLPLELPDL
FT                   PFSSAFLQSQHFEICSKIWSLSALFNWCLKLRIWLNNSTISKTELKKALGGLLAFHRRD
FT                   VPLDVVSNNAAAAFENFVSSGAIEVIEDVEAQGSDKTLIVMNENVYLNGVLPLLTECYS
FT                   NFQHTKEVEQSNMTCYSTCCTLSKSMNLERKMRNTNIKDIVLEHDWTSHWHLTVEDLKT
FT                   LNHATSKQQSLIFDLMRYEQTFIQRADCFVEVVAPEFIKAAKSYFGQNSEKISRFEQDI
FT                   ISAGKQIVNIHRTVLFEPLLKILIAEGKFIKNLVGIGQTYSDWAFEIKPPLIKYMSCMP
FT                   MIEELLGIETIKAYIDNRISALPRVRDLKVNVGILFISTFNSRYMQLPLQLEDIYKKFD
FT                   VNDPEHISMLKAANDIRKLGVRINDSKKSADNNYAISVIKDQLLWKSGVTQINLNLNSP
FT                   NRKFVCRGDLTRKSVLSKLQTSNINHIILLDNYVLLTDRARNRRGGLAYKILEDPIPVE
FT                   YLIVEEKVVSSSTLLPNQNALTTTQSGVADAETDDNDAFQLKLRYAGRTRRAYTFSCGT
FT                   EREIRDWINYFIAAKSALCKRLAQSNPYRVVSVSNTVFGYENSHRVTKLQLLARYDPIY
FT                   DICQDSVEKTKKLNLWSDLYNPRLAHNRIVFSKLQCMCWFEYKGCKYNLVALEAGLYMC
FT                   EAKGRWKKIIGGDNYVQMQVDSQIGIVVVLTEKQLGYYPIHQILNVYNETKVNLTCIPL
FT                   SKDTVLFFEMGRHKNVKMLFYAKKKTNGSIHFKVMIPQIDNGGIFSRFKDHARFYIEAE
FT                   CFGISIFNSSFAVHTDKGFEILTLDKLIPSSVPELPPPVETEKKKADPYATRKNKPTSS
FT                   VETIRMLINAKYKPMGMYKLNNNKEFLLVYKEYAIFINKHGKPSRDFIIHFRAHHVYFE
FT                   NNYLFVVNDQLIEVWHIGDHPKKAQVIIGKDIKHLGQNGFSMANPLVPGLQLVFRLVE"
FT   CDS_pept        956221..957369
FT                   /transl_table=12
FT                   /locus_tag="CD36_04230"
FT                   /product="histone binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44683"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019544"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M2"
FT                   /inference="similar to AA sequence:UniProt:Q9USQ4"
FT                   /inference="similar to AA sequence:UniProt:Q59RB9"
FT                   /inference="similar to AA sequence:UniProt:Q2UMI9"
FT                   /protein_id="CAX44683.1"
FT                   /translation="MSNYSPEIAKLISEGSRAYSSKDFELASEKYGEACEEYSKTHQGN
FT                   EDADLLFLYGKAVFQSGVSKSEVFGGKPAEQDLENENSESKEEDSKPETDKTDDTFQFY
FT                   ADGDGDEEDGDANVFQEQGEEKDEPNEDENNDDDANKSDFEVAWELLDLARALFEEKLE
FT                   SLDKGDLKPPYLAQDTEESNNDYVVALKKLSETYDILGEVSLEAENFNQAAEDLRKCLD
FT                   LRLELFSDSSSLISESHYKLALALEFQSDDSSSRKNAAEQMKLAIESVERRNQTEKDDS
FT                   RKKDNQEIIDEMREKYQDLLKDPSEEIKKQQLDIIKGILGEEASGSEQSAGAAIVNNLQ
FT                   TMVKKKQKPEETKPVVNDLSGMVRKRKKQDSNDDKTKKPKSE"
FT   CDS_pept        958475..960127
FT                   /transl_table=12
FT                   /locus_tag="CD36_04240"
FT                   /product="isocitrate lyase, putative"
FT                   /note="Similar to C. albicans ICL1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44684"
FT                   /db_xref="GOA:B9W7M3"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M3"
FT                   /protein_id="CAX44684.1"
FT                   /translation="MPYTPVDIQKEEADFQKEVAEIKKWWSEPRWRKTKRIYSAEDIAK
FT                   KRGTLKINHPSSQQADKLFKLLEKHDADKTVSFTFGALDPIHVAQMAKYLDSIYVSGWQ
FT                   CSSTASTSNEPSPDLADYPMDTVPNKVEHLWFAQLFHDRKQREERLTLSKEERAKTPYI
FT                   DFLRPIIADADTGHGGITAIIKLTKMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQ
FT                   EHINRLVAIRASADIFGSNLLAVARTDSEAATLITSTIDHRDHYFIIGATNPEAGDLAA
FT                   LMAEAESKGIYGDKLAAIEAEWTKKAGLKLFHEAVIDEIKSGNYSNKDALIKKFTDKVN
FT                   PLSHTSHKEAKKLAKELTGKDIYFNWDVARAREGYYRYQGGTQCAVMRGRAFAPYADLI
FT                   WMESALPDYAQAKEFADGVKAAVPDQWLAYNLSPSFNWNKAMPADEQETYIKRLGKLGY
FT                   VWQFITLAGLHTTALAVDDFSNQYSQIGMRAYGQTVQQPEIEKGVEVVKHQKWSGATYI
FT                   DGLLKMVSGGVTSTAAMGQGVTEDQFKESKAKA"
FT   CDS_pept        960580..962028
FT                   /transl_table=12
FT                   /locus_tag="CD36_04250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44685"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M4"
FT                   /inference="similar to AA sequence:SWALL:Q59RB7"
FT                   /protein_id="CAX44685.1"
FT                   /translation="MGFIDPGKSLRKRKSRSNSPLPAKIPRVSPSLSPRQYAPAIPKVC
FT                   SLATLPVEIIHKIFVYVGPYENNLPLVEKHMNSILRFNGDIQVEPVYNYPLFKSMVNSY
FT                   FLFDLNIRINHQCLQMKSKYYTSKLETIQQHHPEYTRSSYYNRLRRNLAIVESTVQSFN
FT                   QNRHALLVDILNFKFVSSQVLYRLNQERETMGQGLLSIRSMSEITLLQKSRLKFLRLKF
FT                   NEMGDNLKRLLSEIENGLIETSVTFDIESIQQSLFDEPEYDLNPHFQYFEDENLPTEGF
FT                   SSCTNDRFIKISEGFINFNEGFEVIEEEAPGRSKIPELLFTKSIYSKRHYDTLSYLRRF
FT                   YKFGKMDGPRIIISLSEVLESPHKYQVLNWLQLAGLVDYVCACNNPQYKFTEAIITSFR
FT                   LFAHYNSKDHPLLFDIKIDIADAINKIFQMVETLVEYFFAHDHNNEERRQLWIEAMQLK
FT                   SICLIDLLRKYDDNPDYDILHRFG"
FT   CDS_pept        complement(join(962156..963107,963187..963206))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04260"
FT                   /product="cyclin-dependent serine/threonine protein kinase,
FT                   putative"
FT                   /note="deleted EC_number 2.7.1.37"
FT                   /note="spliced gene"
FT                   /note="Similar to C. albicans PHO85"
FT                   /note="Similar to S. cerevisiae PHO85"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44686"
FT                   /db_xref="GOA:B9W7M5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M5"
FT                   /inference="similar to AA sequence:UniProt:Q9HGY5"
FT                   /inference="similar to AA sequence:UniProt:P17157"
FT                   /inference="similar to AA sequence:UniProt:O74456"
FT                   /protein_id="CAX44686.1"
FT                   /translation="MTGSSSQFQQLEKLGEGTYATVYKGRNRATGALVALKEISLDSEE
FT                   GTPSTAIREISLMKELDHENIVTLYDVIHTENKLTLVFEYMDKDLKKYMEVHGQQGALD
FT                   LKVVKSFMFQLLKGIMFCHDNRVLHRDLKPQNLLINNKGELKLGDFGLARAFGIPFNTF
FT                   SNEVVTLWYRAPDVLLGSRAYTTSIDIWSAGCIFAEMCTGKPLFPGTANEDQLIKIFRL
FT                   MGTPNERTWPGISQYTNYKNNWQIFVPQDLRLIVPNLDSMGLNLLQSLLQMRPESRITA
FT                   RQALQHPWFHEITMPNAVPQNLNDPYQQQQHHSHQPIIDQQY"
FT   CDS_pept        complement(963509..965068)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04270"
FT                   /product="methyltransferase, putative"
FT                   /product="tRNA U44 2'-O-methyltransferase, putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to S. cerevisiae TRM44"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44687"
FT                   /db_xref="GOA:B9W7M6"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M6"
FT                   /inference="similar to AA sequence:UniProt:Q02648"
FT                   /inference="similar to AA sequence:UniProt:Q59RB5"
FT                   /inference="similar to AA sequence:UniProt:O74516"
FT                   /protein_id="CAX44687.1"
FT                   /translation="MDHSDKKLLTANASVLGPCWVPIYESPVGFSVQHFEAAMLNIIHQ
FT                   PNINSTVIMRADILRENIFDPDEGDTTFTSKIANEIPKFQTHDDSELLLRNLKDIKVRQ
FT                   IPDIPDIQFTMRHEIVRRVIPRNPFKDYIINQTCLMLTDNKKNNLVVYIPHIDSVEETP
FT                   YYLPPVYGIGILYNDFKVSVHYLPFGFETPNCKELTLLKSMTEQDRPIRIALRLLNTAT
FT                   KHSQGRKLGYEKRVNHDLVVPQTSFQNQYITLKKKYSDYFMNNWSESTDPRKHVFEDIA
FT                   IAAFIIEYWKLNDFEPEKFEFRDLGCGNGLLVHILISEGYKGKGIDARARKSWVSYPSK
FT                   VQQCLLEQIIVPQILLDQQPMSSDITASISKQQISTTAEFPKNTFIIGNHSDELSCWIP
FT                   LLGFPFIVIPCCSFGINGVRKRYPPRKNMAFKTPPSTYKTLVDHVEDIALMNGWLVQKE
FT                   MLRIPSTRNAAIISCEKIPVLANEPEHIRRIRLLDIIALEGGADGWVENSINLMKSEPK
FT                   KH"
FT   CDS_pept        complement(965429..968272)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04280"
FT                   /note="vacuolar protein sorting VPS16 homologue, putative"
FT                   /note="Similar to C. albicans VPS16"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44688"
FT                   /db_xref="GOA:B9W7M7"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="InterPro:IPR038132"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M7"
FT                   /inference="similar to AA sequence:SWALL:Q59RB4"
FT                   /protein_id="CAX44688.1"
FT                   /translation="MPSNPSFNWSKLQNVYYNIRTCYDELNWTIDNLYSNYLVSLSPNA
FT                   TLIAIASKSAPHPNLIEIYSISGHKLWSVVYNSTHNDYIQSFHFTRDEDLIIVLNNGKY
FT                   RHYYDLIGNFNEYNFVENLVTMDNISQTPNGADKIDPNSDNTRIITNLENNQTEEIVKI
FT                   MEVKTWNKFLVVRLESKLIVTDLDSFTNYAVSLASYAASDFECFNIQGKTGTKKAVTIQ
FT                   LGYRKSILSIDVDFDLASYEIVDQELTDGPFSSIAISPSGQLISLFNKQLKKIFVISNK
FT                   FDQILLDYDTSNESSDPYQVQWCGNDAIVLSFKDEIKLIGPGQQSISFFYDIEDDDEFD
FT                   LDNLMVKKDNKSSDYKKFDDLLFTIPILQTSIDGLRIITTTKVQFLSRVPETCVQMYQV
FT                   GSTAPSSILADCVDKFSANASKADSNISLLRADNTLLKAMEDCLQVALEEFSPDWQRRA
FT                   LKAVSFGKVYYDDYFDSDKFVSVVDNIKVLNLIRSPELGLFLTYQQIENIGGWEEVIKM
FT                   LLRRNHHDLSLDIIKKLNLGNAKPLVYIHWCCYKIRKELDMSDIDLFKLITDKLISSTK
FT                   KARVNYISTDQISETAHEEGREELCKLLLHLEPSVIKKIGKLLDLDEDELALLKSFQNG
FT                   NYDLSTLILLYLQDNLTTSQFFKVLSQTESVSKKENSTKQAIEKLDIEFKSEYIQVTGD
FT                   VVGHAWEESIAKDSSPRLLETYLKHEDRIYELNVFKIQQFKHDSDVHRDNYYESYKSVL
FT                   TKCINRSTNQRISKALQREIQILELQKKLSDTYLADFYQDKALMGILKRLIVMNQIKPA
FT                   KKIAANFQLSVEKFWYLVLNTLMDRCEFDQLYEFAFGSSDQTSGNSPIGFEPFAELGLR
FT                   KNAPQSHISTYIRNSTKYKYEERISMFIKNDDYESAALEAFRNKDIEILKSLLQKIPNS
FT                   NQAGTQVVNSYIQQLGY"
FT   CDS_pept        968519..968821
FT                   /transl_table=12
FT                   /locus_tag="CD36_04290"
FT                   /product="elongin C, putative"
FT                   /note="Similar to C. albicans ELC1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44689"
FT                   /db_xref="GOA:B9W7M8"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR039948"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M8"
FT                   /inference="similar to AA sequence:SWALL:Q59RB3"
FT                   /inference="similar to AA sequence:SWALL:O13292"
FT                   /protein_id="CAX44689.1"
FT                   /translation="MSLLNTEFVTLVSSDNFKFVISKDVASISSVLRNSQGFEEGKTGK
FT                   IKLDMDGDILECIVEYLYYHHKYRDSVTEGKDIPEFNIPTHLALELLVKADYLDI"
FT   CDS_pept        969359..971107
FT                   /transl_table=12
FT                   /locus_tag="CD36_04300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans RMD5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44690"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7M9"
FT                   /inference="similar to AA sequence:SWALL:Q59RB2"
FT                   /protein_id="CAX44690.1"
FT                   /translation="MTTTTTTTTTTALLDTLSTEVTNLDQSGTDSLNDLLQDSNEFLAE
FT                   LRLIELDLIEEVNSQQNEHTNHKPVDSVDKLSKLSDKWYKSSISRLKSYNSANNKFSKN
FT                   ILNNPKFSIELDDAYTYPLLLNNYPHNNQKDDHESHASTISKESNMGTSKDPYSILSKS
FT                   SQLEKIKNENREELIKAIVLHLLKTGQCEIVPEVLKELPANTSSVIDQDLFKKFEILNQ
FT                   IVDNIITRHDLSMALQWFQKKYNERVAINAKNSTLPPNTSADTFGSINLSWDQNDSFYD
FT                   IEFKFHMLQFTILLNGENSSFTLDNALKAYLYSKDNFSKFFKDYINEISPLMTLLLFRT
FT                   DKDTETLDDFSKKHMVTTVKSFITKMKQGFYMENERNQRGMGHGGEAKFVYELLANFEN
FT                   IHDSGNLFTNLANEFIAEYCKDLKLSNDSSLFQSVLAGHIYLPSFYKYNQIQLKLKKLK
FT                   SVSGSKLSEDSSGVSNSTNSISDNQVENFVATYHFELPFQLPDSNRFLFKYHPIFICPV
FT                   SREQLIPITENGYTTQAVVLNYCQHLVLRDSIWHLSKKGIDIFKCHYCYKKHKYSDVTD
FT                   AYFIDL"
FT   CDS_pept        complement(971322..972716)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44691"
FT                   /db_xref="GOA:B9W7N0"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N0"
FT                   /inference="similar to AA sequence:SWALL:Q59RB1"
FT                   /inference="similar to AA sequence:SWALL:Q6FXI4"
FT                   /inference="similar to AA sequence:SWALL:P38907"
FT                   /protein_id="CAX44691.1"
FT                   /translation="MSRLEQQTRSYKNILPNTYVPYLGHKVLYNILDRLSKNSILQFII
FT                   LWTKLKNTQPKPPSKYTQQGFNKKIIKEVNEFRKSINRTPKRKLIDKIIFEYWTQGLNL
FT                   LQISQIDCQLIVDKSNSTQSWIYSTVKDMHDKIVPISINPREFLDNLVKNLSSLYLSYI
FT                   YICKHPKLPIILIRIQVFDLNGMDITEKPHIISHKAYFFGIFINSPHVVHSINNDAMVH
FT                   GIVMEAFERSLPQSKNNLLKLITPENQFPVKSIQSMHILKGCDRFGNSLGIWTPYADGT
FT                   VDMLPLGAVEDHQVSKNEVSEAGVENEAGTAENINSLKLQRLKKIANLRFKGSLTGNKQ
FT                   TSNEQPKLQQQDEDTNPDQAANEGHINDTEFDSIAPIQYAEFILREKTTVARTEKSIDD
FT                   DGRTNIKFKITGSDVFGGLHELSVKSTEPEEIILNPEEVPNWLTGEEGATFGEIRNGNF
FT                   YEKTNG"
FT   mobile_element  972837..974311
FT                   /mobile_element_type="retrotransposon:tara B, Tcd30, LTR"
FT                   /note="LTR and putative Gag ORF"
FT   CDS_pept        973171..974328
FT                   /transl_table=12
FT                   /locus_tag="CD36_04320"
FT                   /product="putative Gag protein, transposable element
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44692"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N1"
FT                   /protein_id="CAX44692.1"
FT                   /translation="MSDNNITTNHQTIDNGDFPSLRMLGDKQNLVLDVAVETADIYIDN
FT                   IGDFIFTRHEADGSIHLVHDPLNRWSVDQIPAELKKNMEVTYSQCLARVSLISTDRICM
FT                   ILNITEQVLDSVFNSELAKSFAKPPFSRLITHILDTNLTVSRQNFLFPAYTFHRVRVGS
FT                   LDSDNLVEKVFFLRDFEFKLMQRLSQIKSFTERFPNCHSLKAVILKAASPSRLTDSGEI
FT                   RLILDHIKSNLLNAKDARECWERCNELPMPNTEAAKFIRKLNSKRNFVQWYLNVSIKFK
FT                   NKAIVVKTLTHHFGRFKDGEEPNADNVVNDIINEPGFVNDMFPIQMSFDQPTSKSDLKN
FT                   KQANNRRTFHNDGKDGNGKIKKLKTDNKGYVAGGKTKGQNMTSCM"
FT   mobile_element  complement(974312..974614)
FT                   /mobile_element_type="retrotransposon:solo LTR, vau E"
FT   CDS_pept        complement(974790..975620)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44693"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N2"
FT                   /inference="similar to AA sequence:SWALL:Q59RB0"
FT                   /protein_id="CAX44693.1"
FT                   /translation="MSFEILALPYSWIHKDSASSRFENLKHLINASYNKPRYRFGIIQS
FT                   PRIKNNNSVLSDLAIDAKDEICIYLLLGKEEKFDDLFFNEGYKRDLTKVATTFSQVFAN
FT                   DIPERYYSIFNLEDIKTAKISFVDSDFEFTEEALNRCIASVGLRSFHGTVKPDTKEFEL
FT                   TAFTSFMRNTAPVFLDFIINQCLLDSGRFEQISFQGTLNDFRTIIIHADVIKEHGLVEY
FT                   YTKKCSFTKSCQEDVLIKIDNQQNVEDGILEKGILASKDFHLSFLERVIHIEPK"
FT   CDS_pept        complement(976381..976692)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44694"
FT                   /db_xref="GOA:B9W7N3"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N3"
FT                   /protein_id="CAX44694.1"
FT                   /translation="MRCELPPQMIFLHKTRFLVCKTTDESRQHSFISNITTTTATTITW
FT                   MTMLNLTEIYIHSIMAFDNVFILFRFILLTCFIFFSFVSRRGDVQCEGEVITDFVITT"
FT   CDS_pept        complement(978615..979637)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44695"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N4"
FT                   /inference="similar to AA sequence:SWALL:Q59RA9"
FT                   /protein_id="CAX44695.1"
FT                   /translation="MLGSTTKRILVNSSKRSIRYNSSNNSKNGSDAVKLNLSDLFKRID
FT                   QVSAKAAELKNKTANSRLFEAGNKRPGWQKKENNNFANRTVRNDFNEGGQQQMPRQHQQ
FT                   QQQQQQQREGNSETNFRAPRSNTRPSRFPKTVEGERAPAARFNNRGNRPSGFNDRSFKR
FT                   STPRRNTIEGKPEVRKPTVAKPIKSKELTAVPLQPKVIAEDFFYGKVPSINATVASRLA
FT                   SIAKLSLNDSKYPYMLPKDVIAQAFPGSKNRFILQRTWKIDPKEDVLKERVQTIVLGQT
FT                   KDLEYKGKKTELASRTLHDININPNLDLEQKDTMFNIVNGLTDIKTIFKDAHWKKQASK
FT                   "
FT   CDS_pept        join(980377..980451,980738..980880,981087..982509)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04360"
FT                   /product="ATP alpha synthase chain, mitochondrial
FT                   precursor, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="spliced gene"
FT                   /note="Similar to S. cerevisiae ATP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44696"
FT                   /db_xref="GOA:B9W7N5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N5"
FT                   /inference="similar to AA sequence:UniProt:P49375"
FT                   /inference="similar to AA sequence:UniProt:P07251"
FT                   /inference="similar to AA sequence:UniProt:Q6FJ33"
FT                   /protein_id="CAX44696.1"
FT                   /translation="MLSARPVLRTAVRTATIAARSSLRVARPTLLTAQRFASAKAAPTE
FT                   VSSILEDRIRGVSEEANLNETGRVLSVGDGIARIYGLNNIQAEELVEFSSGAKGMALNL
FT                   EADQVGVVLFGSDRLVKEGETVKRTGQIVSVPIGPELLGRVVDGLGNPIDGKGPIKAAA
FT                   YSRAQVKAPGILPRRSVHEPMQTGLKSVDALVPIGRGQRELIIGDRQTGKTAVALDAIL
FT                   NQKRWNNGSDEKKKLYCVYVAVGQKRSTVAQLVQTLEQHDALKYSVIVAATASEAAPLQ
FT                   YIAPFTACAIGEWFRDNGRHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLH
FT                   SRLLERAAKMSDAYGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGI
FT                   RPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLNR
FT                   GERLTQLLKQKQYNPLAAEEQVPLIFAGVNGFLDNVPLDRIGEFEEAFLGHLKSNEAGI
FT                   LDAIKTKGELSKDELEKLRKVTEEFVASF"
FT   CDS_pept        983296..985020
FT                   /transl_table=12
FT                   /locus_tag="CD36_04370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44697"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N6"
FT                   /inference="similar to AA sequence:UniProt:Q59RD7"
FT                   /inference="similar to AA sequence:UniProt:Q59RA7"
FT                   /protein_id="CAX44697.1"
FT                   /translation="MASSPERKIDAKSNLNQIKSQLYESTPSSGDSTPDIIEEQKFEND
FT                   LDYLLTNKENGNYEESTEFVSTKYDEVVISKSTGTKHKAKPKAQNKKFTVADVTKDMEG
FT                   LDFSSDEDVANGDDTGKNKDEKPNKLKSQKSRSRLNKRKSKSKLNKTVVNDSSTSNSEG
FT                   QNDANLQIDTNKEATKTKPKRSPKKKETESMQIEETQVNKTAKKVKSKKSRNNLKNKAR
FT                   PEAKPTDAAKTDEDKNIANGKDMDINNETPGSKSNGTDNSELVDEALNNEVEEEEDEAL
FT                   KRKLKNKKRKERRKKRNQLTKESNTSENEESATPSVPSPAAAPSPSKETTSKPEDNPFV
FT                   IKLRSVKSTINKKYSENLPEVQPTKTIIGMSHQQILHSDLSDVKIKTLMTSSSVSKYAA
FT                   NAVKFVTTHKDDLFGNFENKKIFLTLCINIALYESLGYKKTTKLYPNVLELFGGYAEIN
FT                   LETTRTKLTPSKKDIHQNDLDYSVLSYFGHILIWAAHQQRQGKVPIFADKFGISLTSKE
FT                   VRSKIGGYHLWDKLFRELQGMNSKRWKHVIKFRNAFQYEEDQFMIILRFMQIDENIP"
FT   CDS_pept        complement(985140..988631)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04380"
FT                   /product="phospholipid-transporting ATPase, putative"
FT                   /note="Similar to C. albicans NEO1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44698"
FT                   /db_xref="GOA:B9W7N7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N7"
FT                   /inference="similar to AA sequence:SWALL:Q59VF0"
FT                   /inference="similar to AA sequence:SWALL:P40527"
FT                   /protein_id="CAX44698.1"
FT                   /translation="MSSSKPYSFVGRDSFDDLDSSLDKALHSATNNYFHSSNNRSNGTR
FT                   NNSQSSVNAIALETFRSSNNFDEHSDSVPLISNSNIYSRLQNRSISSSSTSLNIAARSF
FT                   SSKFKKFVRTLVDFFKNAKRELEQERIRLSGSSDYRNTDHSNVADERYISAKTTNLKAN
FT                   NIYPSNSISNAKYNPITFIPIILYEQFKFFFNLYFLIVALSQIVPQLRIGYLSSYIVPL
FT                   AFVLTVTMMKEAGDDIARRRRDKEQNQELYEVLNRNSSDALSIEPKLVPASGLRVGDLV
FT                   RLHKDIRIPADMILLQSSESTGEVFIKTDQLDGETDWKLRIACAATQASQNTKQIIDSV
FT                   SVIVGNPSKSIHHFNGQLIYKSPSTTGSASPISNNETYALSIDQTLWANTVLASGTAVG
FT                   MVIYTGIETRQSMNTTKTGVKTGLLELEINGLSKILCAVVFILSLVLVLAHGFPLKSAW
FT                   YLDIMRFLILFSSIIPVSLRVNLDLAKSVYASQIQNDNSIAGTIVRTSTIPEDLGRIEY
FT                   LLSDKTGTLTQNDMELKKLHLGTVSYAGDAMDIVTDYVKVLLKHLDSGQKKKDLSSRVC
FT                   ELVLTLALCHNVTPTYDDEGDVGFGEVTYQAASPDEIAIVKFCESVGLKLYKRDRHSIT
FT                   LLHVYTNKFLEFEILYNFPFSSETKRMGIIVKDKNREDIWFMQKGADTVMSSIVSSNDW
FT                   LDEETGNMAREGLRTLVIGKKKIGSKLFNDFVDDYKQASLSMHDRDSDMQKVVSYYLEQ
FT                   DLELLGLTGVEDRLQHDVKTSIELLRNAGIKIWMLTGDKVETAKCVSISARLISRGQYV
FT                   HQITKLSHPDMAMNQLEYLRINTNACLLIDGESLGTYMKHFSDDFFKVVINLPAVIACR
FT                   CSPQQKADVAVAIRKVTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSI
FT                   DQFCYLSKLLLWHGRNSYKRSAKLGQFVIHRGLLISVAQAVYSISSKFEPLALYQGWLM
FT                   VGYSTIYTMAPVFSLTLDCDVDEHLTKLYPELYKELTLGKSLSYKTFFMWVFISLYQGC
FT                   VIQLLSQRLQTLLDKRFTAMVALSFSCLIYNELIMVAISINKWNKIMASTIILTFLAYI
FT                   GSIPFLSEYFNLTYVSSFSYIWQVGLLLVVSLFPVWLVQYLNRRLRPPSYAKVQQD"
FT   CDS_pept        989681..991642
FT                   /transl_table=12
FT                   /locus_tag="CD36_04390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44699"
FT                   /db_xref="GOA:B9W7N8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N8"
FT                   /inference="similar to AA sequence:SWALL:Q59VF1"
FT                   /protein_id="CAX44699.1"
FT                   /translation="MSEEDTDDTQELLATNAASGYSTGTGAPRFEALSTLSQSQQEKSS
FT                   TKYKKFSEFIKINVLGHPNNFEEYVLRNEANDCSLIAKYCETTTIDLSTQPALSIDSIS
FT                   LNTIHIPHPLVNFMKNEANQQLSPDDQVDVSKELQESPIVVFLHGLGGQMSQFEPLMGL
FT                   LSQCSEILSLDLPGFGNSKVKFENGFKFISEISDADKSKISSSIQRMNWEDFSTDNIVR
FT                   IVYEFISQNVPSSKKILLIGHSMGTHISIKLAKKLPQSKVEGLILLSPPALVDDINTNQ
FT                   QSTKNTHNSLSLFTMFTYFPWLFNSFRTWDRLEGLDSSSVVRQLSKTNNSIYNKLRQFR
FT                   WNLDVNSDIVLKYASGFQRATYSDLIAAISRFNDNPEDKQVYEKTVFICGNNDQMTPVS
FT                   TIYKCDEFLTSNFGRKVSSAIEVKGVGHSLLLSKPEFISGIILNHIESKFPERLHLSPA
FT                   WVLKIKAKVSGDKWGLKNEQKWSNIQSVSYNITRNGGKDIAPLLGMKTLRESDSIHSPS
FT                   ILEKQFYDDHLSNQVQGNLIAIIDISADIPPYSPKSFEKIKYYKCATVSKVVPDQSAIR
FT                   RFIQLVNDILHENTVAKPLIAVHCHYGFNRTGFLICCYLIEVLGWSVEEAVEGFKIAKQ
FT                   PGIKHPHFIDALYVRYEK"
FT   CDS_pept        992852..995029
FT                   /transl_table=12
FT                   /locus_tag="CD36_04400"
FT                   /product="urea active transporter, putative"
FT                   /note="Similar to C. albicans DUR3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44700"
FT                   /db_xref="GOA:B9W7N9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7N9"
FT                   /inference="similar to AA sequence:SWALL:Q59VF2"
FT                   /inference="similar to AA sequence:SWALL:P33413"
FT                   /protein_id="CAX44700.1"
FT                   /translation="MTDSYVPLPQSAGYAVVVGLGFVFAFGMMLTTYILRRYNKEVMTA
FT                   EEFATAGRSVKTGLIAACIVSSWTWSATLNGSTSQVYNNGVCGSIFYAMGATVQITLFA
FT                   CLAIKARERAPAAHTYLEIVKGRYGTTTHFIYIFWGIVTNILVTSMLLSGGSATVNDLT
FT                   GMNIVAAILLLPLGVVIYTLFGGIKATFLTDYAHTVVLIVIIFVFAFTTWATSPKLGSP
FT                   QAVWEIVTKLAESNPREGNAGGSYFTMHSRSGGMFFVINIIGNFGTVFLDNGYFNKAFA
FT                   ANPSSTYKGYIFGSLAWCAIPALCSLTMGFAALALEHTEYWPLGRPMTAAEVASGLVLP
FT                   NAASALLGKAGAVLALLMVFMAVTSAMSAELIAVSTIATYDIYRTYINPNASGKKLIWV
FT                   SHLSTVIFAYTMAGFAIGLYYAKVSMGYLYEMMGVIIGGAVLSSALTILSKRQNWHAAT
FT                   FTPIISTALAIMAWLVCTKKKFGSVTYLNTFEDDAMLTGNCVALLTPFIIVPILTFVFK
FT                   PQNFDWKLLDQRITRVDEEEELAEALGGTVSSDPEKLNPVKSQISVIASQLVEGEREQY
FT                   QKEKEILNKSFKICCIVCCTLAICLVVLFPMPLYGTKYIFSKKFFTGWVVVFIIWLFYS
FT                   AFQVIIFPIWESRTDLYHTFRGIYWDLTGQTYKLKAWQNEHPEEMHAVRSQLQAQLSRT
FT                   AVTHEIVDGKAFGDGYVTPANIDDALDEKKG"
FT   CDS_pept        996061..1001502
FT                   /transl_table=12
FT                   /locus_tag="CD36_04410"
FT                   /product="urea amidolyase (including urea carboxylase and
FT                   allophanate hydrolase), putative"
FT                   /EC_number="6.3.4.6"
FT                   /EC_number="3.5.1.54"
FT                   /note="Similar to C. albicans DUR1,2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44701"
FT                   /db_xref="GOA:B9W7P0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P0"
FT                   /inference="similar to AA sequence:UniProt:Q59VF3"
FT                   /inference="similar to AA sequence:UniProt:P32528"
FT                   /protein_id="CAX44701.1"
FT                   /translation="MSHLGWSVEDWKKFHYESTPDESFELLSQLLKSQKSAPEDPAWIS
FT                   LASIENLEHQWKFLQSKSNKRDLPLYGVPVAVKDNIDAKTFETTAACPSFAYSPSKDAT
FT                   TVRLLRDAGAIVIGKTNLDQFATGLVGTRSPYGITPNTFNPKYVSGGSSAGSASVVARG
FT                   IVPIALGTDTAGSGRVPAALNNLIGLKPTKGVFSCSGVVPACKSLDCVSIFALNLQDAQ
FT                   LTFSIMAQEDEHDEFSRSMPENPLLKFGKTPKIVVPTNLLWYGEQENPKLYKEAVAKFE
FT                   RIGCELVSLDIEPLLELARCLYEGPWVAERYVAVKDFFATNPPEKDLDPTVTKIIKGGE
FT                   HYSAATCFQYEYKRQGIVKRVNKLLEGIDAIIVPTAPLNPTIEEVTNEPIKVNSCQGTY
FT                   TNFVNLADMSALAIPAGFRNDGLPFGVTLLSHKFNDYALLDLASRYLKLDNLRTCGVSQ
FT                   KKTSTIHDELYLLPKSIPQETVKLAVVGAHLKGFELHWQLEKVDARFIESTTTSKNYKL
FT                   YALPKTGPVAKPGLRRVESAGEHIIVETYSIPKEKFGQFIKYVPEPLGIGSVELKSGEW
FT                   CKSFICEEFGYKQPGTVDITEFGGWKKYQEHLRASKKPFNSVLVANRGEIAVRIIKTLK
FT                   KLGVKSIAIYSDPDKYAQHSLLADVAIPLHGTTAAETYINIEKVIKAAKDSGAEAIIPG
FT                   YGFLSENADFSDRCGKEGIVFVGPSGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKDA
FT                   KEAREIAAKLEYPIMVKSTAGGGGIGLQKVDSEKDIERVFETVQHQGKSYFGDSGVFLE
FT                   RFVENARHVEIQMLGDGNGNAIAVGERDCSLQRRNQKIIEETPAPNLPEETRSKMRKAA
FT                   ESLGSTMKYKCAGTVEYIYDPKRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAA
FT                   DTPPDFNQKIEVKGASMEARLYAENPVKGFMPSPGQLTEVQFPEWARIDTWVEKGTIVS
FT                   AEYDPTLAKIIVHGKDRDDALKKLRQALNETVVYGCITNVDYLRSIANSKMFEEAAVAT
FT                   KVLDSYDYNPHAIEILQPGAYTTVQDYPGRRGYWHIGVPPSGCMDQYSFRVANKIVGND
FT                   AASPGIEITLNGPKLLFHQDCVVAVTGGKTKVEVNQVEVNQWEPINIKSGDKLNIGKLS
FT                   TGCRAYLAIRGGVDVVEYLGSRSTFALGNLGGYNGRVLKLGDVLFLGQPDVTSCTLPGP
FT                   ISQPTPVPSLLIPNYDNKVWKIGVTCGPHGSPDFFKAESVEEFFSSTWKVHYNSNRFGV
FT                   RLIGPKPKWARKDGGEGGLHPSNTHDYVYSMGAINFTGDEPVILTCDGPSLGGFVCEAV
FT                   VAESELWKVGQVKPGESIQFVPISYESAKKLKKQQNDAIENLSGDLTPLDNVSLSAPEN
FT                   PILYQFKVSSNAPKVTYRQAGDRYILVEYGDNLLDLNLAYRIHKLDAMVKEYKPKGIFE
FT                   LSAGVRSVLVEYTDDITQKEALDTLVSYEKEIIFVNKWKVSSRIIKLPMAFEDKKTLDA
FT                   VKRYQETIRSEAPWLPNNVDFIANINGITRTDVKDMLYTARFLVLGLGDVFLGAPCAVP
FT                   LDPRHRLLGTKYNPSRTFTPNGTVGIGGNYMCIYTMESPGGYQLVGRTVPIWDKLSLGE
FT                   HSPSTKPWLLSPFDQIEFYPVTEEEVDAFSEQMNAGKFKVDIVESVFDHGKYLEWIQEN
FT                   SKSIEEFQQNQGGEKLEEFNRLIQISNSELEKSGTKVQDDEKFDDNAELVYSEYSGRFW
FT                   KSVVEVGDKVTAHQPLIVVEAMKTEMVVNAPRDGKVLKIYHKNGDMVEAGDLVVVLE"
FT   CDS_pept        1001809..1003053
FT                   /transl_table=12
FT                   /locus_tag="CD36_04420"
FT                   /product="histone acetyltransferase b catalytic subunit,
FT                   putative"
FT                   /note="Similar to C. albicans HAT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44702"
FT                   /db_xref="GOA:B9W7P1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013523"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="InterPro:IPR037113"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P1"
FT                   /inference="similar to AA sequence:SWALL:Q59VF4"
FT                   /inference="similar to AA sequence:SWALL:Q12341"
FT                   /protein_id="CAX44702.1"
FT                   /translation="MSLSKDQSSVTAALQPEQWTTSSNEALKLFVTNSEAAVNFQPVFT
FT                   YPIFGDAETIYGYQDLDIFLCFDHYTFKPFLNIKYSAKLTDDPEIIDIKKTIDEFLPKS
FT                   TIFKDEVKWVDSIKEEKVNGYKIPGELIDSFSEDDKEYEIYKIDLKSENGYELHQRLQI
FT                   LVLLFIEAGSFIDAKDELWNLYVLYEKDNKSASNNNEPSIIGFTTAYNYWKYPGAKKFD
FT                   STEQESRIKISQFIILPIYQGQGLGQLFYSHLYDQWLAKDDIIEVVVEDPNESFDDLRD
FT                   RADLKRLNASEQFDFKAVTPKVNKEWVEKTRRALKLEKRQFARLLEIILLYKLKHGYPG
FT                   ISKKDVRIFIKKRLYDKNKEGLATLDDNTKKDKLQTAYQALEEDYYRILGDLKLNIKRE
FT                   NDEKRTDSVSKKQKV"
FT   CDS_pept        1004443..1005369
FT                   /transl_table=12
FT                   /locus_tag="CD36_04430"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans SLB1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44703"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028245"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P2"
FT                   /inference="similar to AA sequence:SWALL:Q59VF6"
FT                   /inference="similar to AA sequence:SWALL:Q59KV8"
FT                   /inference="similar to AA sequence:SWALL:Q6FKT0"
FT                   /inference="similar to AA sequence:SWALL:P53252"
FT                   /protein_id="CAX44703.1"
FT                   /translation="MHRTYSLRSSKAPTASQLQSPPPPPSSTKNKFFGSGGLSSTIRKA
FT                   AAGATGPELSRKLSQFIKMEKNFMRAVEVTSRERKDVAKQLSAWGEDNEDDISDVTDKL
FT                   GVLIYEIGELEDQYIDKYDQYRITLKSIRDIEGSVQPSRDRKQKITDEIAHLKYKDPQS
FT                   PKIPVLEQELVRAEAESLVAEAQLSNITREQLKAAFNYQFDATRELAEKYALIAGYGKA
FT                   LLELLDDSAVTPGETRPAYDGYEASKQIIIDAENALASWTLDSAAVKPTLSLHHEYDED
FT                   ELEHEHGEIDDAAQEEFNKHDENVEHQ"
FT   CDS_pept        complement(1005904..1007832)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04440"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans SPO69"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44704"
FT                   /db_xref="GOA:B9W7P3"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR039781"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P3"
FT                   /inference="similar to AA sequence:SWALL:Q59VF7"
FT                   /inference="similar to AA sequence:SWALL:Q59VJ2"
FT                   /protein_id="CAX44704.1"
FT                   /translation="MELINQSNNSLSTGLHTAWLLATLGSKPSIRSKLVKKSTINYLSI
FT                   PELCHELITSTRSPTTHTQDIDTAIGETLTTGNSIRYISNIMHGISILYQTKINYLMND
FT                   LIYIESRLKCYNYNNLSDIIGLSPDSVNQTCLGVSMNRKRPIRYLIDDPSFSIHLGLVV
FT                   PFMEETDEITKRRKLDILQKDNAVFPLVNGNGGIVEQLNFHSMTFTLQPQPEDPFQVHE
FT                   SSSLSNGNNNGLSPDLELIPDFEFNNNGDIVDNEGENLLLGTRFPTRELVHNDEADVMN
FT                   ISFEDNVAHSANPIAIIPNNQTNSISNDLNFYTTTDTLVPVNNEHAIQQNLGINKLPFR
FT                   KLLLDKHTRIDSDSMISFVMNYESRMNTVDEPTESVDNVVNELYDVVNAVPPFMKFVNK
FT                   VTLPSVNNNNSHNNNSVEQSFFTRTASILQKTEETGNENTEEGRQNMAVKNYAMDEEIA
FT                   DPNLNFEDEDHFELPRESEHIFNLEFDYNDINHSEEEDSKEGVNSTKVSQQSTNDFSIS
FT                   DDNLIGTDNKLNKFYRYMKARSNEFGKTIVGKYHILKTNNENNELLSSQTSSDYRQTKF
FT                   QILVPDSKHAIEVGESPVPRRVAANAFACVLTLATKSLIKIEVVRETDELQKSNDINII
FT                   MSLELSL"
FT   CDS_pept        complement(1008185..1010899)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04450"
FT                   /note="vacuolar sorting protein VPS70 homologue, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44705"
FT                   /db_xref="GOA:B9W7P4"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR034308"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P4"
FT                   /inference="similar to AA sequence:SWALL:Q59VF8"
FT                   /inference="similar to AA sequence:SWALL:P47161"
FT                   /protein_id="CAX44705.1"
FT                   /translation="MTDVANSENAENDVNEHTQLLESNNNNNTQTDISVNDTNVISPSS
FT                   AELEEQNGLQDYLATPPTTQETDPLLATNNKSPNIIHDNSNTGNVNENNDENNDDDDDD
FT                   DNMSRVLRLARRPSFIWVCCLGILALIIFQLTFLPRTSLARDYRNWHGIRLTKTDVKRH
FT                   YLQMTGIGKSQNTLTTEEYIDGLLKNFTQLNRQSSYNLMSQDNSNLTEFVISGFKDLKA
FT                   FQTQVVKRKVNIGTPESSSVRLFDEHGKVIYEPSLLELDYNTPAYFALGNTGNAIGEYV
FT                   FVNNGYPSDYTLLSDSNIDVKNKIVVIKSNYHDSNITIGEKIAIAEYHGAIAALSYYDI
FT                   ESDFDLVGNHKVKSLKNAITRGTLFNNTKIPAIPVSQNEIQPILDTLSVSRDGPFSHWD
FT                   FAPTSSGKFTLEVDTTFVNSEEPKEFTNIVGTIKGIINDADIVIGARRDSYASSNPLSG
FT                   HAVLLEIMRYYQKLVHVGWKPLRNIKFVSWDASYLNLLGVESLTNDTTIFNPKRTIVAY
FT                   ISIDGDSVTGSKFAVDANAVFNSVLRRTAKSIPIPKESVLFNNRMNEHGIDDNDIYITD
FT                   NNHNRENDILIDNFARDDFTTLYRYWWKQDKTSINNNLGLPIDSSESLIFQKHLATPII
FT                   NVRFENDIEQDKAIYIPNSNYYSYDWLIKEKVDDDLLLHGSLIRFIGLLGISLTEHEVY
FT                   DYKTHAYFKTISTYYKQLKVETTQFLSQWGDLVVPNYLIFKSTIFQDLDTNNPVKFHQI
FT                   THQFDKLMDHIVNQTTIFDKWNENVEDGLMQDYPWYMYYKKLQHYAEYKVSNYKLAYLE
FT                   NDLQLNDRDYLYLRTGENGVTIDVPNYYYDSIIYGEQSFNAHKSSQEYFDKKFSHGTFT
FT                   YLYQSIQNEDFEFTIKWFVMIYEKLNNIDYKMT"
FT   CDS_pept        complement(1011564..1012154)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44706"
FT                   /db_xref="InterPro:IPR028217"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P5"
FT                   /inference="similar to AA sequence:SWALL:Q59VF9"
FT                   /protein_id="CAX44706.1"
FT                   /translation="MAASDAHNNNKKRSNRRRKKRRTEDFSSSSESSSSESSESSHEDL
FT                   DDPEKEIPEQDINIDDIDIDSETETNTLTTDNSSNKLIPQDLSITEKQQLNTIPFTKTS
FT                   ISNITNDNQLKTIPNINEINKNLDQRKNQLNNEFLKIMTNEFGDDLDELRKKPDFSEKS
FT                   LVILAKTLQSGVNMFDIDVLNGLIQESGNTNTE"
FT   CDS_pept        complement(1013467..1014750)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04470"
FT                   /product="homocitrate synthase, mitochondrial precursor,
FT                   putative"
FT                   /note="Similar to S. cerevisiae LYS21"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44707"
FT                   /db_xref="GOA:B9W7P6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P6"
FT                   /inference="similar to AA sequence:SWALL:Q59VG1"
FT                   /inference="similar to AA sequence:SWALL:Q59TC4"
FT                   /inference="similar to AA sequence:SWALL:Q12122"
FT                   /protein_id="CAX44707.1"
FT                   /translation="MVDGYKEVSESFDRSKFQQNPYGPNPGDYLSNVGNFQLIESTLRE
FT                   GEQFANAFFSTETKIEIAKALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTH
FT                   IRCHMDDARVAVETGVDGVDVVIGTSQFLRQYSHGKDMNYIAQSAIEVIEFVKSKGIEI
FT                   RFSSEDSFRSDLVDLLNIYRTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVNCDI
FT                   ECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITPLGGLMARMIAADREYVLS
FT                   KYKVHKLRDIENLVAEAVQVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILSPSD
FT                   FGLTRYIHFANRLTGWNAIKSRVDQLNLHLTDEQCKEVTNKIKKLGDVRQLNIDDVDSI
FT                   IKDFHADMSTPLLKSNGEGEPDVKKQKV"
FT   CDS_pept        complement(1017490..1018581)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04480"
FT                   /product="biotin synthase, putative"
FT                   /product="biotin synthetase, putative"
FT                   /EC_number="2.8.1.6"
FT                   /note="Similar to S. cerevisiae BIO2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44708"
FT                   /db_xref="GOA:B9W7P7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P7"
FT                   /inference="similar to AA sequence:UniProt:P32451"
FT                   /inference="similar to AA sequence:UniProt:Q5A974"
FT                   /protein_id="CAX44708.1"
FT                   /translation="MSVKRFFSMTKALALASSASGFNPVSASNTLSKARSSKPRSDWTK
FT                   DEISQIYNAPLMDLIFNAQLKHREYQNPGQVQLCTLVNIKQGGCTENCSYCSQSSKHDT
FT                   GVQAQKLDLDAVMDIARDAKARGGTRVCLGSAWRDMQGRKSALDKISKIVKQINEELKL
FT                   ETCVTLGMINEMQAKILKENGLTAYNHNIDTSREHYPNVVTTRTYDERLETIKNVQKAG
FT                   IKACTGGILGLGETPQDHVSFLYTLSNMSPHPESLPINRLVPIKGTPIVKVLENAPKER
FT                   QLEFDAILRTIATARLIMPESIIRLAAGRYTMKEHEQFLCFMSGVNAIFTGKRMLTTMC
FT                   NGWDEDIAMLKKWGLTPMESFTK"
FT   CDS_pept        1020176..1021345
FT                   /transl_table=12
FT                   /locus_tag="CD36_04500"
FT                   /product="butanediol dehydrogenase, putative"
FT                   /product="alcohol dehydrogenase, putative"
FT                   /EC_number="1.1.1.14"
FT                   /note="Similar to S. cerevisiae BDH1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44709"
FT                   /db_xref="GOA:B9W7P8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P8"
FT                   /inference="similar to AA sequence:UniProt:Q59VG4"
FT                   /inference="similar to AA sequence:UniProt:P39713"
FT                   /inference="similar to AA sequence:UniProt:P39714"
FT                   /protein_id="CAX44709.1"
FT                   /translation="MKAIVYHDRGDIRYDPDFPDPKIIRSDDVKIKVHYCGICGTDLKE
FT                   YTDGPIFFPPKGKLNEISQMESIQVMGHEISGEIIAIGDDVTNVKVGDKVVVEVTGTCL
FT                   DRHRYLDSQHEDVSKPNCPSCTSGNYNACDHLSLIGCGFANGGCAEYLVVASSKVIAFD
FT                   NDKIPMDIAALIQPIAVSWHAVKVSNFKPGSNALILGGGPIGLTTIFALKGNQVSQIVL
FT                   SEPALARRELAEKLGVITFDPTGKSIEQCVAELKKLSPGGYGYEYSYDCSGVKVTFETG
FT                   LKTLKIRGCATNVAIWAHKSIPLYPMEITLSEKMLTGSICFVKKDFQESIQAIENGLIS
FT                   IDELQMLITSKIHLQDGIEKGFLELINHKEKHIKILFSPKSVYLPSNGK"
FT   CDS_pept        complement(1021455..1024421)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04510"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans SYG1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44710"
FT                   /db_xref="GOA:B9W7P9"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="InterPro:IPR033507"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7P9"
FT                   /inference="similar to AA sequence:UniProt:Q59VG5"
FT                   /inference="similar to AA sequence:UniProt:Q59VK1"
FT                   /inference="similar to AA sequence:UniProt:P40528"
FT                   /protein_id="CAX44710.1"
FT                   /translation="MKFAESLKEGLVPEWQDQYVDYKQGKKLIKKCKKLQEEYAFDDTL
FT                   KTQKKDINNTTDDRTPLITPTEPQQVYTSTGAINEYNNDDDVEGVPPLSAGQYSNSGYS
FT                   RRRLSIFASSMKSSNKRDDYIKEKKNFTKWLNEQLMKVDDFYIEKEQDVYERFLLLQDQ
FT                   LYQLRDQKTQLIKEKNFHDNKNHPVKSNADHVVNKVNDFAFHTKSVISNLNRFELPSLP
FT                   SLRFLKKWGTKRKQANRFEDEISLQIQDKADLNYAENRVRNGIVEISEGATTNDSTSLE
FT                   ESDGESIFIPNITAPQPPPPQTEEQLRKSRRRDYALHKQHFGVPYLYARKQLKSALLEH
FT                   YRALSLLKSFKTMNRTAFRKITKKYDKALKTEIMQPFMHKIDTTSYFLTSDLLDKLISH
FT                   VEELYIVFFDSTSTDRKHSLEKLKTIAYAINASEMRPPSFYKEFFVSGLFLGFGLPLFV
FT                   LALYTGLDKTLNGEMTEGKYLLQIWAGFFLLNLTFILIAVNLAIFDKFKINYRFIFEFN
FT                   IATTLNYKQFLVLPSFGFAFFAILAWFSFNNYWPHDFPGRDWPWIYFAVMLTILFLPGN
FT                   MLYGNSRRWLQVALWRLLLSGLYPVEFRDFFLGDIVSSLTYTMGNISFFFCLYSHHWKG
FT                   TLPGQMPSQNICGSDKSRLLGFFSTLPSIWRLLQCIRRYMDTGDWFPHLANSLKYTISS
FT                   VYYITLSIYRIDRKTENRAVFIVFASMNSIISSIWDIVMDWSLLQSDSKNFLLRDHLFY
FT                   KNPNYYYAAMIADVILRFQWIFYAFFTRQIQQSAVTSFCIAIAEILRRFIWILFRMENE
FT                   HATNVILFRASKDTPLPYAVSNKVEKAIKKLVELRYYSKFSQQQEPSFQDYTMDFQPTS
FT                   PINVGATASTIDTSAATGYSARDRDSHIDEVSVPISRKTIASTELSRRKSTFKVISDQL
FT                   NRAHIKDFQRRKTALQIEDDSDDDEDEDEDELSLPPLRRTATTGGSSRLTSVRETEEV"
FT   CDS_pept        complement(1025597..1026757)
FT                   /transl_table=12
FT                   /gene="ERG3"
FT                   /locus_tag="CD36_04520"
FT                   /product="c-5 sterol desaturase"
FT                   /product="sterol-c5-desaturase"
FT                   /product="ergosterol delta 5,6 desaturase"
FT                   /EC_number="1.3.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44711"
FT                   /db_xref="GOA:Q8NJ57"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NJ57"
FT                   /inference="similar to AA sequence:UniProt:Q8NJ57"
FT                   /protein_id="CAX44711.1"
FT                   /translation="MDIVLEICDYYLFDKVYADVFPKDGPVHEYLKPAIQSFSEINFPK
FT                   LQNWDSFDTNSTLISSNNFNISNVNPATIPGYLLSKIASYQDKSEIYGLAPKFFPATEF
FT                   IDTSFLSRSNIFREVLSLFIITTLFGWLLYFIVAYLSYVFVFDKKIFNHPRYLKNQMSL
FT                   EIKRATSAIPVMVLLTIPFFLLELHGYSFLYEEINESTGGYKAILWQIPKFILFTDCGI
FT                   YFLHRWLHWPSVYKALHKPHHKWIVCTPFASHAFHPVDGFFQSLPYHLYPLLFPLHKVL
FT                   YLLLFTFVNFWTVMIHDGSYWSNDPVVNGTACHTVHHLYFNYNYGQFTTLWDRLGNSYR
FT                   RPDDSLFVKDQKKEEEKKIWKEQTRQMEEIRGEVEGKVDDREYIDQ"
FT   CDS_pept        complement(1028286..1030925)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04530"
FT                   /product="protein kinase, putative"
FT                   /note="Similar to S. cerevisiae SCY1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44712"
FT                   /db_xref="GOA:B9W7Q1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q1"
FT                   /inference="similar to AA sequence:UniProt:Q59VG8"
FT                   /inference="similar to AA sequence:UniProt:Q6BT87"
FT                   /inference="similar to AA sequence:UniProt:P53009"
FT                   /protein_id="CAX44712.1"
FT                   /translation="MLSRLGFSTGIRSIYSVSDQPSFVSEPWAIYPAKHKTNGKIVSVF
FT                   IFDKSRFETQVSRLHSTSSSVKNPKVVISECYELIKYEVSQLSKLKHPQLLQVYEVLEE
FT                   TKSKFLFVTEPVIDNLVTVNPKDLDDLSIQKGLLQISKGLQFLHSYGSIIHLNLQPSSV
FT                   YINNQGDWKLGGFKFLQNLNEISPQERENFYILNNMSVVPFANFNLNFTAPELIIDSHT
FT                   KLDFANDIWSLGQLIYYLYNHQDLLINCFDANSISDYKQEFRKFEQKFYNHKPTELKYV
FT                   LKDIPTKLYPLYPQILARYPHDRITLDQFMDSEFFNGSIIKAMWFIDEFSTKSVDEKLV
FT                   FLKGLLEVDQQQPNTLPLISQFPPSFRSSKLLPLLIDLLTNELNVLTESVIDPKTDVLI
FT                   SESLTIVLKISETLSSLTFQDKVFDILFKDNPRDKKAPQTFTKLINSSVRTRLTLINNL
FT                   DTIHTKSKDKQFVQFFKSIIDLVLTISPRENGQIELQIQLQEKFLGFIPQFVDKLDFPY
FT                   IKNTLVPLLCQVFKTTTILSTKLSTIDTFEGLVDKKIIDKIIVNEQLFPIMKNLKSRDK
FT                   RIVTKMLNFFFKLATSEHINLDLEAIVESIIPQSYSLAFGCNDCNQLEFNQFISIINSV
FT                   QKQLVEKKLSTLLKTSSNGFSNGHKGGKNEAVANNNFEALLQTQTIHDVPDEINAPKGK
FT                   VMQPKRKSVLSTAIPTKSNSAASTNTTQVRNSDTLRPRPKPRPVKKPTEGLAFGATNTQ
FT                   SNTTNNRLLNTLNSTFDKKQDDDDFDDFQSAASTSVSELSSSRNGTINWQGEVNKMKTL
FT                   PNTPTTAESFNVSRSQSQPQTKNTNYPPGFNTNMVLSPKSSSINTNVKSSSSAFNGNAN
FT                   NSDLLDLL"
FT   CDS_pept        1031212..1031886
FT                   /transl_table=12
FT                   /locus_tag="CD36_04540"
FT                   /product="RNA binding protein, putative"
FT                   /note="Similar to S. cerevisiae ScCBC2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44713"
FT                   /db_xref="GOA:B9W7Q2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q2"
FT                   /inference="similar to AA sequence:UniProt:Q59VH0"
FT                   /inference="similar to AA sequence:UniProt:Q08920"
FT                   /protein_id="CAX44713.1"
FT                   /translation="MNLIEDNFKNSAERLDKPSAYLIRKARHNYGELERAMTSKTVYVG
FT                   NLSHFTTEEQIHELFSKCGAIDRIIMGLDRNKLTPCGFCFVIYRSEQGSLNAMKFLQST
FT                   ILDSQSISIDLDPGFREGRQFGRGKHGGQASQEIAAAGGFDNGRSGGGYRGRGRGGFRG
FT                   GRGGGYRGRGGGFRGGFRGGRGGGGGGGGFGRGESSVYIPSKDPTFDAPTTFNPLADMS
FT                   QG"
FT   CDS_pept        complement(1032019..1034130)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04550"
FT                   /product="acid sphingomyelin phosphodiesterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44714"
FT                   /db_xref="InterPro:IPR041805"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q3"
FT                   /inference="similar to AA sequence:UniProt:Q59VH1"
FT                   /inference="similar to AA sequence:UniProt:Q5ABD3"
FT                   /protein_id="CAX44714.1"
FT                   /translation="MLLSRLLTLTVAIVGSTAEFHLRNQVIVNHGYSDISDEIFDNLSR
FT                   EDGDFINFNINKVQIANGTACDKCKSRIINAKNLVEQNPDKEHLVGLLLFKNCLNTQWR
FT                   EACQWTDFFVTTSSRNEQRFNDDGPDAGISSISNVNFYDNDFLQIIKKFNTSSEYDLET
FT                   YCYFKGNKACKLPATPNVTELFDLESWWPKKDSKYDSPPVYTNNSETFNVLHASDFHIQ
FT                   LDYKLGAEGNCTSVPCGTSSSYSKDAPGKTYNFTDYYKSFNNDVSGSDISFYPDSHYDE
FT                   DAKFSKGDYYDFPQYFGWSFNKAPATSFGAYLSDAPYLLVNNSIVEMKKLHQEKNFESI
FT                   IFTGDSFSHNGELANPDELKFSEAAIFNSINHYLNGVQVFPALGNHDTMFRYAEVAPRI
FT                   YVSNASYYWNEDYVTDLWVNNGWFDKKDADAIKTHYTGYSFTTKRGLKVIGLNSNFYYG
FT                   DNLWSYGETTTKPDKFGIWKFLIDELVDSESHGQRVWILAHIPSNNYDVLPIQSHIFAA
FT                   IVKRFSPYTIANLFFGHTHRTQYSVYYSTNDTSRIEDALTVSWVNPSVTPYTNFNPGFR
FT                   YYEVENESFNIRNSFSYYFDLNGTFTNSGNEPTWKLEYSARESYDPKGTWPKDAPLNGT
FT                   FWHSYVSKYLWNTTDTHFNQKFMNNKYRQSPLTPNCTTAKNALDDKCYNDNNCFLYFLS
FT                   DDNILCQKG"
FT   CDS_pept        1035548..1037680
FT                   /transl_table=12
FT                   /locus_tag="CD36_04560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44715"
FT                   /db_xref="GOA:B9W7Q4"
FT                   /db_xref="InterPro:IPR018857"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q4"
FT                   /inference="similar to AA sequence:UniProt:Q59VH2"
FT                   /inference="similar to AA sequence:UniProt:Q59VK9"
FT                   /protein_id="CAX44715.1"
FT                   /translation="MSAHNTPKKDYSNDSRPQSTENDPTRSRRGGKDSQPPQHHNSTVT
FT                   RSSLPNNPRPASTGNIPRNTSTPSLNKKQGNRVKAHNRSLSHNKSSTKLSTSTGATARP
FT                   HLNRSKSTEFLLKSRQGGALKRSSRSLTKMTALQPMTKTTSSPTLPTHKSTTSLKRINS
FT                   ACNIGLKSSARMGKAILQLNDDDADYEDVENLSNDEGTGQDNAPVPERFDSQDTISTTH
FT                   SQNEQNIPSLYEQINRILPEPTPASEEPPKFKDKLEVVEEGNTIDSKIDPSRPELGSST
FT                   KSSTDDFSQANNFYSGSLLLSQSTGLVRKIDPKHSANLKMTEAYPTMPSDEALNSTAIS
FT                   GISFKANPMELNNAAEPVTTSKNVNQNNSYQPDQTIFNNLQRTNNQYLMNKKQQQQQQK
FT                   IQQKTQQKQQQVKPLSPAGASINNGTNNFSDFLRTNNSTSSADSQYGHNIETRTQQRLW
FT                   LQRESSLMDVTNLDANRMSNFSNLSLNNLMFSHNYNNQSQANIRDLQYGSSIPQQHQPL
FT                   TPMTPATPGIGNNGSYSGSDSNGNQGLLNLVQGTLPLTVQTKIEFERLNREYLNVRRHA
FT                   NPMGESLKRLESYSGKELKVSKTRKGDKSATNANPSTFEEFSPTFHEKGTEIANTLNKL
FT                   WQEAIISSSSPSSSSSSAAAAARPNQPITQQHPMNQRSMNPRLASYNQTYNNSRQNQTT
FT                   NTRAVKLTTAQTTDAA"
FT   CDS_pept        complement(join(1037862..1038143,1038154..1038249))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04570"
FT                   /product="60S L36 ribosomal protein, mitochondrial
FT                   precursor, putative"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44716"
FT                   /db_xref="GOA:B9W7Q5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q5"
FT                   /inference="similar to AA sequence:UniProt:Q59VH3"
FT                   /inference="similar to AA sequence:UniProt:O14464"
FT                   /protein_id="CAX44716.1"
FT                   /translation="MCVYIRTKKVTTIFTLRFFPEILSMYIFFFIQVIYTWLTTSHINM
FT                   ISITKVISQQFKSTNITNNLFNATPKIISPITSGSLYQPIRGFKVRTSVKCMCKDCYLV
FT                   KRKGRVYVYCKSNGKHKQRQG"
FT   CDS_pept        1038413..1041220
FT                   /transl_table=12
FT                   /locus_tag="CD36_04580"
FT                   /product="coatomer gamma subunit (Gamma-coat) protein,
FT                   putative"
FT                   /note="Similar to C. albicans SEC21"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44717"
FT                   /db_xref="GOA:B9W7Q6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="InterPro:IPR032154"
FT                   /db_xref="InterPro:IPR037067"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q6"
FT                   /inference="similar to AA sequence:UniProt:Q59VH4"
FT                   /inference="similar to AA sequence:UniProt:P32074"
FT                   /protein_id="CAX44717.1"
FT                   /translation="MSTSSYKKQDAYSSNVGIPDKMAVFQECLQQFNASPVNAKKCRQL
FT                   LAKLLRLIYNGESFPAQESTTLFFSISKLFQHKDSSLRQLVYLTIKELSSTSDDILMVT
FT                   SSIMKDIQGNDAVYKPNAIRTLSKVLDPTTVNAAERLFKNAIVDKNPVISSAALISSYN
FT                   LLPHAKEVVKRFTNETLETIQSYKSFPPTQFQLHEYYGSSTSNLPSTSYMYQYHALGLI
FT                   YQLKNHDKMALMKLISSLSEGSSLKNSLSIIQLIRYINKILNDDQSLISHLYPILAGFL
FT                   KHKSDMVELEACKTLINLQHLIKDDQFMQIVTTLQKLLGVPRTATRFAAIRLINKISIK
FT                   HPEKIIVVNLELEGLINDTNRSISTLAITTLLKTMGAGTVDTGSTGGESVDRLITKMTS
FT                   LMDEITEDFKIVIIEAIENLALKFPAKHKKLVSFLTDLLRDDGTLELKSSIVDALFDLI
FT                   KFLPDTGAKQLILMNLCEFIEDCEFTELSVRILHLLGDEGPHTSNPSYYIRHIYNRLVL
FT                   ENSIVRSSAVIALAKFAAVCGGDVSKNIVILLERCLNDVDDEVRDRAAISLNFINNGKK
FT                   NLIVSDSRYDLNALESKLVHYLNNEENFSVKFDISEIRVISSEELKSIEYDRKISKLES
FT                   SNVENNDAPEVEEQKGAKIESAGDGVANDLLKQQEYAQELAAIAEFESYGKLTKSTSVP
FT                   IYLTDKENEIVVSVVKHLFAESQKLVLQYNINNTLPHTVLQDISVIAQPDNELYQEDFI
FT                   VPLAELKPDQTGIVYVSFSAPGIQDEELLSAFGNTVAYTNKDLDDEGNVDPTDDGWSDE
FT                   YQIDDLELLAGDFIIPLYNSNFTSIFDQLPNQDSGVVNISNVDTIENAVNKVKTALNMM
FT                   PLDGSDYVPSDITSHTLKLLGKDVWGGKVGASIRLASTGGKIVAKVEAKTDTENFANVV
FT                   ISSVY"
FT   CDS_pept        complement(1041413..1042351)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04590"
FT                   /note="mannose receptor-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44718"
FT                   /db_xref="GOA:B9W7Q7"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR028927"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q7"
FT                   /inference="similar to AA sequence:UniProt:Q59VH5"
FT                   /inference="similar to AA sequence:UniProt:O59745"
FT                   /inference="similar to AA sequence:UniProt:Q06815"
FT                   /protein_id="CAX44718.1"
FT                   /translation="MSKLVRRTILPAITVVCIVFFVVLESSKKPNDSLYDAGSHIFDSI
FT                   SHLSFVDGQLIEHKPPNQPLLNEQFKNIDSNPDINLQTIKQADGEKKKLKEKEEEEEKQ
FT                   LDPCTVFNPINKGFIDLSGLSSLSNEGKALPWVSKGYDSGKNYTIGICSSPFKKHHSEI
FT                   TEIQDNLNSSLIGAYYVDAETKKYVSMGKYSTVPKFRGRKLTLTYENGSYCDIIDNNTN
FT                   QRLRKSTILTFTCDREMSARASVSYIGQANECTYFFEIRSHHACPTAAKANNLAAVWIF
FT                   LFIFLAAVFVYFSGGLLYRQMKQASSARSKV"
FT   CDS_pept        1042902..1045454
FT                   /transl_table=12
FT                   /locus_tag="CD36_04600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR037986"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q8"
FT                   /inference="similar to AA sequence:UniProt:Q59VL3"
FT                   /inference="similar to AA sequence:UniProt:Q59VH6"
FT                   /inference="similar to AA sequence:UniProt:O13585"
FT                   /protein_id="CAX44719.1"
FT                   /translation="MDAWNNTTSFAADSLSGFNSQLPDILNLSDPLLAKIITSKKALQL
FT                   LESNLVSGVSEDGGENSSNNANKAIIELLMSACDGDVVTLESITRSNPHIVNQLFPSDE
FT                   NGATALIYAVCFNNPDIVESLLENHKADPDISDSIVNYTPIMWAVHLNYLNIVKLLLDH
FT                   QADPFLSPKDDGKNASTLVFPENAEMYEYFRSHNLLKTNTDNSNDIYQANSFLPQDDYE
FT                   DDLNTKLRMHTITGDTITNEDEENQEPRVVGEDEEYNLAQDPILQQLPDFEYDKLLPEQ
FT                   YIKFTDSDIPTLLNYIFDLRSQTTYQHNTKLPAAIVFQLVRYSALKVESTELTDFLFDC
FT                   FTARLRTVTNTKSGAFNMAIQDDGKPANTMGAGDIVLLSYWLSSLQFLHFYFGKNNIYL
FT                   KYPRFLQELINLVQSLTATLSFSINSRLNLLVDDCIINFTNLVDVSNALYAKDWNLFKK
FT                   NKSHPNTYDDIMNTLYPPTQMELMKPSPIRYLQVLGALDYVLRIHKVDNLLRSEAFSQV
FT                   FYYINCTIFNRLISQSKYCSRAKAIQIRLNVSAIEDWLRSHNTKVYRTETIGGLNKLLG
FT                   DADVKLHNLLNEDTSSEHRKNPHYLQFYYNSLYHIGKNQLQPTIELLQWLQCMTSLSDE
FT                   ESLINTINQFDCLNYYQLFKVAHKLYKYEVNEVKLPKKLIQVIKSLMTEQGPNQIQRLF
FT                   LHYMTQTTFLSKEEYIYLNPNYIFEVALPNLTELINSYGAGLGGVRVLRNKKYQPSLPI
FT                   SIMDDIDERLTENRSWQNETYDYDDKNDDEDEDDHNGNGDSGSVDPGTFEKKPALTKDI
FT                   DDFKGDELFKQVQMPNSLLHKNWGDSSTGVEDFESNPW"
FT   CDS_pept        1046844..1048535
FT                   /transl_table=12
FT                   /gene="SAP7"
FT                   /locus_tag="CD36_04610"
FT                   /product="secretory aspartyl protease, putative"
FT                   /product="aspartyl protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44720"
FT                   /db_xref="GOA:B9W7Q9"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Q9"
FT                   /inference="similar to AA sequence:UniProt:Q59VH7"
FT                   /inference="similar to AA sequence:UniProt:P43096"
FT                   /protein_id="CAX44720.1"
FT                   /translation="MQRILELLLLSSTALAVIGDGFIALPVHKLQADEGSVHFPNRLPI
FT                   FDLVNGVAKTAQEDVNQIIQPIFGNGIFSGGSIEVGHSADGHSVKHEVSFSPPSSTDNK
FT                   DNEPTKTGFSLDDLIKSIPTEFWSLIGSDKPPTLSDDRSKDADFTPSAVSQVEQPTSKS
FT                   VESTAPSSVSNDSEPSSSGANKQTGAFFLSLDNTQTLYTATLKVGSPPQEVQVMIDTGS
FT                   SDLWFISSGNSQCKANGGSIDCDQYGVFDKSKSSSWHDNKTDYSISYYDGDKASGTMGQ
FT                   DNITFAAGFSIENANFAVIENTTSSIGVFGVGYPELEAVKPKYTNLPFAMKEQNLIAKV
FT                   AYSLYLDSRDAAQGYILFGGIDHAKYTGDLKAFDIVKSNDKYVYSQIPLTSVVSSLNNY
FT                   TNAYGLPAGTNHPKVGAVIYNGTDSFNGGIDLKDTPTLLDTGTTYSYLSKDQVESIVGL
FT                   FGNVTYNDAGKAYEVPCWVGNPGNYLEFNFKNEQYIKVPTSEFVISVGTYASGAELCVF
FT                   GILPGTHSILGDNFMRSVYAVFDLEDHVISIAQAAYNDNHAVVPIE"
FT   CDS_pept        complement(1048906..1049247)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04620"
FT                   /product="60S ribosomal protein L37, mitochondprecursor,
FT                   putative"
FT                   /note="Similar to C. albicans MRPL37"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44721"
FT                   /db_xref="GOA:B9W7R0"
FT                   /db_xref="InterPro:IPR013870"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R0"
FT                   /inference="similar to AA sequence:UniProt:Q59VH8"
FT                   /inference="similar to AA sequence:UniProt:P36532"
FT                   /protein_id="CAX44721.1"
FT                   /translation="MFRSISKVTFKRVSPIINTRQLTVSSTRFNETTTTTPKSTCPAGT
FT                   VLNLKVFKKGDEPVAKEDSEYPEWLWTMLDPKENLKAIQNENFLRWRRIKLSKENNSTI
FT                   KNNNFLSKL"
FT   CDS_pept        1049561..1050751
FT                   /transl_table=12
FT                   /locus_tag="CD36_04630"
FT                   /note="GTP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44722"
FT                   /db_xref="GOA:B9W7R1"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R1"
FT                   /inference="similar to AA sequence:UniProt:Q59VH9"
FT                   /inference="similar to AA sequence:UniProt:P38219"
FT                   /protein_id="CAX44722.1"
FT                   /translation="MAPKKKGVVEKPILLGRPGNNLKSGIVGLANVGKSTFFQAITRSP
FT                   LGNPANYPFATIDPEEARVIVPSPRFDKLCELYKPKSEVPAFLTVYDIAGLTKGAHAGE
FT                   GLGNNFLANIRAVDSIFQMVRCFDDADIIHINDEVNPIADLDIIKDELRLKDIDFANTY
FT                   LEGVEKIAKRGGQSLEVKQKKEEAEFVKKVIQMLEDGKRIANQTWTAKEVDVINQMLLL
FT                   TAKPCIYLINLSEKDYIRKKNKYLLKIKEWVDTNSPGDLIVPLSVSFEEKLASMESDEE
FT                   REAYCKEIGAQSALPKIIVAMRQKLDLISFFTGGPDEVREWTIRKWYTAPQAAGTIHTD
FT                   LERTFILAQVIKYEDLIEYGDENSVRAAGKLMQKGKDYFVEDGDIIYIKAADGKAR"
FT   CDS_pept        1051467..1053734
FT                   /transl_table=12
FT                   /locus_tag="CD36_04640"
FT                   /product="alpha-1,3-mannosyltransferase, putative"
FT                   /note="Similar to S. cerevisiae MNT2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44723"
FT                   /db_xref="GOA:B9W7R2"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R2"
FT                   /inference="similar to AA sequence:UniProt:Q59VL7"
FT                   /inference="similar to AA sequence:UniProt:P53059"
FT                   /protein_id="CAX44723.1"
FT                   /translation="MRFTLKKISFVLITLLTISIGYLLLQSIDLQRIRELLHDDEKFDL
FT                   ESLKQASLEIRKEIHYTNYLFSGYDNFTKQFSDDETIKQTSLNDKCKLVFNQWKVSHPD
FT                   FEFKTFEPEYERYDKSSDRKELFFKERINELRKRFEKDGNNRDKKFTLSRSDNKTISHE
FT                   YMKNVKRSKNVLQFMADFVSMMRLYGKCFFGRELDDELNSIYTEYRGKLFPFITNQAPK
FT                   FRKVGESEESGWPIYDDQKNIIDRKTEFGNNPIEFLQKNSKGRGIVISVSTRYAKDTMR
FT                   LIKILRALNNRLPIQIVFKNDITKKNIELLEFAAVATPEELFDPEIIRDGAKFMPELNL
FT                   LENYKNYGSEFPVQDLTFVNIVGCVSRPYRFSFPGYSNKILAMLYSSFEEVILFDADVV
FT                   PTVNPQEFFDSKYYKLSGTYFFQDRSLRDFNDFIETNFFSTLFPSNEKSIDTFFDIPRV
FT                   GEKTFDNKYMTGWRHYQEAGVVAYNKMQHFLGLLMMFPLALWTEPVQSSIWGDKEMYWL
FT                   GLSMAGDENYEFNHYAAASVGEKATEQKHKYYPNSESNEVCSTHPGHIDENGKLLWINS
FT                   GFSYCKKNGYFRDKGKFPFSTFELRDLVKLYSSPIKIRAGLIPPDLPNHREPGSPPDTN
FT                   PEMEFRKSWKSRKKDIDEINDKLPEGQEPYDFISEWGPQKGWVKNGICSGYYYCAYDKI
FT                   TSYSSEREFDTGTLVEFDSKSNELFDYLSKIWHTGGSKMMPKVKLETDKSGTDPDKQQQ
FT                   ES"
FT   CDS_pept        complement(1053873..1054829)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44724"
FT                   /db_xref="GOA:B9W7R3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R3"
FT                   /inference="similar to AA sequence:UniProt:Q59VI1"
FT                   /inference="similar to AA sequence:UniProt:Q59VL8"
FT                   /protein_id="CAX44724.1"
FT                   /translation="MSTKSANSTAVNSFNANHSNYDVFRPSFTPVLVNPFLTHLGLATK
FT                   NPDGTFTFDTSKYVLEIAAGTGKFTRNLVNNGWTDNLAVLEPSKGMLETFNKNFPQIKN
FT                   QILGSSYKIPLEDNSVDAVIIAQGFHWFADLDSLKEIHRVLKPQGKLGLIWNFDYASPS
FT                   QDSSVADSEYYNSGTKYYNTLNFDVDTNEKVFEQYFDNQQWNKVATQFIYGFDVNVPQY
FT                   RHGKWREVLKDNPYFKSKETNLFALYDSIVAKNDAWKYWETRSYITEKSDNEKQKIRQK
FT                   FNELVEQNLEDSSYSDKDKQLIIKPMATHAVVLQKTP"
FT   CDS_pept        complement(1055117..1055827)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44725"
FT                   /db_xref="GOA:B9W7R4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R4"
FT                   /inference="similar to AA sequence:UniProt:Q59VI2"
FT                   /protein_id="CAX44725.1"
FT                   /translation="MKSTFVSIVDFPDELLEKIVNSLNQKDLIQLALTHPRFSKICQDS
FT                   LLRRIYIYNDDKYFKFTKKATYIQECMHMTIVGLSNFLKLLTSPNFQPSLIKEIIIAND
FT                   DNAYLQYFELMERQQLPVKYDRIKDIDIRNWLGDNKLSRKTKLAIELAELKRRSQFVAT
FT                   INQNKTNYYDSNDQFIVIIAIIFIFVGVLFFIALWGNKWDLQMVNSLLNGSNPFGISKI
FT                   DNTKKLFTSLLWDS"
FT   CDS_pept        complement(1056722..1057669)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44726"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R5"
FT                   /inference="similar to AA sequence:UniProt:Q59VI3"
FT                   /protein_id="CAX44726.1"
FT                   /translation="MKFTQVFTLGLFALSTQATVIPQESTTEVDKRLDADVAAQLALNI
FT                   LNLIQLGIGADVNVTAKRDEFVVEESKRLDADIAAQLAANILNLAQLGVGADVSASAKR
FT                   DTAAADIAANILNLIQASVGADAKVDLKRLDADIAAQLAANILNLVQLGIGADVNVAAK
FT                   RADATAAADIAANILNLIQASIGADAKVDLKRLDADVAAQLAANILNLIQLGIGADVNV
FT                   AAKRADATAAADIAANILNLIQASIGADAKVDLKRLDADIAAQLAANILNLVQLGIGAD
FT                   VSASAKRDTVAADIGANVLDLVQAEVGAQATIDL"
FT   CDS_pept        complement(1061787..1065824)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04680"
FT                   /product="ribonuclease P protein component, mitochondrial
FT                   precursor, putative"
FT                   /EC_number="3.1.26.5"
FT                   /note="Similar to S. cerevisiae RPM2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44727"
FT                   /db_xref="GOA:B9W7R6"
FT                   /db_xref="InterPro:IPR013888"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R6"
FT                   /inference="similar to AA sequence:UniProt:Q59MC4"
FT                   /inference="similar to AA sequence:UniProt:Q59MB1"
FT                   /inference="similar to AA sequence:UniProt:Q02773"
FT                   /protein_id="CAX44727.1"
FT                   /translation="MVFQSFIRFAKYSLSSSSCRSEVRHHFFRSSYPYLNRHHFFKNSI
FT                   SNYNKNFYKSKWWFRSQRNTSNRSKSFLTISDGHYGLYYSMYNHDSERQQQQKDHEKYI
FT                   KHMILKQLETSDRILGHKSLNSEIFFARNHPHYNHHHRSHHIANCFMGRYNRRQNSDNN
FT                   GRNHYHRRRCPHHHGFHMKLLLIGFTAKFLISKAMVDTQINLDGIKKFSSKLFSSFAYK
FT                   PFNYSFASFIRLATVAKNGAISNQKEQELATIVSPQLSNVFTTGIVKRTFATLAHQQQQ
FT                   QQQQKSNEIKTVAEQQKQSQPPSQENITVDTFEQDFLASKVSKIVSVFDTYSSPDDLNI
FT                   IYPLYQAVKRNDLKLPSIDVYNIVLKSILHRSLNSELTLDSIEGKLTVLLTVYQDILAA
FT                   GIKPNKETYNIVVTALLNGSLQCLDIPTDNILQYNEVHGKSQEFAQICLELFTSISNQL
FT                   DLQALLPDLLRLLYNYPQLITPQIIEPFVNSIQVARVSDKDYYLLILELSKYFTQFGLL
FT                   DKEQTYQVIESAYTKYKSFGKVNPFIAYKKVIASLVNNDFITEASQLLDDVLLDYKESL
FT                   QFKYRPSKHQISNLIGSFLKAFIMKTNDLAKGYELLVKFNSVAYLPDFPVRFYNYMITK
FT                   LAENGMHDEMWSVYNRVMVRTDYQNTSTMEMVKHNGKACRDVLLSQSLDESDHEHAFQL
FT                   IKEILVKEHLIADLDTLNKTFHYLYNAVLHNTTDEEYFNQYYFGLLWQVMETQAKHYKT
FT                   STDINDFISHFVQFLTVKVPEILANDERAVLAVIKYNVNLLLNSPFINRAVESFNLQTD
FT                   NIYGLTLVVRELMKFDDRFPIESQELYMRIVEFETLVIDEFEDSENSYIELTPEMTQFL
FT                   QDIKMDRDHRLAQLQISNRDQDHDHVLSNSKDLLSTFESDIQPDLTCDIDLSYLLNLNF
FT                   DKGLPRFLELYNKNHKFNFATWNIIINFEFLDNFNSQFEIQEFLQRIWMTNCEESKKLE
FT                   LLKRLVKYNFEPVINGVGIFVKENKIYNDNELLITLFQTCLKMKDTIDHEIFANDSFFQ
FT                   TIYQTNRNTEWIIAYLNYLVSVKQHEKVASIIDSMEGNLPAPLGHLLLEADLNFDLNKF
FT                   QTNFKELNITPSNKVHELCLRYDLKSGDLSARQIINKYSKFADKGSITLQELVSFCHVL
FT                   CSLQSSESIKPYRTGNFESTYILATSLLTARKFDEMVTIIESNETKIDTQKLFGQMISV
FT                   LIELLPYHNNQTQLMNKFIDTIKLCKILRLGSVSMENFMKIIRFLTEIKSDLLTVILNR
FT                   FINDGEFADVVTFYFIEVDLFQYKSKLTVLKELYYSMRKLGNEFNVSMINEFCHANGIR
FT                   FF"
FT   CDS_pept        complement(1066995..1068938)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04690"
FT                   /note="ubiquitin ligase complex F-box protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44728"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R7"
FT                   /inference="similar to AA sequence:UniProt:Q59MB0"
FT                   /inference="similar to AA sequence:UniProt:Q04511"
FT                   /protein_id="CAX44728.1"
FT                   /translation="MSSLKEEDHTQDSLGNTIIKPSHKPNNQVPKHPKLTINDLPPEIL
FT                   IQIFTNLDPIYLNTLRLVCKNWNYIINDKELWMKSFQLRFNIPITSSSFPSLSQSSNWM
FT                   NEYFTRLQVNKNWKRGISVHKTYQIINNEHRFNDITMVDFGMNKILTYDKRYNNISIGK
FT                   LSDGKNQGFIPGSISGFSTDVLCFDINWNYLVTGMKNGEVILKNLYTSTSASQRSSVTK
FT                   FDTMEDSPIMDIIMNKDLIISGSYNGNLRCWNLQGKVVKEFRLEEVIYNISSDFKKHII
FT                   VNTDRHIFVIDYQAEEIISKIDLGFIINENEPLEYDLLIRSKNKLDVDYGTKKVIICYK
FT                   SHIQVFYFDNHSHREMKLDQNVEVIDSRFQIATSNKFFNRNTYVVGQDGLLYGNLLSDG
FT                   SVIIWNVREDSVLITPITQIYPELDHKKYSHGLNHAIARHNLLEITSFAMNGTMLAIGG
FT                   YNGLTNVYDVFTGKFIREISIKYPARFQHMHNSLVPISSIQLNPSQTDNNGIIICGDAV
FT                   QYFEFGEIKQPPGKQPQRRQMQKSLNNRGKNESVKKIRDGLEDYDEEKHRQSHADRLLD
FT                   KYNGNKYEDEDEELMMALALSESMNNSRDASQISVNESLLTPEELVGEGQQDEEEMDEE
FT                   LRRALELSLIEH"
FT   CDS_pept        1069770..1073744
FT                   /transl_table=12
FT                   /locus_tag="CD36_04700"
FT                   /product="eukaryotic translation initiation factor 3 135kDa
FT                   subunit (eIF p135), putative"
FT                   /note="Similar to C. albicans CLU1"
FT                   /note="Similar to S. cerevisiae TIF31"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44729"
FT                   /db_xref="GOA:B9W7R8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR027523"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R8"
FT                   /inference="similar to AA sequence:UniProt:Q59MA9"
FT                   /inference="similar to AA sequence:UniProt:Q03690"
FT                   /protein_id="CAX44729.1"
FT                   /translation="MSTEEKIEETQQQQDPVPAKELLLKVQLPAFFNVGDDLTIPSSYE
FT                   ENITDLKQALNIIVVCRNLTNYSILIKGIDIVENFGEMITFEQIISHFELGEEVSELKI
FT                   VIKEKSYNLANIYEQISRFREVIGLHYIDKISNDIGSSGGVSKFNGIQLDDIKPKEPKE
FT                   KSTKENKEEEGEEKSKQQEEISISQEEVSTISDFAKQFTSESFDGDFTKLTNFDEVNGK
FT                   IKIPIKSLTISQWSPVPPFQQAKGDLLYLSLQTLEHETFNVTCHFSGFFVNKSSTVNFN
FT                   PAIKVNEKGKFNKSYLLYDLISQLSPLFSKTIAENEVNLSDSTKYPETYLLPGNSFPAY
FT                   PWLVNEKDLKNVPDLSRSQLSSLINGVDGADYIKDWNNDIQSIKELPATTVQERIIREK
FT                   LVQKSLFEFNKTATETAINIIKGNITPLNPDESSDRFIYLRNGIFYSSGTSTVDGFETT
FT                   GGEEASRYVASKDLTGIKLINRHDIRGISSLVTCIVDYMGKRVVCQAPVPGILDTPVVT
FT                   STDGETEEPVEKVVYGLSSDGTKILEDKTFEESLKLIGEFFHLKPHQVQLSDDVKTESK
FT                   LVVSKDTKGLKGTDGRKYVIDLYRTTPRDIEFIEQHFKLDDETSYPHGEALIRHEAVNE
FT                   WWRRKVAVLFKKETENLEKEGKLDNKDQENKPQIAIPTDKVVFNPDSFSTENEDEQDRE
FT                   EVREISKFIKEKLVEEFLDEIKDQVIPFDGKQLTDALHRSGINMRYLGYIAERLVANKE
FT                   KHLADLEELIKENEAQAEKKRKEQEEKENKGEATESEDKKEEKEEEKEKEEEEEEEEEA
FT                   PTKATYQLTLANYSTLHRIIIQEMISRAVKHILRSLTKSLPSYLVSTAIAHFHNCLLGG
FT                   AINSTPQVEIDEIYKSFCSESEIEFTKLTHEDVIQLVSKEVFSRFRYNLSQDWINTVHL
FT                   PQLFREIAFKYGIQWKSQNYPFTKEEFETHNKQIQVQVIETKSSKKSKKKTQVATKKSI
FT                   ERSSIFIADDIVGFVPIIKDSSYKSTIVDEIYNNARSHLAQGNKEMGMALFNELLAINE
FT                   SIYGKVNPETARFYNLVAQVYQELGYDTEAALIGRKAVILCERSCGFDSYDTITAYMNS
FT                   AYYESSNDQYLNSLKLYKEAMNTWSLVYGKDHPTLINTLTNLSESLLKIRAYDSALQLL
FT                   EEALEITKKLNGEISEITGFIYYRIANIVVSLNKFKESKELFDKAYDIFLKLLGPDDSM
FT                   TKQVAKYVSSVTLYVEYLKRQQQETQKKTKTKVTSGNNTNSNNNTSTITPTANKNGKKS
FT                   KKNNTPPQPNPEIANQSVEEILRFIEGKPSGSKKSNNKKK"
FT   CDS_pept        complement(1074444..1075940)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04710"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans MMT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44730"
FT                   /db_xref="GOA:B9W7R9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7R9"
FT                   /inference="similar to AA sequence:UniProt:Q59MA8"
FT                   /inference="similar to AA sequence:UniProt:Q66R35"
FT                   /protein_id="CAX44730.1"
FT                   /translation="MNYHFSSVTSPSLSRYLYYRSSTNTVSYWTLSQFHIRLKLTTRPN
FT                   CTRTALISRHFYSTFSIFQRTMSTSNNQLSKETPPPPSGQDSHSHVHSHSHDSEHLHSH
FT                   SAAGMLHHHKHSMHEPNELLAGGASAIKTNPAVRITWIGLLVNVTLAISKGVGGVYFHS
FT                   QALVADAIHSVSDMLADFLTLATVNVAAKVGTATKFPLGYGKLETVGAFSVSAILLFAG
FT                   ISVGWSSLLQIFEFVLPTHLYEIASHIHIGHDHSHSHSHVQAQPDAHSHGHIDPSNITT
FT                   HREIPNINAAWLAGGSIIAKELLYRKTMKVAIQTNSKVLVANAWHHRVDSLTAVVALFT
FT                   VAGGVLFNVAWLDSIGGIGVSILIIKAGYDSLREAWNELIDRGERPGSELYNKIEGIIN
FT                   NELQMNNELKQFKLNQLSVLSSGANTNIHINLSTTNQNLNLKTLNQYEKRLSDLIRQDD
FT                   RFVRNIFVKFEQVEEEQEKVKTQEEEEEINGSNDVHSHKH"
FT   CDS_pept        complement(1076629..1077747)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04720"
FT                   /product="spliceosomal U2AF small subunit, putative"
FT                   /note="Similar to C. albicans UAF22"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44731"
FT                   /db_xref="GOA:B9W7S0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S0"
FT                   /inference="similar to AA sequence:UniProt:Q59MA7"
FT                   /inference="similar to AA sequence:UniProt:Q59LX5"
FT                   /inference="similar to AA sequence:UniProt:Q09176"
FT                   /protein_id="CAX44731.1"
FT                   /translation="MDTTEQIYQSQSQNRNQTRLKSTVLCSFYTRIGACRHGEKCTKKH
FT                   LRPTSTKTILIPNLYQNPRFDLEEYLKPNKKHHSAKKRKTENKKDGEADAKIKHEPRDD
FT                   VKDNEEVIAVDEDNKKLNEIKKKISEALIDKDKEKDIEGESKITQQDKHDESSKEEQSE
FT                   LEKEELAHQDTTPEVPNHSQEKTCINQEKHSHDESHPVLTDEQIRKDFDLFYQDIFVHI
FT                   AKLGQINDMAVCENENHLSGHVYVKFNDYEDAYNANLQLNQEWYNGRPIYSELSPVNSI
FT                   SDAHCSAWDHGHCNRGATCNYLHVKQPTQGMKKSLYDSQSKSYTLKRLEMLKKQVPGEI
FT                   ISGAGSNMANGNEVNVNNISIRSTTAFLEHLF"
FT   CDS_pept        1080327..1082288
FT                   /transl_table=12
FT                   /locus_tag="CD36_04730"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C. albicans WRY7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44732"
FT                   /db_xref="GOA:B9W7S1"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S1"
FT                   /inference="similar to AA sequence:UniProt:Q59MA6"
FT                   /inference="similar to AA sequence:UniProt:Q5ALW2"
FT                   /protein_id="CAX44732.1"
FT                   /translation="MLAWLRYRIKSYNTTSTTTASASSLLSSAMFRKWYKQGTKLNFTL
FT                   LILCLLLTFSVFFNYFYLADNYGFDINTEDQEKIFNDRKVVIFPNNFEITDKNLVEYYL
FT                   KTLEEPLHPQDTIYRNRFTYKVPDVTYKSQSINLFSGLSQNSQSSQCEELSSVYNIDVS
FT                   GPQNKNCDLYKVLGKFLNDNSEYFQEVSPLFPNLKELLTKKQIEKHWYQLIGSSVWLEQ
FT                   YGVHLMTSRIFYSSTGDKVKPVVSLTYVQAFDHDWREIENVELIVPDGEGKYKPKTYPT
FT                   FLPMSVYHNEKQQQGRFYGVEDPRITLVRNKLGYDEPIIVYNSHHRKITNAKSDNDGES
FT                   NIHFKAYRSIFMAWLWQNQKGKTNVEEIVNGKVKNRVYVKSKELIKPNNKREDKEKNWA
FT                   PFINYQQRMKQGFDSHIYFIYQFQDLKILKCSILDDEDCVWEYQFNDKNGAGRLRGGTE
FT                   LVNINRLLTTFDHPEVNRVKNLMPENREIWIGVARAALEKCGCGDKMYRPNIVVLIKDG
FT                   DNEYRLSHVSPFVELGIPILPWWSDKGICDGKNLIIPNGISSWHLNKNEDNSIQDYLTL
FT                   SISRADATVDLIHIKGLLKSLLFEDPNSKLLEVNDYGFNNKNIECAVKSSEVFCKKYGE
FT                   EHKKNKEENKAKGKGSSN"
FT   CDS_pept        complement(1082479..1083453)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04740"
FT                   /product="haemolysis-ralated integral membrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44733"
FT                   /db_xref="GOA:B9W7S2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S2"
FT                   /inference="similar to AA sequence:UniProt:Q59MB7"
FT                   /inference="similar to AA sequence:UniProt:Q59MA5"
FT                   /inference="similar to AA sequence:UniProt:Q12442"
FT                   /protein_id="CAX44733.1"
FT                   /translation="MQNSNISLRQRQKSDNSQTSTVLETTPLQKRLHYYHELDEWQQDN
FT                   HFIKSGYVKQTNSYKECFKSLTYLHNESVNIYSHLLPSSISFWVILYYINYILPKYDNY
FT                   LGIWEKLNFLQFGLACTFCMFMSSTFHCIKAHSHPVSKFGNQLDYFGIVILITCSLISI
FT                   IVFAYYDYPWYRNIFVALSLFFGTVCTVLTLDQKFSSNEYRPFRSFMFILFGLSGVLPI
FT                   VNSMYMFGFEITRQKAGVEWLILEGVFYIGGAVLYAARVPERFTHVEDDEHTLLNNPSS
FT                   GMFDIFGHSHQIFHVMVVIAAFCHWKGLVQSYHYLHLHTLPNL"
FT   CDS_pept        complement(1083968..1085710)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04750"
FT                   /product="acetylglutamate synthase, mitochondrial,
FT                   putative"
FT                   /note="Similar to C. albicans ARG2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44734"
FT                   /db_xref="GOA:B9W7S3"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011190"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W7S3"
FT                   /inference="similar to AA sequence:UniProt:Q59MB6"
FT                   /inference="similar to AA sequence:UniProt:Q59MA4"
FT                   /inference="similar to AA sequence:UniProt:O94330"
FT                   /inference="similar to AA sequence:UniProt:P40360"
FT                   /inference="similar to AA sequence:UniProt:Q595W7"
FT                   /protein_id="CAX44734.1"
FT                   /translation="MSKLKTLNRQFISNLETHKVTTDAKRNLILSILKSTTTKREAKNY
FT                   LTKYQNQFDFNDDLDFNKNIKIKNEQLSLTNRDSQRELFINRFLNQSNPFINIYDREDV
FT                   KLQKVPLRLAIFKIKFTKITIKQWKGIAETFKRLITLGISPIIMLDYDHLPSNSFKNNE
FT                   LYMINQGNKMLNYLGRPEEESDLKVTLLRSLFTSHKGVPTLDSLESILIPLYQGIIPII
FT                   QPIVYNADASKQEFLESDKLLLGLSSALIEKRTTDLLSIEKIVMIDPMGGIPSIERRQT
FT                   SHVFINLSQEYSDILSELFIGHIEPKYRDTHVNNLNTMNNVLSFINEKSGNDETTGIIT
FT                   TPEIMSINIDQLNPIIYNVLTDRAIISSSLPSTTNRTPHLSTTIIKKGVDVQIFDIDNY
FT                   DKDLTMQNLFDDKLVNKEKLINLLNDSFGKSLDVDPYLDRINDNIATVVIVGDYDGAAI
FT                   ITWEYSKGEKIAYLDKFAIAKKNQGLPGLADVIFKIILQSHPFELIWRSRKNNPVNKWY
FT                   FERCCGCMSAPDSQWKIFYTGEVFDKKIDRFKRNPRHKNGVVNIDRKLQQYSEICEGIT
FT                   PSFK"
FT   CDS_pept        complement(join(1086090..1086584,1086666..1086785))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04760"
FT                   /product="DNA replication complex GINS protein PSF2,
FT                   putative"
FT                   /note="spliced gene"
FT                   /note="Similar to C. albicans PSF2"
FT                   /note="Similar to S. cerevisiae PSF2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44735"
FT                   /db_xref="GOA:B9W7S4"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S4"
FT                   /inference="similar to AA sequence:UniProt:Q59MA3"
FT                   /inference="similar to AA sequence:UniProt:P40359"
FT                   /inference="similar to AA sequence:UniProt:O94329"
FT                   /protein_id="CAX44735.1"
FT                   /translation="MVLPKNLQGNLMPSEITFLAENELITILPRYSIKKIDLIGTSIPN
FT                   LRAMRRELVPLWVALILKSQDKCNIVPPKWLTVAYLKERYDDEIRKPLQFSDLPWNWLE
FT                   LSKILLEKAPDDLSDPVDQLRTVIQDLRETRLVKSKKGLKELNESNIQLNGLSLLEINE
FT                   LRPFVIPVMNKLRQLYETTQNNTVNTGDQEMEDASDDDDDA"
FT   CDS_pept        complement(1086998..1089328)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04770"
FT                   /product="exosome complex exonuclease RRP6, putative"
FT                   /product="ribsomal RNA processing protein 6, putative"
FT                   /EC_number="3.1.13.-"
FT                   /note="Similar to S. cerevisiae RRP6"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44736"
FT                   /db_xref="GOA:B9W7S5"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S5"
FT                   /inference="similar to AA sequence:UniProt:Q59MA2"
FT                   /inference="similar to AA sequence:UniProt:Q59MB4"
FT                   /inference="similar to AA sequence:UniProt:Q12149"
FT                   /protein_id="CAX44736.1"
FT                   /translation="MSSGSEDVFKEIFPKLMNTIRAASSLGAQDVNFYKTVDKDLGKQI
FT                   DEQSQRLLNISNDLLRAATDDPNDFEAIEYGQENVTGEASWKPISRIIDSIFDKIDSTF
FT                   DQAKRKAKGISKDQELEYLDDGITSTIKNEKPSKTEKPQLKFKVPIDNSEAGPFKPKLS
FT                   SKPHALVPFNDSLINPEPVYEDSIEIIDPPFYAQPYEYEIDNQPYPDAILAKSDPIPPK
FT                   DWSTTKAIWVDTVEELHKMVPELKKSTEIAVDLEHHDYRSYYGIVCLMQISSREQDWIV
FT                   DTLVLRDDLTVLNEVFADPNIVKVFHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFP
FT                   RFSLAYLLEVYAHFKTSKQYQLADWRIRPLSPPMLAYARSDTHFLLFIYDQLKNKLIDA
FT                   NKLAQVLYDSRQVAKRRFEYTKYRPMANTFSNKVTCPVMAFNPKEPWGSIVSQYNVPHF
FT                   KRPVVEVLYKWRDLMAKQQDESVRYIMPNQLLVSLVNLESPVDLNKILNVSYRISDAVR
FT                   INAKELANLIEQTLKDTEANDWDLVDQWNKQQSEEQADTYVDVASIANEFDKLLTNAAQ
FT                   VFEASTLLTSESKAFGNIYHNKPLVTLEFRDEKVFKHNFNDAWQKRLEATWKELTVGTD
FT                   LAITIPISDIEDIEEEEESEEDIPEKAPATASEGTKISGQAVLFNTAKEIDPNELITLR
FT                   KRNVQPIKRNNNKKVSQEEQKEIDYANADKILLKDSKKKNDRKKRGFDPYGRDSEGPKP
FT                   AKKAKTMTSGRTSTYKKKMNKYK"
FT   CDS_pept        join(1089366..1089393,1089567..1090744)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04780"
FT                   /product="conserved hypothetical protein"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44737"
FT                   /db_xref="GOA:B9W7S6"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040025"
FT                   /db_xref="InterPro:IPR041661"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S6"
FT                   /inference="similar to AA sequence:UniProt:Q59MA1"
FT                   /inference="similar to AA sequence:UniProt:Q59MB3"
FT                   /inference="similar to AA sequence:UniProt:P38344"
FT                   /protein_id="CAX44737.1"
FT                   /translation="MLKKRTRRGYYTNEMFTCNTCNLQFPAAEDQRSHMKSDWHRYNLK
FT                   RRVAQLPPITEDLFNSKVSTLTNTEETKQKQLTKKEQRRKEKEAILEQKRQILEQAKRA
FT                   MLAQIQENGGELPPTKEESSNIDSNKERPEEEPESEITPEQNEEKLLAQKLANKLDIPP
FT                   TTCLFAHPKYNHNFDTIDENIEHMFRQHGLYIPERKYLIDKQGLLEYLGEKIGFGFCIV
FT                   CNYQGKTAEAAREHMQQKRHMRIPYETEDEKLEISKFYDFSSTYDNDVVVDGEDEDEGD
FT                   WEDVSEDDDDDDDDEELPPIERDAIYQHGNELHLPSGAVVGHRSMARYYRQNLAPDREL
FT                   SEGQGTVIAAETRHMLTLKDREELATKKRSWKKEKKMEDLNDRRAAKFINNQPHFRDQL
FT                   LQ"
FT   CDS_pept        complement(1090840..1093497)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04790"
FT                   /product="fungal cell wall GPI anchor synthesis protein
FT                   GPI7, putative"
FT                   /note="Similar to C. albicans GPI7"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44738"
FT                   /db_xref="GOA:B9W7S7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037674"
FT                   /db_xref="InterPro:IPR039527"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S7"
FT                   /inference="similar to AA sequence:UniProt:Q8TGB2"
FT                   /inference="similar to AA sequence:UniProt:Q59LX3"
FT                   /inference="similar to AA sequence:UniProt:P40367"
FT                   /protein_id="CAX44738.1"
FT                   /translation="MSNSLNSRWVVQVSLTVINIIGFLVFLRGFFPSKVVLPGFSSFED
FT                   STKTPFSDQYGNPQFNRFILMVVDAMRSDFCFSERSNFQFLHQLINQGHALPFTAFSNP
FT                   PTVTLPRLKGITTGGTPNFLDAILNVADDQDDSQGLHNQDSWIHQFKHTSNKTINFFGD
FT                   DTWLKLFQNEFTEFEGTNSFFVSDFTEVDNNVTRHLDDQLNSNKWDGLILHYLGLDHIG
FT                   HKGGPESPYMKPKQIEMDRILQRLYSYVTKNDDALIVLIGDHGMNEIGNHGGSSLGETS
FT                   AALSFISPKFNHKGKSPLPYNSDYTYHHKINQIDLVPTLAALLNFPIPRNSLGVIAKEM
FT                   LDIWPENQRVEILYENCAQIMNLYEAKYGASGEVWTQWETLQVKQHPIADYYEFLQDIQ
FT                   SEMASSATNYGYKDIYAGALILVITAVAVVVVFNRYFLTVSNMSIYSVLFYELFVVLYS
FT                   LHFHGSSLIEEEHQIWYFFTTATLLFLAITFFDTFKDLQTFISFGVLFACVRFMRSWNN
FT                   SGQKYSSQYNIAYYLSHSNPNLMWGLIILTYFVLTLCIYSQGSLVPTFAFTFGKRLPDV
FT                   KDPGGLISFIVVFVATSVSFSFKLLQYYIDGNTIPKWLNRFLLWIIESHHIDMAKAALE
FT                   DNELKFQLQGVCIQLSKFTTIILSVLLVSRVIIGKIRKIRYGTITDITNIMTIYLVHQT
FT                   RQENIPMFLALMLAKFALSKLIYRKTNRIDQYILTVTVSVLCLQNLSFFCMGNTNSLAT
FT                   VDLSNAYNGVKAYNVFLVGLLTFVSNFAGPIFWSLSGLQLLYEPSLLNFNGPATTDLLH
FT                   YTGLKKSILLIKSLISLFFYTVSAVNLVGSCINLRFHLFIWTVFSPKLLFFGSWILFVN
FT                   VLIDLILAVTVLLL"
FT   mobile_element  complement(1095089..1101346)
FT                   /mobile_element_type="retrotransposon:kotuku A, Tcd32, LTR"
FT   CDS_pept        complement(1095414..1096712)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04800"
FT                   /product="polyprotein (fragment), putative"
FT                   /note="Similar to C. albicans Tca4 retrotransposon
FT                   polyprotein"
FT                   /note="transposable element"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44739"
FT                   /db_xref="InterPro:IPR039537"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S8"
FT                   /inference="similar to AA sequence:UniProt:Q5AG24"
FT                   /inference="similar to AA sequence:UniProt:Q8TFK0"
FT                   /protein_id="CAX44739.1"
FT                   /translation="MKKIYIALYINNFIGVFSNKTFNHGLFVWKPNSNYIGEISEYLGI
FT                   EFQKNAFGYELHQNKFVKRLIEAFPTEIMKGADLPRTPDNIFKNEKYKIIDDNTGKPLK
FT                   NQKDIPIPDEYIYEDSNSPRLDKEHHDLYRSIVGMLLWLTNNTMPSISYGTNALAAKCH
FT                   EPTENDYKHLMQMIKYLYKNNNERLIMRRNQTKDISEDSHVIYAYSDASFAADLDRHSV
FT                   SGFAIYLNGNLVSWGTKKQRSITKSSMACELIALGETVDRSMIIRQIVQSIGYSAPKII
FT                   IFEDNQPVIMNSYNRKSSAIRRSVDICLKTIRQLILEYKLLSVVYINTKLNVADLLTKA
FT                   VNNNTMKTLKPLLYDKGNLDGVRKLIKDNFTSHRPVEMGQHSLVYNIITPTEEIKESYY
FT                   VAPNNVQSKVESRNNKHPEISGGIARIKRLSMS"
FT   CDS_pept        complement(1097647..1098906)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04810"
FT                   /product="transposon polyprotein (fragment), putative"
FT                   /note="transposable element"
FT                   /note="Similar to C. albicans Tca4 retrotransposon
FT                   polyprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44740"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7S9"
FT                   /inference="similar to AA sequence:UniProt:Q5AG24"
FT                   /inference="similar to AA sequence:UniProt:Q8TFK0"
FT                   /protein_id="CAX44740.1"
FT                   /translation="MNGMVESHNNVVKKQMLYVMLNFPNRYKELLIFFCEIVAYAVFIK
FT                   NHTPSERVETHKGWTPHELFYGRRYRPNYHQLGVDVFVILSNKQEAEALGVQFIKGFHR
FT                   GVPGIFLGYGNDSNVYIIQLVDGNYTRRLFVNVRFLGSMNNINTFLDTFGEKMRKNMDE
FT                   SGNFPFFEDSSRNELLNGRYVPYEDHLPTQGTSSQDVSSDRPTTIEPTATNINMDELIA
FT                   EVPDEFLQNNIAGDFLTQQGFTLPQLQVTGKLLEHQSGQSLAPYNWMSKDNMEYSKMGS
FT                   DHKYLGQNDTENIEPNKNKQVHISEPSFQSSMANKPNESDLGVLPTADGIRHGVPNARG
FT                   ETTQDGTVSSNIDMHQPYSTIPTHRPPPPVGKNVQFSGVNNDSTTLLPSEWGLPPQQHL
FT                   SNGGAYESSPVSNVTTSVRL"
FT   CDS_pept        complement(1099232..1100794)
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_04820"
FT                   /product="transposon polyprotein (fragment), putative"
FT                   /note="transposable element"
FT                   /note="Similar to C. albicans Tca2 retrotransposon
FT                   polyprotein POL98"
FT                   /inference="similar to AA sequence:UniProt:Q59K39"
FT                   /inference="similar to AA sequence:UniProt:Q8TFK0"
FT   CDS_pept        1101874..1103595
FT                   /transl_table=12
FT                   /locus_tag="CD36_04840"
FT                   /product="polyamine/amino-acid GABA-like
FT                   permease/transporter, putative"
FT                   /note="Similar to C. albicans GPT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44742"
FT                   /db_xref="GOA:B9W7T0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T0"
FT                   /inference="similar to AA sequence:UniProt:O74248"
FT                   /inference="similar to AA sequence:UniProt:Q09887"
FT                   /protein_id="CAX44742.1"
FT                   /translation="MNSGIHTPHDIHPVVSQVHVDDMGIASILSNKNITINVDHVIDND
FT                   EAMLLAIGYRQELRREFSLWSIFAVSFSVLGLLPSIAACFDYQQLVVGMSPLPWSIAMI
FT                   FITSVAYSMAEIASAFPCSAGTPYAVSQLAPKKYSSFLTWFTCWTNWSCQITAAPSVSY
FT                   SCACMMLALHSFTDPSFVASNAQIFGLTTGIQVLCAFMACFPTKWVARFSSAGTVCNIV
FT                   FLVIVFVMILGGNKRDQINEGISKFNSNSTAWGLDNQAEWPTGLSFLISFMGVIWAMSG
FT                   YDSPFHLAEECSNAAVAAPRAIVLTSTVGGLIGFMFMIAIAYTLVDLNQISADPQGLGQ
FT                   PFVTYLTQIMDKNLVIGATALTIISSFFMAQNCLLASSRVTYAYARDGLFPLSGIWKKV
FT                   SPKTQTPINAVLMNFIVEELLLLLIFGGDVSIGSIFSIGALAGFISFTMPTLLKITYAR
FT                   KTFQPGPWNLGKLSEPIGWVSVAFVGLMVPILCFPTVRGADLTPTEMNWTCLVYFGLIL
FT                   LTTIWFVVDARRWYVGPRSNISEEDIVYGEKIEDEGDEIPDVIDGQKISISSTEKK"
FT   CDS_pept        1104018..1105142
FT                   /transl_table=12
FT                   /locus_tag="CD36_04850"
FT                   /product="spliceosomal factor U2AF small subunit, putative"
FT                   /note="Similar to C. albicans UAF21"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44743"
FT                   /db_xref="GOA:B9W7T1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T1"
FT                   /inference="similar to AA sequence:UniProt:Q59LX5"
FT                   /inference="similar to AA sequence:UniProt:Q59MA7"
FT                   /inference="similar to AA sequence:UniProt:Q09176"
FT                   /protein_id="CAX44743.1"
FT                   /translation="MNRSSYSSQSDNRYPRSPVVLCSFYSRIGACRHGENCSKKHLKPI
FT                   SSRTILLANLYQNPKLNDDEYRHGNYKGNETLQLTEKEGVTKTTTEGALSQIDDSQHPD
FT                   SSKGLNDETVETQEADTESQENIGENDDVEIKHNEDQKGSENAKESDNIESPKEVERDN
FT                   KPQQGDTLEKVSEDNIKQEENTREKELENVEKDKLPEHPAEFKMSQTQHDFDQFFQDIF
FT                   VHISKFGQISDIAVCENENNHLAGNVYVMFESPEDAYNANLQLNQEWYNGRPVYSELSP
FT                   VSDFNEACCEAYSYYHNCERGAMCNYMHIRLPSRDLEQSLYESQTKSYILKQLEKLKRE
FT                   LPADTKPSASTNDEETNGNEKGISSTMALLEQLS"
FT   CDS_pept        1105346..1106131
FT                   /transl_table=12
FT                   /locus_tag="CD36_04860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44744"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T2"
FT                   /inference="similar to AA sequence:UniProt:Q59LX6"
FT                   /inference="similar to AA sequence:UniProt:P87055"
FT                   /protein_id="CAX44744.1"
FT                   /translation="MTKTSHLIILPCHSIWKSGPNLGETRDEWHLVDFQIEGYDHLAFK
FT                   QQIVTSLQELQQDPESYLIISGGETKLDAGPVSESLSYYLLACKLCQDDSSILSRISTE
FT                   VFARDSFENVIFSICRYYELFETYPEKITVVGFEFKRERFVKHHLQQALLFPETRINYI
FT                   GNSPDPRDLNELEVKKYFDDLSESEFKYAVKHFQNDWYGLSGSLLKKKIARNPFRRYHG
FT                   YSESNPKLSDFLRAIKDDITTSRSNESIRELLLDIAWVE"
FT   CDS_pept        complement(1106286..1107398)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04870"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   tyrosine-inhibited, putative"
FT                   /product="phospho-2-keto-3-deoxyheptonate aldolase,
FT                   putative"
FT                   /product="dahp synthetase, putative"
FT                   /product="3-deoxy-d-arabino-heptulosonate 7-phosphate
FT                   synthase, putative"
FT                   /EC_number="2.5.1.54"
FT                   /note="Similar to S. cerevisiae ARO4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44745"
FT                   /db_xref="GOA:B9W7T3"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T3"
FT                   /inference="similar to AA sequence:UniProt:P79023"
FT                   /inference="similar to AA sequence:UniProt:P32449"
FT                   /protein_id="CAX44745.1"
FT                   /translation="MSKTPVPTEYDDTRILGYDPLVPPALLQHEIKASAESLDVVIKGR
FT                   YESAQILKGNDDRCIVIVGPCSIHDPPQALEYGKRLKKLADELKDDLVVIMRAYLEKPR
FT                   TTVGWKGLINDPDVDNSFDINRGLKISRQLYSDLTSVVGLPIGSEMLDTISPQYFSDFL
FT                   SFGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLAVALDAVQASSKGHHFMGVTKNG
FT                   MAAITTTKGNDCCFIILRGGKKITNYDPESVKAAKEAIAKCSDPNIKLMVDCSHDNSRK
FT                   DYRNQPQVLDSVAEQISNGEDSIIGVMIESNIHEGKQSMPPAGSGKEALKYGVSITDGC
FT                   VSWETTVEMLTKLSQAVQTRRGLKKQKVSN"
FT   CDS_pept        1108192..1109472
FT                   /transl_table=12
FT                   /locus_tag="CD36_04880"
FT                   /product="vacuolar protein transport protein, putative"
FT                   /note="Similar to S. cerevisiae ScYHC3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44746"
FT                   /db_xref="GOA:B9W7T4"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T4"
FT                   /inference="similar to AA sequence:UniProt:Q59LY9"
FT                   /inference="similar to AA sequence:UniProt:Q59LX9"
FT                   /inference="similar to AA sequence:UniProt:P47040"
FT                   /protein_id="CAX44746.1"
FT                   /translation="MFIISETQRTFASFFIFGLLNNILYVIILSAAIDLVGPSTPKAIV
FT                   LLADIIPSFSFKVAAPFFIHAVPYIIRLWTLVALSATGMVLISLSPTNVISWKILGITL
FT                   ASLSSGLGEISFLQLTHYYEENSAIGGFSSGTGGAGLFGSFLFMMLTNVMGFPVWVVLL
FT                   ICAIFPSGFLITYFNLLPLPMHEYQVILQQQQEREEEQEEEEYQQQLHDEAGNQNLESI
FT                   GEVKYSVDYMSRHVQNTVQKIKPLILPYMLPLTTVYISEYVINQGISPTLLFPLKEVPQ
FT                   WLISNYRDIYVVYGFLYQLGVFISRSSVTMGIRIKRLYLLSVLQFVNVIITLCQSIYDS
FT                   PFHSIWWLFLLIFYEGLLGGASYVNTFKSVSEQVSRTKREFSMGCVSISDSLGIVIAGC
FT                   INWSLELKLCHLQVARGRDWCLKGGSI"
FT   CDS_pept        join(1109854..1109946,1110044..1110115)
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_04885"
FT                   /product="conserved hypothetical protein, pseudogene,
FT                   putative"
FT                   /note="rearranged pseudogene"
FT                   /inference="similar to AA sequence:UniProt:Q59LY0"
FT   CDS_pept        1120432..1121769
FT                   /transl_table=12
FT                   /locus_tag="CD36_04890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44748"
FT                   /db_xref="GOA:B9W7T5"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T5"
FT                   /inference="similar to AA sequence:UniProt:Q59LY1"
FT                   /protein_id="CAX44748.1"
FT                   /translation="MTSSSSSSSSTATATTSSARIRLPSISELTSRSSISGGSDRGGDP
FT                   TWKSQISPRLSDTSRILPSILNNTSGSSTPTSSSSPFKYPPLKSTAGGAVTSGNTQSNY
FT                   VLGNTKINSLPRLSSPSLPTKPQPQQQQPQLPPASTLSPVTRIINTPPQQPQSVSASTS
FT                   PNTHYQYYQYQQQSSPIQQQQQQQQQQQQATPAATPTVVHMAQNPPSHPAPLQYATQQY
FT                   YQQPIYYPGTAAVPPPPPPPSATHQGHIIAVHPHPGSISQVGVSGMPPNVGYTIVQPEI
FT                   VNKSTNRCHRCGTTETPEWRRGPKGVRTLCNACGLFHAKLVKRKGAALAAEEVLNNKVT
FT                   KGKNGRRISMKKHLLNESLKQQHQINSVGIHINEFNHQLVPPSFKPQQGGIATLPPLHG
FT                   HYSNNVNNLVIQHPPQPRPPQQQQQQHMLGGGVPVAYPAQIPLIRH"
FT   CDS_pept        complement(1130528..1131727)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44749"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T6"
FT                   /inference="similar to AA sequence:UniProt:Q5A2E4"
FT                   /inference="similar to AA sequence:UniProt:Q5A292"
FT                   /inference="similar to AA sequence:UniProt:P36151"
FT                   /protein_id="CAX44749.1"
FT                   /translation="MLIRRLPIIPTRAIPRISYSQFHTAIVNLNKSTNSGNDHKGHDFA
FT                   FVFDIDGVLIRGKKPILQAKPALEILNSHKIPYILMTNGGGVSERRKAEEVSEINQLNP
FT                   PISPLQIVQSHTPLKALALHHAFNRVLVIGGDGDNARHVAKQYGFQDIIMPIDIVYNNP
FT                   SVSPHHRYTQEEFDKFAQPIDVTKPIEAIFVLNDPRDLNSDMQIVQDLLNSENGLIGTK
FT                   RNIHHIRNLHDPSIPIIFSNNDYVYANDYPLPRFGQGAFRIITERLYKITNGLKKHQHL
FT                   NSLILGKPFKIQYDFAHHVLIDWQNKLINEDFNSEQILPILGSEPTNTPFKKIYMVGDN
FT                   PASDIKGANDHGWESVLLKTGVYRDEDAIDADAAKPTAGVFNNVEDAVTTILESHGIKV
FT                   "
FT   CDS_pept        complement(1132536..1133789)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44750"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T7"
FT                   /inference="similar to AA sequence:UniProt:Q5A2E6"
FT                   /inference="similar to AA sequence:UniProt:Q5A294"
FT                   /inference="similar to AA sequence:UniProt:Q08412"
FT                   /protein_id="CAX44750.1"
FT                   /translation="MTKQSEELNVVSSEPLDSIDDSSEKETTVATADKESSTSEENKQE
FT                   TTEESTKESKSADSTSETKSETKPESKKDRKTVSFKKEIDSTEEVPINEEEQDESVPPP
FT                   QPPRPKDPTQQIIEDMKQAFPNIEEKYIIATLIASQGNPDPAFNALLYISDPTFKPEIP
FT                   VYKPPISTSSTGSIGTGGGGGGRNSKELTDDELLARKLQKEFELEDERNRRNRRRSSHE
FT                   RHRAAEQQRQRHYRNHQGDGDDELDDSPDEFEQIKETFTQGLEEAKSTLNGWVSNIAKR
FT                   FEGNNDGNNPQQRRNDNPKLFGALGGSSFNDNKRKTNRFDEDPEILSNDFHDGIRLQDN
FT                   DDHGPSLPNRFKGELQSDTPTLASREKGPSDKKKWQPLESGVSADPDAFLVTDSEEDGD
FT                   DVATTDATKNTTIGSTKK"
FT   CDS_pept        complement(join(1134958..1135163,1135319..1135346))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04920"
FT                   /product="nadh-ubiquinone oxidoreductase b18 subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44751"
FT                   /db_xref="GOA:B9W7T8"
FT                   /db_xref="InterPro:IPR008698"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T8"
FT                   /inference="similar to AA sequence:UniProt:Q02368"
FT                   /inference="similar to AA sequence:UniProt:Q6BQ95"
FT                   /protein_id="CAX44751.1"
FT                   /translation="MSVTEFPPLLSQDDCQKYKVPLKWRDRCAAYFALYQTCIIRQSAN
FT                   SSVSCKHDKHAWEECENLDLIRRKQELKEASQ"
FT   CDS_pept        complement(join(1136108..1136301,1136421..1136457))
FT                   /transl_table=12
FT                   /locus_tag="CD36_04930"
FT                   /product="nadh-ubiquinone oxidoreductase b18-like subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="spliced gene"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44752"
FT                   /db_xref="GOA:B9W7T9"
FT                   /db_xref="InterPro:IPR008698"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7T9"
FT                   /inference="similar to AA sequence:UniProt:Q6UKY7"
FT                   /inference="similar to AA sequence:UniProt:Q02368"
FT                   /inference="similar to AA sequence:UniProt:Q4WYQ8"
FT                   /inference="similar to AA sequence:UniProt:Q6BQ96"
FT                   /protein_id="CAX44752.1"
FT                   /translation="MAHTENYEYPPIPSQQELDDSNVPFFHRDKCAAHLINYYKCLDKG
FT                   TSFCNKTKDEFYKCQYLALKERLDNHTKQTH"
FT   CDS_pept        complement(1137129..1138046)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44753"
FT                   /db_xref="InterPro:IPR037830"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U0"
FT                   /inference="similar to AA sequence:UniProt:Q5A295"
FT                   /protein_id="CAX44753.1"
FT                   /translation="MAAGLRQMKLHNKRKSNELEDISNIHKKSRTVSFKNQSETKKPIT
FT                   RSNLNRKRTHFVTPPSPPQQRSSPPATCLEDVTPQHQQDNDHDTEQDQQQHHHHVSFPA
FT                   TPPESINDGGSTPIAAATNSNRNDSYNENNNTSSNNDNEYKDAKNKDVQTLSASNGISA
FT                   NNSTGGTYAEVTTSSSTDGETIKQDLNENPDYIALTSSLRMAKITNAKINQDIIELSKL
FT                   QQYYSTNANKEETIQFFLKLINNELNLPKPTKITKCPIINWSKYHPCLSQVNKDFENQL
FT                   RKCDKKEQAKNSLYKALNLFDKLK"
FT   CDS_pept        complement(1139114..1140271)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44754"
FT                   /db_xref="GOA:B9W7U1"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U1"
FT                   /inference="similar to AA sequence:UniProt:Q5A296"
FT                   /inference="similar to AA sequence:UniProt:P53736"
FT                   /protein_id="CAX44754.1"
FT                   /translation="MLVLMSPRLGYHIAKNSNLMLRPISILRFKSSVPSAKQSKNNLPT
FT                   DGVPKKSLPSEGEWKHLKLHIPGENVQTNDLKDRIPKFPLGKENVPTLLPRPGVPQVGK
FT                   NFTFRQVIGILKNKTQPELIYESEPHRLYFLMCFCASIVFAVYGCVLFEWAIWIANKEY
FT                   DENEKEETNEAIRKREWAISLLMYLAPSASLFLLAYGAALFPTKLVRRIWYLPGPVEHI
FT                   KFTSYPFIPGRPTPVYTMPLENLKRKHTTRVWTGKGFYGTADKGFFYFTLLETLPNGKT
FT                   KNWIVDRKGFFWSDGRVFDYLFGKETLQEAEAGVPYDKQFNIINQEMKKKKQQLREKHG
FT                   VFWRYKMAAKEFGKDIKKLGGYITNTKSIDSEKKTANGKQLPKGK"
FT   CDS_pept        complement(1140476..1140913)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04960"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44755"
FT                   /db_xref="GOA:B9W7U2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U2"
FT                   /inference="similar to AA sequence:UniProt:Q5A297"
FT                   /inference="similar to AA sequence:UniProt:Q10355"
FT                   /protein_id="CAX44755.1"
FT                   /translation="MNPPSKVSKSKKVVHTTGRVSAKKAASYLHSMQNSSTTKLTPPAS
FT                   IAAPIWNPKHFRLFVGNLGPDGNDELLKEAFQKYPSMSQVHVPIDRKTTKNKGFGFVAF
FT                   GKSEDYLRAFQEMNGKYIGQHPVQLKRAESSVPKKTKCKRK"
FT   CDS_pept        1141171..1141758
FT                   /transl_table=12
FT                   /locus_tag="CD36_04970"
FT                   /product="DNA-directed RNA polymerase III 25 kDa subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to S. cerevisiae RPC25"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44756"
FT                   /db_xref="GOA:B9W7U3"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U3"
FT                   /inference="similar to AA sequence:UniProt:Q5A298"
FT                   /inference="similar to AA sequence:UniProt:P35718"
FT                   /protein_id="CAX44756.1"
FT                   /translation="MFILSEISDLIRIPPSSFNVPIQHSISDELNKKYANKIIANLGLV
FT                   ITIWDILDIKDGLLKPGDGGSYVEVRFRSIVWKPFRGEILTGWVTECTPKGIKVRMEFF
FT                   DEIWIPKDFLFENCQYSESEQAWIYLLDENELFIDVNERIRFRVEEENFYNVKPKLNDE
FT                   QTEEEKKATTLPPYTITASCQDYGMGCVSWWD"
FT   CDS_pept        complement(1141900..1143234)
FT                   /transl_table=12
FT                   /locus_tag="CD36_04980"
FT                   /product="26S proteasome regulatory subunit 7, putative"
FT                   /product="CIM5 protein, putative"
FT                   /product="TAT-binding homolog 3, putative"
FT                   /note="Similar to C. albicans RPT1"
FT                   /note="Similar to S. cerevisiae RPT1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44757"
FT                   /db_xref="GOA:B9W7U4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035245"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U4"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A0"
FT                   /inference="similar to AA sequence:UniProt:P33299"
FT                   /protein_id="CAX44757.1"
FT                   /translation="MPPKEDWDKYIPPSEEETTEKITPLTEGDIQVLKTYGTAPYADSL
FT                   KEIEKDLKTIEERIKTNQGIKESDTGLAPPHLWDVLGDKQRMSEEQSLQVARCTKIIEA
FT                   SQPQQPTGLQNADTKSKYVINIKQIAKFVVGLGERLSPTDIEEGMRVGVDRHKYEIQLP
FT                   LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFVKLGIDPPKG
FT                   ILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC
FT                   IIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
FT                   ALLRPGRIDRKVEFSLPDLEGRANIFRIHSKTMSVEKDIRWELISRLCPNATGAELRSV
FT                   CTEAGMFAIRARRKVANEKDFLKAVDKVIKGNLKFSSTSQYMQYN"
FT   CDS_pept        complement(1143528..1145444)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05000"
FT                   /product="succinate dehydrogenase (ubiquinone) flavoprotein
FT                   subunit, mitochondrail precursor, putative"
FT                   /product="flavoprotein subunit of mitochondrial complex II,
FT                   putative"
FT                   /EC_number="1.3.5.1"
FT                   /note="Similar to S. cerevisiae SDH1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44758"
FT                   /db_xref="GOA:B9W7U5"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U5"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A1"
FT                   /inference="similar to AA sequence:UniProt:Q5A1E8"
FT                   /inference="similar to AA sequence:UniProt:Q00711"
FT                   /protein_id="CAX44758.1"
FT                   /translation="MFTKRIRQAVQVPNRFFSNSSSVLQTIGRIKGVEANSKKYLQQKY
FT                   VVIDHEYDCVVVGAGGAGLRAAFGLAESGFKTACISKLFPTRSHTVAAQGGINAALGNM
FT                   HKDDWHWHFYDTVKGSDWLGDQDAIHYMTKEAPDSIYELEHFGVPFSRNDEGRIYQRAF
FT                   GGQTKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHDCHFFIEFFAMDLLMQDGECV
FT                   GVIAYNQEDGTIHRFRSHKTVIATGGYGRAYFSCTSAHTCTGDGYAMASRAGLPLQDLE
FT                   FIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPSAKDLACRDVVSRAITME
FT                   INEGRGVGTEKDHMYLQLSHLPASVLKQRLPGISETAHIFAGVDVTKEPIPILPTVHYN
FT                   MGGIPTNWQGEVLKKDHEGKDKVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAV
FT                   SHTIRDNLTPGTSLHASPADLGKTSIENLHRLRTADGTRSTAEIRLDMQKTMQRGCAVF
FT                   RTEETLEKCVNHINDVDKSFADVRTTDRSMIWNSDLVETMELQNLLTCATQTAASALAR
FT                   KESRGSHSREDYPDRDDVNWWKHTLSYQNNVGSEVKLDYRDVIKTTLDTTDCQPIPPAV
FT                   RKY"
FT   CDS_pept        complement(1146004..1146723)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05010"
FT                   /product="mitochondrial DNA repair/recombination machinery
FT                   subunit, putative"
FT                   /note="Similar to C. albicans MHR1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44759"
FT                   /db_xref="InterPro:IPR024629"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U6"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A2"
FT                   /inference="similar to AA sequence:UniProt:Q06630"
FT                   /protein_id="CAX44759.1"
FT                   /translation="MAMRTRAEKRMRKFLIEQLKTRKQHGARIAQGKKSEHELIKNNLG
FT                   PQVFLFRNLFSGQVLYSQVPAYHENQINQQFLSPNWQNRKPSRRQDLWKIMCVVNFDNY
FT                   EYAIAAYKGLVDLRKTRDVVQKKEANEMRKKNDEGNIWYSGQFRPTYTQEAVADLTHVI
FT                   DEFELEGTKIFWANEWHRGEDKHWRADLVEHDKLPVYDPRHQTVLLDIMREKAVEAFRE
FT                   NNTSEKTIDHAAEPETA"
FT   CDS_pept        1147011..1148759
FT                   /transl_table=12
FT                   /locus_tag="CD36_05020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44760"
FT                   /db_xref="GOA:B9W7U7"
FT                   /db_xref="InterPro:IPR015672"
FT                   /db_xref="InterPro:IPR022535"
FT                   /db_xref="InterPro:IPR025969"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U7"
FT                   /inference="similar to AA sequence:UniProt:P38799"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A3"
FT                   /inference="similar to AA sequence:UniProt:Q6BQ82"
FT                   /protein_id="CAX44760.1"
FT                   /translation="MSVILSVVPYFAIVSGLGIWAYRLIYHNNLIQKYSTYLHIPKVQI
FT                   NEYIDKNLKHLNLIRVKIDSSDEVNDDKPSTLHNSKVNMLNRIIGVVFSVTLSLSVGLI
FT                   LLILLELGDFLDADSRLGLFKITINTLIFLLVSVVPIFIISLLAIQDILPKTLPSAGLV
FT                   SLLYAVWLLVLHKCGDLTQSFNPRDSVSRHVVEKVINEVSIVGITILAILSGVGSISTP
FT                   YKIFEKYKGLESESKDVSQMDINSAIQYFNNTSSLIAKRKSELNKLQVAAGGTVYNLPN
FT                   DSHMMLKSSKKLSLLHKVQSFANISKYDSEENELVKEIESLESLKNTLYDDLVKLISKY
FT                   TLQNDQYNVSLERLLHWGNLSLAIYCVYRIINVFLVKLPLLIFYGEDYYSVSSTVIDSN
FT                   EEAPSSKDALAITLSKVILSVFRNLPVSEAQLVNQLSFILSASLFVCSFSNVLTTFKSF
FT                   SRFFPGHSSSETTKNWLKHLIVAELVGVYVIATALLIRTNLPATLSNQISKILSLSGSA
FT                   ARTPNASIEEVVFIDNWFDKIFAITCVITSMVIFMKRLLDEDRLNIDSSSYDEESFIED
FT                   SGLKLA"
FT   CDS_pept        1149047..1151005
FT                   /transl_table=12
FT                   /locus_tag="CD36_05030"
FT                   /product="glycyl-tRNA synthetase, putative"
FT                   /product="glycyl-tRNA ligase, putative"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to S. cerevisiae GRS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44761"
FT                   /db_xref="GOA:B9W7U8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U8"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A5"
FT                   /inference="similar to AA sequence:UniProt:P38088"
FT                   /protein_id="CAX44761.1"
FT                   /translation="MSASRTNIPFSRDSLEQTLKRRFFFAPSFEIYGGVAGLFDFGPPG
FT                   CAFQNNVIDAWRKHFILEEDMLEVEATMLTPHDVLKTSGHVDRFSDWMCKDLKTGEIFR
FT                   ADHLVEEVLESRLKGDKLARGVKIVEDEDEDKKKRKKKVKEIKNVKLDDEVVKEYESIL
FT                   AQIDGFSGPQLGGLIDKYNITNPSTGGKLEPPVEFNLMFGTAIGPSGNLKGYLRPETAQ
FT                   GQFLNFNKLLEFNNDKMPFASASIGKSFRNEIAPRAGLLRVREFLMAEIEHYVDPESKS
FT                   HPKFEDVKDIKLKFLPKNVQESGSTELIEESVDKAVSTGMVDNETLGYFIARIYLFLVK
FT                   IGVDPNRLRFRQHMSNEMAHYASDCWDAELETSYGWIECVGCADRSAYDLSVHSARTGE
FT                   KLVARETLAEPRTVENFEIEIAKKKFGPKFRKDAGTVEKWLTSRTQCELEDMGKELNEK
FT                   GKIVAQIKDVEGDVELDGDLIKIDKVKRTEHVREFVPNVIEPSFGIGRILYSIFEHQFW
FT                   CRPDDADRGVLSLPPIVAPTKVLLVPLSNNSELQPIVKKVSQALRKEKIPFKVDDSSAS
FT                   IGKRYARNDELGTPFGITIDFDSVKDDSVTLRERDSTKQVRGSIQEIVEAIKDITYNDG
FT                   TWKEGTAKLKPFEGQSA"
FT   CDS_pept        complement(1151195..1153303)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05040"
FT                   /product="saccharolysin, putative"
FT                   /product="protease D, putative"
FT                   /product="proteinase yscD, putative"
FT                   /product="oligopeptidase YSCD, putative"
FT                   /note="Similar to C. albicans PRD1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44762"
FT                   /db_xref="GOA:B9W7U9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR024080"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7U9"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A7"
FT                   /inference="similar to AA sequence:UniProt:P25375"
FT                   /protein_id="CAX44762.1"
FT                   /translation="MHFSYFIVILLSYIAYRIYHSNMSIDFQTIVQDQSYPLWNQSPEE
FT                   VLEIANAIAASETKLFNEIAAITDPSIANVLKPFATHYDENSFPEGQSTFYQHVSTNKE
FT                   LRDASTKGEEIMDNNSIEQWSRADVYQVFQKLYDSVKNDSSLDPESKRYLEKTLVSFKR
FT                   NGLALPEETREKVKKLQVELNNLRVKFSKNLNEDKGFVLFSKEELEGIPEDTLNQYEKV
FT                   DGKFKVTFKYPDIFPIFKHASNSNTRKTANIAYGNRCAENGPILDQIIKIRFQIAKLLG
FT                   YDTFSDYVLEERLAKKKDTVLNFLADLRTKLTPIAEEELKVLKEFKKKDLQTRRLEPEE
FT                   TFYSWDYNYYNERLLEQKYKVDHVKIAEYFPLEPTVAKMLGFYEKIFDIKFVKIEKKEP
FT                   ASVWHEDVQQYAIYQNVKTKSKELEFMGWIYFDLHPREGKYGHAANFGLGPGYLEKDGK
FT                   TRHTPITVLVCNFTKPSKDKPSLLKHDEVTTFFHELGHGIHNILSKTKYSRFHGTNVER
FT                   DFVETPSQMLEYWTWSKNELKELSSHYETGEPISDELIDQLISTKHVNSGLFNLRQLFF
FT                   GIFDMQLHTIANQKDLDTLDIFKVWNDLREEVTLLPSGGNTTKGYASFGHIAGGYESGY
FT                   YGYLYSLVYATDIYYTLFKDDPMNVENGIRYRDIILKPGGSKEIMDNLVELLGREPNSE
FT                   AFFHEIFG"
FT   tRNA            1153902..1153994
FT                   /gene="tRNA-Pro (TGG)"
FT                   /locus_tag="CD36_tRNA_0010"
FT                   /product="transfer RNA-Pro (TGG)"
FT                   /anticodon="(pos:1153934..1153936,aa:Pro)"
FT   CDS_pept        complement(1154093..1155835)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05050"
FT                   /product="beta-glucan synthesis-associated protein KRE11
FT                   (killer toxin-resistance protein 11), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44763"
FT                   /db_xref="GOA:B9W7V0"
FT                   /db_xref="InterPro:IPR024662"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V0"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A8"
FT                   /inference="similar to AA sequence:UniProt:Q5A2G0"
FT                   /inference="similar to AA sequence:UniProt:P32893"
FT                   /protein_id="CAX44763.1"
FT                   /translation="MSLRIILPLDLLEISGLTPNNLRGYLDNCPVRDIVFFDESVSGFV
FT                   VYEGSLDQETSFVQCEVAILQLNNVDERDPLNCVNSENKISLTLGKEELVYDNDLVHIW
FT                   KFEIPVTYPRKRLNSPQMCISCSLVNENNESLVVENESFSEEILDNYIPCMRRNLLAEL
FT                   DHQLDFIDISNGVLETGISVQENSIIEKPSVRAFISVPVTISLVIKLKSTKPAGRNGML
FT                   LATFNIETSEEFAKVANNKDYYFDIMDMEVEFKSGSVQPINSIIPIRIQHTDSVNLAYK
FT                   FNNYEIDFKETTSSRPINISLTLRVQESADGVYRNVSNIIQTEWSPYLDFGLIAPPINN
FT                   ALKTTNNAMQSQSQPSIPISSIRHKALMSNLYKLKGASLSNANSISSSTTNLRRNRVSL
FT                   ANPSGRTSSVTVNLTMGNNSSLTGLRLTFVGKLDIKLGEVVNWKIQAINNSMSRLNLSL
FT                   LVQNPINFNPVYSGANITTNNFSSSNLLNNSGGIPNNDVIIYNRVQLYSLYNSLKVNGD
FT                   GEGILILNNDIRMGPLDPNAVFETEIQLIGVSKGIFNLDGVKVFDMSSGDGIDFGKLVE
FT                   VFVI"
FT   CDS_pept        complement(1156095..1157471)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05060"
FT                   /product="genome integrity and telomere function protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44764"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V1"
FT                   /inference="similar to AA sequence:UniProt:Q5A2A9"
FT                   /inference="similar to AA sequence:UniProt:Q06640"
FT                   /inference="similar to AA sequence:UniProt:O14235"
FT                   /protein_id="CAX44764.1"
FT                   /translation="MANKRRPKKTRAPYRRYVYKSNNYLAGSDEDEEFEDETEQSETTL
FT                   HTTNNARFKRAINVQSIYVLSDQIRYQGKMWPWSKFEKVDILQCALQGHNPSYAHNGPE
FT                   DEPTQGVMKFPAEIFVHIFEILDAWGKLKPKYMRVCKLFYLLILPILYRQPQLKATNFF
FT                   NFVEAISSNKSLGQYIHALDLSYIIQSGKNAFVSKLMKRAGKNLEILVAPQTSFGLGPL
FT                   IALKNCSNLKVLDLRLVSETLNLEELFKSIRNLTELTQLSFPRSSVEIHDYQSINWPPK
FT                   LTFLRLSGGISDDFLYQFEFPPSITQLEFAHCPSISDLGFRQILYRIGANLKTLKVQYP
FT                   MPGLKKNSLDQVFSYCPNLRVLEVSVDYVSSMFFDEQYLGYMDYPRPLRTLYINSSGML
FT                   GTSTRLDPIDLAVALNDGRLPYLKHIQCTAKLGWDPSSDALGYIADELDERKGGIYIGY
FT                   "
FT   CDS_pept        complement(1157750..1160077)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05070"
FT                   /product="zinc cluster transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44765"
FT                   /db_xref="GOA:B9W7V2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V2"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B0"
FT                   /protein_id="CAX44765.1"
FT                   /translation="MSQKVKREKTTKVRKHVSSACLECRRRHFKCDGKQPVCDRCQKSN
FT                   KPCQYVASHRGGSRKKGVSTKKKPVTVNDINQGPEMPMFVADIEDFGKSKSTDESTNNR
FT                   NEIKSNDDMFEKLMTLPCAHDQGRCQDSNCPGKSGVRYVKTRPEKRGQLNESEVQMMET
FT                   LRKRIKLESTMNNIDCLFNDNNPPIDIRSFKELEMTTAVHDSSNYVDLTVLDKDETLKN
FT                   YYETFHKAHPILPTREEMLIYMSNQSVEKELLPILSIVGDGETSSVYARAIDLISDRLI
FT                   QCVEVVKSFGYIDIISLQVLTLVSFVAHVSSLHALSKNLRHFCIYLLQDLQINFLDAPS
FT                   KHGSNDMTPESETNAPLKVFNSPRLSHVPRDSIVQCARRLFWELHFVDIITGSADGKTV
FT                   SSFDKIESFVDFPTVPSRDEFDYKGRSEAGTLVTNAVKMNIEISNKRPYDILLTRLQAS
FT                   LSSWEMRLEDPSLFEAPPLIDKSGKVNEGVHQAILLFNYAKIFVHRPFSYLWKINSPQH
FT                   PKCNGDSVDSTDVPPQLQANSRTTIETRKTIEGANSIIQVLMDTGASKVFQRTHFFACA
FT                   LALSSLVHLSAYIWVETTLAVDKTQAFGLNEEDLDVYTEYIKLALTAIYPISKHWQLSG
FT                   KLAKHIRDSLTTLRPKLYSKLKDFLPQLEIGMEKMKIREGESTGEDSTRSSVLPINAMS
FT                   SSTTTTNNESMQNPDYNNSTLLNRQSALDINGGTIPGDNINGSYDFENLSWEPVSPISP
FT                   SGCDWIDKGLLDFNFDSFPSTL"
FT   CDS_pept        1160955..1161614
FT                   /transl_table=12
FT                   /locus_tag="CD36_05080"
FT                   /product="YPT-like, Rab5-family GTPAse, putative"
FT                   /note="Similar to C. albicans YPT522"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44766"
FT                   /db_xref="GOA:B9W7V3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V3"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B1"
FT                   /inference="similar to AA sequence:UniProt:Q9C1Z3"
FT                   /inference="similar to AA sequence:UniProt:P36017"
FT                   /protein_id="CAX44766.1"
FT                   /translation="MSETSNPSLLPPPYKIVLLGDSSVGKTSLVHRFTTNRFDMHTPNT
FT                   IGAAFITKEFSPHENHERKVKLEIWDTAGQERYRSLTPMYYRNARVALVSFDLSKFEST
FT                   FNTAKYWIQQLELNNSSDSREKIEIRLIGTKRDLVEIIDENTKDQINKLITEQSNVVKF
FT                   HETSSKEGTGVESLFDDIVNDIDETFFTQYYEQNRDTSDQIGNMLRTRQTSNSYCC"
FT   CDS_pept        complement(1161648..1163468)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05090"
FT                   /product="topoisomerase 1-related protein TRF4, putative"
FT                   /note="Similar to C. albicans TRF4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44767"
FT                   /db_xref="GOA:B9W7V4"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V4"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B2"
FT                   /inference="similar to AA sequence:UniProt:P53632"
FT                   /protein_id="CAX44767.1"
FT                   /translation="MGAKRKRENLNGKPRSKKQKKNSLPIKVDNASLLENKFETLQNHL
FT                   DEESDSELIYDYDRKKSEELTDEVVLIDSDDEFNKSSVGSDNDNSESEEKHAIVDKEET
FT                   PENELANNEDFIGFGFSSEDESEEFLDSEDDSSYKNEGDYANGGTPNSHYPWVKDHDHS
FT                   KQKEIADWLTLEMKDFVNYISPSSEEIVTRNNVISTLKTEIGMFWPGTETHVFGSCATD
FT                   LYLPGSDIDMVVVSETGDYENRSRLYQLSTFLRTKKLAKNVEVIASAKVPIIKFVDPIS
FT                   ELHIDVSFERTNGLDAAKRIRRWLISTPGLRELVLVIKQFLRSRRLNNVHVGGLGGYAT
FT                   IIMCYHFLRLHPKLSTSSMDALDNLGVLLIEFFELYGRNFSYDDLIISLDSDTEEPRYE
FT                   KKANHPILNTSRNTFSIVIRDPADTTNNITRSSYNLRDLKKAFGGAYQLLVEKCYQLNA
FT                   ASYKQRLGQSILGDIIKYKGKERDFNDDRHKVVNHALINHEEETDDESDGLDGNDKYYF
FT                   SDMTVESNEDEYVPPKKRATPVTNKAKDTKKLVESFLSLEDNSDADESLAKDNAGGIEE
FT                   EPYIPKLKKVKSNLDKDIKRDYWRQKGLDL"
FT   CDS_pept        complement(1163711..1165897)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05100"
FT                   /product="protein kinase, putative"
FT                   /note="deleted EC_number 2.7.1.37"
FT                   /note="Similar to S. cerevisiae IKS1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44768"
FT                   /db_xref="GOA:B9W7V5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V5"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B3"
FT                   /inference="similar to AA sequence:UniProt:P47042"
FT                   /protein_id="CAX44768.1"
FT                   /translation="MSIIPYNNNKDVLYHNPNDGIMVVHDPHKNTIKLLSTVASETQRE
FT                   SNESKQTRRPSRVFNNDQFPHNTSMTKCPNCGFTWNEFSNARSRRSSSHSSSGHFNISL
FT                   PQEYLSQSFIHTDYFKLIGKLPYSEEHTCKSTLNNSLPEGVFNQGYFKRFFKKIDPYTL
FT                   GSGAHAQVYKVNHVLNNIVLGTYAVKKINIGGQLEFLQQVLNEVLILYELSTTGANENN
FT                   LIRYNHVWLEMGELDDSNSIFFQTPKSADRKEIKVPYVFILQQYCDGGHLEDLIKRNFT
FT                   IKENLTWKEKVELERKKRRAVKLGDETIPKGKQWLSTFEIWKFFHDVANGVNYLHHNGI
FT                   LHRDMKPSNCLLDVKYVSQEIKSTFESQEDFEQHLYKLPRVLVSDFGEGKFIEKRQNIN
FT                   LENLSDRQGNTGTLEFTAPELWLYACDPKFGNDGKKFYNDFTYESDIYSLGLILCYLCI
FT                   GKLPFSDIIRDENDPQEARTKIMNWYNNLRFASFSEWFESQIHDREGVMDECMADFQKL
FT                   AYKMIKGEDEVVVVGGGSTTSRIGSKDVLLYLNNIKWERFINTGHTFTSSDSRSINNEL
FT                   AIIEKDDRDLYSFNKDYVPSLLQNEEFSDDDDIEYEGQHDFDHINLTEDEFEDDLSRSY
FT                   HESADPVKSDFFQIDTFKTVPIYCIELVLLEYLSFYSPSFSKSTLKLCIFSSIGLDIFV
FT                   IERTKLRTMLFLLLSIVLSILLAYELGHSNPYIV"
FT   CDS_pept        complement(1166157..1170830)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44769"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022031"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V6"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B4"
FT                   /protein_id="CAX44769.1"
FT                   /translation="MPPKRKKLSKETKLASLSKKQSSTVTKRRRSARKLAQENKNNCSP
FT                   TQKIVDDIDVDNRSSEEITGSLNSSPIKQMAKRLNNSTPTKNIISSSPIKTKKSVAFSD
FT                   DLISDIPSTPERVHSPGRSILKSCNPELQNRLVDPSNTLLWRKANDNVSYGPKNTDFWL
FT                   QGTIVQLPPNSPDLYYLIEGCITVLRDVSFDKRFEVYATLNGVYKTNSGPSAVKLFSSI
FT                   LENSGSVSPRKSRSTPSPLKNYSPTKKQRENSYVALLAGQIIKDIEATEDSLFNDNKDK
FT                   ENRTPTKNDPFRIRIVNQATKLMSYFILDQELNKLISLQNVDWLYHHACAMLTHPKASK
FT                   AIISAYLVIMKECRLSVKKKKALFETGDLAEKMLFALINMKRFPSSSLVSEQFLCFKNF
FT                   VNLFPGIMAKNVSHWFGMLLLSVCEVGSPFYLKCFSVGVHCLLEVTKAFLDNRKVMAYV
FT                   KLFLSSPFSINIKSMSSSESIAINSDSSDSQNQKVVDVVLSKLQDLIQDGQFKEAMDIW
FT                   VALTVLVGYSGESFERWEHLSKWLQITKLCFNSQVPQARVLALSCWKAIIFNLCRNDLD
FT                   EIRKTLDSAMGHSNIRDKQQQITTAMKPKVKLLTYLFGSFNAEEMEDKVIDTLHNLFIA
FT                   ILYSTINPLVIKSRTKYLHILWDRVFQFVFINFYFKKDASNAHMNQLGFTVLSKLIKSA
FT                   TPVTERNFNEVRCLSNDPVSINEVNSLPSRWIHAKFDKIMQNMILIFLSANLHVEDKIG
FT                   FFIAFLASIKPIVKNEASVSPTTFDIIDNIPIVLSHLFKSNTLSHDLAIKLIVNLHDTF
FT                   TSSLLVRRANKQDEIDTSNNIYIPVLANCLKSLSKEEYLEIFQLITQSLSHKKILVFIA
FT                   DYVQSGLEMEDVRGLFSDILTKRTVELSNEELGLYGEICQYFDTGFETFVKKLIQTVVV
FT                   VPESEKMLNCFECLNITSWSYSIVVFLLLLLKNAPNRHIFQFTINLIEKMMTSNFVETL
FT                   ELLTIQDFEAEILPLVDQIYRNSLQYSGETLFKICSLLKNYLEYKLKNSDNHELVDRLL
FT                   LGCYSVLGIDVGTFIQEDYSKFPNFKTELDKRNMCVVDGKIVFNGLEKSQESDEKSSQE
FT                   LDASVPPGPDNSLKLQVDSNIQKEEDISKNNEFDQNCMSESLSAASSALILDVDTVNTI
FT                   DENAINRLSSDVIPRETKQVSKQDCEVNDIIMTDTEGPKDESGVSSLAKCESDIQNTER
FT                   GFGLIVKLTPVKKKSASQTMSPKQELIVKIVRKKPEEQAQDSSSSAKDDDEISDIETSS
FT                   ISQGNSNDIIEQQEIISPETPNGVLVRKRDYQEESFTPSKRLKVCDIANLLDGGLEATE
FT                   TQSNVNEKLLPSGDENDLENKQEELKISNCDVDLTEQQGESAQVDSCDLSDTSHDSSES
FT                   KARTEHIVNTDGEENYENDGSAPTKELDAEGNSLSDLKIFDIPALSETNSDSNENATEE
FT                   QEKNNEEPQSKIQEFPSYSLPLKEFEEIRSKKDLADDLYNSVGPSSNEIKRSCSPMELV
FT                   DLLSTKSDAELACITSDEKYDMETKLLNLMVRLRRFK"
FT   CDS_pept        complement(1171227..1173290)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44770"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V7"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B5"
FT                   /protein_id="CAX44770.1"
FT                   /translation="MVNGNLNECIQSLSGIVQATIEKVLQDNDKNFLFEIPDDSLFNNG
FT                   NIQFKNLLENIDLDYKVSSNDNATDQVKSQVEIYNDNVDNKCKEFVVSSTFLNVINARV
FT                   QAFVESNMADKTDFFNAISLILDFEVSLFLNVDPILKQVFYDSISKITKLLFPISTAII
FT                   ETFWSSLETRVPIILNKLYKNTPSERMALLEMCNYLTDNLIVKNKEGQRDSYKKDSFND
FT                   RFQARVRFFIAGILNFEDNTGLNKYFHVSNRASSSIQTKDPYLEDLLEIQRLFNNPLQY
FT                   LKRENQKKLRVLAGKVAQVTKELLIQEKIFRASHPSWDQFLISPPKSKAERDYLIEKFS
FT                   KSSYVPENYFLSLFPKSDRKQQAQDAEMLDGIMRKPVARMQCIQSIYIVAHFFSELSLK
FT                   NKNQFLNSIHAPPTIKHFVDGVSPDDVVSSFASVKKDIMHTLRAIDSHWLFLLQHLTLS
FT                   EKNWWSWLTYGKESKTNKSFFFDKNLTLDDIHNVENTFKSMYPYKDKKYFNTFVTPQVT
FT                   RKMKIQRGLSQIQGADVFSINDSKFEIDSIDNELSQTTDANNRNELLEKKSLLTWRVLR
FT                   EQRSSDWLKATQALRAQAVLDQEMKADSDRQEVDSQDDAKSQKRSSIDSEEKELPVTKR
FT                   IRLDEQNIGENSGNEPEENSQNLEINEAIDSNKDSNGENHDAVDVDIKDHDM"
FT   CDS_pept        complement(1173503..1174096)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44771"
FT                   /db_xref="GOA:B9W7V8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V8"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B6"
FT                   /protein_id="CAX44771.1"
FT                   /translation="MFRIINTCNGIKSFLPNQILKVYPYHSKFYSTNESFSKDEIEKSK
FT                   KWLESFAHTQIPTHLFDISYSRSSGPGGQKVNKTSSKATVSLESGLWLDPRICYWIPQP
FT                   IQAQLKSKGIRYETKGGGLLIQSDTSRNREHNTELCFQRLVEEIKSKVYFASETSQEDK
FT                   EKWQELEEDYKERKKFNKKKQSDKKKNRSKKFDW"
FT   CDS_pept        complement(1174288..1174842)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05140"
FT                   /product="peroxiredoxin PRDX5, putative"
FT                   /note="Similar to C. albicans AHP12"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44772"
FT                   /db_xref="GOA:B9W7V9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7V9"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B7"
FT                   /inference="similar to AA sequence:UniProt:Q5A2G9"
FT                   /protein_id="CAX44772.1"
FT                   /translation="MFAFTRTVPRSQLSLAVRNSLRTYVSIGDKVPATPVFEGSPGNDV
FT                   NLAEETATGKTILIGVPGAFSPACSSSHVPGYIKNIRAFNDKGYQRFFVVAVNDPFVTK
FT                   AWGEQLLESVAGQQIRFFADSTGAFTKELDLLFDARKAFGNERSKRYALIIEDGKVVKS
FT                   FVEPDNTSVDVSAAQKVLEEA"
FT   CDS_pept        1175054..1175611
FT                   /transl_table=12
FT                   /locus_tag="CD36_05150"
FT                   /product="mRNA decapping enzyme Dcp1, putative"
FT                   /note="Similar to C. albicans DCP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44773"
FT                   /db_xref="GOA:B9W7W0"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W0"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B8"
FT                   /inference="similar to AA sequence:UniProt:Q53QH1"
FT                   /protein_id="CAX44773.1"
FT                   /translation="MGSKVKDTSDIKQEQITRDEALRLYTNALNFNVISRYDPAIKQLL
FT                   CNTSHCVLYNFNDETEEWVKSDFQGTLALYIRDFKVPPTATVPSYRDLQNLFCYGLILL
FT                   NRNNPECFSLGLLPNKISSQFFPNGLDNSSVSEMDVELNDNLIIIRNLLGEIYGLWVFN
FT                   ESDRIKLFKSIEFCLNTETNIN"
FT   CDS_pept        1175991..1178195
FT                   /transl_table=12
FT                   /locus_tag="CD36_05160"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44774"
FT                   /db_xref="GOA:B9W7W1"
FT                   /db_xref="InterPro:IPR021950"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W1"
FT                   /inference="similar to AA sequence:UniProt:Q5A2H1"
FT                   /inference="similar to AA sequence:UniProt:Q5A2B9"
FT                   /protein_id="CAX44774.1"
FT                   /translation="MIKSEVSSGAASTTVGNLAHNGASLSAKNQDGKQNLIRQQQHQQQ
FT                   LQQQQQLKHRAALQNYHFASTSEEILKKYSKYPASMSLHIFETHYRFNNSQDSQVIPKD
FT                   SPMIKDFMKHVLKEEIPVEMCELIKDFAIRPYDGCIILQVYDHRNMIKTAVLQNRSTLS
FT                   PSKDQDKKQQMAVSKPRTYRTLLRPTSLSIYYDLLYHTDSALHRFTDYLSLQMESEILT
FT                   ATNRELNLSVPLNPYNYDHLRPEPELSGDESHDIGNEIDEVKFQHRDAIEQPRRKIHQD
FT                   EMVLHKSSEYEELMLLLSNKPKRPDDCSDKRLVVVSTSALPSSSTTGASSTSTVTAAAT
FT                   PTPTSTTASAASQSSKQTTADGVSSADTKTKKGDKANGAGTNQTAASPTSVHPPITTIP
FT                   QNSVRATGQFMRLRLIEEIRKKREIEKLQQEAKIQAQANAIQGESVQPSQQLVPQNSMN
FT                   SPVSVEQTKRPSPATQNQPAPKRAKKETKKQLQAKAQAKAQAQAQAQAKAQTETQSPVP
FT                   IQGQNSVSAASSLNGSNVTNTANTPTMNNQNTLQQPSQPQQPQIGSLNNNQQSQQQKTP
FT                   QQTLQQQQQQQIFQNSLTPEEQKVYKQIQQNMATLAMMGQSGVTPTGQKLTPQQKQQAI
FT                   QQAKNLQQQLFQRFPLYFQRMKQLQLIHQKRRLQQQQQASNAANSSGSNQNSTLNQASP
FT                   QTQQFNQASPSTTEQPKPVASSPEVKKKRTYQKKKNAPTN"
FT   CDS_pept        complement(1178718..1180439)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44775"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W2"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C2"
FT                   /inference="similar to AA sequence:UniProt:Q5A2H4"
FT                   /protein_id="CAX44775.1"
FT                   /translation="MYNSKLKQETFKKTARINDSSFISYCPLSSDERIVPFINGQSVSI
FT                   KRASDRQEGRFAKLTNLYFRNNHLSKEHAKIRYDREQGFYIQDANSTFGTVLNNEKVLI
FT                   PGVEHSLNTNDTVGLIMSKTSSQIKKITEEFISANSTDKDIRSIPISEFDNPTIVINFR
FT                   IDIKDSILKLIPIERGGDQVANYTKADKEPVLVASTDSTDRVNEIPDDSESSSDEVEVV
FT                   DIGIVSNTVTENDNSCLNGHNSDDEIIVIDVSDEDSEDHLVSEKPSHLEDNEITKSDHL
FT                   KNTETQGSSVGALSPTDRIESPVSKMIVEVPSSEHEADDSGINVNTKRNWKGNNSNEIS
FT                   HNCSSGEFSESEISNISSSDDFSDSDIVDEIKNRQDEISILCDESESTKGEFGEYDQSD
FT                   GDNNDRRSNEQLDTFCYKSRKDDHDSKYYSLLEKCDHDHSDFESESDVESTLFGSNCDK
FT                   IDNIEIPEDNKLVRTGSQEFGDDYDETMSLDQSSSGCSSRKRRYEEIDNLEDLEHHTSI
FT                   EYSDCESTNQPPRKKHASTESKWKTFTKEVGKGLFYVFATIVALGVYGSSIANEES"
FT   CDS_pept        1181484..1185764
FT                   /transl_table=12
FT                   /locus_tag="CD36_05180"
FT                   /product="WD-repeat MIP1-like developmental modulator,
FT                   putative"
FT                   /note="Similar to S. pombe MIP1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44776"
FT                   /db_xref="GOA:B9W7W3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W3"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C3"
FT                   /inference="similar to AA sequence:UniProt:P87141"
FT                   /protein_id="CAX44776.1"
FT                   /translation="MSTSQELYTSLGRRPPQQPLNDKMRHGFEVDYNSEKFLNSLANTF
FT                   YIYFDDKRQNTNGNPLTEEMKQSAELFKNYQPISDWKVMKERQKTINAILVLCLNLGVA
FT                   PPDVMKPSPCARFESWCDPSTFNDTKKAIENIGKNLQTQYENISSKTRYRQSLDPCVED
FT                   VKRFCNTQRRNAKDERILFHYNGHGVPKPTASGEIWVFNRNYTQYIPISLYDLQTWLGA
FT                   PVIFVYDCNSAGNIVHNFKKFVQKRIDDDNDGNHDQSAPSPTSAYLDCIQLAACKSNEL
FT                   LPMSPDLPADLFTCCLTSPIDISIRWFIIQSSLKKGYYDALPRNSIGNIIIPGNLNDRR
FT                   TPLGELNWIFTAITDTIAWTSLTRPIFKRLFRQDLMVAALFRNFLLAKRIMPHLNCNPI
FT                   SDPPLPDAVRFHPIWDSWDLAIDQVLSRLLKSAKETTTLPLAGNNQNGGAAKGDSVSSV
FT                   QQQANGSQTTALFPNLGNVQYTTFFEQQLTAFEIWLKFEGPSSKTPPEQLPIVLQVLLS
FT                   QVHRLRALILLSQFLDLGPWAVYLSLSIGIFPYVLRLLQSPAQELKPVLIFIWARIMAV
FT                   DYKGTQQELCKDKGYNYFYSILNSPPINHVGVNGNAIVSSGAMLINDDHKAMSAFILTL
FT                   FIKDFKNGQRLCFSSEIVTNCLKFIQTSDNPLLRQWCNLLLSQLWNRYPEGKWVIYKNN
FT                   YITKLLNLIDDPIPEVRTSILVALTTYLSDPPHLASQQPPNPVAVNTNDLRKDEIRQQD
FT                   LKLANAVLGLLGDGSPIVRKELVYFINKFVQTYAKFFLVVAFNQLQEEIVLIENPNYLN
FT                   DFRKRSPAYGSIFSSVWKALLILSEDPHCEVKQLAETLIDYVMVQLNESELSSLVKEMQ
FT                   DYLLSKSTINISESFKPTKPVVNRQLGENRLSSSASVGNRRNTLLIDGSSLTTRSASAN
FT                   NISSNHTKGNMDDSDAESITSRIKSLSVSKLFKSFHITEENDMNSFTRILNPGPVQSNY
FT                   GSEYIPKTAFFKKRDLSKAPELPIESGFFEYSCEYFQEPQMSRNEIDEPGSKEYVKRLW
FT                   RRNRNESIIQETQPQKEMALRGEWNKDIQILNNITQPKCIKFTQFEKILVASDEKDNMT
FT                   VWDWGNGQVVKKFSNGNPFGTKITDIKFLNEDDLPLLLTGSSDGVIKIYKNFHNYENSN
FT                   SSDKDEDGFDEEKRVELVTGWRALTDLLLTSKSTGLVSEWQQSRGSLLVSGDVKIIRIW
FT                   DAPRELCLSDIPARSSSSITSLTSDQVAGDIFIAGFDDGSIRVYDTRLDSRESMVMTWK
FT                   PTKQHPGLQQSNYTGLGSIRNVHMQRGGFRELISGSSDGIVNIWDLRLHDPVMTYATPN
FT                   KSMRTMDVHEHAPILMTGLKTVDIWSTAGECLTTLNNPNGFSGRSLNYLSSTTFHPHRM
FT                   MLATNYNQNGHINLYTCNDTVVEY"
FT   CDS_pept        1186612..1187661
FT                   /transl_table=12
FT                   /locus_tag="CD36_05190"
FT                   /product="mitochondrail carrier protein, putative"
FT                   /note="Similar to C. albicans MTM1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44777"
FT                   /db_xref="GOA:B9W7W4"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W4"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C4"
FT                   /inference="similar to AA sequence:UniProt:P53320"
FT                   /protein_id="CAX44777.1"
FT                   /translation="MAEENISLSQRMISACSGSLVTSLVVTPFDVIRIRIQQQSILPQE
FT                   QPCCQAHFPDHSFPKQKVPIEVAPELFWIHDKYCQSAESCTRIYSTFQGFSTVAKHEGV
FT                   GTLWRGLSLTLLMAVPSNIIYFTGYEYIRDHSPIGNHPLNPLFCGSLARTLSATFVAPA
FT                   ELIKTRLQSIPTDSKSASHILSNLIRDSSAAVKKDGVRTMFKGLGITLWRDVPFSGIYW
FT                   SSYEFFKLFLASVLKTDFNNSTTRGIDHWKVFATSFLSGSISGTIAAFFTNPFDVGKTR
FT                   IQITMQENEKISHPNMFKFLFKIYKNEGMGALYAGFGPRVMKIAPACAIMISSYEVGKK
FT                   FFKNGNNFS"
FT   CDS_pept        complement(1187801..1188910)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44778"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W5"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C5"
FT                   /protein_id="CAX44778.1"
FT                   /translation="MPTNGSFEKMSRPATAFQKVLDKVGSVFSSTETSRSQHESQLDDK
FT                   AANLFSVSSQKLYSKLSKMLKIESRSKNLKMELCNDFSAWGQSIPNLESSAFVKEFSAL
FT                   LNTQINNQTILQEKMERLKLSLSFVNEREKKQKGLITAKVKLEKQLKEAKAKFGPNASN
FT                   TILLNEKAEEVDCNLQVVEQQYIRSITNDLKDALIDYAYSMSASARKAEDSSSNFIQYM
FT                   TGMENDMVAGSIENDFVRFSPNKYSKLQKRKELKYPSPSLLDGGIVGSGVQQPKSKNYN
FT                   LPTPQSPCPECKKMSPCIHSEGAKVIQPSQREINHQQVHQQTQLRTFSQPNRNFSVNLQ
FT                   HPSDDSLGNEVPLFTTNRENSMPFSDHWS"
FT   CDS_pept        complement(1189200..1189946)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44779"
FT                   /db_xref="GOA:B9W7W6"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="InterPro:IPR033181"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W6"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C6"
FT                   /inference="similar to AA sequence:UniProt:P50087"
FT                   /protein_id="CAX44779.1"
FT                   /translation="MFKGIRLVTPIITTGAIMTIPTSNQMIFNESTKKRSFYEDDENVV
FT                   PIPGTVTPAPATELESLGSNRIIDGISVRSTPSTENLFKSVRKFTESTVDSLRFWADQK
FT                   YHQYNKTERSVTDTVSSLHNKSEDLLPNSLYILVAVLSGTIAGRTRGVLAKITLPTVFG
FT                   LTAFKYFLPQTFNNTAGFFWKLEKENVPQIAAQQESAYNSAVGLVHSIEETTESGKKSI
FT                   ENGTKSLKKSIANITGLNLDEEVSKK"
FT   CDS_pept        1190206..1192470
FT                   /transl_table=12
FT                   /locus_tag="CD36_05220"
FT                   /product="mitochondrial ribosomal protein, putative"
FT                   /note="Similar to C. albicans RSM22"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44780"
FT                   /db_xref="GOA:B9W7W7"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR016522"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W7"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C7"
FT                   /protein_id="CAX44780.1"
FT                   /translation="MYKRTLILRHSNLPFRCMNIIRNYSNSQPSDNKYKEYDFIVEENR
FT                   SPQDIVKNYLSPEQIEGHIESEGVLPAQEMSPFRNPDGTFIKGKNSAEARLDDRTLEGK
FT                   IDHSITNLPNRIAKAIQNNIIKLSIPARLRTRVAHIYQNLQKNQIQQAPSTALDCNAHI
FT                   AALFLQDYSHAKQVLSELQRRVGKDKFKPQRILDIGYGPATGIVALNEIMGSKWVPEEK
FT                   EAYIVGRKNNEMKKRAKIILSRQLNENYSGKEVNLDEHVAQEEWQVEDEEEEEENDSEE
FT                   NDYVGHIDVKRLHIRTKLRDTLPVTKKYDLIIIHSSLLSKEFNFPKDVDDNIHMVLPLL
FT                   APGGHLVLIERGNSVGFETIARARQIMIRPESFPQELGKIPRPYIKGSKGKPQKMRMKK
FT                   EDQFITQEDIEYEKELLAKLDYQEALEKAREMGEDFEKELNEKFGSVSEEELKFDNEDS
FT                   EQLEVFDVNTPHEEMYDKVDYHLSVIAPCPHHRKCPLQLGDPKYYKIPDHRHRLNFCSF
FT                   SKIVSRPPYILELKKGKKLAIRWDKSAEDGIGTISRNAVKRLAGSGRPGGRDTEVGSYS
FT                   YLIVERSANDSETIKKIEDLRSYSDNVIDENDITNWPRIIATPNKLKRNVKLTVCSTEG
FT                   NIETWQVPKSLGKQTYHDARKSQLGDSWALGRKTRTIKNQIPDTVKEKLDILYKTSKKT
FT                   FKKEQQRKLWKKKVGSSAEEFEDGFYATEVMASQLEHSKKYKHQGRQAQFEEDPSKFDG
FT                   N"
FT   CDS_pept        complement(1193063..1193311)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05230"
FT                   /product="ribosomal protein S27, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44781"
FT                   /db_xref="GOA:B9W7W8"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W8"
FT                   /inference="similar to AA sequence:UniProt:P35997"
FT                   /inference="similar to AA sequence:UniProt:Q75C52"
FT                   /inference="similar to AA sequence:UniProt:Q6FPV0"
FT                   /inference="similar to AA sequence:UniProt:P38711"
FT                   /protein_id="CAX44781.1"
FT                   /translation="MVLVQDLLHPNPITENEKNKLKKLVQEPNSFFLDIKCPSCFNIKT
FT                   IFSHAQTAITCDKCSTLLSSPTGGKAKLVDGSSFRRK"
FT   CDS_pept        1196379..1198442
FT                   /transl_table=12
FT                   /locus_tag="CD36_05240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44782"
FT                   /db_xref="GOA:B9W7W9"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7W9"
FT                   /inference="similar to AA sequence:UniProt:Q5A2I0"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C8"
FT                   /protein_id="CAX44782.1"
FT                   /translation="MNSSATTTSTIANPPPINSVHSHISSEKMSQTSNQSPSPQLFPQM
FT                   QKLSQPNQSQDVLFKIFTYTIIILPTLTSILFPIKTTMPPSEHAGNLIIDLLTVLLLSL
FT                   VVKHTIEWPYNWLRQLQKTKVMLLQDMDRENTDKTILLVRKIYTFEIIALISCLVSCIF
FT                   SSILLIWTRQYTIIDQKRKKVVFNNVNIALLQFWSLFRVIITFTDSLQQSSMHTNQLSW
FT                   ETPQLKNWYQDLSHYFLPNVSNQILLDHLQQHNRQFDQLKMDLISLQNELEEKKSLSND
FT                   SRESSFTPFPLNMSPTLLSPNASVNLSPTTSRNYVSFPFKAPPSSSESPTVASPPVPKR
FT                   KSSTMKSSSSKKSSLNTIIEEDDSTLYDSKENTFTNFDEIIPGIGIATRPPTLLDEIRS
FT                   MVTSVRQEVSFLDIIKHPNAVCNLLLKEFAPLLNHNFELGEYDIVRIVATEIFNNYLHN
FT                   LVHDIREELGKYWNYPLYFVKKAVIFLGLRLPIYAISFYFRVSFYVPWVLFRMIVLEPI
FT                   VQMGNLMLVIFKFALLTITTMTPKFTMNFPVSTSSPLPSPLSSPSSYSSSLSSSLPPSP
FT                   KISEKSSKTIAKKSQKKSSHSNQKKSVIVPKVAKEASSSKFAMKPFHLSPILADSMTFE
FT                   NNVNNNNNQSKTRKKIHLQSIDTIPEELNTISGGKKNGRFYKYSNRLALYDD"
FT   CDS_pept        complement(join(1198733..1200222,1200331..1200340))
FT                   /transl_table=12
FT                   /locus_tag="CD36_05250"
FT                   /product="protein transport protein sec61 alpha subunit,
FT                   putative"
FT                   /note="spliced gene"
FT                   /note="alternative shorter form, but only in silico
FT                   complement(302899..304179) which is then CaSSH1"
FT                   /note="Similar to S. cerevisiae SEC61"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44783"
FT                   /db_xref="GOA:B9W7X0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X0"
FT                   /inference="similar to AA sequence:UniProt:Q96TW8"
FT                   /inference="similar to AA sequence:UniProt:Q59MJ6"
FT                   /inference="similar to AA sequence:UniProt:Q6CPY9"
FT                   /inference="similar to AA sequence:UniProt:P32915"
FT                   /inference="similar to AA sequence:UniProt:Q5A2C9"
FT                   /protein_id="CAX44783.1"
FT                   /translation="MSGFRLLDLVKFFLPILPEIEYPFEKIPFDEKIVFTVGSAIIFLF
FT                   GQLPIYGLIPNGQFYLLDPFSNFRSIFAMNKGTLLELGLLPIITSAFIWQLGAGLKLIN
FT                   VNFKLRIDRELFQTGQKLTSFIFSIVFAIGLIYSGYYDNAIRGYNPLEDGIPYGPYSLI
FT                   LLQITAWSWIVTLMVEIFDKGYSFGSGILCFLAIQSSTNFIANLLGLENFPILNSNKFE
FT                   SYGALMNLIKNFSIFNPKQTVYQIWHSFFRIQLPNLTQFYISLASILIVVALQNFRIEL
FT                   PIRSTKVRGMNNVFPIRLLYTGGLPVLFAYSVVANIQVIGYLIHSILSKLGTSPIVISI
FT                   IGNYVYNPISNELYLNSGILNYFASSSSIVQSIISQIKTTVYSATIIILAVWFANKWSY
FT                   ISGSSPKDISKQFKDQGISLAGKRDISITKELSRVIPVASVSGAFILSVVALIGEFFGG
FT                   LGYGVASIIGVTSSFAVLEEFMTEYQQNGGGQFSNALASFQ"
FT   CDS_pept        complement(1200952..1201968)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44784"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X1"
FT                   /inference="similar to AA sequence:UniProt:Q5A2D0"
FT                   /protein_id="CAX44784.1"
FT                   /translation="MSINPNLKLFKLINNRRNSNTTDIMNSQQPQKSHQQKSQHHQKNK
FT                   YDSFDATSSILSDYDDLEIIDDDDQSSYVLFNPRSSTSSSRGKQKNKHHDSDILSFTNT
FT                   SNTNGEYQSDTEKEEEDSEEEEEEEDDNDYDTQEDKEGYFDDENNDTEVLNRESLSNKI
FT                   NSWYTANVVTSSHHQSLIDERIASWELDEEANILEGSQESSKSLEESKSILREFYGDDL
FT                   FKYLNQDEIAKVKKFHKMVDIKNYLLDKTDKSNNSLLDQLLYKVLLFKEKKHNDTTFHR
FT                   QYNIGTTDYINYLTKDVSSHSPAFVAPSTISDTTTGGSSLIMCGGVGFGGSTSWNDI"
FT   CDS_pept        join(1204395..1204437,1204523..>1204944)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05270"
FT                   /product="DMRL synthase, putative"
FT                   /product="riboflavin synthase beta chain, putative"
FT                   /product="lumazine synthase, putative"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase,
FT                   putative"
FT                   /EC_number="2.5.1.9"
FT                   /note="spliced gene"
FT                   /note="Similar to S. cerevisiae RIB4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44785"
FT                   /db_xref="GOA:B9W7X2"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X2"
FT                   /inference="similar to AA sequence:UniProt:P50861"
FT                   /inference="similar to AA sequence:UniProt:Q6FXA8"
FT                   /inference="similar to AA sequence:UniProt:Q9UUB1"
FT                   /protein_id="CAX44785.1"
FT                   /translation="MAVKGLGEVDQKYDGSKLRIGILHARWNKKIIDALVAGAVKRLQE
FT                   FGVKEENIVIETVPGSFELPYGSKLFVEKQKRLGKPLDAVIPIGVLIKGSTMHFEYICD
FT                   STTHQLMKLNFELGIPVIFGVLTCLTDEQAEARAGLIEGKMHNHGEDWGAA"
FT   tRNA            1205376..1205481
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CD36_tRNA_0011"
FT                   /product="transfer RNA-Asn (GTT)"
FT                   /anticodon="(pos:1205410..1205412,aa:Asn)"
FT   tRNA            1205567..1205669
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CD36_tRNA_0012"
FT                   /product="transfer RNA-Asn (GTT)"
FT                   /anticodon="(pos:1205601..1205603,aa:Asn)"
FT   tRNA            1206175..1206247
FT                   /gene="tRNA-Thr (AGT)"
FT                   /locus_tag="CD36_tRNA_0013"
FT                   /product="transfer RNA-Thr (AGT)"
FT                   /anticodon="(pos:1206208..1206210,aa:Thr)"
FT   CDS_pept        1206508..1211223
FT                   /transl_table=12
FT                   /locus_tag="CD36_05280"
FT                   /product="1,3-beta-glucan synthase component, putative"
FT                   /product="glucan synthase, putative"
FT                   /EC_number="2.4.1.34"
FT                   /note="Similar to S. cerevisiae GSL1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44786"
FT                   /db_xref="GOA:B9W7X3"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X3"
FT                   /inference="similar to AA sequence:UniProt:Q04952"
FT                   /inference="similar to AA sequence:UniProt:Q5A9Y9"
FT                   /inference="similar to AA sequence:UniProt:O13429"
FT                   /protein_id="CAX44786.1"
FT                   /translation="MNQNKPQYSAWCPENGALISNEKIHKIFLTLGNKFGFQDDNVSNM
FT                   YDHFMTILDSRSSRMSCPNALLSLHLDYIGGKNSNYKKWYFSAQWYFEHDWSPKMKKRK
FT                   PVSSDYQLWLYRFQKYTEEDYVYHVALYLLIWGEANNVRFMPECLCFIFQCALDCNGPN
FT                   LPKFNYLNRVITPLYEFIRDQLYCKVDNKWKRREIDHACTIGYDDVNQLFWSPDGLYKL
FT                   ILYDGTRLYQLPQAERYNKLENINWSKSLSKTYRERRTWIHVLSNFSRVWIIHVSVFWY
FT                   FMSFNSPSLYTPNYTPNKSPQVHIRLAIVSIGGIIAVLISLGAAISDFFFVSGSIRNIA
FT                   LLLILTVANSGSIVYNLGLLKWDKYSKNGTVVAAISMCLSVLTFLFLAINPPGSFKTVF
FT                   SNNFPKLKLRSRLFSISLWIGVFAAKYSESYFFLILSLKDPIQILSTIVLNCDKGHFLC
FT                   QFQPKITLILFYLTDLILFFLDTYLWYVICNCLFSVGLSFSLGVSIFTPWKNIFSRLPD
FT                   RILTKIYYGDSTELILVISQIWNSIIISMYREHVLSVEQVCKLIYQRGVDENTIRPPLF
FT                   FVYEDDNKFYDFIKIEKEWERRITFFAQSLSSPLPEPFPVVSTPTFTVLIPHYSEKILL
FT                   SLQDLIKEQSFSKLTLLDYLKQLHSKEWDSFVQDSKMIQTIKEMDEDKFVRENMDDLPY
FT                   YCIGFKDSSPENVLRTRIWAALRCQTLYRTVSGFMNYETALKLLYRTEVIGFEQNEFPE
FT                   EEPEEFVSRKFNLLIAMQNFQNFTPDMKTDADSLFKAFPNVKVAILESDNDQDYYSTLL
FT                   DVSQRDDKSQYVKKYRIKLSGNPILGDGKSDNQNSALIFYRGEYIQVIDSNQDNYIEEC
FT                   LKIKSLLNEFEEMNLDVSFGYMTEHPDTSSVAIVGAREFIFSQNIGILGDIAAAKEQTF
FT                   GTLFARTMGEIGSKLHYGHPDLLNGIFMTTRGGISKAQRGLHLNEDIYAGITATCRGGR
FT                   IKHSDYYQCGKGRDLGFQSIVNFTKKIGSGMGEQLLSREYYYLGSMLPIDKFLSFYYAH
FT                   AGFHINNLSIMLSVKAFMFLLMSLGALNNGTVTCTEDNPTPGCHNLVPVLNWIYRFVLS
FT                   VFVCFFISFLPLIIQEFIEKGLLKAILRILLHIVSLSPFFEVFMCQVYSRALRDNFIFG
FT                   EAKYIATGRGFAISRVSFATLYSRYASLSICYGGEIFLVILFASVTIWRKSLLWFVITI
FT                   ISLCLAPFIFNPHQFNFVDFFVDYRDYVRWLTRGNSSLKESSWAHYTKIRRARLTGEKF
FT                   DGGYVSGRNTATFNLLLGEVASPFINLILYLLPYLFLHSSQNLLAFNVNNPLIKLTAVV
FT                   LAPYLENSAVLFFVWLMSLTLAPLVGIWFKKTPAFFAAFVHFACLILHIFNLELLLFLE
FT                   DWNMVKLLSALLVIFNCHRVISNFILILVVSRERTENVNQAWWSGKWFRKGLGVHVVSQ
FT                   NLREFIVKTLELNKFTFDFIIGHFLLFSMFPFLFIPYVDSLHTSMLFWLKPSRQFSRPI
FT                   INRSQRRKRNWRIIKYFILFSGILGIFIALFVVPPIFRDKLSFIKKWVGLQ"
FT   CDS_pept        1211503..1213032
FT                   /transl_table=12
FT                   /locus_tag="CD36_05290"
FT                   /product="cytochrome oxidase assembly factor, putative"
FT                   /product="glutamyl-tRNA(Gln) amidotransferanse subunitB,
FT                   mitochondrial precursor, putative"
FT                   /EC_number="6.3.5.-"
FT                   /note="perhaps to be trimmed to next Met"
FT                   /note="Similar to S. cerevisiae PET112"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44787"
FT                   /db_xref="GOA:B9W7X4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9W7X4"
FT                   /inference="similar to AA sequence:UniProt:Q5A9Z1"
FT                   /inference="similar to AA sequence:UniProt:P33893"
FT                   /protein_id="CAX44787.1"
FT                   /translation="MFLNAEFFFFFFQISISYIRLSQVSMFVRRLHKFSYNPNYKFKCG
FT                   LEIHTQLKTKYKLFSLSPTSYNEPPNTKLSYFDVGLPGTQPLLNPEALLLALKASVALN
FT                   CEIQSHSSFDRKHYFYADQPLGYQITQHYYPLAKNGYVQLNKFDDVPDKVITLEQVQLE
FT                   QDTGKTVNYDDRINVDLNRANTPLIEVVTKPDFENIDQVQAFVRKYQLLVRHLDICTGD
FT                   LETGAIRVDANISVNDNPRVEIKNLGSSGEIVDALKYEYNRQVTLLQNNETIVQETRGW
FT                   NGTGTESLRKKENAVDYRYVPDSELPVIRLDSHIQEQLENTLDELPDSVLDRLTKEPYN
FT                   LQLAHARNLLFQPEVLNYYENIFGRIRDANKWFFHELLAAFAKSDVQFQVDIVSTNMLV
FT                   DIVSAVEKNEISLTGARIILKHIIRNKSFSTLPHLIKELDIGKPEASAELDDTINEICQ
FT                   QIINTNADVVEKIARGHANALQVLIGQAMKATKGKVHAKEFRSKFMELLNQ"
FT   CDS_pept        complement(1213101..1214354)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05300"
FT                   /product="a-factor pheromone receptor, putative"
FT                   /note="Similar to C. albicans STE3"
FT                   /note="Similar to S. cerevisiae STE3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44788"
FT                   /db_xref="GOA:B9W7X5"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X5"
FT                   /inference="similar to AA sequence:UniProt:Q5A9Z4"
FT                   /inference="similar to AA sequence:UniProt:P06783"
FT                   /protein_id="CAX44788.1"
FT                   /translation="MYKGAAGMGSFLIISFCLLIPPFLWHIRSRNLPATILIFWLMYVD
FT                   LTGFISTMIWSGDNFEEAWDGQVYCDIIGKLDAGSSVGKCCAIACVIMNLYFVLCAKHP
FT                   TLLEQGSWKKVAIDMSICLINPIFVMAVHYIVTGSRYAIVKYQGCSTIYSATYASIFLV
FT                   SIWTVLWSIVALIFAILTLITFFRKRKDVKDILLCTNSGLNIKRFARLLIFSFLIVFAM
FT                   VPLSLYYFVSQAEVSKNAFHWDQVHNEEWSVIYFYDFGFFTFYDRLVNCILSVLAFIIF
FT                   GLGSDALEMYKSIFYKIQNKFRYKKTDDAFSQEQAIKAMEPQTKINSNKSQFSNTTSFT
FT                   NTSTMRDIENQFGDVMHQIISEENASFRFEKQLQSSPATLVKEDGVPRELQSIIKDTDS
FT                   SSDQIFYKYQVKSKASDK"
FT   CDS_pept        complement(1214831..1218160)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05310"
FT                   /product="importin beta-4 subunit, putative"
FT                   /product="karyopherin beta-4 subunit, putative"
FT                   /product="Ran-binding protein 4, YRB4, putative"
FT                   /note="Similar to C. albicans KAP123"
FT                   /note="Similar to S. cerevisiae KAP123"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44789"
FT                   /db_xref="GOA:B9W7X6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X6"
FT                   /inference="similar to AA sequence:UniProt:Q5A9Z5"
FT                   /inference="similar to AA sequence:UniProt:P40069"
FT                   /inference="similar to AA sequence:UniProt:Q8VI75"
FT                   /protein_id="CAX44789.1"
FT                   /translation="MDAQFISSLEETLKQTLVPDSSVIKQASSKLTKDFYPNPIALPAL
FT                   LQISQTTTQDELKQLSLVEARKLALDKWEQVDASLKPTLRESLLKGTFGEQNKRLRNLS
FT                   AYVIAAIGEIDLDKNEWQDLLSTLFSAVQNSDVHTREVGTFVLFALLESQIAAVVPHIS
FT                   DLLTLFNTLLNDSESKEVRINSIMSLDVLSQIIEEDEERIIQLAGKFQATVPSMINIFK
FT                   DVISGDDIESAKNVFNVFNSLILVDSRLVGDHLITMIQIIAEMVTNPQLDEEFKIFGLQ
FT                   FLISCVTYRKSKISANKLGPQITLVALKVASGEIDIEDELQNEDEENENEENSPPSLAL
FT                   RLLAVLSAELPPSQVVNPLFDALPQMLSSSNQFERRAGLLAIGVSSSGAPDFISLQIQK
FT                   IIPAIVNGLKDSELIVKVAALKTLGQLTVELQDIITEYHEQLLPLIIEIIDSASSVVAY
FT                   RHACVALDGLIEFMSHNAMGNYIEPLTHKLFHMLQQANSATLKSSIVSAIGSTAFASGK
FT                   AYTPYFEASVQQLEPFIANSASVEGLTEDDIELRAVTFENISTMARAVGSESFSAYAKP
FT                   LVEAAYNSLSSEHSRIRESGFAFIANMAKVYGAEFAGFLDQIVPKILECLKQEEFSFNL
FT                   GDPEEDEPEYDDEDEDADPLKIHTGITIEKEMASVALGELAVGTGNQFFPYVESTIAVL
FT                   QDQIENSYGMREGAMSCLFKITKAMFVAVQGENFKAPKGVPKQSYVEANVLQLIQNLRK
FT                   VSIPLLEEEFESTMVASILDGVATALFTFGPIFVVDEPGNTELLEKLCTTLMLLLKQEH
FT                   QCQIDDDEMPNEEEDSSETEVMLNEATLEVLINLSLALQSDFVQIFSSFKDVILAKFNS
FT                   KSKPLRVGSIGAIAEMVEGMKEANPYSEELLQIFSDKLANDKSIEVKGNAAYGIGLIIQ
FT                   YSSVDLSSTYPHILQLLFQLLNKVDKKADSIDDEEAKDVVNRSYANACGCVSRMILKHE
FT                   QSVPLEHVLPALLAHLPLETGLEENTPIFEVIIKLYGSNNELIVNQTPKIVEVFAGAFK
FT                   ADAERIKLINESTLGREENIDSLKQFSSEDLRNRVVELLKYLDQKFSGVVSSNEILKSV
FT                   VA"
FT   CDS_pept        complement(1218467..1219666)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05320"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="possible eukaryotic translation initiation factor
FT                   eIF4A-12?"
FT                   /note="Similar to C. albicans FAL1"
FT                   /note="Similar to S. pombe TIF412"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44790"
FT                   /db_xref="GOA:B9W7X7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X7"
FT                   /inference="similar to AA sequence:UniProt:Q9UVI5"
FT                   /inference="similar to AA sequence:UniProt:Q10055"
FT                   /protein_id="CAX44790.1"
FT                   /translation="MDDFDRDLDNELEFSHKSTKGIKVHRTFESMNLKPDLLKGIYAYG
FT                   FEAPSAIQSRAIMQIISGRDTIAQAQSGTGKTATFSIGMLEVIDTKSKECQALILSPTR
FT                   ELAIQIQNVVKHLGDYMNIHTHACIGGKNVGDDVKKLQQGQQIVSGTPGRVIDVIKRRN
FT                   LQTRNIKVLILDEADELFTKGFKEQIYEIYKHLPPSVQVVVVSATLPREVLEMTSKFTT
FT                   DPVKILVKRDEISLSGIKQFYVQCEREDWKFDTLCDLYDNLTITQAVIFCNTKLKVNWL
FT                   ADQMKKQNFTVVAMHGDMKQDERDSIMNEFRRGNSRVLISTDVWARGIDVQQVSLVINY
FT                   DLPTDKENYIHRIGRSGRFGRKGTAINLITKDDVATLKDLEKYYSTKIKEMPMNINDIM
FT                   "
FT   CDS_pept        1219844..1220602
FT                   /transl_table=12
FT                   /locus_tag="CD36_05330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44791"
FT                   /db_xref="GOA:B9W7X8"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X8"
FT                   /inference="similar to AA sequence:UniProt:Q5A9Z7"
FT                   /inference="similar to AA sequence:UniProt:Q6BT26"
FT                   /inference="similar to AA sequence:UniProt:Q5SKR5"
FT                   /protein_id="CAX44791.1"
FT                   /translation="MTSTTVNRSIIVLLGGGHASGKKTTALSLKEELLATVPKSHFDVR
FT                   IIDMNDYTTDGKSSIDSSQYVSNKSAAISINKINDKLPRLKPSRFEFDKLKTFLLNNLD
FT                   TPSNQPQKILLVHGLYALYDKEIRNISHIKAFIDSDSDTRLIRWIRRDVLQNQTDSLEG
FT                   VINAYLLGARLEMSDFIFPTKEFADVILPRGAEPNAIRLIIDGIMLYLNDKHLTNDTTQ
FT                   FPENLLRPNEIGNFQKERFDVQKNKFYELN"
FT   CDS_pept        complement(1220651..1224931)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05340"
FT                   /product="nucleoporin NUP170, putative"
FT                   /product="nuclear pore protein NUP170, putative"
FT                   /note="Similar to S. cerevisiae NUP170"
FT                   /note="Similar to C. albicans NUP170"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44792"
FT                   /db_xref="GOA:B9W7X9"
FT                   /db_xref="InterPro:IPR004870"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR042533"
FT                   /db_xref="InterPro:IPR042537"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7X9"
FT                   /inference="similar to AA sequence:UniProt:Q5A9Z9"
FT                   /inference="similar to AA sequence:UniProt:P38181"
FT                   /protein_id="CAX44792.1"
FT                   /translation="MVVQVPQVVSSGTSASSSSSKYISPTLKLQDDVVADSLQFHQDKS
FT                   TGSSRGQLSRRFVQPAGLESKESNYKINVPDFANLPPLQLGSKFISDLNKIDSSIPHDI
FT                   FYSETVSKSESGLDNYYFDYENGLKDFSRFEKVQQLDLPDRFFEEYNSTECITKIGLFP
FT                   EIERTWIAIDNKLVLWNYKLPRSSFNQASQFLTIDQIRHTILTVKLVRPKKGVFTKEVN
FT                   YLLLVSTTVDIHIYIVKYDESMNNLEIFNPDLSVSTQGLAVDNFTVNSKTNDIYFSGES
FT                   DGINIWRLDYSNKSSFIKNKCDKVCLTKGGFSSVIPNKLPGFGFSSGPSSTNENSSSNI
FT                   PESIVQLEVDSDRDILYSLSNKSVIRVYKLHPKQEHLTEGSTLTPSVIFKSALTVFVDA
FT                   SNFKVFERFKIISIHKISPEESSSIQLIAVTSNGCRILLKLGSTSTFSSLLTSSFSAAN
FT                   ALKLNLVNIKFPPTREVPKINTELDTFSRDRQYMSQLIANQQKSQLLKNTKLSKIISPG
FT                   VFLCVKKTKRSDKLFVATANYGYLKKNNKLVEDAEFMNYVGNEDSPYTYIQDIVQLTPS
FT                   MNATNTPNGYANIAASQYTKLPLKFAVLTNFGIVIYQFRTADQILKSLKDEVIENFLEE
FT                   NGYEETCSSLLYLACSYGQYSTSDIYKRKAQILFSTCGNGARFNDSSQSSSSSLIPHHQ
FT                   TNISSYAHPTVDQVVLSDRFYGTCLLVSRLFRDFWNKKVFSPLSSIKITPSGDVEVASI
FT                   KEGKLLIQGLNIDKKKVEFFIGSVIVLIDFFSENGTNIPGLSAPSYSSDPNQFESEICL
FT                   RAEHIAFTSIIKSLNSMKEALSFLMVLIEEIQINQSNFKEIFEFLSLSNQVNLLTVRFK
FT                   DLLLPNRDVKNLVKDLLSSIINKNILKGGSIDLIASSLQTRCGSFCSTNDVFIFKAIEN
FT                   LTKAKNIGFRDTDLKNKCLKNAVLLFEEAYESLTLENIENSINIMLDLEFYAGAVGMLL
FT                   NIAQKVGNNIKVPSLTFNQDDESATLKRDIVEIEKKKKSLYGLIFNILIKMDMKALKIS
FT                   DTNNQLLINEFLEIRDATYDTCFASNDKNFQYTFYDWFIQQGVSERLLDVNTPFILPYL
FT                   EEKSENNLALSDLLWLYHAKRENYFDAAKILYALSISQFNLELNQRIEYLSRANGFCNC
FT                   VCPPNLRQRMIQLSSVIQELFEVANVQLDILSRIKGDSRISDENKHIATEALNYKILSI
FT                   SDLFNNYTDTLGYYDLSLLIFKVSDYKNTDDILKRWELFFEKIFHEFNSESKSKNEPFY
FT                   VLLNEQFISCGSKLSSNDLVFPIDELIKIASKYLQEASDENSASQKPPKGFLVEMFVKT
FT                   GVSYERLYYVLKSLIEHNTFEVYPGFTNDLKTNEIVYLIKNWYAQDRKLRELVSAEQIA
FT                   NLVDNYSVENDPINEIIRNGDFVL"
FT   CDS_pept        1225486..1226739
FT                   /transl_table=12
FT                   /locus_tag="CD36_05350"
FT                   /product="leucine aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44793"
FT                   /db_xref="GOA:B9W7Y0"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y0"
FT                   /inference="similar to AA sequence:UniProt:Q5AA00"
FT                   /inference="similar to AA sequence:UniProt:Q04033"
FT                   /inference="similar to AA sequence:UniProt:Q5QHG5"
FT                   /protein_id="CAX44793.1"
FT                   /translation="MKIAIILGFIVCLVNAFPLIFPEWTTNAISFFANDGYSNSDRLIK
FT                   LGPENYRIVSENEKLNLKRNNINFIDVTNQIPIESAIEQGLTLKPNPPSLWRKFQLMGS
FT                   KQITTLKKKIPVYNYPKHPKFAKEIFNIFQSIDVEFMQEKLSKFTSFYTRYYKSDYGIE
FT                   SAEWLYQQISDIIAPVKDTVVISKIEHKGWKQFSIVVSIPGQVSDKVIVGAHQDSANLI
FT                   LPNLMKAPGADDDGSGTVAILESLRLLITSYKDGTFKPYNTLEFHWYSAEEGGLLGSID
FT                   VFTRYSESNQVVVGMLQQDMTGYTQGSIDQGIEPHFGLIADYTSVELNNFLKQIITSYN
FT                   FIPYHESQCGYACSDHASALENGYPSSFLIESEMKYTNKYIHSTMDTIDRLDWAHIKEH
FT                   VKLTIAYAYELSLAINLY"
FT   CDS_pept        complement(1226834..1227259)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05360"
FT                   /product="telomere-binding protein, putative"
FT                   /note="Similar to C. albicans RIM1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44794"
FT                   /db_xref="GOA:B9W7Y1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y1"
FT                   /inference="similar to AA sequence:UniProt:Q5AA01"
FT                   /protein_id="CAX44794.1"
FT                   /translation="MLRSFTRSFTSTVVKRDFARAQLFGRVGNVDFRESESGTKYVTYS
FT                   VAVNRYDRESNDNVPTWYRVVAFDPIQIDRLEKILKVGRLVHVDAALRVRRHEDPETHK
FT                   FTSEISLVQTGFDIASYKKRTEGEGEGEGENSSHAEE"
FT   CDS_pept        complement(1227536..1228279)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44795"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y2"
FT                   /inference="similar to AA sequence:UniProt:Q5AA03"
FT                   /protein_id="CAX44795.1"
FT                   /translation="MVTASELNQLNVWNDKNEGETRSPQSYIPDSINWMIGSSKICNTN
FT                   NSSPTTNLRNKRLHYLFKNHQSASRDQASNGKKNSNSSGSVKEDAESSIDYPTTQLNTH
FT                   ELTSKLELELVESSFLEYGRKTMVPNEFSHRSKERECSFDSKTCDINCLNSISVGNSLP
FT                   SEAEGSSFLQSTRDIESGNCKADPHQEFDIQMGHSHENISIHSNPRKHVRDNNTMANCP
FT                   KPVKRFKSKSQCDLVFPNLNFRNSG"
FT   CDS_pept        join(1228834..1228867,1228939..1229312)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05380"
FT                   /product="autophagy-related protein 8 precursor ATG8,
FT                   putative"
FT                   /product="autophagy-related ubiquitin-like modifier ATG 8,
FT                   putative"
FT                   /product="cytoplasm to vacuole targeting protein 5,
FT                   putative"
FT                   /note="spliced gene"
FT                   /note="Similar to C. albicans ATG8"
FT                   /note="Similar to S. cerevisiae ATG8"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44796"
FT                   /db_xref="GOA:B9W7Y3"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y3"
FT                   /inference="similar to AA sequence:UniProt:P0C075"
FT                   /inference="similar to AA sequence:UniProt:P38182"
FT                   /protein_id="CAX44796.1"
FT                   /translation="MRSQFKDEHPFEKRQAEAARIAQRFKDRVPVICEKVENSDIPEID
FT                   KRKYLVPVDLTVGQFVYVIRKRIKLPSEKAIFIFVNDILPPTAALISTIYEEHKDEDGF
FT                   LYVLYSGENTFGEKIAIDISSLDYSDIPDYV"
FT   CDS_pept        complement(1229750..1231423)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05390"
FT                   /product="GABA-specific transport protein UGA4, putative"
FT                   /product="GABA-specific permease UGA, putative"
FT                   /note="Similar to S. cerevisiae UGA4"
FT                   /note="Similar to C. albicans UGA40"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44797"
FT                   /db_xref="GOA:B9W7Y4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y4"
FT                   /inference="similar to AA sequence:UniProt:Q5AA92"
FT                   /inference="similar to AA sequence:UniProt:P32837"
FT                   /inference="similar to AA sequence:UniProt:Q5A0I5"
FT                   /protein_id="CAX44797.1"
FT                   /translation="MSKIHTVLSQEELVEQVKSHKEYYNNTQNVEGRKIDPNLASNDVE
FT                   MLGQLGYKQELKRHFSTFQCFGVAFSIMGLLPSIASIFSQGIVAGPAGFLWGWVISSLL
FT                   ILAIGVAMAISGSSISTSGGLYYWTNYYAPPRIKTVLSYLIGNTNSIALVGGFCSVVYG
FT                   FAIQVYAIVVIARDGDFEITQAKLYGVFVACVIAQVAVTCLSSKNCAHLQTVSVVCNVF
FT                   IIIVYVIAMLVGSRGKFKPASYVFGEFENLSDWPIGWTQISAAWLPAIWTIGAFDSVIH
FT                   QSEEVHNAGKVIPIGILGSISACGVLGTIIIIVTLFCIQTDDIEGHILGSKFGQPIAQI
FT                   IYDVLGKKWALFFMIFMSICQFLMGSSILTAISRQIWAFSRDNGLPFSFWIKRVNKNLS
FT                   TPINAVIFGGICSVIMGLLVLIGTVAANALFSLYIAGNYLAWSTPTLLRLTSGRKLFVP
FT                   GKFYLGKVFSPLIEWVSVIFGFYTIAMVMFPASTHVDKDTMNYTCVITPAVVILSYIYY
FT                   MLYSRKHYHGPCKTIDVEDECEILDGIEHQHIDAELNEKS"
FT   CDS_pept        join(1232388..1232395,1232986..1233076,1233317..1233943)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05400"
FT                   /product="60S ribosomal protein L7, putative"
FT                   /note="spliced gene"
FT                   /note="Similar to S. cerevisiae RPL7A"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44798"
FT                   /db_xref="GOA:B9W7Y5"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y5"
FT                   /inference="similar to AA sequence:UniProt:P05737"
FT                   /inference="similar to AA sequence:UniProt:Q12213"
FT                   /inference="similar to AA sequence:UniProt:Q6BTA4"
FT                   /protein_id="CAX44798.1"
FT                   /translation="MATTLKPETLQKKEKAQQKTAEERAAAKKVRKAANKEKRKVIFDR
FT                   AAAYQKEYTEAERSVIKAKRDAKASNSYYVDAQPKLVFVVRIKGINKIPPKPRKVLQLL
FT                   RLTQINAGVFVRLTKATSELIKLAEPYVAYGYPSLSTIRQLVYKRGFGKVNKQRIALSD
FT                   NAIIEANLGKFNILSIEDLIHEIYTVGPNFKQVNNFLWPFKLSNPNGGFRARKFQHFIQ
FT                   GGDTGNREEFINALVKQMN"
FT   CDS_pept        complement(1234212..1235354)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05410"
FT                   /product="conserved hypothetical protein"
FT                   /note="complement(338378..339727) would extend it, but no
FT                   evidence supporting 5'/aminoterminal extension"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44799"
FT                   /db_xref="GOA:B9W7Y6"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y6"
FT                   /inference="similar to AA sequence:UniProt:Q5AA06"
FT                   /inference="similar to AA sequence:UniProt:Q5AA93"
FT                   /protein_id="CAX44799.1"
FT                   /translation="MIATQQSIIDKLIDICWKRVRGTSDFIFLSQIRPIINEIQDILQK
FT                   DSLFNERENEIIKQFIQSDPMKKLQKQELKKFIDRSVEFGNFEIFLLNRHRLTSQDIKR
FT                   RIEQNSFLNDSMTDTKIPRLLPTREYKYKVWDELRQRDDYIKEKTQALDSKDLKYSQLL
FT                   SQIDEQHLTVKALKGENLTLKKHIRELESQLSKQPPVNATNAVYGLQLKERDLTIKKLD
FT                   QVGKEYKKRIGQLEQQQLEASKAMNILKQSILEQDKLVGKLKEKLINKTNDDKSNLKKF
FT                   ITSLPIIKQWYILLKYKMDNRNTKMLALNIMLLIVTAWLFGMVLQMTYRTGILLFSTSP
FT                   SPATYIYDNYGRNRLSFRLGFDLWRNIPWLEKLIYHYLEW"
FT   CDS_pept        complement(1235551..1240557)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44800"
FT                   /db_xref="GOA:B9W7Y7"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y7"
FT                   /inference="similar to AA sequence:UniProt:Q5AA08"
FT                   /inference="similar to AA sequence:UniProt:Q5AA95"
FT                   /protein_id="CAX44800.1"
FT                   /translation="MSHRSDDHSHSFSNEQTETTHNPKAKFPKTSRFFSNSSLPDLKTF
FT                   EVIRQNKKILFNGQSTNFNYSPFNLPQQKLKASIPLDYRNLPSKILTSPVSNSAFSKNE
FT                   IPCFSLTQEQTKDPIAFIESIMEVGKEYGAVKVKLPQNDVELFQSTNQINSDLFWFQTN
FT                   KLLNNPPEDEVYMRLKFHHDLLEFHQSEESVKYEDQESKRSGNTSASSGSQQANKMPMI
FT                   DKRPLDLYKLFQSVIIRGGFIEVINKKLWAQIGRELGYKGKIMTSLSSSLKSSYQKILY
FT                   PYELYLREKQSILEVKQEELKHIQVKKENKIDFLVNRDESNEDLQRNFNGKRELNEDFS
FT                   SNKRIKTEGYTAPLIIGSAKDFRRSVKSKLRKGYLLNSPLSIDIKQPNVFTIKQDEKKR
FT                   RRQNEKVDITISPQTQLDSAIRYIANSQDDSRVKAAPKIASIYTLRQFMEKDIKFQEFL
FT                   VQNNSIQFSNVNVTDRNLIPLQCLEKLYWEYISSSKGSNLLNFGLELEMGKDIPNYING
FT                   SGFVKMGDDLINYKNHLNSEHLNLSHTKSGPHNSSNSTKSNNSTVNQPIQFDSQRFNDD
FT                   DFINKLLQSALHPWNLHNLPTLPNALLGALDKTDVNDYDLNESRINIGMTFSTDNWTCE
FT                   DHFTNLVNFQFFGAVKKWYFIPESEFTKFESLIENIQMRDQSRSNINNKKPVDIDRIMK
FT                   LLKKSEDDVDYEVVLKTLDNLINVDKDVRLNIGNEKFANLIGKGAKFNYNQEFMITPEL
FT                   LDSFGIRYTTAVQEPGEFIIKFPKTYSSTISFGFNLSEEVNLATKSWLDYALESEKWLA
FT                   KQNIIPGFSTFKLLVNLALMYEGGTNLLFDSDIFYKAATMYDQLYQEEINSRNEVRKFR
FT                   IKEMVVDGTVDMLSDDSFANLYPSRIVATDPKSKKSVIMSMQKFIQCQQQEEENFMKQF
FT                   QIELQLCYSDEKLRYFSKILNSYSVDFESWVNNYEQLMRENSDVLLRTYKALLSDGEKI
FT                   YSSIVSSAVKQQDIDQEKFKTFKNQVENLRTFIDNSNAFVEKCQNLLSIKHQQRIRNGN
FT                   DIFREKSYSYGDLLKLVDSISKLNFMCPEIEQILEFKNEIENFDKASRLLLSKKSKSIQ
FT                   EFDDLISLGESFGLDIPSLNFIIRIRDRLKWLRTYSLIEKGVDPYGDKNEVFSIYDLRK
FT                   FLDQGISVLSKDDLPMIKQVETILNASNAFDLEVSKFLKYNYVLELDLNRLSDIAKRFS
FT                   TEKLFISMNNYHELSKLHINIKLIEQFKELEAASYPELKQLHNSVLESGLKFDTEILSK
FT                   KLAGVESWIDLSWNKLSKTKVITTLNKSIDIDRLNSKLTINAKLLEKLLQLLYKSEFSL
FT                   SEDDKYEESSSYLANKSDQPDTEDEVTPKYYCVCREYEYGTMVECDKCNEWYHVQCVKD
FT                   VSNPDADKYICPTCLVISTTSNYNQFLQNQITLGELKEIYSKGELLNARSINEMTIMKD
FT                   LIDELTKHHIRLQNQIERIVLQSDIAAKIDSLRLILRKLYGNGVLLNDIWEHVLNLIKG
FT                   YERILEDDKKLSMEIIPIESISTTENIEKVIQKDESSLLSRNNINQEKGDSNTIEKKVE
FT                   IGAGNASNISQESEMKVPFDEKSSNLEKTQVSPQQSVTPQVTTSIKVEEILNKTEDYGD
FT                   IVKQTELETSEDHSISGVRSNQTEVVEHEM"
FT   CDS_pept        complement(1241347..1241742)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44801"
FT                   /db_xref="InterPro:IPR024391"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y8"
FT                   /inference="similar to AA sequence:UniProt:Q5AA09"
FT                   /inference="similar to AA sequence:UniProt:Q5A5U9"
FT                   /protein_id="CAX44801.1"
FT                   /translation="MQFSKIIARSVLTSVALAEFHNGTVTTEVTATGYTTYCPYPTTIT
FT                   LTICEEDNICTKRPIVVSEPTTITVTEPCIISTSYETTELVATTTLPNSVAPSSVAPAN
FT                   VTSFEGAGSKNVAGALVGVVAIAAALM"
FT   CDS_pept        complement(1243396..1245030)
FT                   /transl_table=12
FT                   /gene="CPY2"
FT                   /locus_tag="CD36_05440"
FT                   /product="serine carboypeptidase precursor, putative"
FT                   /product="carboxypeptidase Y precursor, putative"
FT                   /EC_number="3.4.16.5"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44802"
FT                   /db_xref="GOA:B9W7Y9"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Y9"
FT                   /inference="similar to AA sequence:UniProt:Q5AA10"
FT                   /inference="similar to AA sequence:UniProt:Q5AA97"
FT                   /inference="similar to AA sequence:UniProt:Q59PQ0"
FT                   /inference="similar to AA sequence:UniProt:P30574"
FT                   /inference="similar to AA sequence:UniProt:Q59PN2"
FT                   /protein_id="CAX44802.1"
FT                   /translation="MQLSTLVNWLAALTVGAQAVSFGNNLKDQIILDSEESSPDLYLES
FT                   MFKDLGSLPIDLITAWAEMQSELSPEQIAKLINQYDSKNEKPKKNKFNPMTSSSSPTAK
FT                   FEKLSNEKFTGYSMRVKESFPEILGLDTVKQYTGYLDIDSLDKHLFYWFFESRNDPKND
FT                   PIILWLNGGPGCSSSTGLFFELGPSSINKTLHPVYNPYSWNSNASVIFLDQPVGVGYSY
FT                   TGGDEVKNTLTAAKDVYVFLELFFQKFPQFLNNKFHIAGESYAGHYIPAFASEIINNAD
FT                   RSFELASVLIGNGITDPLIQDGSYKPMGCGEGGYKPVLTTEQCDQMERDYPKCAKLTKL
FT                   CYSFQTALTCIPAQFYCDTRLFKPYEETGLNPYDIRKHCADQGGNCYVELDYLDEYLNL
FT                   DYVKEAVGASNIDIFTSCDDTVFRNFILDGDEMKPFQQYVAELLDNNVPVLIYAGDKDF
FT                   ICNWVGNLAWVNELEYSDSEQFAPKPLQLWKPNGKNPAGEVKNHKHFTFLRIYDAGHMV
FT                   PFDQPENALAMVNTWIQGDYAFGLESN"
FT   CDS_pept        1245836..1247734
FT                   /transl_table=12
FT                   /locus_tag="CD36_05450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44803"
FT                   /db_xref="GOA:B9W7Z0"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z0"
FT                   /inference="similar to AA sequence:UniProt:Q5AA11"
FT                   /inference="similar to AA sequence:UniProt:Q6FXE6"
FT                   /protein_id="CAX44803.1"
FT                   /translation="MPSLIPVSTSSRTTFPLSAGTGNNLYNNQYGAHGHGYTQSLGHNH
FT                   RGIEDMKRIEMSLKSGIDSEIAWALSSLTLMSMQPLIDLEHSPFLGNELIKYFSKPYQL
FT                   IQEKKFDLFTQDVLTFSLDSVLALRNLSQDLSNQQWLSQIPSFKKNLIESIKFLTNWFY
FT                   QPGGNQIPQLEKYNNQFAESLNYIVDLLEPLTCYYIDNNKNDPLFNILLNTLIITTDRN
FT                   LFINILKCISHLLIIWDKSVKAKAGEEEEEDDDDLAQEEEGEEDVKLTNNCIDNISESQ
FT                   LETIINTLLIADNEMNNAVLDFLKMYLFSEALHEKYPNSIKDSQRHRLRKLLQLNTSKA
FT                   TFSTLMKQLPLLLVSDLPLNEPIEEQPVPSLNLTKRSQYSGVPTSAPELTEELYKIIVA
FT                   FPEPIRASTWLHCCYEATMTEQAEVTQISIWKAYETQFQEIWKPNTEGTFNHNYKPLLP
FT                   AVEFIKNVTKAFPYAEAKVVALPQMPGEENQAPKKKFVIKGIQPRQFPVSIDVGNYDAL
FT                   KPMGETTVTEGDESLPIGHMDVKKFHYSLTSGVDNILFADSASKITKESLNSINESSHD
FT                   LLDYIISEVLEVSGIESKESSIFRLHNGYWIPELVYANPSLLEKGIIETSWLKYLL"
FT   CDS_pept        complement(1248324..1249016)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44804"
FT                   /db_xref="GOA:B9W7Z1"
FT                   /db_xref="InterPro:IPR006735"
FT                   /db_xref="InterPro:IPR027799"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z1"
FT                   /inference="similar to AA sequence:UniProt:Q5AA12"
FT                   /inference="similar to AA sequence:UniProt:Q10154"
FT                   /protein_id="CAX44804.1"
FT                   /translation="MGADGGTIAKRQDLLSSLTNRANADAQRGEDKEEDLIKICHLSSL
FT                   PLYNNDPIVGDYKGKLYIKEKLLQYLLDIKMNKSSIKSEFSHIKSLKDICPVTVSWTII
FT                   NREPFIECPVIKKVEKSYLYLRSCGCLISKKALNELSETKEERKCPNCNVIFYDYDIVM
FT                   LDPLNLKQNRDINEENISILKQKGLSHSKLPLKKTKKKKLLDEDEYIRKRKLPDEITNS
FT                   RKRKPTVS"
FT   CDS_pept        1249184..1249660
FT                   /transl_table=12
FT                   /locus_tag="CD36_05470"
FT                   /product="prefoldin dubunit 5, putative"
FT                   /product="chaperone, putative"
FT                   /note="Similar to C. albicans GIM5"
FT                   /note="Similar to S. cerevisiae GIM5"
FT                   /note="Similar to S. pombe BOB1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44805"
FT                   /db_xref="GOA:B9W7Z2"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z2"
FT                   /inference="similar to AA sequence:UniProt:Q5AA13"
FT                   /inference="similar to AA sequence:UniProt:Q04493"
FT                   /inference="similar to AA sequence:UniProt:O94307"
FT                   /protein_id="CAX44805.1"
FT                   /translation="MSTEPTNVDLNSLPPQKLVEFRKSIDEEITHFTQSLQALAAAQSK
FT                   LKDCISSINNLEQSKEDNLLVPLTSSLYIPGQVVTRNRYLVDIGTGYYVEKSAKKAKLG
FT                   YDKKIKKLDEDAKKLKGILVQKNELLNTVNLILRKKVIEMEKQQEGPSSADATN"
FT   CDS_pept        complement(1249695..1250690)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05480"
FT                   /product="DNA excision-repair protein, putative"
FT                   /note="Similar to C. albicans ERC1"
FT                   /note="Similar to Homo sapiens ERCC1"
FT                   /note="Similar to S. cerevisiae RAD10"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44806"
FT                   /db_xref="GOA:B9W7Z3"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z3"
FT                   /inference="similar to AA sequence:UniProt:Q5AA15"
FT                   /inference="similar to AA sequence:UniProt:P07992"
FT                   /inference="similar to AA sequence:UniProt:P06838"
FT                   /protein_id="CAX44806.1"
FT                   /translation="MSNNKDNPNDIDASSFASILAGVQKMREDAGSIPSHEPAPKEANV
FT                   DPQPNASSSLNTIQQPPTHKNVTNDRYQRATLDQSTAKPVSPKKSNNSVKPSTKRLQTT
FT                   GPSDILVAPSQERNPLLSLSKMQVTSWSFDKSILSDYYINPKFQILFLSLRYHKLHPEY
FT                   IWNRWKKLNQGSSTVHTRGDDVLRVLLVFVDIDSHQELLRKLSDFCIKHDLSLVLAWSY
FT                   EEAGNYIALCKQLDNAPTKARKIIEGTKGTDYNSSVVEAFTGIKSVNKTDVSNLLANCK
FT                   SVKEIILQSCQNDNDDGIGLSSIPGLGTRKLANLKNVFSEPFISNKNYDT"
FT   CDS_pept        1251228..1252157
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_05490"
FT                   /product="conserved hypothetical protein, pseudogene,
FT                   putative"
FT                   /note="stop codon"
FT                   /inference="similar to AA sequence:UniProt:Q5AA16"
FT                   /inference="similar to AA sequence:UniProt:Q5AAA3"
FT                   /inference="similar to AA sequence:UniProt:Q7S9P9"
FT   CDS_pept        1252619..1253764
FT                   /transl_table=12
FT                   /locus_tag="CD36_05500"
FT                   /product="pirin-like-family protein, putative"
FT                   /note="Similar to C. albicans PRN1"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44808"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z4"
FT                   /inference="similar to AA sequence:UniProt:Q5AA17"
FT                   /inference="similar to AA sequence:UniProt:O00625"
FT                   /protein_id="CAX44808.1"
FT                   /translation="MVIFPLISKIQFLILFFLYYPLQVLSINNTNKESLDMSVRSISKI
FT                   VTANEQAEGAGARVRRSIGIMNQRNFDPFLMFDHFSSSGTNGFPEHPHRGQETITLVLN
FT                   GAMAHEDFTGSKGILYPGDLQFMTAGRGVVHSEMPIKNDDGSPTVGLQLWVDLPNNMKG
FT                   VKPRYRDLREWEIPEVVTDDGKVTIKVISGKSHGVESIKELAYTPINYYYYKVKAGGEF
FT                   KQELQPGFNYFLYVLNGRNLVLNEDTKVDRYQNVFFGDKGDFITGKNAAKKDNNETEVQ
FT                   FILVGGKKLEQEVVQYGPFVASSRENIQKAFQDYQYGRNGFENIKTWQTLISGGVTKEM
FT                   IEGPLNGNLEKRAAKKSAYLEKQQKKAAPIAAQAELVKDEL"
FT   CDS_pept        1254074..1255318
FT                   /transl_table=12
FT                   /locus_tag="CD36_05510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44809"
FT                   /db_xref="GOA:B9W7Z5"
FT                   /db_xref="InterPro:IPR019038"
FT                   /db_xref="InterPro:IPR041913"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z5"
FT                   /inference="similar to AA sequence:UniProt:Q5AA19"
FT                   /protein_id="CAX44809.1"
FT                   /translation="MTMSSSVDEIEYLATEIITNSKPVSYHKFSRQLNIHLSKAKATLL
FT                   EYYQKNKSDLTATFIVTGDNDSGKLIKLSNEDELESDLKKFNTVRCVHIYCVSKKSLQF
FT                   STNELALEELKHSSSLNKISEYEKNGIIIGPKIENVIPANISSSPVKPEPSQMNKSTEE
FT                   KKSSSSLLSSYVSRKQEKKQQDKTRAGTLSNYVSRKTESTIPSKRSNTEPPTKPTYQYK
FT                   SRKLEAKAPKERVIIAENNDNDNEEEEDDDDDDKPIKASRATNTSDLQRMFDGDDFTFS
FT                   DDDDDDDDDQSPEKANKEVEEPKIEDKKDILPETPKEQQSKEASPEREQGLFVNEEEEQ
FT                   EEEHEEEEKPAEEQEEFVTEKDEDGYLITRKVKPITKQAKPKKHIAPPKVTKPSTGKKT
FT                   GMKQSSLMNFFGKKK"
FT   CDS_pept        1255611..1256612
FT                   /transl_table=12
FT                   /locus_tag="CD36_05520"
FT                   /product="pirin-like-family protein, putative"
FT                   /note="Similar to C. albicans PRN2"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44810"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z6"
FT                   /inference="similar to AA sequence:UniProt:Q5AA21"
FT                   /inference="similar to AA sequence:UniProt:O00625"
FT                   /protein_id="CAX44810.1"
FT                   /translation="MSIRSIAKIVTSKQKTEGSGAIVHRSLGIYQQRKYNPFLLFDHFI
FT                   GANNHGFPAHPHQGHETITYVLNGAVAHEDFTGARGMLYKGDLQFMTAGKGIMHSEMPV
FT                   SKNEESPTVGLQLWVDLPENKRNIDPNYRDLREWEIPEVVADDGKVSVKVISGKSYGIE
FT                   SIKQLAYIPIDYFHYKIKPGGQFKQEFRSDFNYFLYVIRGTTLELNNNTKVEQYQNVYF
FT                   EETGDFITGRNITTKPDEEVEFAIIGGKKLDQDVYIFGTFAADTEENMKKGFQDYKNQR
FT                   NGFEKIKTWKSLISKGVTQEMIDGPLNGNLELREKNKNDYLKSLQTRENILV"
FT   CDS_pept        1257217..1258197
FT                   /transl_table=12
FT                   /locus_tag="CD36_05530"
FT                   /product="pirin-like-family protein, putative"
FT                   /note="Similar to C. albicans PRN3"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44811"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z7"
FT                   /inference="similar to AA sequence:UniProt:Q5AA22"
FT                   /inference="similar to AA sequence:UniProt:O00625"
FT                   /protein_id="CAX44811.1"
FT                   /translation="MSVRSIAKVVTPNPPRPGSPVKIRNSIGSSSQFNPFLLFDHFSIP
FT                   STGGFPAHPHRGQETITLVLKGGVAHEDFTGSKGVLYPGDLQFMTAGKGVVHSEMPVPN
FT                   KDGSPSVGLQLWVDLPNDMKGVKPRYRDLREWEIPEVIADDGKVKVKVISGTSHGISSQ
FT                   KELAYTPVNYYHYKVKAGGKFKQELSPGFNYFLYVLNGKNLKLNGNKIVDQYQTVFFNE
FT                   TGDYITGENTAIEDTEANQSEFVLIGGKILNQKPVQYGPFVASSKTGITKALFDYELAR
FT                   NGFEHRVKWNSLISRGVNKSMVDGPLNGSLEKRAADKKSYLDSKI"
FT   CDS_pept        1258992..1259981
FT                   /transl_table=12
FT                   /locus_tag="CD36_05540"
FT                   /product="pirin-like-family protein, putative"
FT                   /note="Similar to C. albicans PRN4"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44812"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z9"
FT                   /inference="similar to AA sequence:UniProt:Q5AA23"
FT                   /inference="similar to AA sequence:UniProt:O00625"
FT                   /protein_id="CAX44812.1"
FT                   /translation="MSARSIAKIVTARQQAEGVGARVRRSIGVANQPSFNPFLMFDHFS
FT                   SSGANGFPEHPHRGQETITLVLNGAMAHEDFTGSKGILYAGDLQFMTAGKGIVHSEMPV
FT                   ANADGSPTVGLQLWVDLPDALKNTEPRYRDLREWEIPEVVTDDGKVIIKVISGRSHGIE
FT                   SIKELAYTPINYYYYKVKAGGKFKQELQSGFNYFLYVLNGNDLYLNGEKKIDQYQNVFF
FT                   EEKGDFITGENKANEDTKDTEVQFILVGGKKLDQKVVHYGPFVADCEENIEHAIIDYQY
FT                   AQNGFENRKTWKTLISDGVTKDMIEGPLNGNLEKREATKKEYLESKQK"
FT   CDS_pept        1261018..1262064
FT                   /transl_table=12
FT                   /locus_tag="CD36_05550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44813"
FT                   /db_xref="UniProtKB/TrEMBL:B9W7Z8"
FT                   /inference="similar to AA sequence:UniProt:Q5AA24"
FT                   /inference="similar to AA sequence:UniProt:Q5AAB1"
FT                   /protein_id="CAX44813.1"
FT                   /translation="MKLSTTTALAVLATATAINAAPEQQQQSESEFGSKALTKREQQDI
FT                   QELVQHINNYKARRDAIDEEIMKRDYAIVTDVLSAINQSQLAPKILDYFVTNETFKPII
FT                   VNVAIATIKSGIISLQALLDALVSSNLAVNVVNDLISDCSLYVQLFNAAKSVINDLASK
FT                   VKDLISKGVNQLITRDENEVDALAPYVVTVERRLDLDGVVDNLLDSLYKSGLATSVVKD
FT                   VLTNSDYIPFATDLIKAMIANNLIDLGSIVDAVKQSGLVTQLFQKLVNFGTVQTVAETA
FT                   FAAYAGECQGSGSGSGSGSGSGSGTTTITPGGSSSGGSSGGSGSGSGSGSAGPCKKRKR
FT                   RRRRRSNY"
FT   CDS_pept        1264101..1267037
FT                   /transl_table=12
FT                   /locus_tag="CD36_05560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44814"
FT                   /db_xref="GOA:B9W800"
FT                   /db_xref="UniProtKB/TrEMBL:B9W800"
FT                   /inference="similar to AA sequence:UniProt:Q5AA25"
FT                   /protein_id="CAX44814.1"
FT                   /translation="MSEEEEDKHLKSPSGSLQPRKSSDLQPSASSSSQTLDDTHSQPKS
FT                   TTTASESTEYTSPSKSLKSFFFKNRLSSYSIDSISEQPELEFQSHHHHSTDRNKKSSIG
FT                   SGELSPSRSPRMMNFSLRPKFIRSRSSGISDTSTSSTHPIPPASLLSPSSQRRATIEDF
FT                   ADTESEESSEDSNEEGEDDHTKRNDTKKHQHQHHNDGGGDDDDDEDSINSLLQEYNNRD
FT                   SEFENKDIKNKFIFREEFDDTNSVKTKSRPTSRILTPEENEELKAEIIRHGSIRSSGSA
FT                   SSSSQILKPVGGGISRGINPQQQQQQQQQQQQQQPYIDTQLAQQYYGDTRKHIEVVDPA
FT                   KREKSTSVIATTVSGDSPTALKRLSGASNSSGSSSANTGVGGGNENRNSGASSATSLRF
FT                   KIYNDKIEPIKHASAGKHMSTSTTNAEAAGISGADRSSMRVSTAFSDESEIGDVKYPEP
FT                   TVTPTQTPRINRNSETPSTDTNYTSNDTSGISYEAPLAIAGSLQKSSSNSSSSPNSGHR
FT                   SSSSVPSTPLRTQYTNQQQGGSNLQRGANIQEFRIDADVSRSTGTNTTSTGFYDETMLK
FT                   SSRKSIAHSSMSSGELLQNLEHSYDYSKSNDNSGNSEDNNNNNNNNNQIKSPSQQQTQQ
FT                   SRDPIYQFVIRDPKSPPLSSPPQIEEYPTNETPQSSKDEVFTTSIPRPIGIPKSDSVGQ
FT                   NMTAGLDSKSELPVMLFKVQDRDIQRDSKFFDNSNSRGHHHKSDGGDGDGEGDENQSLS
FT                   ASDIESAGNVRESVSGSVSGSGSASGSGSASGTRSGRSSRGRLTIGSLSEAGNSSRSSG
FT                   SSIKQIISRHFKSIGESLNANEKQQQQQQQQQSPQQQQQQQQPLRSLNLVKDSPPILFD
FT                   EKNHIILPSTKFDQESQDNNITKQTLEYPWINWSLLMILGLIVPPLYFIIPIGLLDGDY
FT                   LGLRYANKPSRKFSTKQKIISLILGILWLLIVLAMIGVGIGLGVTRES"
FT   CDS_pept        1268769..1270310
FT                   /transl_table=12
FT                   /locus_tag="CD36_05570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44815"
FT                   /db_xref="InterPro:IPR039301"
FT                   /db_xref="UniProtKB/TrEMBL:B9W801"
FT                   /inference="similar to AA sequence:UniProt:Q5AA26"
FT                   /inference="similar to AA sequence:UniProt:Q5AAB3"
FT                   /inference="similar to AA sequence:UniProt:P40210"
FT                   /protein_id="CAX44815.1"
FT                   /translation="MGNVPAKETRSRSSSSVSDYRNSASSTTTHNLSTGSSSSSSSKRR
FT                   NTTSSLYGIVSSSSSSNHHNRSGSHDLRKLKRQEEKEQAQIHHYMQLIVKYNESVDGGY
FT                   LAPFGTYKSNLDYDCDIVRNLIINRKLSPFFTPLQDFDESWTDDELCILLGQLTLHALE
FT                   PGYNNEEDEDEEDDIDNHKIHKSANYYKRQEEKAKLKSLINKVKELQKDEEQKYFDEKQ
FT                   KHNKDCSSRDLLLRLYRNANECPICFLYYPKHLNISRCCLQPICSECFVQIKRLDPHPP
FT                   HDDQSNQEAGELPHRLISEPANCPYCASPDFGVTYEPPIDIHTGIDGIKPGDYKISPPI
FT                   VEESELESESAIDDSATATTADGTPGKGEINLNSTPPPVNNSLSPKKNSLKKRRGSLAA
FT                   NAPGVITIDMIRPDWETKLNSARSKLARKAATASAIHASNLLLDENSNSNGSGSGSNNN
FT                   NRRRNNSSGRSSSFGGSGSNNRYATVEQRMIEEAMRLSILDEEERKRNASKENKK"
FT   CDS_pept        1273331..1275466
FT                   /transl_table=12
FT                   /locus_tag="CD36_05580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44816"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:B9W802"
FT                   /inference="similar to AA sequence:UniProt:Q5AAB5"
FT                   /inference="similar to AA sequence:UniProt:Q5AA27"
FT                   /protein_id="CAX44816.1"
FT                   /translation="MTITATTTALSLPNAEVKTFHNYQVVLPTQLPIKRLYNPLKEQLI
FT                   QSIKLPNDFNSKKKPNANNTNNEILVRIKMCGINYLSDFKSSAINNSVIHKSRKPIVPG
FT                   MRIICKIDSIKNIKFLIFPFTTCQLENIHNHPHHVRQQPLSNKVDSNNNTIANNSNSSI
FT                   KNNCDLIYGKDIDGGLQTHLSVPKSLLIPIPYNISLHDVCFIFDILLPFYKFFQFVKPG
FT                   KTIILLNDIKKELNEVLLILKIFNINFNSIIIIDGNSLSPRFNNKFETVYCFNRNLKHE
FT                   AINYCISTGLQATRSKYTVLTSFPVNVNSMMVNPKTHKRHNASIDSSFSSISTLASNTS
FT                   FKSASMMMGGADVNTNTTTTTTTTTNTASNNKFKNDKTIKYMQLNYHDKPLCIEVLKIL
FT                   SAINFEREDQEKQRNKEKQQQDKQQSPELAHDGIIDDYNYNYVDEYDENINEEKCRQLL
FT                   INDNDSLVHSTSSTHTGSSTLQMHSQTESDPHGSNKNHIKKNEKKGKRRKVTTKKYHHY
FT                   SWIWCNKDVYLKNYYDLNDYDVNDLTNDIDNIDNEKEKEKDYDYDYDYNYNYDEYGYNS
FT                   SNCHYHDDRYDDDEYGIGDNHQNKIIKQMNRLLQDDVNLNRVCYFNSDDHDNDYGDDIC
FT                   NSNDEEEEGEEEVDGNGDDDNNRYENKNSDGNQEDGEDNKSNIEDRNSNTSSRLGNRTY
FT                   KRHRNRNWAKNINACII"
FT   CDS_pept        complement(1275577..1279050)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44817"
FT                   /db_xref="GOA:B9W803"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017149"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B9W803"
FT                   /inference="similar to AA sequence:UniProt:Q5AAB6"
FT                   /inference="similar to AA sequence:UniProt:Q5AA29"
FT                   /inference="similar to AA sequence:UniProt:Q5AA28"
FT                   /inference="similar to AA sequence:UniProt:Q5AAB7"
FT                   /inference="similar to AA sequence:UniProt:Q6BQB3"
FT                   /protein_id="CAX44817.1"
FT                   /translation="MTSSNNISSNNFNIHESEYLSQDRKPLPLSSTPSTENIILTPRTH
FT                   TPIRLNSPHINMAELAIHNNQKQQQQQQQRSKQSSPLFFSDGKVSGPGTVVTSASIATP
FT                   HFQQQQQPQFSNFSQISNNSSTTTSQPSTALLSSFSSSSEMPITTTPRYNDRQDLNGED
FT                   TDNDNNNNNNNNNETNLPRLVHKWSHTHSILCCLASPKNRLLFCGTQDGKILVYDMNTY
FT                   SLTDIIGLENNNNNNNNNKNNEQHHPHPHPHHQQASILTICLNKDETRLFVAGSDSLVK
FT                   IYNLQNQNDNDNNNKNEKYQCTHVIYSLVDIGDIFSIHWCDLTSTIYIGAQNASILWCH
FT                   ISFDNENLSSKGNNQQTNSKNHKHEHEHEQPTQHDHHNHNHNHHQQQHTISNGHTTKNV
FT                   SDIERLPHFRYDKFFDSKGPGGSQNTLQTNHNLLKRRYSKNTNESHHHSIKLIECKSDD
FT                   IIRFAHNGYVYCLDVITNVTIDNSSESTFLISGGGDGIINIWSFNNKSSGLTKVASLEN
FT                   DESILSMKIQNSLLYVGLSDCSINVWDLLTLQMIRSFQFGDNNFDEILSLDIYDNSIYK
FT                   GSSSTGLIKLSILNHQFISDKILMSSEIEDGVINAVKIFPLDNKIYLLSGATKSLSLWD
FT                   ITATTTTTTTTTTTTTTTTNPNHNSKKNLNIDEEDKFNINNNNNNNNNNKKKLSNDDML
FT                   TMLEKYVAFKTISKNPQLYLEESRHCAQFLCKLLNNFGAYQTKLLPISNGNPIVFSEFK
FT                   ANHNGPGGGPGGGPGGGNKRPRLLWYAHYDVVDATKNEAKDWKTDPFILTAKEGNLYAR
FT                   GVSDNKGPTLAAIYSVAELYYHQQLNCDVVFIIEGEEECGSIGFQKVINDNKQLISGGT
FT                   SGGIDWIILSNSYWLDDLTPCLNYGLRGVINASITIKSDKPDRHSGVDGGVSREPTMDM
FT                   MHLLSTLVDPITRKIQLPGFYKDILPLTLSEKKLYDNIAQYSGIKVSTLMTKWREPSLT
FT                   IHKIQVSGPNNNTVIPQIVKATISMRIVPNQDLSKIKQSLIDTLNENFAKLSSSSSTST
FT                   TTDKSGNKLSIEIFHQAEPWLGDHENKVYSILFKNLKIHWNQEPLFIREGGSIPSIRFL
FT                   EKCFNAPAAQIPCGQSSDNAHLKDEKLRIINLFKLRAILTDTFKELGDIS"
FT   CDS_pept        1281662..1284733
FT                   /transl_table=12
FT                   /locus_tag="CD36_05600"
FT                   /product="inorganic phosphate transporter PHO87, putative"
FT                   /note="Similar to C. albicans PHO87"
FT                   /note="Similar to S. cerevisiae PHO87"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44818"
FT                   /db_xref="GOA:B9W804"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniProtKB/TrEMBL:B9W804"
FT                   /inference="similar to AA sequence:UniProt:Q5AAB9"
FT                   /inference="similar to AA sequence:UniProt:Q5AA31"
FT                   /inference="similar to AA sequence:UniProt:P25360"
FT                   /protein_id="CAX44818.1"
FT                   /translation="MKFSHSLKFNAVPEWQDNYINYPTLKKTIYKLQQDQVINNGNQDQ
FT                   GFIVGTNQTTVSQLVEDFEHNQSNTINTTTTTTNTNDGVADEKINKHNPFGDNIIKHRL
FT                   TKNIISKFKRNNNNNKNNNNTSNGSESDLEINQTSLDNEKESETKSFTGELEYTSTSSN
FT                   GGGGGSGSGSGENHNDSINNDSITKHELILQQILNSNDESYINPQSLTFDPLKIFTKQL
FT                   IGELIKINSFYNIKEFEIFKSYNNLIQDLQNQNINIDDVFKFTQAYNYSDVNIINTDDH
FT                   HQYHLKSTLSRTVTNASVFDTINHIDNDYDNDNNNNKDGNNYDLEKQPNTTTIAIHDDD
FT                   SEDEDEDDDDDDEEETHSHDSVLLNHTHFNVKQQLKITLKRKAITLFINLSELKSFIEL
FT                   NRIGFTKICKKFDKTCGFSIKQDFINNFLPQYSRIFQINTIQDLDYKLNQIIKIYAFLS
FT                   NKLEGNEITKEDLDNIKFELRSYLRDHIVFERNTVWKDLLSLEKKSYNIDLDNSIVQHN
FT                   KMGDEGHIINSMMNLSLKRINFPKPIIRLIKIDHIDIPKFLVTTQMLKIIIIVIVFIIL
FT                   LSIKTFNDPVQGRCLAVLVAAAMLWASEALPLYTTALLIPLLVVTCKVCKNPGTDDPMD
FT                   ATKASQYILGTMWNSTIMILIGGFTLAAALSKYNLAKILSSYILALAGTNPRNVLLAIM
FT                   SVSLFLSMWISNVAAPVLCFSLIQPVLRSIPTESPVAKALVLGIALASDVAGMASPIAS
FT                   PQNVIALESMNPNPGWGKWFAVALPVAIISLILIWVELFMTFKINNVKIKKFKPIKEKL
FT                   TMKQWFVFAVTLTTILLWCVMQKVDGTFGESGIITCIPIVLFFGTGLLKVDDLNNYPWS
FT                   IVMLAMGGIALGKAVTSSGLLKTIALALQKKIMHYDAIVVLIIFGVLILVVATFVSHTV
FT                   SALIIIPLVKEVGDSLPKPHPLMLIMGVTLIASGAMGLPTSGFPNVTAIGMRDEVGKPY
FT                   LTVNLFITRGVPASIIVYICIITIGYGIMSTMNF"
FT   CDS_pept        complement(1285228..1286460)
FT                   /transl_table=12
FT                   /locus_tag="CD36_05610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44819"
FT                   /db_xref="UniProtKB/TrEMBL:B9W805"
FT                   /inference="similar to AA sequence:UniProt:Q5AAC0"
FT                   /inference="similar to AA sequence:UniProt:Q5AA32"
FT                   /protein_id="CAX44819.1"
FT                   /translation="MKLPSLSIIAPIITLGFSPLALCLQSSSETITSTIHSFDDQDPDY
FT                   SKYNYLLDQFTSLFTTEEQKENTDGVNQYIKIKRDENTVNSISSLLQSVEQSGIIPDIV
FT                   SDITSSQTKMDNLANYTVSLLSTIMSGNQSSSSSSSSLLLSGINIDLNTTEILNAVLSS
FT                   GLIQSVASGLLLDNANNAKLADLVGGILGSPDNVWIGWLLAGLGNGEDLTIPYIANLVV
FT                   NTTSKANTNSTNQSKIGNNKNQVEDVIINKDSTNQEDDEYSGSLNEFLNNIAIKRDDNQ
FT                   YSGSLNQFISNVGNSVAQSSLIQASANDILKALNQSNIIVPTIMQITENQNLGTLVKTL
FT                   TKRVYESGIINDLPLDTYYEYAKKENILSDSLQYILTDPTYSPGLATLFKRMDDAGAYQ
FT                   RLQDNMYGIKK"
FT   CDS_pept        1288630..1290021
FT                   /transl_table=12
FT                   /locus_tag="CD36_05620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CD36_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CAX44820"
FT                   /db_xref="UniProtKB/TrEMBL:B9W806"
FT                   /inference="similar to AA sequence:UniProt:Q5AA33"
FT                   /inference="similar to AA sequence:UniProt:Q5AAC1"
FT                   /protein_id="CAX44820.1"
FT                   /translation="MQFLFTFIFLLIPLVYSLPAASPKSGTDFDFNQEIEQFVEKTFNQ
FT                   DDPASVAAAASLQEFLIDVFNYDDNKNQEEKEEEEALKVFEKRDASTEQTIEGVLVAVN
FT                   NSGVIWNLLDSIANDPSRIEYIGNLTSSFLKNYNITLNIADLISESSSLTENLNITGLL
FT                   SAVENSGLITSLLDGILLDENFRPRLVDLIDRLVLSQKDVLLYIFAGVLSKRDFIIDSN
FT                   LVNVLLKRATNDDPYSGSLGSFLNNAASTILSSSLVSNAAADVLNALNDTGFLVYATKR
FT                   FLSSDAYVNMTVALVNDIVSSSSVTIDTSGLNLTELVTSALGNPKEIAALVGALLSGDS
FT                   SAQTSQLSNILGKYSGALSQILQDLEKKGLFAELNSYIFGDSTTKTSATATATATSSSN
FT                   NDKDVANNNKDAANSGSATSNSQTSTNTKRASNGAGAVIYTGSNTQTTFFKALSILFGG
FT                   ALLFL"
FT   CDS_pept        1291771..1292262
FT                   /pseudo
FT                   /transl_table=12
FT                   /locus_tag="CD36_05630"
FT                   /product="conserved hypothetical protein,
FT                   pseudogene,putative"
FT                   /note="fragment pseudogene"
FT                   /inference="similar to AA sequence:UniProt:Q5AAC4"
FT                   /inference="similar to AA sequence:UniProt:Q5AA36"
FT                   /inference="similar to AA sequence:UniProt:Q5AK33"
FT   CDS_pept        1293801..1295405
FT                   /transl_t